Q9Y343 SNX24_HUMAN
Gene name: SNX24
Protein name: Sorting nexin-24
List of terms from Generic GO subset, which this protein is a part of:
- protein transport GO:0015031
- transport GO:0006810
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q99965 | ADAM2 | 0.97217 | cell adhesion GO:0007155 membrane organization GO:0061024 nervous system process GO:0050877 ... |
| 2 | Q6ZMS4 | ZNF852 | 0.7232 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 |
| 3 | Q9ULZ2 | STAP1 | 0.65493 | anatomical structure development GO:0048856 cell differentiation GO:0030154 cellular component assembly GO:0022607 ... |
| 4 | Q9UNK0 | STX8 | 0.65493 | immune system process GO:0002376 membrane organization GO:0061024 protein transport GO:0015031 ... |
| 5 | Q9Y243 | AKT3 | 0.58579 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 cell population proliferation GO:0008283 ... |
| 6 | Q9GZL7 | WDR12 | 0.57956 | cell cycle GO:0007049 cellular nitrogen compound metabolic process GO:0034641 ribosome biogenesis GO:0042254 ... |
| 7 | A8MW99 | MEI4 | 0.5617 | anatomical structure development GO:0048856 cell cycle GO:0007049 cell differentiation GO:0030154 ... |
| 8 | Q0VD86 | INCA1 | 0.55778 | cell cycle GO:0007049 cell death GO:0008219 cell population proliferation GO:0008283 ... |
| 9 | Q9NXF7 | DCAF16 | 0.54383 | cellular protein modification process GO:0006464 |
| 10 | P31749 | AKT1 | 0.53475 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 biosynthetic process GO:0009058 ... |
20 40 60 80 100 AA: MEVYIPSFRYEESDLERGYTVFKIEVLMNGRKHFVEKRYSEFHALHKKLKKCIKTPEIPSKHVRNWVPKVLEQRRQGLETYLQAVILENEELPKLFLDFL STMI: DO_DISOPRED3: .................................................................................................... DO_IUPRED2A: .................................................................................................... DO_SPOTD: .................................................................................................... CONSENSUS: .................................................................................................... CONSENSUS_MOBI: ....................................................................................................
120 140 160 AA: NVRHLPSLPKAESCGSFDETESEESSKLSHQPVLLFLRDPYVLPAASDFPNVVIEGVLHGIFYPHLQPR STMI: DO_DISOPRED3: ...........DDDDDDDDDDDDDDD........................................... DO_IUPRED2A: ...............DD.DDDD............................................... DO_SPOTD: .....DDDDDDDDDDDDDDDDDDDDDDDD.....................................DDD CONSENSUS: ...........DDDDDDDDDDDDDDD........................................... CONSENSUS_MOBI: .....DD.............................................................. RICH_[E]: EscgsfdEtEsEE RICH_[ES]: EScgSfdEtESEESS