List of terms from Generic GO subset, which this protein is a part of:
- cellular component assembly GO:0022607
- protein-containing complex assembly GO:0065003

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page

#	UniProt Accession	Gene Name	Cosine Similarity	Generic GO terms
1	Q5T4B2	CERCAM	0.56255	cell adhesion GO:0007155
2	O00522	KRIT1	0.47038
3	Q13492	PICALM	0.45325	anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell death GO:0008219 ...
4	Q9UGK8	SERGEF	0.43051
5	P0C853	BAALC-AS2	0.38476
6	Q9H9L4	KANSL2	0.37868	cellular protein modification process GO:0006464 chromosome organization GO:0051276
7	Q8NBF4	n/a	0.34578
8	P59090	TSPEAR-AS2	0.32516
9	Q16560	SNRNP35	0.31362	cellular nitrogen compound metabolic process GO:0034641 mRNA processing GO:0006397
10	Q8N1P7	CRYBG2	0.31289

                                           20                  40                  60                  80                 100
AA:                      MFAPAVMRAFRKNKTLGYGVPMLLLIVGGSFGLREFSQIRYDAVKSKMDPELEKKLKENKISLESEYEKIKDSKFDDWKNIRGPRPWEDPDLLQGRNPES
STMI:                                  MMMMMMMMMMMMMMMMMMMMMMM                                                               
DO_DISOPRED3:            DDDDD..D...................................................................................DDDDDDDDD
DO_IUPRED2A:             .......................................................D...............................DDDDDDDDDDDDD
DO_SPOTD:                DDDDDD........DD.D.DDDDDD.....DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.DDDDDDDDDDDDD.DDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               DDDDD.........                       ..................D...............................DDDDDDDDDDDDD
CONSENSUS_MOBI:          ..............                       .......................................DDDDDDDDDDDDDDDDDDDDDDDD
RICH_MOBI_[W]:                                                                                        WknirgprpW             
RICH_MOBI_[DW]:                                                                                      DWknirgprpWeDpD         

                                       
AA:                      LKTKTT
STMI:                          
DO_DISOPRED3:            DDDDDD
DO_IUPRED2A:             DDDDDD
DO_SPOTD:                DDDDDD
CONSENSUS:               DDDDDD
CONSENSUS_MOBI:          DDDDDD