Q9Y3E2 BOLA1_HUMAN
Gene name: BOLA1
Protein name: BolA-like protein 1
List of terms from Generic GO subset, which this protein is a part of:
- biosynthetic process GO:0009058
- cellular nitrogen compound metabolic process GO:0034641
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q9NVP2 | ASF1B | 0.68305 | anatomical structure development GO:0048856 cell differentiation GO:0030154 cellular component assembly GO:0022607 ... |
| 2 | Q9Y6K0 | CEPT1 | 0.62092 | biosynthetic process GO:0009058 |
| 3 | Q9NXV2 | KCTD5 | 0.61053 | biological process involved in symbiotic interaction GO:0044403 catabolic process GO:0009056 cellular component assembly GO:0022607 ... |
| 4 | Q8NGA4 | GPR32P1 | 0.54946 | homeostatic process GO:0042592 immune system process GO:0002376 response to stress GO:0006950 ... |
| 5 | Q9NSB4 | KRT82 | 0.52655 | anatomical structure development GO:0048856 cell death GO:0008219 cell differentiation GO:0030154 |
| 6 | Q8IZY2 | ABCA7 | 0.52323 | biosynthetic process GO:0009058 catabolic process GO:0009056 cellular component assembly GO:0022607 ... |
| 7 | Q6UXN2 | TREML4 | 0.48367 | immune system process GO:0002376 response to stress GO:0006950 signal transduction GO:0007165 |
| 8 | Q9UF12 | PRODH2 | 0.43806 | catabolic process GO:0009056 small molecule metabolic process GO:0044281 |
| 9 | Q494W8 | CHRFAM7A | 0.4367 | cell-cell signaling GO:0007267 nervous system process GO:0050877 signal transduction GO:0007165 ... |
| 10 | P31371 | FGF9 | 0.42369 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 biosynthetic process GO:0009058 ... |
20 40 60 80 100 AA: MLSGRLVLGLVSMAGRVCLCQGSAGSGAIGPVEAAIRTKLEEALSPEVLELRNESGGHAVPPGSETHFRVAVVSSRFEGLSPLQRHRLVHAALAEELGGP STMI: DO_DISOPRED3: DDDDDDDDDDDDDDDDDDDDDDDDDDDD........................................................................ DO_IUPRED2A: ..............................................DDD.DDDDDDDDDDDDDDDD.................................. DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDDDD....................................................................... CONSENSUS: DDDDDDDDDDDDDDDDDDDDDDDDDDDD........................................................................ CONSENSUS_MOBI: ....................DDDDDDDDDD...................................................................... RICH_[CG]: GrlvlGlvsmaGrvClCqGsaGsG RICH_[CL]: LsgrLvLgLvsmagrvCLC RICH_[CV]: VlglVsmagrVClC RICH_[GL]: GrLvLGLvsmaGrvcLcqG
120 AA: VHALAIQARTPAQWRENSQLDTSPPCLGGNKKTLGTP STMI: DO_DISOPRED3: ................................DDDDD DO_IUPRED2A: .......DD..DDDDDDDDDDDDDDDDDDDDDDDDDD DO_SPOTD: ..................DDDDDDD.DDDDDDDDDDD CONSENSUS: ..................DDDDDDDDDDDDDDDDDDD CONSENSUS_MOBI: ..................DDDDDDDDDDDDDDDDDDD