Q9NXV2 KCTD5_HUMAN
Gene name: KCTD5
Protein name: BTB/POZ domain-containing protein KCTD5
List of terms from Generic GO subset, which this protein is a part of:
- biological process involved in symbiotic interaction GO:0044403
- catabolic process GO:0009056
- cellular component assembly GO:0022607
- protein-containing complex assembly GO:0065003
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q6V0L0 | CYP26C1 | 0.67247 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 catabolic process GO:0009056 ... |
| 2 | P35030 | PRSS3 | 0.67123 | immune system process GO:0002376 protein maturation GO:0051604 small molecule metabolic process GO:0044281 ... |
| 3 | Q8NBK3 | SUMF1 | 0.65874 | cellular protein modification process GO:0006464 |
| 4 | Q9NSB4 | KRT82 | 0.63239 | anatomical structure development GO:0048856 cell death GO:0008219 cell differentiation GO:0030154 |
| 5 | Q5XKL5 | BTBD8 | 0.63013 | |
| 6 | Q9Y3E2 | BOLA1 | 0.61053 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 |
| 7 | Q7RTY9 | PRSS41 | 0.59453 | |
| 8 | Q9H2C2 | ARV1 | 0.5932 | biosynthetic process GO:0009058 membrane organization GO:0061024 plasma membrane organization GO:0007009 ... |
| 9 | Q8IUG1 | KRTAP1-3 | 0.5923 | anatomical structure development GO:0048856 cell differentiation GO:0030154 |
| 10 | Q8NCQ5 | FBXO15 | 0.59059 | cellular protein modification process GO:0006464 |
20 40 60 80 100 AA: MAENHCELLSPARGGIGAGLGGGLCRRCSAGLGALAQRPGSVSKWVRLNVGGTYFLTTRQTLCRDPKSFLYRLCQADPDLDSDKDETGAYLIDRDPTYFG STMI: DO_DISOPRED3: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.............................................................. DO_IUPRED2A: .....................................................................................DD............. DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD............................................................ CONSENSUS: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.............................................................. CONSENSUS_MOBI: .................................................................................................... RICH_[AC]: AglggglCrrCsAglgAlA RICH_[AG]: GAGlGGGlcrrcsAGlGAlA RICH_[AL]: AgLgggLcrrcsAgLgALA RICH_[G]: GGiGaGlGGGlcrrcsaGlG RICH_[CG]: CellsparGGiGaGlGGGlCrrCsaGlG RICH_[CL]: CeLLsparggigagLgggLC RICH_[GL]: LLsparGGiGaGLGGGL RICH_fLPS_[G]: GGiGaGlGGGlcrrcsaGlG
120 140 160 180 200 AA: PVLNYLRHGKLVINKDLAEEGVLEEAEFYNITSLIKLVKDKIRERDSKTSQVPVKHVYRVLQCQEEELTQMVSTMSDGWKFEQLVSIGSSYNYGNEDQAE STMI: DO_DISOPRED3: .................................................................................................... DO_IUPRED2A: .................................................................................................... DO_SPOTD: .................................................................................................... CONSENSUS: .................................................................................................... CONSENSUS_MOBI: ....................................................................................................
220 AA: FLCVVSKELHNTPYGTASEPSEKAKILQERGSRM STMI: DO_DISOPRED3: .................DDDDDDDDDDDDDDDDD DO_IUPRED2A: ............DDDDDDDDDDDDDDDDDD.... DO_SPOTD: ............DDDDDDDDDDDDDDDDDDDDDD CONSENSUS: ............DDDDDDDDDDDDDDDDDDDDDD CONSENSUS_MOBI: ...........DDDDDDDDDDDDDDDDDDDDDDD