Q99471 PFD5_HUMAN
Gene name: PFDN5
Protein name: Prefoldin subunit 5
List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- biosynthetic process GO:0009058
- cell-cell signaling GO:0007267
- cellular nitrogen compound metabolic process GO:0034641
- protein folding GO:0006457
- signal transduction GO:0007165
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q9NVX2 | NLE1 | 1 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 cell cycle GO:0007049 ... |
| 2 | Q86Y56 | DNAAF5 | 1 | cellular component assembly GO:0022607 cytoskeleton organization GO:0007010 protein-containing complex assembly GO:0065003 |
| 3 | P0DMW5 | SMIM10L2B | 0.99967 | |
| 4 | Q08AG7 | MZT1 | 0.99941 | cell cycle GO:0007049 cellular component assembly GO:0022607 cytoskeleton organization GO:0007010 ... |
| 5 | Q9UFG5 | C19orf25 | 0.99941 | |
| 6 | Q9HCM9 | TRIM39 | 0.99862 | catabolic process GO:0009056 cell cycle GO:0007049 cell death GO:0008219 ... |
| 7 | Q96S52 | PIGS | 0.99746 | biosynthetic process GO:0009058 cellular protein modification process GO:0006464 |
| 8 | Q8WWT9 | SLC13A3 | 0.99746 | circulatory system process GO:0003013 transmembrane transport GO:0055085 transport GO:0006810 |
| 9 | Q7RTP0 | NIPA1 | 0.99673 | transmembrane transport GO:0055085 transport GO:0006810 |
| 10 | O15212 | PFDN6 | 0.99589 | cellular component assembly GO:0022607 protein folding GO:0006457 protein-containing complex assembly GO:0065003 |
20 40 60 80 100 AA: MAQSINITELNLPQLEMLKNQLDQEVEFLSTSIAQLKVVQTKYVEAKDCLNVLNKSNEGKELLVPLTSSMYVPGKLHDVEHVLIDVGTGYYVEKTAEDAK STMI: DO_DISOPRED3: DDDD................................................................................................ DO_IUPRED2A: .................................................................................................... DO_SPOTD: DDD................................................................................................. CONSENSUS: DDD................................................................................................. CONSENSUS_MOBI: ....................................................................................................
120 140 AA: DFFKRKIDFLTKQMEKIQPALQEKHAMKQAVMEMMSQKIQQLTALGAAQATAKA STMI: DO_DISOPRED3: ..........................................DDDDDDDDDDDD DO_IUPRED2A: ...................................................... DO_SPOTD: .....................................DDDDDDDDDDDDDDDDD CONSENSUS: ..........................................DDDDDDDDDDDD CONSENSUS_MOBI: ...................................................... RICH_[A]: AlgAAqAtAkA RICH_fLPS_[A]: AlgAAqAtAkA