Q9Y5V0 ZN706_HUMAN

Gene name: ZNF706
Protein name: Zinc finger protein 706

List of terms from Generic GO subset, which this protein is a part of:
- biosynthetic process GO:0009058
- cellular nitrogen compound metabolic process GO:0034641
- translation GO:0006412

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q9NVA2 SEPTIN11 0.76565 cell cycle GO:0007049
cell division GO:0051301
cell junction organization GO:0034330
...
2 Q9H583 HEATR1 0.7102 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
ribosome biogenesis GO:0042254
3 Q96A22 C11orf52 0.68587
4 P84101 SERF2 0.68362
5 Q8TAL5 C9orf43 0.68072
6 Q9BXY4 RSPO3 0.68059 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
cell-cell signaling GO:0007267
...
7 Q8IV76 PASD1 0.6503 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
8 P48729 CSNK1A1 0.64829 anatomical structure development GO:0048856
catabolic process GO:0009056
cell cycle GO:0007049
...
9 P22492 H1-6 0.62873 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cell differentiation GO:0030154
...
10 P26640 VARS1 0.62732 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
small molecule metabolic process GO:0044281
...

                                           20                  40                  60    
AA:                      MARGQQKIQSQQKNAKKQAGQKKKQGHDQKAAAKAALIYTCTVCRTQMPDPKTFKQHFESKHPKTPLPPELADVQA
STMI:                                                                                                
DO_DISOPRED3:            D.DD...D..D..........DDDDD..................................................
DO_IUPRED2A:             DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.................DDDDDDDDDDDDDDDDDDDDDDDDDDD
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD....................D..DDDDDDDDDDDDDDDDD
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD........................DDDDDDDDDDDDDDDDDDDD
CONSENSUS_MOBI:          DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD....................DDDDDDDDDDDDDDDDDDDDDDDD
RICH_[AK]:                           KnAKKqAgqKKKqghdqKAA                                            
RICH_[AQ]:                             AkkQAgQkkkQghdQkAA                                            
RICH_[K]:                      KiqsqqKnaKKqagqKKKqghdqK                                              
RICH_[Q]:                    QQkiQsQQknakkQagQkkkQghdQ                                               
RICH_[KQ]:                   QQKiQsQQKnaKKQagQKKKQghdQK                                              
RICH_fLPS_[Q]:             rgQQkiQsQQknakkQagQkkkQghdQ                                               
RICH_fLPS_[QK]:              QQKiQsQQKnaKKQagQKKKQghdQK                                              
RICH_fLPS_[K]:                 KiqsqqKnaKKqagqKKKqghdqK                                              
RICH_MOBI_[AK]:                      KnAKKqAgqKKKqghdqKAA                                            
RICH_MOBI_[AQ]:                        AkkQAgQkkkQghdQkAA                                            
RICH_MOBI_[K]:                 KiqsqqKnaKKqagqKKKqghdqK                                              
RICH_MOBI_[Q]:               QQkiQsQQknakkQagQkkkQghdQ                                               
RICH_MOBI_[HK]:                                                                KqHfesKHpK            
RICH_MOBI_[KQ]:              QQKiQsQQKnaKKQagQKKKQghdQK                                              
RICH_fLPS_MOBI_[Q]:        rgQQkiQsQQknakkQagQkkkQghdQ                                               
RICH_fLPS_MOBI_[QK]:         QQKiQsQQKnaKKQagQKKKQghdQK                                              
RICH_fLPS_MOBI_[K]:            KiqsqqKnaKKqagqKKKqghdqK