Q86XR7 TCAM2_HUMAN

Gene name: TICAM2
Protein name: TIR domain-containing adapter molecule 2

List of terms from Generic GO subset, which this protein is a part of:
- cell death GO:0008219
- immune system process GO:0002376
- protein transport GO:0015031
- response to stress GO:0006950
- signal transduction GO:0007165
- transport GO:0006810
- vesicle-mediated transport GO:0016192

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q13490 BIRC2 0.92886 anatomical structure development GO:0048856
catabolic process GO:0009056
cell cycle GO:0007049
...
2 Q3ZCX4 ZNF568 0.9284 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
...
3 Q9UIQ6 LNPEP 0.78441 catabolic process GO:0009056
cell-cell signaling GO:0007267
cellular nitrogen compound metabolic process GO:0034641
...
4 P55064 AQP5 0.77302 anatomical structure development GO:0048856
cellular component assembly GO:0022607
protein-containing complex assembly GO:0065003
...
5 Q96RQ3 MCCC1 0.77302 catabolic process GO:0009056
cellular nitrogen compound metabolic process GO:0034641
small molecule metabolic process GO:0044281
6 Q9UKJ5 CHIC2 0.77302
7 Q96M32 AK7 0.77102 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
small molecule metabolic process GO:0044281
8 Q9GZL7 WDR12 0.77102 cell cycle GO:0007049
cellular nitrogen compound metabolic process GO:0034641
ribosome biogenesis GO:0042254
...
9 Q9UI26 IPO11 0.76876 nucleocytoplasmic transport GO:0006913
protein transport GO:0015031
transport GO:0006810
10 P42857 NSG1 0.76319 cell death GO:0008219
cell-cell signaling GO:0007267
cellular component assembly GO:0022607
...

                                           20                  40                  60                  80                 100
AA:                      MGIGKSKINSCPLSLSWGKRHSVDTSPGYHESDSKKSEDLSLCNVAEHSNTTEGPTGKQEGAQSVEEMFEEEAEEEVFLKFVILHAEDDTDEALRVQNLL
STMI:                                                                                                                        
DO_DISOPRED3:            DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD...........................
DO_IUPRED2A:             .....................D.DDDDDDDDDDDD.D..DDDDDDDDDDDDDDDDDDDDDDDDDDDDD................................
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..........................
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD...........................
CONSENSUS_MOBI:          DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.............................................................
RICH_[E]:                                                                    EgptgkqEgaqsvEEmfEEE                            
RICH_[S]:                                     SvdtSpgyheSdSkkSedlS                                                           
RICH_fLPS_[E]:                                                                    kqEgaqsvEEmfEEE                            

                                          120                 140                 160                 180                 200
AA:                      QDDFGIKPGIIFAEMPCGRQHLQNLDDAVNGSAWTILLLTENFLRDTWCNFQFYTSLMNSVNRQHKYNSVIPMRPLNNPLPRERTPFALQTINALEEESR
STMI:                                                                                                                        
DO_DISOPRED3:            ....................................................................................................
DO_IUPRED2A:             ......................D....................................................D..............D.........
DO_SPOTD:                ....................................................................................................
CONSENSUS:               ....................................................................................................
CONSENSUS_MOBI:          ....................................................................................................

                                          220     
AA:                      GFPTQVERIFQESVYKTQQTIWKETRNMVQRQFIA
STMI:                                                       
DO_DISOPRED3:            .........................D.D.DDDDDD
DO_IUPRED2A:             ...................................
DO_SPOTD:                ............................DDDDDDD
CONSENSUS:               .............................DDDDDD
CONSENSUS_MOBI:          ...................................