Q9Y6D0 SELK_HUMAN

Gene name: SELENOK
Protein name: Selenoprotein K

List of terms from Generic GO subset, which this protein is a part of:
- biosynthetic process GO:0009058
- cell adhesion GO:0007155
- cell death GO:0008219
- cell differentiation GO:0030154
- cell population proliferation GO:0008283
- cell-cell signaling GO:0007267
- cellular protein modification process GO:0006464
- homeostatic process GO:0042592
- immune system process GO:0002376
- protein transport GO:0015031
- response to stress GO:0006950
- signal transduction GO:0007165
- transport GO:0006810

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q9BTV5 FSD1 0.58525 cell cycle GO:0007049
cell division GO:0051301
cytoskeleton organization GO:0007010
...
2 P32239 CCKBR 0.53923 anatomical structure development GO:0048856
cell population proliferation GO:0008283
homeostatic process GO:0042592
...
3 Q5RGS3 FAM74A1 0.52801
4 P38159 RBMX 0.52274 biosynthetic process GO:0009058
cell differentiation GO:0030154
cellular component assembly GO:0022607
...
5 A1L168 C20orf202 0.5161
6 Q6P087 RPUSD3 0.50482 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
mRNA processing GO:0006397
...
7 Q96E39 RBMXL1 0.48991 cellular nitrogen compound metabolic process GO:0034641
mRNA processing GO:0006397
8 Q969E3 UCN3 0.48293 cell-cell signaling GO:0007267
protein transport GO:0015031
response to stress GO:0006950
...
9 Q8NG27 PJA1 0.47575 catabolic process GO:0009056
cellular protein modification process GO:0006464
10 Q96PD7 DGAT2 0.47302 anatomical structure development GO:0048856
biosynthetic process GO:0009058
carbohydrate metabolic process GO:0005975
...

                                           20                  40                  60                  80      
AA:                      MVYISNGQVLDSRSQSPWRLSLITDFFWGIAEFVVLFFKTLLQQDVKKRRSYGNSSDSRYDDGRGPPGNPPRRMGRINHLRGPSPPPMAGGUGR
STMI:                                       MMMMMMMMMMMMMMMMMMMMMMM                                                    
DO_DISOPRED3:            ...............................................DDDDDDDDDDDDDDDDDD.....................D..DDDDD
DO_IUPRED2A:             ................................................D..DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
DO_SPOTD:                ............................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               ...................                       ......DDDDDDDDDDDDDDDDD.....................D..DDDDD
CONSENSUS_MOBI:          ...................                       .....DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.......DD.
RICH_[SY]:                                                                 SYgnSSdSrY                                  
RICH_[DY]:                                                                  YgnssDsrYDD                                
RICH_MOBI_[PR]:                                                                         RgPPgnPPRR                     
RICH_MOBI_[RY]:                                                          RRsYgnssdsRYddgR                              
RICH_MOBI_[R]:                                                           RRsygnssdsRyddgR       RRmgRinhlR             
RICH_MOBI_[SY]:                                                            SYgnSSdSrY                                  
RICH_MOBI_[DY]:                                                             YgnssDsrYDD                                
RICH_MOBI_[GR]:                                                          RRsyGnssdsRyddGRGppG                          
RICH_MOBI_[GY]:                                                             YGnssdsrYddGrGppG                          
RICH_MOBI_[NR]:                                                                              NppRRmgRiN