Q9H2C2 ARV1_HUMAN
Gene name: ARV1
Protein name: Protein ARV1
List of terms from Generic GO subset, which this protein is a part of:
- biosynthetic process GO:0009058
- membrane organization GO:0061024
- plasma membrane organization GO:0007009
- small molecule metabolic process GO:0044281
- transport GO:0006810
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q7RTY9 | PRSS41 | 0.99778 | |
| 2 | Q4G148 | GXYLT1 | 0.9275 | biosynthetic process GO:0009058 cellular protein modification process GO:0006464 |
| 3 | P30154 | PPP2R1B | 0.92 | anatomical structure development GO:0048856 cell death GO:0008219 cellular protein modification process GO:0006464 ... |
| 4 | P0DH78 | RNF224 | 0.88893 | |
| 5 | Q5T0D9 | TPRG1L | 0.88447 | cell-cell signaling GO:0007267 |
| 6 | Q5SRD1 | TIMM23B | 0.87824 | protein targeting GO:0006605 protein transport GO:0015031 transmembrane transport GO:0055085 ... |
| 7 | P47972 | NPTX2 | 0.8555 | cell-cell signaling GO:0007267 nervous system process GO:0050877 signal transduction GO:0007165 |
| 8 | Q13253 | NOG | 0.8513 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 biosynthetic process GO:0009058 ... |
| 9 | Q66LE6 | PPP2R2D | 0.85105 | cell cycle GO:0007049 cell division GO:0051301 cellular protein modification process GO:0006464 ... |
| 10 | Q6UW01 | CBLN3 | 0.84905 |
20 40 60 80 100 AA: MGNGGRSGLQQGKGNVDGVAATPTAASASCQYRCIECNQEAKELYRDYNHGVLKITICKSCQKPVDKYIEYDPVIILINAILCKAQAYRHILFNTQINIH STMI: DO_DISOPRED3: DDDDDDDDDDDDDDDDDDDDDDDDDDDD........................................................................ DO_IUPRED2A: .................................................................................................... DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDDDD....................................................................... CONSENSUS: DDDDDDDDDDDDDDDDDDDDDDDDDDDD........................................................................ CONSENSUS_MOBI: .................................................................................................... RICH_[AG]: GlqqGkGnvdGvAAtptAA RICH_[G]: GnGGrsGlqqGkGnvdG RICH_fLPS_[G]: mGnGGrsGlqqGkGnvdGva
120 140 160 180 200 AA: GKLCIFCLLCEAYLRWWQLQDSNQNTAPDDLIRYAKEWDFYRMFAIAALEQTAYFIGIFTFLWVERPMTAKKKPNFILLLKALLLSSYGKLLLIPAVIWE STMI: MMMMMMMMMMMMMMMMMMMMM MMMMMMMMMMMMMMMMMMMMM DO_DISOPRED3: .................................................................................................... DO_IUPRED2A: .................................................................................................... DO_SPOTD: .................................................................................................... CONSENSUS: ........................................... ........... .... CONSENSUS_MOBI: ........................................... ........... ....
220 240 260 AA: HDYTSVCLKLIKVFVLTSNFQAIRVTLNINRKLSFLAVLSGLLLESIMVYFFQSMEWDVGSDYAIFKSQDF STMI: MMMMMMMMMMMMMMMMMMMMM DO_DISOPRED3: ....................................................................... DO_IUPRED2A: ....................................................................... DO_SPOTD: .....................................................................DD CONSENSUS: ................................ .................. CONSENSUS_MOBI: ................................ ..................