Q9UGQ2 FLOWR_HUMAN
Gene name: CACFD1
Protein name: Calcium channel flower homolog
List of terms from Generic GO subset, which this protein is a part of:
- transport GO:0006810
- vesicle-mediated transport GO:0016192
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q86XR7 | TICAM2 | 0.6488 | cell death GO:0008219 immune system process GO:0002376 protein transport GO:0015031 ... |
| 2 | Q3ZCX4 | ZNF568 | 0.64313 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 ... |
| 3 | Q14416 | GRM2 | 0.62031 | cell-cell signaling GO:0007267 homeostatic process GO:0042592 signal transduction GO:0007165 ... |
| 4 | P05783 | KRT18 | 0.61265 | anatomical structure development GO:0048856 biological process involved in symbiotic interaction GO:0044403 cell cycle GO:0007049 ... |
| 5 | P21506 | ZNF10 | 0.57923 | |
| 6 | Q9UHX3 | ADGRE2 | 0.56257 | cell adhesion GO:0007155 immune system process GO:0002376 response to stress GO:0006950 ... |
| 7 | Q96A25 | TMEM106A | 0.56257 | biosynthetic process GO:0009058 cell-cell signaling GO:0007267 cellular protein modification process GO:0006464 ... |
| 8 | Q8NEV1 | CSNK2A3 | 0.55869 | catabolic process GO:0009056 cell cycle GO:0007049 cell population proliferation GO:0008283 ... |
| 9 | Q9H222 | ABCG5 | 0.54807 | homeostatic process GO:0042592 transmembrane transport GO:0055085 transport GO:0006810 |
| 10 | Q92503 | SEC14L1 | 0.54453 | immune system process GO:0002376 response to stress GO:0006950 signal transduction GO:0007165 ... |
20 40 60 80 100 AA: MSSSGGAPGASASSAPPAQEEGMTWWYRWLCRLSGVLGAVSCAISGLFNCITIHPLNIAAGVWMIMNAFILLLCEAPFCCQFIEFANTVAEKVDRLRSWQ STMI: MMMMMMMMMMMMMMMMMMMMM MMMMMMMMMMMMMMMMMMMMM DO_DISOPRED3: DDDDDDDDDDDDDDDDDDD................................................................................. DO_IUPRED2A: ...........D.D...................................................................................... DO_SPOTD: DDDDDDDDDDDDDDDDDDDD................................................................................ CONSENSUS: DDDDDDDDDDDDDDDDDDD............. .... ...................... CONSENSUS_MOBI: ................................ .... ...................... RICH_[A]: ApgAsAssAppA RICH_[S]: SSSggapgaSaSS RICH_[GS]: SSSGGapGaS
120 140 160 AA: KAVFYCGMAVVPIVISLTLTTLLGNAIAFATGVLYGLSALGKKGDAISYARIQQQRQQADEEKLAETLEGEL STMI: MMMMMMMMMMMMMMMMMMMMM DO_DISOPRED3: .....................................................DDDDDDDDDDDDDDDDDDD DO_IUPRED2A: ........................................................................ DO_SPOTD: ................................................DDDDDDDDDDDDDDDDDDDDDDDD CONSENSUS: .. ..............................DDDDDDDDDDDDDDDDDDD CONSENSUS_MOBI: .. ................................................. RICH_[E]: EEklaEtlEgE