Q9UNX3 RL26L_HUMAN

Gene name: RPL26L1
Protein name: 60S ribosomal protein L26-like 1

List of terms from Generic GO subset, which this protein is a part of:
- biosynthetic process GO:0009058
- cellular nitrogen compound metabolic process GO:0034641
- ribosome biogenesis GO:0042254
- translation GO:0006412

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q8N370 SLC43A2 0.87344 transport GO:0006810
2 Q9Y2R4 DDX52 0.84923 cellular nitrogen compound metabolic process GO:0034641
ribosome biogenesis GO:0042254
3 Q9BXB7 SPATA16 0.83269 anatomical structure development GO:0048856
cell differentiation GO:0030154
reproduction GO:0000003
4 Q02878 RPL6 0.82779 biological process involved in symbiotic interaction GO:0044403
biosynthetic process GO:0009058
catabolic process GO:0009056
...
5 Q96ND0 FAM210A 0.81558
6 Q9Y421 FAM32A 0.8129 cell cycle GO:0007049
cell death GO:0008219
7 Q8IYW2 CFAP46 0.77733 cellular component assembly GO:0022607
cytoskeleton organization GO:0007010
8 Q15431 SYCP1 0.76996 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cell cycle GO:0007049
...
9 Q5T9S5 CCDC18 0.75769
10 O95478 NSA2 0.75611 cellular nitrogen compound metabolic process GO:0034641
ribosome biogenesis GO:0042254

                                           20                  40                  60                  80                 100
AA:                      MKFNPFVTSDRSKNRKRHFNAPSHVRRKIMSSPLSKELRQKYNVRSMPIRKDDEVQVVRGHYKGQQIGKVVQVYRKKYVIYIERVQREKANGTTVHVGIH
STMI:                                                                                                                        
DO_DISOPRED3:            D...................................................................................................
DO_IUPRED2A:             ...DDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..DDD.DDDDDDD........DD...................................DDDDDDD..
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDD............................................................................
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDDDDD............................................................................
CONSENSUS_MOBI:          DDDDDDDDDDDDDDDDDDDDD...............................................................................
RICH_[NR]:                         RskNRkRhfN                                                                                
RICH_MOBI_[NR]:                    RskNRkRhfN                                                                                

                                          120                 140               
AA:                      PSKVVITRLKLDKDRKKILERKAKSRQVGKEKGKYKEELIEKMQE
STMI:                                                                 
DO_DISOPRED3:            ............................DDDDDDD.DDDD....D
DO_IUPRED2A:             ................D..DDDDDDDDDDDD..............
DO_SPOTD:                .......................DDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               .......................DDDDDDDDDDDDDDDDD....D
CONSENSUS_MOBI:          .....................DDDDDDDDDDDDDDDDDDDDDDDD
RICH_[K]:                                       KsrqvgKeKgKyK         
RICH_MOBI_[E]:                                         EkgkykEEliEkmqE
RICH_MOBI_[K]:                                KaKsrqvgKeKgKyKeelieK   
RICH_MOBI_[EK]:                               KaKsrqvgKEKgKyKEEliEKmqE
RICH_fLPS_MOBI_[K]:                           KaKsrqvgKeKgKyKeelieK