Q9P0L0 VAPA_HUMAN

Gene name: VAPA
Protein name: Vesicle-associated membrane protein-associated protein A

List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- biological process involved in symbiotic interaction GO:0044403
- biosynthetic process GO:0009058
- cell death GO:0008219
- cell differentiation GO:0030154
- immune system process GO:0002376
- membrane organization GO:0061024
- signal transduction GO:0007165
- transport GO:0006810
- vesicle-mediated transport GO:0016192

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q96JL9 ZNF333 0.59029 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
2 Q99712 KCNJ15 0.58962 transmembrane transport GO:0055085
transport GO:0006810
3 Q99418 CYTH2 0.58094 cytoskeleton organization GO:0007010
signal transduction GO:0007165
transport GO:0006810
...
4 Q8NDV2 GPR26 0.56335 signal transduction GO:0007165
5 Q8IZC7 ZNF101 0.54472 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
6 Q8NF50 DOCK8 0.54088 cell adhesion GO:0007155
cell death GO:0008219
cell population proliferation GO:0008283
...
7 O95972 BMP15 0.54046 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cell differentiation GO:0030154
...
8 Q96DC7 TMCO6 0.51635 nucleocytoplasmic transport GO:0006913
protein transport GO:0015031
transport GO:0006810
9 O00168 FXYD1 0.51284 cellular protein modification process GO:0006464
circulatory system process GO:0003013
transmembrane transport GO:0055085
...
10 Q008S8 ECT2L 0.4971

                                           20                  40                  60                  80                 100
AA:                      MASASGAMAKHEQILVLDPPTDLKFKGPFTDVVTTNLKLRNPSDRKVCFKVKTTAPRRYCVRPNSGIIDPGSTVTVSVMLQPFDYDPNEKSKHKFMVQTI
STMI:                                                                                                                        
DO_DISOPRED3:            DDDDDDDDDDD.........................................................................................
DO_IUPRED2A:             .DD................................D.........................DD........D......DD.............DDDDDDD
DO_SPOTD:                DDDDDDDDDD..........................................................................................
CONSENSUS:               DDDDDDDDDD..........................................................................................
CONSENSUS_MOBI:          ....................................................................................................

                                          120                 140                 160                 180                 200
AA:                      FAPPNTSDMEAVWKEAKPDELMDSKLRCVFEMPNENDKLNDMEPSKAVPLNASKQDGPMPKPHSVSLNDTETRKLMEECKRLQGEMMKLSEENRHLRDEG
STMI:                                                                                                                        
DO_DISOPRED3:            ...................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD...............................
DO_IUPRED2A:             D......DDDDDDDDDD......DDDDD...DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..DDD
DO_SPOTD:                .................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               .................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS_MOBI:          ...................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.................................
RICH_[M]:                                                                                           MeeckrlqgeMM             
RICH_[N]:                                                 NeNdklNdmepskavplN                                                 
RICH_[R]:                                                                                                             RhlRdeg
RICH_[EL]:                                                                                                LqgEmmkLsEEnrhLrdEg
RICH_[ER]:                                                                                                   EmmklsEEnRhlRdEg
RICH_[LR]:                                                                                                       LseenRhLRdeg

                                          220                 240           
AA:                      LRLRKVAHSDKPGSTSTASFRDNVTSPLPSLLVVIAAIFIGFFLGKFIL
STMI:                                               MMMMMMMMMMMMMMMMMMMMM 
DO_DISOPRED3:            .....DDDDDDDDDDDDDDDDDDDD........................
DO_IUPRED2A:             DDDDDDDDDDDDDDDDDDDDDD...........................
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDDDDDD..                     .
CONSENSUS_MOBI:          ...........................                     .
RICH_[R]:                lRlR                                             
RICH_[EL]:               L                                                
RICH_[ER]:               lRlR                                             
RICH_[LR]:               LRLR