Q9UJ90 KCNE5_HUMAN

Gene name: KCNE5
Protein name: Potassium voltage-gated channel subfamily E regulatory beta subunit 5

List of terms from Generic GO subset, which this protein is a part of:
- cell-cell signaling GO:0007267
- circulatory system process GO:0003013
- transmembrane transport GO:0055085
- transport GO:0006810

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 P31271 HOXA13 0.63718 anatomical structure development GO:0048856
2 Q9BR10 SPATA25 0.6263 cell differentiation GO:0030154
reproduction GO:0000003
3 Q96RP8 KCNA7 0.60672 cellular component assembly GO:0022607
protein-containing complex assembly GO:0065003
transmembrane transport GO:0055085
...
4 Q9NSD7 RXFP3 0.60017 cell cycle GO:0007049
cell division GO:0051301
signal transduction GO:0007165
5 Q96EX3 DYNC2I2 0.59677 cellular component assembly GO:0022607
cytoskeleton-dependent intracellular transport GO:0030705
protein transport GO:0015031
...
6 O15212 PFDN6 0.58649 cellular component assembly GO:0022607
protein folding GO:0006457
protein-containing complex assembly GO:0065003
7 Q9NVX2 NLE1 0.58408 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
cell cycle GO:0007049
...
8 Q99471 PFDN5 0.58408 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cell-cell signaling GO:0007267
...
9 P0DMW5 SMIM10L2B 0.58253
10 Q96FN4 CPNE2 0.58191

                                           20                  40                  60                  80                 100
AA:                      MNCSESQRLRTLLSRLLLELHHRGNASGLGAGPRPSMGMGVVPDPFVGREVTSAKGDDAYLYILLIMIFYACLAGGLILAYTRSRKLVEAKDEPSQACAE
STMI:                                                                                MMMMMMMMMMMMMMMMMMMMM                   
DO_DISOPRED3:            DD.........................DDDD.DDDDDDDDDDDDDDD.....D...............................................
DO_IUPRED2A:             ...........................DDDD.DDD....D.DD................................................D.....DDD
DO_SPOTD:                DDD...................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               DD.........................DDDDDDDDDDDDDDDDDDDD.....D.......                     ..........D.....DDD
CONSENSUS_MOBI:          ............................................................                     ...................
RICH_[G]:                                           GlGaGprpsmGmG                                                            
RICH_[GM]:                                          GlGaGprpsMGMG                                                            
RICH_[GP]:                                          GlGaGPrPsmGmGvvPdP                                                       
RICH_[MV]:                                                   MgMgVVpdpfV                                                     

                                          120                 140                  
AA:                      HEWAPGGALTADAEAAAGSQAEGRRQLASEGLPALAQGAERV
STMI:                                                              
DO_DISOPRED3:            ...........DDDDDDDDDDD...............DDDDD
DO_IUPRED2A:             DD.......D...DDD...DDDDD...D..............
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               DD.......DDDDDDDDDDDDDDDDDDD.........DDDDD
CONSENSUS_MOBI:          ..................DDDDDDDDDDDDDDDDDDDDDDDD
RICH_[A]:                          AdAeAAAgsqAegrrqlA              
RICH_fLPS_[A]:                    tAdAeAAAgsqAegr                  
RICH_MOBI_[AL]:                                    LAsegLpALA