Q9Y3B7 RM11_HUMAN
Gene name: MRPL11
Protein name: 39S ribosomal protein L11, mitochondrial
List of terms from Generic GO subset, which this protein is a part of:
- biosynthetic process GO:0009058
- cellular component assembly GO:0022607
- cellular nitrogen compound metabolic process GO:0034641
- protein-containing complex assembly GO:0065003
- ribonucleoprotein complex assembly GO:0022618
- ribosome biogenesis GO:0042254
- translation GO:0006412
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q9Y426 | C2CD2 | 0.75592 | |
| 2 | Q6XQN6 | NAPRT | 0.72313 | |
| 3 | Q9BV29 | CCDC32 | 0.64376 | |
| 4 | Q9BSL1 | UBAC1 | 0.635 | cellular protein modification process GO:0006464 |
| 5 | Q9BSY9 | DESI2 | 0.627 | cellular protein modification process GO:0006464 |
| 6 | Q92630 | DYRK2 | 0.62031 | biosynthetic process GO:0009058 carbohydrate metabolic process GO:0005975 cell death GO:0008219 ... |
| 7 | O43248 | HOXC11 | 0.61999 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 biosynthetic process GO:0009058 ... |
| 8 | P09497 | CLTB | 0.61675 | cellular component assembly GO:0022607 membrane organization GO:0061024 protein transport GO:0015031 ... |
| 9 | Q6L8Q7 | PDE12 | 0.59419 | biological process involved in symbiotic interaction GO:0044403 catabolic process GO:0009056 cell death GO:0008219 ... |
| 10 | Q96S44 | TP53RK | 0.58927 | cellular nitrogen compound metabolic process GO:0034641 cellular protein modification process GO:0006464 signal transduction GO:0007165 |
20 40 60 80 100 AA: MSKLGRAARGLRKPEVGGVIRAIVRAGLAMPGPPLGPVLGQRGVSINQFCKEFNERTKDIKEGIPLPTKILVKPDRTFEIKIGQPTVSYFLKAAAGIEKG STMI: DO_DISOPRED3: DDDDDDDDDDD......................................................................................... DO_IUPRED2A: ....D............................................................................................... DO_SPOTD: DDDDDDDDDDDDD....................................................................................... CONSENSUS: DDDDDDDDDDD......................................................................................... CONSENSUS_MOBI: DDDDDDDDDDDDDDDDD...................................................................................
120 140 160 180 AA: ARQTGKEVAGLVTLKHVYEIARIKAQDEAFALQDVPLSSVVRSIIGSARSLGIRVVKDLSSEELAAFQKERAIFLAAQKEADLAAQEEAAKK STMI: DO_DISOPRED3: ....................................................................................DDDDDDDD DO_IUPRED2A: ............................................................................................ DO_SPOTD: ................................................................................DDDDDDDDDDDD CONSENSUS: ....................................................................................DDDDDDDD CONSENSUS_MOBI: .........................................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD RICH_MOBI_[AE]: EElAAfqkErAiflAAqkEA RICH_MOBI_[AF]: AAFqkerAiFlAAqkeAdlAA RICH_MOBI_[A]: AAfqkerAiflAAqkeAdlAAqeeAA RICH_MOBI_[EF]: EElaaFqkEraiFlaaqkE RICH_fLPS_MOBI_[A]: AAfqkerAiflAAqkeAdlAAqeeAA