Citrus Sinensis ID: 000202


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------1000------1010------1020------1030------1040------1050------1060------1070------1080------1090------1100------1110------1120------1130------1140------1150------1160------1170------1180------1190------1200------1210------1220------1230------1240------1250------1260------1270------1280------1290------1300------1310------1320------1330------1340------1350------1360------1370------1380------1390------1400------1410------1420------1430------1440------1450------1460------1470------1480------1490------1500------1510------1520------1530------1540------1550------1560------1570------1580------1590------1600------1610------1620------1630------1640------1650------1660------1670------1680------1690------1700------1710------1720------1730------1740------1750------1760------1770------1780------1790------1800------1810------1820------1830------1840------1850------1860------
MASSSSSPPRNDKKMYDVFLSFRGEDTRDNFTSHLYSALCQNNVETFIDNDLKRGDEIPESLLGTIEASTISIIIFSEKYASSKWCLDELLKILECKRNYGQIVIPVFYRVDPSHVRKQIGSFGDSFFMLEERFPYKMRNWRSALTEAADLSGFDSCVIRPESRLVADIANEVLERLDDTFQSESKDLIGVEWRIKEIESLLRTGSAGVYKLGIWGIGGIGKTTIAGAVFNKISRHFEGSYFACNVRAAEETGRLDDLRKELLSKLLNDRNVKNFQNISVNFQSKRLARKKVLIVFDDVNHPRQIELLIGRLDRFASGSQVIITTRDKQVLTNCEVDHIYQMKELVHADAHKLFTQCAFRGDHLDAGYTELAHKALKYAQGVPLALKVLGCYLCGRSKEEWESAMRKLEIVPHMEIQEVLKISYDSLDDSQKRMHDLLRAMGREIVRKESIVDPGKRSRLWHDEDIYEVLKKNTGTEAIKDISLNMSDNEKEIFARTFSTMTNLGHLKAYESREIKDVMSDLEVVPFPEVYAKNLVSLKMWDGKVKERWDDVQKVDVECDRLDSHARAYWNHTDLKQLRLKLAEVRYLLQDAVRCGADQNLNIDTWFKDLRGLTYEVDELIDNWEQSEISKSMFDREIRRIHQQLVRLLNLFHKLATGHYEESSAVSELSSRRSDDYAVSENDLAVSERDLVHFINKVNYELLRDVNMVRILPISGMSGTGRTVLAQRVYSNKKVKSHFPFRFWFSVSKNLDLSTVLNAIAVQFSEIRRAENMADLSERLLVVLDDVCDIDDEELHNFRLLISNMRDSGSCFLVTTHSHRVATMMSSVSEGQLISLLKLDSEGYFKSELAPSVGAAQSPVLEHGQNLRLMTPESLVMTETQRHSTSGCKAVINSDLSGCSVVLSESVPASDTDSMSFLFEDPASRLENLKEDQMKYSPQPDKQAIPKGEDQTNPILNICVKQPVEPIPVIKLGTSNVTAVNYTQRNVRKIFRYVNDVTASKIGVYGVGGIGKTAALKALISYPEVKVMFHVIIWVTVSRYWNTRKIQKQVLRQLSLHCKDRETDAQVAEKLWQVLNGEKFLLLLDDVWEQIDLEAVGIPVPGSENGSKIFMASRELDVCRNMDVNMVVKLETLSMKDAWELFCKEVGGIIQSPDIHLYARAIVKGCCGLPLLTIVTAKALAGERNVSVWKHASRKFSLPITIEECCTEDLIELLKFSFDQLKDHDVKSCFLHCSLFPEDREVSIVEFIDYCIQEGIIVGTLANAHKRGHQIVDVLVDASLLLINEVHNSIRMPGLMKDLAFGILSSSTGDRCFLSTAEGFQFLSRAYSRLAELPNAGTSSLRSPERSRLFIPEAYQFLLGARAGLTEPPSEEEWTHAKMIFFMDNDLQTLPGRPSCPNLLTLFLQRNCRLRVIPPSFFELMTSLKVLNLSKTRIKSLPETLVNLKCLQILILRDCDFLFVLPPEVGSLECLEVLDLRGTEIKMLPKEIGKLTSLRYLTVFFFGSMYKSEYIKLPPDLISSDILSRLQALETLSIDVHPGDKRWDKDVKIVITEVSGLTKLSSLSFHFPEIECVAEFLKGSAWNNQQLTEFKFVVGHDVKSIVSWVTDYVQCDYNQHDRCLRFVNGKNVPPEVIQILIHSTAFYVDHHLSIVSLSDFGVGYMSGLKFCIISECLKIKTVVDTKEHTTAVFPSLENLTLNHLWDLTCIWQGILPEGSFAELRILSIHACRHLEYVFTCSMIQFLAKLEELTVEYCLAVKSIILDGEITYSSCIMLPSLKKLRLHHLPELANIWRNDWPSLEYISFYGCPKLKKMGMDSKLKETLIWIKAEKKWWAELEWEDTQLPIDLGDRLSIFSEDDEDQEPPLCT
ccccccccccccccccEEEEccccccccccHHHHHHHHHHccccEEEEcccccccccccHHHHHHHHHccEEEEEEcccccccHHHHHHHHHHHHHHcccccEEEEEEccccccccccccccHHHHHHHHHHHcHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHcccccEEEEEEEcccccHHHHHHHHHHHHHHccccEEEEEEEEEEEcccccHHHHHHHHHHHHHccccccccccccHHHHHHHHccccEEEEEcccccHHHHHHHcccccccccccEEEEEEccHHHHHcccccEEEEcccccHHHHHHHHHHHcccccccccHHHHHHHHHHHHHccccccHHHHHHHcccccHHHHHHHHHHHHccccccHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHcccccccccccccccccHHHHHccccccccEEEEEEEccccccccccHHHHcccccccEEEEccccccccccccccccccccccccccEEEcccccccccccccccccccccccccccccccccccccEEEccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHcccccccccccHHHHHHcccHHHHccccccccccccccccccEEEcccccccccccHHHHHHHHHHHcHHHccccccEEEEccccccccccEEEHHHHHcccccccccccccccccccccccHHHHcccHHHHHHHHHHHHHHHcccEEEEEEcccccccccccccEEEccccccccccEEEEcccccEEEEEccccccccEEHHHHcccccccccccccccccccccEEcccccccccccccEEEEcccccccHHHHHHHcccccccEEEccccccccccccccccHHHHHHHHcccHHHHHHHHHHHHHHHccccccccccHHHHcccccccccccccccccccccHHHHHHHHHHHHHHcccccEEEEEEEcccccHHHHHHHHHHccccccccccEEEEEEEcccccHHHHHHHHHHHHHcccccccccHHHHHHHHHHHccccEEEEEcccccHHHHHHHcccccccccccEEEEEEccHHHHHccccccEEEcccccHHHHHHHHHHHHccccccccHHHHHHHHHHHcccccHHHHHHHccccccccHHHHHHHHHHccccccccccccHHHHHHHHHHcccccccccccEEEEEEEcccccccHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHcccEEEEccccEEEccHHHHHHHHHHHcccccccccccccccHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccEEEEccccccccccccccccEEEEEEccccccEEEcccccccccccEEEEccccccccccccccccccccEEEcccccccccccccccccccccEEEccccccccccccccccccccEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHcccccccccccccccccccccccccccccEEEcccccccEEccccccccccccccccEEEccccccccEEEcccccccccccccEEEEEcccccccccccccccccccccEEEEcccccccEEccccccccccccccccccEEEcccccccccccccccccccEEEccccccccccccccccccccHHHHcHHHHHHHcccccccccccccccccccccccccccccccc
ccccccccccccccEEEEEcccccHHHHHHHHHHHHHHHHHccccEEEcccccccccccHHHHHHHHHccEEEEEEcccccccHHHHHHHHHHHHHHHHcccEEEEEEEEccHHHHHcccccHHHHHHHHHHHcHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHccccccEEEEEEEccccccHHHHHHHHHHHHHHHcccEEEEEccccccccccHHHHHHHHHHHHHccccccccHHHHHHHHHHHHcccEEEEEEcccccHHHHHHHHccccccccccEEEEEEccHHHHHHcccccEEEEccccHHHHHHHHHHHHHccccccccHHHHHHHHHHHHccccHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHEEccccccHHHHHHHHHHHHHcHHHHcccccccccccEEEEcHHHHHHHHHccccccEEEEEEEEccccEEEccHHHHHHccccEEEEEEccccccHccHHcEEEEcccccHHHEEEEccccHHHHHHHccccccccccccccEEcccccccccccEEEccccccHccccccHHHHHHHHHHHHHHccHccccccccHHHHHHHHHHHHHccccccHHHHccHHHHHHHHHHHHHHcccccccccHHHHHHcccccccccccccccccccHHHHHHHHHHHHccccccEEEEEEEccccccHHHHHHHHHccHHHHHcccEEEEEEEcccccHHHHHHHHHHHHHcccccccccccccEEEEEEEccccccHHHHHHHHHccccccccccEEEEEEccHHHHHHccccEEEEEccccHHHHHHHHHHHHHccccccccccHcccccHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHccccccEEEEEEEccccccHHHHHHHHHccHHHHHcccEEEEEEccccccHHHHHHHHHHHHHccccccccHHHHHHHHHHHHcccEEEEEEcccccHHHHHHHHccccccccccEEEEEEccHHHHHHccccEEEEEccccHHHHHHHHHHHHHHccccccHHHHHHHHHHHHccccHHHHHHHHHHcccccHHHHHHHHHHHHHccccccccccHHHHHEEEEccccccHHHHHHHHHHHHHHccccccHHHHHHHHHHcccHHHHccccHHHHHHHHHHHHHccEEEEcccccEEEHHHHHHHHHHHHHHcccccccEEEcccccccEEEcccccccHEEEEHHcHHHHHHHHHHHHHHHHHHHHcccccccccccccccccEEEEcccccccccccccccHHEEEEEccccccHHHcccccccccccccEEEccccccccccccccccccccEEEcccccccccccccHHcHHcccEEEccccccEEccccccccHcccEEEccccccccccccccccccccccccHHccHHHccccccccHHHHccHHHHHHHHHHccccccccEEEcccccccccccccccccHHHcccccccccccccHHcccHHccccccccHHHHHHHHccccccccccHHcccHccccEEcccccccccccccccccccHHccEEccccccHHHcccHHccccccccccHHHEEHcccccccccccccccHcccccccEEEcccccccccccccccccccccccEEEccccccccEccccccccHHHHcccccccEEEccccccHccccccccccccEEEcccccHHccccccccccHHcEEEEccccccHEcccccccccHHHHHHHcHccccHccccccccc
massssspprndkkMYDVFLSfrgedtrdnFTSHLYSALCQNNVEtfidndlkrgdeipesllgtieaSTISIIIFSEKYASSKWCLDELLKILECkrnygqivipvfyrvdpshvrkqigsfgdsffmleerfpykmrNWRSALTEaadlsgfdscvirpesrlVADIANEVLERLDDTFQSESKDLIGVEWRIKEIESLLRtgsagvyklgiwgiggigktTIAGAVFNKISRHFEGSYFACNVRAAEETGRLDDLRKELLSKLLndrnvknfqnISVNFQSKRLARKKVLIVfddvnhprQIELLIGRldrfasgsqviittrdkqvltncEVDHIYQMKELVHADAHKLFTQcafrgdhldAGYTELAHKALKYAQGVPLALKVLGCYLCGRSKEEWESAMRKLEIVPHMEIQEVLKISYDSLDDSQKRMHDLLRAMGREIVrkesivdpgkrsrlwhdeDIYEVLKKntgteaikdislnmsDNEKEIFARTFSTmtnlghlkayesREIKDVmsdlevvpfpeVYAKNLVSLKMWDGKVKERWDDVQKVDVECDRLDSHARAYWNHTDLKQLRLKLAEVRYLLQDAVrcgadqnlniDTWFKDLRGLTYEVDELIDNWEQSEISKSMFDREIRRIHQQLVRLLNLFHKLatghyeessavselssrrsddyavsendlavsERDLVHFINKVNYELLRDVNMVRilpisgmsgtgrTVLAQRVYsnkkvkshfpfrfwfsvsknldlsTVLNAIAVQFSEIRRAENMADLSERLLVVLDdvcdiddeeLHNFRLLISNMrdsgscflvTTHSHRVATMMSSVSEGQLISLLKldsegyfkselapsvgaaqspvlehgqnlrlmtpeslvmtetqrhstsgckAVINSDLSGCsvvlsesvpasdtdsmsflfedpASRLENLkedqmkyspqpdkqaipkgedqtnpilnicvkqpvepipviklgtsnvtavnytQRNVRKIFRYVNDvtaskigvygvggiGKTAALKALISYPEVKVMFHVIIWVTVSRYWNTRKIQKQVLRQLSLHCKDRETDAQVAEKLWQVLNGEKFLLLLDDVWEQIDleavgipvpgsengskiFMASRELDVCRNMDVNMVVKLETLSMKDAWELFCKEvggiiqspdiHLYARAIVKGCCGLPLLTIVTAKAlagernvsvwkhasrkfslpitieECCTEDLIELLKFSFdqlkdhdvkscflhcslfpedreVSIVEFIDYCIQEGIIVGTLANAHKRGHQIVDVLVDASLLLINEVHnsirmpglMKDLAFGIlssstgdrcflstAEGFQFLSRAYSRLaelpnagtsslrspersrlfiPEAYQFLLGaraglteppseeewtHAKMIFFmdndlqtlpgrpscpnlLTLFLQrncrlrvippsFFELMTSLKVLNLSKTRIKSLPETLVNLKCLQIlilrdcdflfvlppevgsleCLEVLDLRGTEIKMLPKEIGKLTSLRYLTVFFFGsmykseyiklppdlisSDILSRLQALETLsidvhpgdkrwdkDVKIVITEVSgltklsslsfhfpEIECVAEFLKgsawnnqqLTEFKFVVGHDVKSIVSWVTDYVQcdynqhdrclrfvngknvppEVIQILIHSTAfyvdhhlsivslsdfgvgymsgLKFCIISEClkiktvvdtkehttavfpslenltlnhlwdltciwqgilpegsfAELRILSIHACRHLEYVFTCSMIQFLAKLEELTVEYCLAVKSIILdgeitysscimlpslkklrlhhlpelaniwrndwpsleyisfygcpklkkmgmdsKLKETLIWIKAEKKWWAELEWedtqlpidlgdrlsifseddedqepplct
massssspprndkKMYDVFLSFRGEDTRDNFTSHLYSALCQNNVETFIDNDLKRGDEIPESLLGTIEASTISIIIFSEKYASSKWCLDELLKILECKRNYGQIVIPVFYRVDPSHVRKQIGSFGDSFFMLEERFPYKMRNWRSALTEAADLSGFDSCVIRPESRLVADIANEVLerlddtfqseskdligveWRIKEIESLLRTGSAGVYKLGIWGIGGIGKTTIAGAVFNKISRHFEGSYFACNVRAAEETGRLDDLRKELLSKLlndrnvknfqnisvnfqskrlaRKKVLIvfddvnhpRQIELLIgrldrfasgsqviittrdkqvltNCEVDHIYQMKELVHADAHKLFTQCAFRGDHLDAGYTELAHKALKYAQGVPLALKVLGCYLCGRSKEEWESAMRKLEIVPHMEIQEVLKISYDSLDDSQKRMHDLLRAmgreivrkesivdpgkrsrlwhdedIYEVLkkntgteaikdislnmsDNEKEIFARTFSTMTNLGHLKAYESREIKDVMSDLEVVPFPEVYAKNLVSLKMWDGKVKERWDDVQKVDVECDRLDSharaywnhtdlKQLRLKLAEVRYLLQDAvrcgadqnlniDTWFKDLRGLTYEVDELIDNWEQSEISKSMFDREIRRIHQQLVRLLNLFHKLATghyeessavselssrrsDDYAVSEndlavserdlvHFINKVNYELLRDVNMVRILPisgmsgtgrTVLAQRVYSNKKVKSHFPFRFWFSVSKNLDLSTVLNAIAVQFSEIRRAENMADLSERLLVVLDDVCDIDDEELHNFRLLISNMRDSGSCFLVTTHSHRVATMMSSVSEGQLISLLKLDSEGYFKSELAPSVGAAQSPVLEHGQNLRLMTPESLVMTETQRHSTSGCKAVINSDLSGCSVVLSESvpasdtdsmSFLFEDPASRLENLKEDQMKYSPQPDKQAIPKGEDQTNPILNICVKQPVEPIpviklgtsnvtavnytqrnvrKIFRYVNdvtaskigvygvggIGKTAALKALISYPEVKVMFHVIIWVTVSRYWNTRKIQKQVLRQLSLHCKDRETDAQVAEKLWQVLNGEKFLLLLDDVWEQIDLEAVgipvpgsengsKIFMASRELDVCRNMDVNMVVKLETLSMKDAWELFCKEVGGIIQSPDIHLYARAIVKGCCGLPLLTIVTAKALagernvsvwkhasrkfslpiTIEECCTEDLIELLKFSFDQLKDHDVKSCFLHCSLFPEDREVSIVEFIDYCIQEGIIVGTLANAHKRGHQIVDVLVDASLLLINEVHNSIRMPGLMKDLAFGILSSSTGDRCFLSTAEGFQFLSRAYSRLAElpnagtsslrspersrLFIPEAYQFLLGARAGLTEPPSEEEWTHAKMIFFMDNDLQTLPGRPSCPNLLTLFLQRNCRLRVIPPSFFELMTSLKVLNLSKTRIKSLPETLVNLKCLQILILRDCDFLFVLPPEVGSLECLEVLDLRGTEIKMLpkeigkltslRYLTVFFFGSMYKSEYIKLPPDLISSDILSRLQALETlsidvhpgdkrwdkdVKIVITEVSgltklsslsFHFPEIECVAEFLKGSAWNNQQLTEFKFVVGHDVKSIVSWVTDYVQCDYNQHDRCLRFVNGKNVPPEVIQILIHSTAFYVDHHLSIVSLSDFGVGYMSGLKFCIISECLKIKTVVDTKEHTTAVFPSLENLTLNHLWDLTCIWQGILPEGSFAELRILSIHACRHLEYVFTCSMIQFLAKLEELTVEYCLAVKSIILDGEITYSSCIMLPSLKKLRLHHLPELAniwrndwpsLEYISFYGCPKLKKMGMDSKLKETLIWIKAEKKWWAELEWEDTQLPIDLGDRLSifseddedqepplct
MASSSSSPPRNDKKMYDVFLSFRGEDTRDNFTSHLYSALCQNNVETFIDNDLKRGDEIPESLLGTIEASTISIIIFSEKYASSKWCLDELLKILECKRNYGQIVIPVFYRVDPSHVRKQIGSFGDSFFMLEERFPYKMRNWRSALTEAADLSGFDSCVIRPESRLVADIANEVLERLDDTFQSESKDLIGVEWRIKEIESLLRTGSAGVYKLgiwgiggigkttiagaVFNKISRHFEGSYFACNVRAAEETGRLDDLRKELLSKLLNDRNVKNFQNISVNFQSKRLARKKVLIVFDDVNHPRQIELLIGRLDRFASGSQVIITTRDKQVLTNCEVDHIYQMKELVHADAHKLFTQCAFRGDHLDAGYTELAHKALKYAQGVPLALKVLGCYLCGRSKEEWESAMRKLEIVPHMEIQEVLKISYDSLDDSQKRMHDLLRAMGREIVRKESIVDPGKRSRLWHDEDIYEVLKKNTGTEAIKDISLNMSDNEKEIFARTFSTMTNLGHLKAYESREIKDVMSDLEVVPFPEVYAKNLVSLKMWDGKVKERWDDVQKVDVECDRLDSHARAYWNHTDLKQLRLKLAEVRYLLQDAVRCGADQNLNIDTWFKDLRGLTYEVDELIDNWEQSEISKSMFDREIRRIHQQLVRLLNLFHKLATGHYeessavselssrrsDDYAVSENDLAVSERDLVHFINKVNYELLRDVNMVRILPISGMSGTGRTVLAQRVYSNKKVKSHFPFRFWFSVSKNLDLSTVLNAIAVQFSEIRRAENMADLSerllvvlddvcdiddeelHNFRLLISNMRDSGSCFLVTTHSHRVATMMSSVSEGQLISLLKLDSEGYFKSELAPSVGAAQSPVLEHGQNLRLMTPESLVMTETQRHSTSGCKAVINSDLSGCSVVLSESVPASDTDSMSFLFEDPASRLENLKEDQMKYSPQPDKQAIPKGEDQTNPILNICVKQPVEPIPVIKLGTSNVTAVNYTQRNVRKIFRYVNDVTASkigvygvggigkTAALKALISYPEVKVMFHVIIWVTVSRYWNTRKIQKQVLRQLSLHCKDRETDAQVAEKLWQVLNGEKFLLLLDDVWEQIDLEAVGIPVPGSENGSKIFMASRELDVCRNMDVNMVVKLETLSMKDAWELFCKEVGGIIQSPDIHLYARAIVKGCCGLPLLTIVTAKALAGERNVSVWKHASRKFSLPITIEECCTEDLIELLKFSFDQLKDHDVKSCFLHCSLFPEDREVSIVEFIDYCIQEGIIVGTLANAHKRGHQIVDVLVDASLLLINEVHNSIRMPGLMKDLAFGILSSSTGDRCFLSTAEGFQFLSRAYSRLAELPNAGTSSLRSPERSRLFIPEAYQFLLGARAGLTEPPSEEEWTHAKMIFFMDNDLQTLPGRPSCPNLLTLFLQRNCRLRVIPPSFFELMTSLKVLNLSKTRIKSLPETLVNLKCLQILILRDCDFLFVLPPEVGSLECLEVLDLRGTEIKMLPKEIGKLTSLRYLTVFFFGSMYKSEYIKLPPDLISSDILSRLQALETLSIDVHPGDKRWDKDVKIVITEVSGLTKLSSLSFHFPEIECVAEFLKGSAWNNQQLTEFKFVVGHDVKSIVSWVTDYVQCDYNQHDRCLRFVNGKNVPPEVIQILIHSTAFYVDHHLSIVSLSDFGVGYMSGLKFCIISECLKIKTVVDTKEHTTAVFPSLENLTLNHLWDLTCIWQGILPEGSFAELRILSIHACRHLEYVFTCSMIQFLAKLEELTVEYCLAVKSIILDGEITYSSCIMLPSLKKLRLHHLPELANIWRNDWPSLEYISFYGCPKLKKMGMDSKLKETliwikaekkwwaeleweDTQLPIDLGDRLSIFSEDDEDQEPPLCT
***************YDVFLSFRGEDTRDNFTSHLYSALCQNNVETFIDNDLKRGDEIPESLLGTIEASTISIIIFSEKYASSKWCLDELLKILECKRNYGQIVIPVFYRVDPSHVRKQIGSFGDSFFMLEERFPYKMRNWRSALTEAADLSGFDSCVIRPESRLVADIANEVLERLDDTFQSESKDLIGVEWRIKEIESLLRTGSAGVYKLGIWGIGGIGKTTIAGAVFNKISRHFEGSYFACNVRAAEETGRLDDLRKELLSKLLNDRNVKNFQNISVNFQSKRLARKKVLIVFDDVNHPRQIELLIGRLDRFASGSQVIITTRDKQVLTNCEVDHIYQMKELVHADAHKLFTQCAFRGDHLDAGYTELAHKALKYAQGVPLALKVLGCYLCGRSKEEWESAMRKLEIVPHMEIQEVLKISYDSL*********LLRAMGREIVRKESIVDPGKRSRLWHDEDIYEVLKKNTGTEAIKDISLNMSDNEKEIFARTFSTMTNLGHLKAYESREIKDVMSDLEVVPFPEVYAKNLVSLKMWDGKVKERWDDVQKVDVECDRLDSHARAYWNHTDLKQLRLKLAEVRYLLQDAVRCGADQNLNIDTWFKDLRGLTYEVDELIDNWEQSEISKSMFDREIRRIHQQLVRLLNLFHKLATGHY***********************LAVSERDLVHFINKVNYELLRDVNMVRILPISGMSGTGRTVLAQRVYSNKKVKSHFPFRFWFSVSKNLDLSTVLNAIAVQFSEIRRAENMADLSERLLVVLDDVCDIDDEELHNFRLLISNMRDSGSCFLVTTHSHRVATMMSSVSEGQLISLLKLDSEGYFK*****************************************CKAVINSDLSGCSVVL**************************************************PILNICVKQPVEPIPVIKLGTSNVTAVNYTQRNVRKIFRYVNDVTASKIGVYGVGGIGKTAALKALISYPEVKVMFHVIIWVTVSRYWNTRKIQKQVLRQLSLHCKDRETDAQVAEKLWQVLNGEKFLLLLDDVWEQIDLEAVGIPVPGSENGSKIFMASRELDVCRNMDVNMVVKLETLSMKDAWELFCKEVGGIIQSPDIHLYARAIVKGCCGLPLLTIVTAKALAGERNVSVWKHASRKFSLPITIEECCTEDLIELLKFSFDQLKDHDVKSCFLHCSLFPEDREVSIVEFIDYCIQEGIIVGTLANAHKRGHQIVDVLVDASLLLINEVHNSIRMPGLMKDLAFGILSSSTGDRCFLSTAEGFQFLSRAYSRLA****************RLFIPEAYQFLLGARAGLT******EWTHAKMIFFMDNDLQTLPGRPSCPNLLTLFLQRNCRLRVIPPSFFELMTSLKVLNLSKTRIKSLPETLVNLKCLQILILRDCDFLFVLPPEVGSLECLEVLDLRGTEIKMLPKEIGKLTSLRYLTVFFFGSMYKSEYIKLPPDLISSDILSRLQALETLSIDVHPGDKRWDKDVKIVITEVSGLTKLSSLSFHFPEIECVAEFLKGSAWNNQQLTEFKFVVGHDVKSIVSWVTDYVQCDYNQHDRCLRFVNGKNVPPEVIQILIHSTAFYVDHHLSIVSLSDFGVGYMSGLKFCIISECLKIKTVVDTKEHTTAVFPSLENLTLNHLWDLTCIWQGILPEGSFAELRILSIHACRHLEYVFTCSMIQFLAKLEELTVEYCLAVKSIILDGEITYSSCIMLPSLKKLRLHHLPELANIWRNDWPSLEYISFYGCPKLKKMGMDSKLKETLIWIKAEKKWWAELEWEDTQLPIDLGDRLSI**************
***************YDVFLSFRGEDTRDNFTSHLYSALCQNNVETFIDNDLKRGDEIPESLLGTIEASTISIIIFSEKYASSKWCLDELLKILECKRNYGQIVIPVFYRVDPSHVRKQIGSFGDSFFMLEERFPYKMRNWRSALTEAADLSGFDSCVIRPESRLVADIANEVLERLDDTFQSESKDLIGVEWRIKEIESLLRTGSAGVYKLGIWGIGGIGKTTIAGAVFNKISRHFEGSYFACNVRAAEETGRLDDLRKELLSKLLNDRNVKNFQNISVNFQSKRLARKKVLIVFDDVNHPRQIELLIGRLDRFASGSQVIITTRDKQVLTNCEVDHIYQMKELVHADAHKLFTQCAFRGDHLDAGYTELAHKALKYAQGVPLALKVLGCYLCGRSKEEWESAMRKLEIVPHMEIQEVLKISYDSLDDSQKRMHDLLRAMGREIVRKESIVDPGKRSRLWHDEDIYEVLKKNTGTEAIKDISLNMSDNEKEIFARTFSTMTNLGHLKAYESREIKDVMSDLEVVPFPEVYAKNLVSLKMWDGKVKERWDDVQKVDVECDRLDSHARAYWNHTDLKQLRLKLAEVRYLLQDAVRCGADQNLNIDTWFKDLRGLTYEVDELIDNWEQSEISKSMFDREIRRIHQQLVRLLNLFHKLATGHYEESSAVSELSSRRSDDYAVSENDLAVSERDLVHFINKVNYELLRDVNMVRIL************************SHFPFRFWFSVSKNLDLSTVLNAIAVQFSEIRR*****DLSERLLVVLDDVCDIDDEELHNFRLLISNMRDSGSCFLVTTHSHRVATMMSSVSEGQLISLLKLDSEGYFKSELAPSVGAAQSPVLEHGQNLRLMTPESLVMTETQRHSTSGCKAVINSDLSGCSVVLSESVPASDTDSMSFLFEDPA****************PDKQAIPKGEDQTNPILNICVKQPVEPIPVIKLGTSNVTAVNYTQRNVRKIFRYVNDVTASKIGVYGVGGIGKTAALKALISYPEVKVMFHVIIWVTVSRYWNTRKIQKQVLRQLSLHCKDRETDAQVAEKLWQVLNGEKFLLLLDDVWEQIDLEAVGIPVPGSENGSKIFMASRELDVCRNMDVNMVVKLETLSMKDAWELFCKEVGGIIQSPDIHLYARAIVKGCCGLPLLTIVTAKALAGERNVSVWKHASRKFS***********DLIELLKFSFDQLKDHDVKSCFLHCSLFPEDREVSIVEFIDYCIQEGIIVGTLANAHKRGHQIVDVLVDASLLLINEVHNSIRMPGLMKDLAFGILSSSTGDRCFLSTAEGFQFLSRAYSRLAELPNAGTSSLRSPERSRLFIPEAYQFLLGARAGLTEPPSEEEWTHAKMIFFMDNDLQTLPGRPSCPNLLTLFLQRNCRLRVIPPSFFELMTSLKVLNLSKTRIKSLPETLVNLKCLQILILRDCDFLFVLPPEVGSLECLEVLDLRGTEIKMLPKEIGKLTSLRYLTVFFFGSMYKSEYIKLPPDLISSDILSRLQALETLSIDVHPGDKRWDKDVKIVITEVSGLTKLSSLSFHFPEIECVAEFLKGSAWNNQQLTEFKFVVGHDVKSIVSWVTDYVQCDYNQHDRCLRFVNGKNVPPEVIQILIHSTAFYVDHHLSIVSLSDFGVGYMSGLKFCIISECLKIKTVVDTKEHTTAVFPSLENLTLNHLWDLTCIWQGILPEGSFAELRILSIHACRHLEYVFTCSMIQFLAKLEELTVEYCLAVKSII**********IMLPSLKKLRLHHLPELANIWRNDWPSLEYISFYGCPKLKKMGMDSKLKETLIWIKAEKKWWAELEWEDTQLPIDLGDRLSIFSEDDED**PPLC*
***********DKKMYDVFLSFRGEDTRDNFTSHLYSALCQNNVETFIDNDLKRGDEIPESLLGTIEASTISIIIFSEKYASSKWCLDELLKILECKRNYGQIVIPVFYRVDPSHVRKQIGSFGDSFFMLEERFPYKMRNWRSALTEAADLSGFDSCVIRPESRLVADIANEVLERLDDTFQSESKDLIGVEWRIKEIESLLRTGSAGVYKLGIWGIGGIGKTTIAGAVFNKISRHFEGSYFACNVRAAEETGRLDDLRKELLSKLLNDRNVKNFQNISVNFQSKRLARKKVLIVFDDVNHPRQIELLIGRLDRFASGSQVIITTRDKQVLTNCEVDHIYQMKELVHADAHKLFTQCAFRGDHLDAGYTELAHKALKYAQGVPLALKVLGCYLCGRSKEEWESAMRKLEIVPHMEIQEVLKISYDSLDDSQKRMHDLLRAMGREIVRKESIVDPGKRSRLWHDEDIYEVLKKNTGTEAIKDISLNMSDNEKEIFARTFSTMTNLGHLKAYESREIKDVMSDLEVVPFPEVYAKNLVSLKMWDGKVKERWDDVQKVDVECDRLDSHARAYWNHTDLKQLRLKLAEVRYLLQDAVRCGADQNLNIDTWFKDLRGLTYEVDELIDNWEQSEISKSMFDREIRRIHQQLVRLLNLFHKLATGH*********************ENDLAVSERDLVHFINKVNYELLRDVNMVRILPISGMSGTGRTVLAQRVYSNKKVKSHFPFRFWFSVSKNLDLSTVLNAIAVQFSEIRRAENMADLSERLLVVLDDVCDIDDEELHNFRLLISNMRDSGSCFLVTTHSHRVATMMSSVSEGQLISLLKLDSEGYFKSELAPSVGAAQSPVLEHGQNLRLMTPESLV**********GCKAVINSDLSGCSVVLSESVPASDTDSMSFLFEDPASRLENLKEDQMKYSPQPDKQAIPKGEDQTNPILNICVKQPVEPIPVIKLGTSNVTAVNYTQRNVRKIFRYVNDVTASKIGVYGVGGIGKTAALKALISYPEVKVMFHVIIWVTVSRYWNTRKIQKQVLRQLSLHCKDRETDAQVAEKLWQVLNGEKFLLLLDDVWEQIDLEAVGIPVPGSENGSKIFMASRELDVCRNMDVNMVVKLETLSMKDAWELFCKEVGGIIQSPDIHLYARAIVKGCCGLPLLTIVTAKALAGERNVSVWKHASRKFSLPITIEECCTEDLIELLKFSFDQLKDHDVKSCFLHCSLFPEDREVSIVEFIDYCIQEGIIVGTLANAHKRGHQIVDVLVDASLLLINEVHNSIRMPGLMKDLAFGILSSSTGDRCFLSTAEGFQFLSRAYSRLAELP**********ERSRLFIPEAYQFLLGARAGLTEPPSEEEWTHAKMIFFMDNDLQTLPGRPSCPNLLTLFLQRNCRLRVIPPSFFELMTSLKVLNLSKTRIKSLPETLVNLKCLQILILRDCDFLFVLPPEVGSLECLEVLDLRGTEIKMLPKEIGKLTSLRYLTVFFFGSMYKSEYIKLPPDLISSDILSRLQALETLSIDVHPGDKRWDKDVKIVITEVSGLTKLSSLSFHFPEIECVAEFLKGSAWNNQQLTEFKFVVGHDVKSIVSWVTDYVQCDYNQHDRCLRFVNGKNVPPEVIQILIHSTAFYVDHHLSIVSLSDFGVGYMSGLKFCIISECLKIKTVVDTKEHTTAVFPSLENLTLNHLWDLTCIWQGILPEGSFAELRILSIHACRHLEYVFTCSMIQFLAKLEELTVEYCLAVKSIILDGEITYSSCIMLPSLKKLRLHHLPELANIWRNDWPSLEYISFYGCPKLKKMGMDSKLKETLIWIKAEKKWWAELEWEDTQLPIDLGDRLSIFSE***********
***********DKKMYDVFLSFRGEDTRDNFTSHLYSALCQNNVETFIDNDLKRGDEIPESLLGTIEASTISIIIFSEKYASSKWCLDELLKILECKRNYGQIVIPVFYRVDPSHVRKQIGSFGDSFFMLEERFPYKMRNWRSALTEAADLSGFDSCVIRPESRLVADIANEVLERLDDTFQSESKDLIGVEWRIKEIESLLRTGSAGVYKLGIWGIGGIGKTTIAGAVFNKISRHFEGSYFACNVRAAEETGRLDDLRKELLSKLLNDRNVKNFQNISVNFQSKRLARKKVLIVFDDVNHPRQIELLIGRLDRFASGSQVIITTRDKQVLTNCEVDHIYQMKELVHADAHKLFTQCAFRGDHLDAGYTELAHKALKYAQGVPLALKVLGCYLCGRSKEEWESAMRKLEIVPHMEIQEVLKISYDSLDDSQKRMHDLLRAMGREIVRKESIVDPGKRSRLWHDEDIYEVLKKNTGTEAIKDISLNMSDNEKEIFARTFSTMTNLGHLKAYESREIKDVMSDLEVVPFPEVYAKNLVSLKMWDGKVKERWDDVQKVDVECDRLDSHARAYWNHTDLKQLRLKLAEVRYLLQDAVRCGADQNLNIDTWFKDLRGLTYEVDELIDNWEQSEISKSMFDREIRRIHQQLVRLLNLFHKLATGHYEESSAVSELSSRRSDDYAVSENDLAVSERDLVHFINKVNYELLRDVNMVRILPISGMSGTGRTVLAQRVYSNKKVKSHFPFRFWFSVSKNLDLSTVLNAIAVQFSEIRRAENMADLSERLLVVLDDVCDIDDEELHNFRLLISNMRDSGSCFLVTTHSHRVATMMSSVSEGQLISLLKLDSEGYFKSELAPSVGAAQSPVLEHGQNLRLMTPESLVMTETQRHSTSGCKAVINSDLSGCSVVLSESVPASDTDSMSFLFEDPASRLENLKEDQMKYSPQPDKQAIPKGEDQTNPILNICVKQPVEPIPVIKLGTSNVTAVNYTQRNVRKIFRYVNDVTASKIGVYGVGGIGKTAALKALISYPEVKVMFHVIIWVTVSRYWNTRKIQKQVLRQLSLHCKDRETDAQVAEKLWQVLNGEKFLLLLDDVWEQIDLEAVGIPVPGSENGSKIFMASRELDVCRNMDVNMVVKLETLSMKDAWELFCKEVGGIIQSPDIHLYARAIVKGCCGLPLLTIVTAKALAGERNVSVWKHASRKFSLPITIEECCTEDLIELLKFSFDQLKDHDVKSCFLHCSLFPEDREVSIVEFIDYCIQEGIIVGTLANAHKRGHQIVDVLVDASLLLINEVHNSIRMPGLMKDLAFGILSSSTGDRCFLSTAEGFQFLSRAYSRLAELPNAGTSSLRSPERSRLFIPEAYQFLLGARAGLTEPPSEEEWTHAKMIFFMDNDLQTLPGRPSCPNLLTLFLQRNCRLRVIPPSFFELMTSLKVLNLSKTRIKSLPETLVNLKCLQILILRDCDFLFVLPPEVGSLECLEVLDLRGTEIKMLPKEIGKLTSLRYLTVFFFGSMYKSEYIKLPPDLISSDILSRLQALETLSIDVHPGDKRWDKDVKIVITEVSGLTKLSSLSFHFPEIECVAEFLKGSAWNNQQLTEFKFVVGHDVKSIVSWVTDYVQCDYNQHDRCLRFVNGKNVPPEVIQILIHSTAFYVDHHLSIVSLSDFGVGYMSGLKFCIISECLKIKTVVDTKEHTTAVFPSLENLTLNHLWDLTCIWQGILPEGSFAELRILSIHACRHLEYVFTCSMIQFLAKLEELTVEYCLAVKSIILDGEITYSSCIMLPSLKKLRLHHLPELANIWRNDWPSLEYISFYGCPKLKKMGMDSKLKETLIWIKAEKKWWAELEWEDTQLPIDLGDRLSIFSEDDEDQEPPLCT
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MASSSSSPPRNDKKMYDVFLSFRGEDTRDNFTSHLYSALCQNNVETFIDNDLKRGDEIPESLLGTIEASTISIIIFSEKYASSKWCLDELLKILECKRNYGQIVIPVFYRVDPSHVRKQIGSFGDSFFMLEERFPYKMRNWRSALTEAADLSGFDSCVIRPESRLVADIANEVLERLDDTFQSESKDLIGVEWRIKEIESLLRTGSAGVYKLGIWGIGGIGKTTIAGAVFNKISRHFEGSYFACNVRAAEETGRLDDLRKELLSKLLNDRNVKNFQNISVNFQSKRLARKKVLIVFDDVNHPRQIELLIGRLDRFASGSQVIITTRDKQVLTNCEVDHIYQMKELVHADAHKLFTQCAFRGDHLDAGYTELAHKALKYAQGVPLALKVLGCYLCGRSKEEWESAMRKLEIVPHMEIQEVLKISYDSLDDSQKRMHDLLRAMGREIVRKESIVDPGKRSRLWHDEDIYEVLKKNTGTEAIKDISLNMSDNEKEIFARTFSTMTNLGHLKAYESREIKDVMSDLEVVPFPEVYAKNLVSLKMWDGKVKERWDDVQKVDVECDRLDSHARAYWNHTDLKQLRLKLAEVRYLLQDAVRCGADQNLNIDTWFKDLRGLTYEVDELIDNWEQSEISKSMFDREIRRIHQQLVRLLNLFHKLATGHYEESSAVSELSSRRSDDYAVSENDLAVSERDLVHFINKVNYELLRDVNMVRILPISGMSGTGRTVLAQRVYSNKKVKSHFPFRFWFSVSKNLDLSTVLNAIAVQFSEIRRAENMADLSERLLVVLDDVCDIDDEELHNFRLLISNMRDSGSCFLVTTHSHRVATMMSSVSEGQLISLLKLDSEGYFKSELAPSVGAAQSPVLEHGQNLRLMTPESLVMTETQRHSTSGCKAVINSDLSGCSVVLSESVPASDTDSMSFLFEDPASRLENLKEDQMKYSPQPDKQAIPKGEDQTNPILNICVKQPVEPIPVIKLGTSNVTAVNYTQRNVRKIFRYVNDVTASKIGVYGVGGIGKTAALKALISYPEVKVMFHVIIWVTVSRYWNTRKIQKQVLRQLSLHCKDRETDAQVAEKLWQVLNGEKFLLLLDDVWEQIDLEAVGIPVPGSENGSKIFMASRELDVCRNMDVNMVVKLETLSMKDAWELFCKEVGGIIQSPDIHLYARAIVKGCCGLPLLTIVTAKALAGERNVSVWKHASRKFSLPITIEECCTEDLIELLKFSFDQLKDHDVKSCFLHCSLFPEDREVSIVEFIDYCIQEGIIVGTLANAHKRGHQIVDVLVDASLLLINEVHNSIRMPGLMKDLAFGILSSSTGDRCFLSTAEGFQFLSRAYSRLAELPNAGTSSLRSPERSRLFIPEAYQFLLGARAGLTEPPSEEEWTHAKMIFFMDNDLQTLPGRPSCPNLLTLFLQRNCRLRVIPPSFFELMTSLKVLNLSKTRIKSLPETLVNLKCLQILILRDCDFLFVLPPEVGSLECLEVLDLRGTEIKMLPKEIGKLTSLRYLTVFFFGSMYKSEYIKLPPDLISSDILSRLQALETLSIDVHPGDKRWDKDVKIVITEVSGLTKLSSLSFHFPEIECVAEFLKGSAWNNQQLTEFKFVVGHDVKSIVSWVTDYVQCDYNQHDRCLRFVNGKNVPPEVIQILIHSTAFYVDHHLSIVSLSDFGVGYMSGLKFCIISECLKIKTVVDTKEHTTAVFPSLENLTLNHLWDLTCIWQGILPEGSFAELRILSIHACRHLEYVFTCSMIQFLAKLEELTVEYCLAVKSIILDGEITYSSCIMLPSLKKLRLHHLPELANIWRNDWPSLEYISFYGCPKLKKMGMDSKLKETLIWIKAEKKWWAELEWEDTQLPIDLGDRLSIFSEDDEDQEPPLCT
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query1866 2.2.26 [Sep-21-2011]
O825001095 Putative disease resistan yes no 0.289 0.494 0.362 8e-96
Q403921144 TMV resistance protein N N/A no 0.248 0.404 0.374 4e-86
Q9T048985 Disease resistance protei no no 0.404 0.766 0.293 2e-82
O235301301 Protein SUPPRESSOR OF npr no no 0.264 0.379 0.354 2e-75
O81825919 Probable disease resistan no no 0.398 0.808 0.275 8e-71
Q42484909 Disease resistance protei no no 0.243 0.499 0.327 3e-64
Q8L3R3885 Disease resistance protei no no 0.229 0.484 0.320 6e-60
O64973889 Disease resistance protei no no 0.363 0.763 0.270 9e-60
P60838894 Probable disease resistan no no 0.231 0.483 0.315 2e-59
Q9FG91848 Probable disease resistan no no 0.280 0.616 0.314 2e-58
>sp|O82500|Y4117_ARATH Putative disease resistance protein At4g11170 OS=Arabidopsis thaliana GN=At4g11170 PE=2 SV=1 Back     alignment and function desciption
 Score =  353 bits (906), Expect = 8e-96,   Method: Compositional matrix adjust.
 Identities = 232/640 (36%), Positives = 337/640 (52%), Gaps = 99/640 (15%)

Query: 1   MASSSSSPPRNDKKMYDVFLSFRGEDTRDNFTSHLYSALCQNNVETFIDNDLKRGDEIPE 60
           MASSSS+  R     YDVF SFRGED R+NF SHL        + TF D+ +KR   I  
Sbjct: 1   MASSSSNSWR-----YDVFPSFRGEDVRNNFLSHLLKEFESKGIVTFRDDHIKRSHTIGH 55

Query: 61  SLLGTIEASTISIIIFSEKYASSKWCLDELLKILECKRNYGQIVIPVFYRVDPSHVRKQI 120
            L   I  S IS+++FSE YASS WCLDEL++I++CK   G  V+PVFY+VDPS +RKQ 
Sbjct: 56  ELRAAIRESKISVVLFSENYASSSWCLDELIEIMKCKEEQGLKVMPVFYKVDPSDIRKQT 115

Query: 121 GSFGDSFF-----MLEERFPYKMRNWRSALTEAADLSGFDSCVIRPESRLVADIANEVLE 175
           G FG SF        EER      NWR ALT+AA++ G        E+  +  I+ +VLE
Sbjct: 116 GKFGMSFLETCCGKTEER----QHNWRRALTDAANILGDHPQNWDNEAYKITTISKDVLE 171

Query: 176 RLDDTFQSESKDLIGVEWRIKEIESLLRTGSAGVYKLGIWGIGGIGKTTIAGAVFNKISR 235
           +L+ T   +  DL+G+E  I ++ESLL   S GV  +GIWG  G+GKTTIA A++N+   
Sbjct: 172 KLNATPSRDFNDLVGMEAHIAKMESLLCLESQGVRIVGIWGPAGVGKTTIARALYNQYHE 231

Query: 236 HFEGSYFACNVRAAEETGRLDD------LRKELLSKLLNDRNVKNFQNISVNFQSKRLAR 289
           +F  S F  NVR +     LDD      L++  LSKLL+ ++++     ++    +RL  
Sbjct: 232 NFNLSIFMENVRESYGEAGLDDYGLKLHLQQRFLSKLLDQKDLRVRHLGAI---EERLKS 288

Query: 290 KKVLIVFDDVNHPRQIELLIGRLDRFASGSQVIITTRDKQVLTNCEVDHIYQMKELVHAD 349
           +KVLI+ DDV++  Q++ L      F + S++++TT++KQ+L + +++H+YQ+      +
Sbjct: 289 QKVLIILDDVDNIEQLKALAKENQWFGNKSRIVVTTQNKQLLVSHDINHMYQVAYPSKQE 348

Query: 350 AHKLFTQCAFRGDHLDAGYTELAHKALKYAQGVPLALKVLGCYLCGRSKEEWESAMRKLE 409
           A  +F Q AF+          LA +    A  +PLAL+VLG ++ G+ KEEWE ++  L+
Sbjct: 349 ALTIFCQHAFKQSSPSDDLKHLAIEFTTLAGHLPLALRVLGSFMRGKGKEEWEFSLPTLK 408

Query: 410 IVPHMEIQEVLKISYDSLDDSQK------------------------------------- 432
                E+++VLK+ YD L D +K                                     
Sbjct: 409 SRLDGEVEKVLKVGYDGLHDHEKDLFLHIACIFSGQHENYLKQMIIANNDTYVSFGLQVL 468

Query: 433 --------------RMHDLLRAMGREIVRKESIVDPGKRSRLWHDEDIYEVLKKNTGTEA 478
                          MH LLR +G+E+VRK+SI +PGKR  L + ++   VL  NTGT  
Sbjct: 469 ADKSLIQKFENGRIEMHSLLRQLGKEVVRKQSIYEPGKRQFLMNAKETCGVLSNNTGTGT 528

Query: 479 IKDISLNMSDNEKEIF--ARTFSTMTNLGHLKAYESREIKDVMS--------DLEVVP-- 526
           +  ISL+M + ++E++   +TF  M NL +LK Y S  I D M          L  +P  
Sbjct: 529 VLGISLDMCEIKEELYISEKTFEEMRNLVYLKFYMSSPIDDKMKVKLQLPEEGLSYLPQL 588

Query: 527 ------------FPEVY-AKNLVSLKMWDGKVKERWDDVQ 553
                       FP  +  + LV L M   K+K+ W  VQ
Sbjct: 589 RLLHWDAYPLEFFPSSFRPECLVELNMSHSKLKKLWSGVQ 628





Arabidopsis thaliana (taxid: 3702)
>sp|Q40392|TMVRN_NICGU TMV resistance protein N OS=Nicotiana glutinosa GN=N PE=1 SV=1 Back     alignment and function description
>sp|Q9T048|DRL27_ARATH Disease resistance protein At4g27190 OS=Arabidopsis thaliana GN=At4g27190 PE=2 SV=1 Back     alignment and function description
>sp|O23530|SNC1_ARATH Protein SUPPRESSOR OF npr1-1, CONSTITUTIVE 1 OS=Arabidopsis thaliana GN=SNC1 PE=1 SV=3 Back     alignment and function description
>sp|O81825|DRL28_ARATH Probable disease resistance protein At4g27220 OS=Arabidopsis thaliana GN=At4g27220 PE=2 SV=1 Back     alignment and function description
>sp|Q42484|RPS2_ARATH Disease resistance protein RPS2 OS=Arabidopsis thaliana GN=RPS2 PE=1 SV=1 Back     alignment and function description
>sp|Q8L3R3|RFL1_ARATH Disease resistance protein RFL1 OS=Arabidopsis thaliana GN=RFL1 PE=3 SV=2 Back     alignment and function description
>sp|O64973|RPS5_ARATH Disease resistance protein RPS5 OS=Arabidopsis thaliana GN=RPS5 PE=1 SV=2 Back     alignment and function description
>sp|P60838|DRL1_ARATH Probable disease resistance protein At1g12280 OS=Arabidopsis thaliana GN=At1g12280 PE=3 SV=1 Back     alignment and function description
>sp|Q9FG91|DRL32_ARATH Probable disease resistance protein At5g43730 OS=Arabidopsis thaliana GN=At5g43730 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1866
2241279171470 tir-nbs-lrr resistance protein [Populus 0.318 0.404 0.414 1e-125
255561496876 TMV resistance protein N, putative [Rici 0.291 0.621 0.427 1e-124
356550897970 PREDICTED: TMV resistance protein N-like 0.287 0.552 0.430 1e-123
2555690481084 leucine-rich repeat-containing protein, 0.305 0.525 0.423 1e-122
255564976944 TMV resistance protein N, putative [Rici 0.264 0.522 0.464 1e-121
2555371391137 leucine-rich repeat-containing protein, 0.267 0.438 0.452 1e-120
2241277541125 tir-nbs-lrr resistance protein [Populus 0.296 0.491 0.426 1e-119
297739493982 unnamed protein product [Vitis vinifera] 0.430 0.817 0.331 1e-118
317106744947 JHS03A10.2 [Jatropha curcas] 0.286 0.563 0.418 1e-117
2555553571094 leucine-rich repeat-containing protein, 0.288 0.492 0.418 1e-116
>gi|224127917|ref|XP_002329209.1| tir-nbs-lrr resistance protein [Populus trichocarpa] gi|222870990|gb|EEF08121.1| tir-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  456 bits (1174), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 273/658 (41%), Positives = 382/658 (58%), Gaps = 64/658 (9%)

Query: 6   SSPPRNDKKMYDVFLSFRGEDTRDNFTSHLYSALCQNNVETFIDNDLKRGDEIPESLLGT 65
           SS     K  YDVFLSFRG+DTRDNF SHL  ALC+  ++TFID+ L+RG+EI  +LL T
Sbjct: 3   SSSAVAQKWKYDVFLSFRGKDTRDNFVSHLRDALCRKQIKTFIDDKLERGEEITGALLRT 62

Query: 66  IEASTISIIIFSEKYASSKWCLDELLKILECKRNYGQIVIPVFYRVDPSHVRKQIGSFGD 125
           IE S IS+IIFS  YASS WC+DEL+KILECK+ YGQIV+PVFY VDPS V +Q GSFG+
Sbjct: 63  IEESRISVIIFSRNYASSPWCVDELVKILECKKAYGQIVLPVFYHVDPSDVDQQTGSFGN 122

Query: 126 SFFMLEERFPYKMRN---WRSALTEAADLSGFDSCVIRPESRLVADIANEVLERLDDTFQ 182
           +F  LE  F  KM     WR+ LT AA++SG+DS V RPES LV  I + +L++L+    
Sbjct: 123 AFAELERNFKQKMDKVPRWRADLTSAANISGWDSQVTRPESSLVEQIVHHILKKLNYASS 182

Query: 183 SESKDLIGVEWRIKEIESLLRTGSAGVYKLGIWGIGGIGKTTIAGAVFNKISRHFEGSYF 242
           S+ K L+G++ R+++IE+ L T       +GIWG+GG GKTTIAG +FNKI+R +EG YF
Sbjct: 183 SDLKGLVGMDSRMEQIEASLCTKLPEFCFVGIWGMGGTGKTTIAGEIFNKIAREYEGHYF 242

Query: 243 ACNVRAAEETGRLDDLRKELLSKLLNDRNVK-NFQNISVNFQSKRLARKKVLIVFDDVNH 301
             NVR +E+ G L  +R EL SK+  + N+      I   F   R+ RKK+LIVFDDVN 
Sbjct: 243 LANVRESEKNGGLFRIRDELFSKITEEENLHIRTPRIGHPFIKDRICRKKILIVFDDVND 302

Query: 302 PRQIELLIGRLDRFASGSQVIITTRDKQVLTNCEVDHIYQMKELVHADAHKLFTQCAFRG 361
             QIE+L+G  + F  GS++I+T+RDKQVL     D I++++ L H +A  LF+  AF+ 
Sbjct: 303 VDQIEMLLGGCESFGPGSRIILTSRDKQVLKK-YADKIFEVEGLNHREALHLFSLHAFKD 361

Query: 362 DHLDAGYTELAHKALKYAQGVPLALKVLGCYLCGRSKEEWESAMRKLEIVPHMEIQEVLK 421
           +     Y EL+ +A+ YA+G PLALKVLG  L GR+ +EWESA+ K+E +   ++  VL+
Sbjct: 362 NQPPYNYMELSVRAINYAKGNPLALKVLGSSLFGRTTKEWESALNKVEKLTRQKVHSVLR 421

Query: 422 ISYDSLDDSQK------------------------------------------------- 432
           ISY++LD  +K                                                 
Sbjct: 422 ISYEALDSEEKSIFLDIACFFRGHRVDFVKRILDGCGFKTDIGFSVLIDRCLIKISDDKV 481

Query: 433 RMHDLLRAMGREIVRKESIVDPGKRSRLWHDEDIYEVLKKNTGTEAIKDISLNMSD-NEK 491
            MHDLL+ M  ++VRKES+ + G +SRLW  +D+Y+VL  N GT  ++ I L++S   E 
Sbjct: 482 EMHDLLQEMAHDVVRKESLDELGGQSRLWSPKDVYQVLTNNLGTGKVEGIFLDVSKIREI 541

Query: 492 EIFARTFSTMTNLGHLKAYESREIKDVMSDLEVVPFPEVYAKNLVSLKMWDG------KV 545
           E+ +     M  L  LK Y S     V   + +    E  ++ L  L  WDG        
Sbjct: 542 ELSSTALGRMYKLRLLKIYNSE--AGVKCRVHLPHGLESLSEELRYLH-WDGYPLTSLPS 598

Query: 546 KERWDDVQKVDVECDRLDSHARAYWNHTDLKQLRLKLAEVRYLLQDAVRCGADQNLNI 603
             R  ++ ++++ C +++   R   N  +LK + L   E    L D  +    + LN+
Sbjct: 599 NFRPQNLVEINLSCSKVNRLWRGDQNLVNLKDVNLSNCEHITFLPDLSKARNLERLNL 656




Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|255561496|ref|XP_002521758.1| TMV resistance protein N, putative [Ricinus communis] gi|223538971|gb|EEF40568.1| TMV resistance protein N, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|356550897|ref|XP_003543819.1| PREDICTED: TMV resistance protein N-like [Glycine max] Back     alignment and taxonomy information
>gi|255569048|ref|XP_002525493.1| leucine-rich repeat-containing protein, putative [Ricinus communis] gi|223535172|gb|EEF36851.1| leucine-rich repeat-containing protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|255564976|ref|XP_002523481.1| TMV resistance protein N, putative [Ricinus communis] gi|223537309|gb|EEF38940.1| TMV resistance protein N, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|255537139|ref|XP_002509636.1| leucine-rich repeat-containing protein, putative [Ricinus communis] gi|223549535|gb|EEF51023.1| leucine-rich repeat-containing protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|224127754|ref|XP_002329169.1| tir-nbs-lrr resistance protein [Populus trichocarpa] gi|222870950|gb|EEF08081.1| tir-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|297739493|emb|CBI29675.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|317106744|dbj|BAJ53239.1| JHS03A10.2 [Jatropha curcas] Back     alignment and taxonomy information
>gi|255555357|ref|XP_002518715.1| leucine-rich repeat-containing protein, putative [Ricinus communis] gi|223542096|gb|EEF43640.1| leucine-rich repeat-containing protein, putative [Ricinus communis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1866
TAIR|locus:21759911294 AT5G17680 [Arabidopsis thalian 0.227 0.328 0.360 5.8e-84
UNIPROTKB|Q403921144 N "TMV resistance protein N" [ 0.228 0.372 0.386 2e-81
TAIR|locus:2151516858 AT5G46490 [Arabidopsis thalian 0.227 0.494 0.350 1.2e-80
TAIR|locus:2161513780 AT5G17970 [Arabidopsis thalian 0.229 0.55 0.328 4.8e-80
TAIR|locus:21361081095 AT4G11170 [Arabidopsis thalian 0.226 0.385 0.376 2.3e-79
TAIR|locus:21181061219 AT4G12010 [Arabidopsis thalian 0.226 0.346 0.384 1.5e-78
TAIR|locus:21674571191 AT5G36930 [Arabidopsis thalian 0.221 0.346 0.379 1.6e-78
TAIR|locus:2146243900 AT5G18360 [Arabidopsis thalian 0.227 0.472 0.343 1.6e-77
TAIR|locus:21158701234 AT4G08450 [Arabidopsis thalian 0.224 0.338 0.382 9.2e-77
TAIR|locus:21704081139 AT5G46270 [Arabidopsis thalian 0.226 0.371 0.368 1.6e-75
TAIR|locus:2175991 AT5G17680 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 688 (247.2 bits), Expect = 5.8e-84, Sum P(4) = 5.8e-84
 Identities = 157/435 (36%), Positives = 249/435 (57%)

Query:     1 MASSSSSPPRNDKKMYDVFLSFRGEDTRDNFTSHLYSALCQNNVETFIDN-DLKRGDEIP 59
             + SSSSS      K  DVF+SFRGED R  F SHL+    +  ++ F D+ DL+RG  I 
Sbjct:     4 LPSSSSSSSSTVWKT-DVFVSFRGEDVRKTFVSHLFCEFDRMGIKAFRDDLDLQRGKSIS 62

Query:    60 ESLLGTIEASTISIIIFSEKYASSKWCLDELLKILECKRNYGQIVIPVFYRVDPSHVRKQ 119
               L+  I+ S  +I++ S  YA+S WCLDELLKI+EC ++    ++P+FY VDPS VR+Q
Sbjct:    63 PELIDAIKGSRFAIVVVSRNYAASSWCLDELLKIMECNKD---TIVPIFYEVDPSDVRRQ 119

Query:   120 IGSFGDSFFMLEERFPYKMRNWRSALTEAADLSGFDSCVIRPESRLVADIANEVLERLDD 179
              GSFG+      ++   K+  W+ AL + A +SG DS     +S+L+  I  ++ ++L  
Sbjct:   120 RGSFGEDVESHSDK--EKVGKWKEALKKLAAISGEDSRNW-DDSKLIKKIVKDISDKLVS 176

Query:   180 TFQSESKDLIGVEWRIKEIESLLRTGSAGVYKLXXXXXXXXXXXXXXXXVFNKISRHFEG 239
             T   +SK LIG+   +  ++S++      V  L                ++N++S  F+ 
Sbjct:   177 TSWDDSKGLIGMSSHMDFLQSMISIVDKDVRMLGIWGMGGVGKTTIAKYLYNQLSGQFQV 236

Query:   240 SYFACNVRAAEETGRLDDLRKELLSKLLNDRNVKNFQNISV-NFQSKRLARKKVLIVFDD 298
               F  NV+       +  L+ E L ++  +R+ + + ++S  N   +R   K V IV DD
Sbjct:   237 HCFMENVKEVCNRYGVRRLQVEFLCRMFQERDKEAWSSVSCCNIIKERFRHKMVFIVLDD 296

Query:   299 VNHPRQIELLIGRLDRFASGSQVIITTRDKQVLTNCEVDHIYQMKELVHADAHKLFTQCA 358
             V+   Q+  L+     F  GS++I+TTRD+ +L +  ++ +Y++K L   +A +LF   A
Sbjct:   297 VDRSEQLNELVKETGWFGPGSRIIVTTRDRHLLLSHGINLVYKVKCLPKKEALQLFCNYA 356

Query:   359 FRGDH-LDAGYTELAHKALKYAQGVPLALKVLGCYLCGRSKEEWESAMRKLEIVPHMEIQ 417
             FR +  L  G+ EL+ +A+ YA G+PLAL+VLG +L  RS+ EWES + +L+  PH +I 
Sbjct:   357 FREEIILPHGFEELSVQAVNYASGLPLALRVLGSFLYRRSQIEWESTLARLKTYPHSDIM 416

Query:   418 EVLKISYDSLDDSQK 432
             EVL++SYD LD+ +K
Sbjct:   417 EVLRVSYDGLDEQEK 431


GO:0005622 "intracellular" evidence=IEA
GO:0006952 "defense response" evidence=IEA;ISS
GO:0007165 "signal transduction" evidence=IEA
GO:0043531 "ADP binding" evidence=IEA
UNIPROTKB|Q40392 N "TMV resistance protein N" [Nicotiana glutinosa (taxid:35889)] Back     alignment and assigned GO terms
TAIR|locus:2151516 AT5G46490 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2161513 AT5G17970 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2136108 AT4G11170 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2118106 AT4G12010 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2167457 AT5G36930 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2146243 AT5G18360 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2115870 AT4G08450 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2170408 AT5G46270 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1866
PLN032101153 PLN03210, PLN03210, Resistant to P 1e-100
pfam00931285 pfam00931, NB-ARC, NB-ARC domain 7e-51
pfam01582135 pfam01582, TIR, TIR domain 3e-36
smart00255140 smart00255, TIR, Toll - interleukin 1 - resistance 2e-34
pfam00931285 pfam00931, NB-ARC, NB-ARC domain 2e-24
PLN03194187 PLN03194, PLN03194, putative disease resistance pr 2e-13
pfam00931285 pfam00931, NB-ARC, NB-ARC domain 6e-13
pfam13676102 pfam13676, TIR_2, TIR domain 4e-09
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 4e-08
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 8e-07
pfam13401124 pfam13401, AAA_22, AAA domain 6e-05
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 4e-04
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 5e-04
pfam01637223 pfam01637, Arch_ATPase, Archaeal ATPase 8e-04
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 0.001
pfam13191154 pfam13191, AAA_16, AAA ATPase domain 0.002
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 0.003
>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information
 Score =  350 bits (900), Expect = e-100
 Identities = 211/637 (33%), Positives = 333/637 (52%), Gaps = 91/637 (14%)

Query: 2   ASSSSSPPRNDKKMYDVFLSFRGEDTRDNFTSHLYSALCQNNVETFIDNDLKRGDEIPES 61
            +SSSS  RN   +YDVF SF GED R  F SH    L +  +  F DN+++R   +   
Sbjct: 1   MASSSSSSRN--WVYDVFPSFSGEDVRITFLSHFLKELDRKLIIAFKDNEIERSQSLDPE 58

Query: 62  LLGTIEASTISIIIFSEKYASSKWCLDELLKILECKRNYGQIVIPVFYRVDPSHVRKQIG 121
           L   I  S I++++FS+ YASS WCL+ELL+I+ CK   GQ+VIPVFY +DPSHVRKQ G
Sbjct: 59  LKQAIRDSRIAVVVFSKNYASSSWCLNELLEIVRCKEELGQLVIPVFYGLDPSHVRKQTG 118

Query: 122 SFGDSFFMLEERFPYKMRN-WRSALTEAADLSGFDSCVIRPESRLVADIANEVLERLDDT 180
            FG++F    +      +  W+ ALT+ A++ G+ S     E++++ +IAN+VL +L+ T
Sbjct: 119 DFGEAFEKTCQNKTEDEKIQWKQALTDVANILGYHSQNWPNEAKMIEEIANDVLGKLNLT 178

Query: 181 FQSESKDLIGVEWRIKEIESLLRTGSAGVYKLGIWGIGGIGKTTIAGAVFNKISRHFEGS 240
             ++ +D +G+E  I ++ SLL   S  V  +GIWG  GIGKTTIA A+F+++SR F+ S
Sbjct: 179 PSNDFEDFVGIEDHIAKMSSLLHLESEEVRMVGIWGSSGIGKTTIARALFSRLSRQFQSS 238

Query: 241 YFACNVRAAE-----ETGRLDD------LRKELLSKLLNDRNVKNFQNISVNFQSKRLAR 289
            F      ++      +   DD      L++  LS++L+ +++K +    +    +RL  
Sbjct: 239 VFIDRAFISKSMEIYSSANPDDYNMKLHLQRAFLSEILDKKDIKIYH---LGAMEERLKH 295

Query: 290 KKVLIVFDDVNHPRQIELLIGRLDRFASGSQVIITTRDKQVLTNCEVDHIYQMKELVHAD 349
           +KVLI  DD++    ++ L G+   F SGS++I+ T+DK  L    +DHIY++    +  
Sbjct: 296 RKVLIFIDDLDDQDVLDALAGQTQWFGSGSRIIVITKDKHFLRAHGIDHIYEVCLPSNEL 355

Query: 350 AHKLFTQCAFRGDHLDAGYTELAHKALKYAQGVPLALKVLGCYLCGRSKEEWESAMRKLE 409
           A ++F + AF+ +    G+ ELA +    A  +PL L VLG YL GR KE+W   + +L 
Sbjct: 356 ALEMFCRSAFKKNSPPDGFMELASEVALRAGNLPLGLNVLGSYLRGRDKEDWMDMLPRLR 415

Query: 410 IVPHMEIQEVLKISYDSLDDSQKR------------------------------------ 433
                +I++ L++SYD L++ + +                                    
Sbjct: 416 NGLDGKIEKTLRVSYDGLNNKKDKAIFRHIACLFNGEKVNDIKLLLANSDLDVNIGLKNL 475

Query: 434 --------------MHDLLRAMGREIVRKESIVDPGKRSRLWHDEDIYEVLKKNTGTEAI 479
                         MH LL+ MG+EIVR +S  +PG+R  L   +DI +VL+ NTGT+ +
Sbjct: 476 VDKSLIHVREDIVEMHSLLQEMGKEIVRAQS-NEPGEREFLVDAKDICDVLEDNTGTKKV 534

Query: 480 KDISLNMSD-NEKEIFARTFSTMTNLGHLKAYESR--EIKDVM-----------SDLEVV 525
             I+L++ + +E  I    F  M NL  LK Y  +  + K+V              L ++
Sbjct: 535 LGITLDIDEIDELHIHENAFKGMRNLLFLKFYTKKWDQKKEVRWHLPEGFDYLPPKLRLL 594

Query: 526 PF---------PEVYAKNLVSLKMWDGKVKERWDDVQ 553
            +              +NLV L+M   K+++ WD V 
Sbjct: 595 RWDKYPLRCMPSNFRPENLVKLQMQGSKLEKLWDGVH 631


syringae 6; Provisional. Length = 1153

>gnl|CDD|216202 pfam00931, NB-ARC, NB-ARC domain Back     alignment and domain information
>gnl|CDD|216585 pfam01582, TIR, TIR domain Back     alignment and domain information
>gnl|CDD|214587 smart00255, TIR, Toll - interleukin 1 - resistance Back     alignment and domain information
>gnl|CDD|216202 pfam00931, NB-ARC, NB-ARC domain Back     alignment and domain information
>gnl|CDD|215626 PLN03194, PLN03194, putative disease resistance protein; Provisional Back     alignment and domain information
>gnl|CDD|216202 pfam00931, NB-ARC, NB-ARC domain Back     alignment and domain information
>gnl|CDD|222311 pfam13676, TIR_2, TIR domain Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|222104 pfam13401, AAA_22, AAA domain Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|216619 pfam01637, Arch_ATPase, Archaeal ATPase Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|221970 pfam13191, AAA_16, AAA ATPase domain Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 1866
PLN032101153 Resistant to P. syringae 6; Provisional 100.0
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 100.0
PLN03210 1153 Resistant to P. syringae 6; Provisional 100.0
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 100.0
PF00931287 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is 100.0
PLN03194187 putative disease resistance protein; Provisional 100.0
PF00931287 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is 100.0
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.84
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.84
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.75
PF01582141 TIR: TIR domain; InterPro: IPR000157 In Drosophila 99.75
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.75
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.71
smart00255140 TIR Toll - interleukin 1 - resistance. 99.7
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.63
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.59
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.56
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.5
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.43
KOG0617264 consensus Ras suppressor protein (contains leucine 99.41
PF13676102 TIR_2: TIR domain; PDB: 3H16_B 3UB4_A 2Y92_A 3UB3_ 99.36
KOG0617264 consensus Ras suppressor protein (contains leucine 99.33
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.1
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.08
PRK15370754 E3 ubiquitin-protein ligase SlrP; Provisional 99.08
PRK15370754 E3 ubiquitin-protein ligase SlrP; Provisional 98.96
PRK04841903 transcriptional regulator MalT; Provisional 98.92
PRK00411394 cdc6 cell division control protein 6; Reviewed 98.85
KOG4237498 consensus Extracellular matrix protein slit, conta 98.83
PF01637234 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 98.8
PRK04841903 transcriptional regulator MalT; Provisional 98.73
PF05729166 NACHT: NACHT domain 98.73
KOG4237498 consensus Extracellular matrix protein slit, conta 98.71
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 98.69
TIGR03015269 pepcterm_ATPase putative secretion ATPase, PEP-CTE 98.68
PRK00411394 cdc6 cell division control protein 6; Reviewed 98.64
TIGR02928365 orc1/cdc6 family replication initiation protein. M 98.62
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.6
PF01637234 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 98.58
COG2256436 MGS1 ATPase related to the helicase subunit of the 98.56
TIGR00635305 ruvB Holliday junction DNA helicase, RuvB subunit. 98.53
PRK00080328 ruvB Holliday junction DNA helicase RuvB; Reviewed 98.51
TIGR03015269 pepcterm_ATPase putative secretion ATPase, PEP-CTE 98.51
PF05729166 NACHT: NACHT domain 98.49
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 98.47
TIGR02928365 orc1/cdc6 family replication initiation protein. M 98.44
PRK06893229 DNA replication initiation factor; Validated 98.42
TIGR00635305 ruvB Holliday junction DNA helicase, RuvB subunit. 98.37
COG2256436 MGS1 ATPase related to the helicase subunit of the 98.36
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.35
COG2909894 MalT ATP-dependent transcriptional regulator [Tran 98.32
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 98.31
PRK13342413 recombination factor protein RarA; Reviewed 98.28
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.27
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 98.27
PRK00080328 ruvB Holliday junction DNA helicase RuvB; Reviewed 98.27
PRK06893229 DNA replication initiation factor; Validated 98.21
KOG3678832 consensus SARM protein (with sterile alpha and arm 98.18
PRK07471365 DNA polymerase III subunit delta'; Validated 98.17
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 98.16
KOG4341483 consensus F-box protein containing LRR [General fu 98.16
PRK14949944 DNA polymerase III subunits gamma and tau; Provisi 98.16
PRK07003830 DNA polymerase III subunits gamma and tau; Validat 98.15
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.14
PRK14961363 DNA polymerase III subunits gamma and tau; Provisi 98.13
PLN03150623 hypothetical protein; Provisional 98.13
PRK12402337 replication factor C small subunit 2; Reviewed 98.12
PF05496233 RuvB_N: Holliday junction DNA helicase ruvB N-term 98.12
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.1
TIGR03420226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Me 98.1
PF0772520 LRR_3: Leucine Rich Repeat; InterPro: IPR011713 Le 98.09
PRK12323700 DNA polymerase III subunits gamma and tau; Provisi 98.08
COG3903414 Predicted ATPase [General function prediction only 98.08
PRK14960702 DNA polymerase III subunits gamma and tau; Provisi 98.07
PLN03025319 replication factor C subunit; Provisional 98.07
PRK14963504 DNA polymerase III subunits gamma and tau; Provisi 98.06
PRK13342413 recombination factor protein RarA; Reviewed 98.06
PF13173128 AAA_14: AAA domain 98.05
TIGR01242364 26Sp45 26S proteasome subunit P45 family. Many pro 98.04
PF13191185 AAA_16: AAA ATPase domain; PDB: 2V1U_A. 98.02
PRK09112351 DNA polymerase III subunit delta'; Validated 98.01
PRK04195482 replication factor C large subunit; Provisional 98.01
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.0
PTZ00202550 tuzin; Provisional 97.99
PRK14956484 DNA polymerase III subunits gamma and tau; Provisi 97.99
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 97.99
KOG2028554 consensus ATPase related to the helicase subunit o 97.99
PRK07994647 DNA polymerase III subunits gamma and tau; Validat 97.98
PRK14957546 DNA polymerase III subunits gamma and tau; Provisi 97.98
COG2909894 MalT ATP-dependent transcriptional regulator [Tran 97.97
PRK08691709 DNA polymerase III subunits gamma and tau; Validat 97.97
PRK00440319 rfc replication factor C small subunit; Reviewed 97.97
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 97.95
PRK05564313 DNA polymerase III subunit delta'; Validated 97.95
PRK08727233 hypothetical protein; Validated 97.94
PRK13341725 recombination factor protein RarA/unknown domain f 97.93
cd00009151 AAA The AAA+ (ATPases Associated with a wide varie 97.93
PLN03150623 hypothetical protein; Provisional 97.93
PF13173128 AAA_14: AAA domain 97.92
PTZ001121164 origin recognition complex 1 protein; Provisional 97.92
TIGR00678188 holB DNA polymerase III, delta' subunit. At positi 97.92
PRK07940394 DNA polymerase III subunit delta'; Validated 97.91
PRK14962472 DNA polymerase III subunits gamma and tau; Provisi 97.89
cd01128249 rho_factor Transcription termination factor rho is 97.89
TIGR03420226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Me 97.88
PF13401131 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S 97.85
PRK14964491 DNA polymerase III subunits gamma and tau; Provisi 97.84
PRK14951618 DNA polymerase III subunits gamma and tau; Provisi 97.84
PRK06645507 DNA polymerase III subunits gamma and tau; Validat 97.84
COG3899849 Predicted ATPase [General function prediction only 97.82
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 97.81
PRK08903227 DnaA regulatory inactivator Hda; Validated 97.8
PRK14958509 DNA polymerase III subunits gamma and tau; Provisi 97.79
KOG4341483 consensus F-box protein containing LRR [General fu 97.79
PRK09376416 rho transcription termination factor Rho; Provisio 97.79
KOG2028554 consensus ATPase related to the helicase subunit o 97.78
PRK14955397 DNA polymerase III subunits gamma and tau; Provisi 97.78
PRK14969527 DNA polymerase III subunits gamma and tau; Provisi 97.77
PRK05896605 DNA polymerase III subunits gamma and tau; Validat 97.76
TIGR02397355 dnaX_nterm DNA polymerase III, subunit gamma and t 97.75
PF13401131 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S 97.74
PRK03992389 proteasome-activating nucleotidase; Provisional 97.74
PRK08084235 DNA replication initiation factor; Provisional 97.73
TIGR02903615 spore_lon_C ATP-dependent protease, Lon family. Me 97.71
PRK05564313 DNA polymerase III subunit delta'; Validated 97.7
PRK05642234 DNA replication initiation factor; Validated 97.69
PRK09087226 hypothetical protein; Validated 97.69
cd01128249 rho_factor Transcription termination factor rho is 97.68
cd00009151 AAA The AAA+ (ATPases Associated with a wide varie 97.66
TIGR03689512 pup_AAA proteasome ATPase. In the Actinobacteria, 97.65
PRK09376416 rho transcription termination factor Rho; Provisio 97.65
PRK14970367 DNA polymerase III subunits gamma and tau; Provisi 97.64
PRK14952584 DNA polymerase III subunits gamma and tau; Provisi 97.63
COG1474366 CDC6 Cdc6-related protein, AAA superfamily ATPase 97.63
PRK07764824 DNA polymerase III subunits gamma and tau; Validat 97.63
PF00308219 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013 97.62
PRK09111598 DNA polymerase III subunits gamma and tau; Validat 97.58
PRK04195482 replication factor C large subunit; Provisional 97.58
PHA02544316 44 clamp loader, small subunit; Provisional 97.57
PRK14087450 dnaA chromosomal replication initiation protein; P 97.57
PRK14954620 DNA polymerase III subunits gamma and tau; Provisi 97.56
PRK09087226 hypothetical protein; Validated 97.56
TIGR02881261 spore_V_K stage V sporulation protein K. Members o 97.56
PRK15386426 type III secretion protein GogB; Provisional 97.55
PRK06305451 DNA polymerase III subunits gamma and tau; Validat 97.55
PRK07003830 DNA polymerase III subunits gamma and tau; Validat 97.54
PRK07133725 DNA polymerase III subunits gamma and tau; Validat 97.54
PTZ001121164 origin recognition complex 1 protein; Provisional 97.54
PRK15386 426 type III secretion protein GogB; Provisional 97.54
PRK14959624 DNA polymerase III subunits gamma and tau; Provisi 97.52
PRK14949944 DNA polymerase III subunits gamma and tau; Provisi 97.52
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 97.52
PRK14088440 dnaA chromosomal replication initiation protein; P 97.51
PRK13341725 recombination factor protein RarA/unknown domain f 97.5
PRK08451535 DNA polymerase III subunits gamma and tau; Validat 97.5
PRK05707328 DNA polymerase III subunit delta'; Validated 97.48
PRK14963504 DNA polymerase III subunits gamma and tau; Provisi 97.48
TIGR00767415 rho transcription termination factor Rho. Members 97.47
PLN03025319 replication factor C subunit; Provisional 97.46
PRK12402337 replication factor C small subunit 2; Reviewed 97.46
TIGR02903615 spore_lon_C ATP-dependent protease, Lon family. Me 97.44
PRK14953486 DNA polymerase III subunits gamma and tau; Provisi 97.43
COG3903414 Predicted ATPase [General function prediction only 97.42
PRK08727233 hypothetical protein; Validated 97.41
TIGR02639731 ClpA ATP-dependent Clp protease ATP-binding subuni 97.41
COG1222406 RPT1 ATP-dependent 26S proteasome regulatory subun 97.4
PF08937130 DUF1863: MTH538 TIR-like domain (DUF1863); InterPr 97.39
TIGR00362405 DnaA chromosomal replication initiator protein Dna 97.39
PRK12323700 DNA polymerase III subunits gamma and tau; Provisi 97.39
PRK14971614 DNA polymerase III subunits gamma and tau; Provisi 97.38
PRK14950585 DNA polymerase III subunits gamma and tau; Provisi 97.37
PRK06620214 hypothetical protein; Validated 97.36
PRK00149450 dnaA chromosomal replication initiation protein; R 97.36
PRK08084235 DNA replication initiation factor; Provisional 97.36
PRK14961363 DNA polymerase III subunits gamma and tau; Provisi 97.36
TIGR00767415 rho transcription termination factor Rho. Members 97.34
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.34
PRK14960702 DNA polymerase III subunits gamma and tau; Provisi 97.33
COG1474366 CDC6 Cdc6-related protein, AAA superfamily ATPase 97.33
TIGR03345852 VI_ClpV1 type VI secretion ATPase, ClpV1 family. M 97.32
PRK14957546 DNA polymerase III subunits gamma and tau; Provisi 97.32
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.32
PRK05563559 DNA polymerase III subunits gamma and tau; Validat 97.3
TIGR02880284 cbbX_cfxQ probable Rubsico expression protein CbbX 97.3
PTZ00361438 26 proteosome regulatory subunit 4-like protein; P 97.29
PRK06647563 DNA polymerase III subunits gamma and tau; Validat 97.28
PTZ00202550 tuzin; Provisional 97.26
PRK14948620 DNA polymerase III subunits gamma and tau; Provisi 97.25
PTZ00454398 26S protease regulatory subunit 6B-like protein; P 97.25
PF13191185 AAA_16: AAA ATPase domain; PDB: 2V1U_A. 97.25
PRK00440319 rfc replication factor C small subunit; Reviewed 97.23
PRK12422445 chromosomal replication initiation protein; Provis 97.23
KOG0989346 consensus Replication factor C, subunit RFC4 [Repl 97.22
PRK06645507 DNA polymerase III subunits gamma and tau; Validat 97.21
TIGR01242364 26Sp45 26S proteasome subunit P45 family. Many pro 97.21
PRK14965576 DNA polymerase III subunits gamma and tau; Provisi 97.17
PRK14956484 DNA polymerase III subunits gamma and tau; Provisi 97.16
PRK14962472 DNA polymerase III subunits gamma and tau; Provisi 97.15
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 97.15
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.14
PF05496233 RuvB_N: Holliday junction DNA helicase ruvB N-term 97.11
PRK07994647 DNA polymerase III subunits gamma and tau; Validat 97.1
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 97.1
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.09
CHL00181287 cbbX CbbX; Provisional 97.07
PRK14086617 dnaA chromosomal replication initiation protein; P 97.07
TIGR00678188 holB DNA polymerase III, delta' subunit. At positi 97.06
CHL00095821 clpC Clp protease ATP binding subunit 97.03
PRK10865857 protein disaggregation chaperone; Provisional 97.02
PF14516331 AAA_35: AAA-like domain 97.01
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 97.0
PRK07399314 DNA polymerase III subunit delta'; Validated 97.0
PRK14955397 DNA polymerase III subunits gamma and tau; Provisi 96.99
PRK14958509 DNA polymerase III subunits gamma and tau; Provisi 96.99
PF05621302 TniB: Bacterial TniB protein; InterPro: IPR008868 96.99
PRK07940394 DNA polymerase III subunit delta'; Validated 96.98
COG3899849 Predicted ATPase [General function prediction only 96.98
PRK14087450 dnaA chromosomal replication initiation protein; P 96.97
CHL00176638 ftsH cell division protein; Validated 96.97
PRK08116268 hypothetical protein; Validated 96.97
PRK08691709 DNA polymerase III subunits gamma and tau; Validat 96.96
PF00004132 AAA: ATPase family associated with various cellula 96.95
PRK08769319 DNA polymerase III subunit delta'; Validated 96.95
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 96.94
PF05621302 TniB: Bacterial TniB protein; InterPro: IPR008868 96.94
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 96.91
PRK05642234 DNA replication initiation factor; Validated 96.9
PRK09112351 DNA polymerase III subunit delta'; Validated 96.9
PF00308219 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013 96.88
TIGR01241495 FtsH_fam ATP-dependent metalloprotease FtsH. HflB( 96.87
PRK14951618 DNA polymerase III subunits gamma and tau; Provisi 96.87
PRK08058329 DNA polymerase III subunit delta'; Validated 96.86
TIGR02397355 dnaX_nterm DNA polymerase III, subunit gamma and t 96.84
PRK14964491 DNA polymerase III subunits gamma and tau; Provisi 96.82
PRK07471365 DNA polymerase III subunit delta'; Validated 96.8
TIGR03346852 chaperone_ClpB ATP-dependent chaperone ClpB. Membe 96.8
PRK11034758 clpA ATP-dependent Clp protease ATP-binding subuni 96.8
PRK06090319 DNA polymerase III subunit delta'; Validated 96.78
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 96.78
PRK05896605 DNA polymerase III subunits gamma and tau; Validat 96.76
KOG2227529 consensus Pre-initiation complex, subunit CDC6, AA 96.76
PRK14969527 DNA polymerase III subunits gamma and tau; Provisi 96.75
PRK08903227 DnaA regulatory inactivator Hda; Validated 96.74
cd01133274 F1-ATPase_beta F1 ATP synthase beta subunit, nucle 96.73
smart00382148 AAA ATPases associated with a variety of cellular 96.72
PRK07993334 DNA polymerase III subunit delta'; Validated 96.72
COG1373398 Predicted ATPase (AAA+ superfamily) [General funct 96.7
KOG2543438 consensus Origin recognition complex, subunit 5 [R 96.68
KOG2982418 consensus Uncharacterized conserved protein [Funct 96.67
PRK14959624 DNA polymerase III subunits gamma and tau; Provisi 96.64
TIGR02880284 cbbX_cfxQ probable Rubsico expression protein CbbX 96.6
PRK07764824 DNA polymerase III subunits gamma and tau; Validat 96.58
PRK09111598 DNA polymerase III subunits gamma and tau; Validat 96.58
TIGR03345852 VI_ClpV1 type VI secretion ATPase, ClpV1 family. M 96.58
COG1373398 Predicted ATPase (AAA+ superfamily) [General funct 96.58
PRK08181269 transposase; Validated 96.56
PRK12377248 putative replication protein; Provisional 96.56
PRK14954620 DNA polymerase III subunits gamma and tau; Provisi 96.55
TIGR00602637 rad24 checkpoint protein rad24. This family is bas 96.55
PRK06620214 hypothetical protein; Validated 96.54
PRK14950585 DNA polymerase III subunits gamma and tau; Provisi 96.54
PLN00020413 ribulose bisphosphate carboxylase/oxygenase activa 96.52
CHL00195489 ycf46 Ycf46; Provisional 96.52
KOG0731774 consensus AAA+-type ATPase containing the peptidas 96.52
PF13177162 DNA_pol3_delta2: DNA polymerase III, delta subunit 96.51
KOG2227529 consensus Pre-initiation complex, subunit CDC6, AA 96.5
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 96.5
KOG2543438 consensus Origin recognition complex, subunit 5 [R 96.49
PRK14970367 DNA polymerase III subunits gamma and tau; Provisi 96.48
PRK06871325 DNA polymerase III subunit delta'; Validated 96.47
COG0593408 DnaA ATPase involved in DNA replication initiation 96.46
PRK07952244 DNA replication protein DnaC; Validated 96.46
PRK11331459 5-methylcytosine-specific restriction enzyme subun 96.46
TIGR01243733 CDC48 AAA family ATPase, CDC48 subfamily. This sub 96.45
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 96.42
TIGR03689512 pup_AAA proteasome ATPase. In the Actinobacteria, 96.42
TIGR01243733 CDC48 AAA family ATPase, CDC48 subfamily. This sub 96.42
PRK10536262 hypothetical protein; Provisional 96.4
PRK08451535 DNA polymerase III subunits gamma and tau; Validat 96.4
PRK03992389 proteasome-activating nucleotidase; Provisional 96.39
PRK14088440 dnaA chromosomal replication initiation protein; P 96.39
PHA02544316 44 clamp loader, small subunit; Provisional 96.38
TIGR02639731 ClpA ATP-dependent Clp protease ATP-binding subuni 96.38
CHL00181287 cbbX CbbX; Provisional 96.38
COG2255332 RuvB Holliday junction resolvasome, helicase subun 96.37
TIGR02881261 spore_V_K stage V sporulation protein K. Members o 96.37
PRK14952584 DNA polymerase III subunits gamma and tau; Provisi 96.36
PRK09183259 transposase/IS protein; Provisional 96.35
KOG0730693 consensus AAA+-type ATPase [Posttranslational modi 96.34
PF08357150 SEFIR: SEFIR domain; InterPro: IPR013568 This doma 96.33
PRK06921266 hypothetical protein; Provisional 96.32
TIGR02640262 gas_vesic_GvpN gas vesicle protein GvpN. Members o 96.31
TIGR00362405 DnaA chromosomal replication initiator protein Dna 96.3
PRK06305451 DNA polymerase III subunits gamma and tau; Validat 96.28
KOG0989346 consensus Replication factor C, subunit RFC4 [Repl 96.28
PRK14086617 dnaA chromosomal replication initiation protein; P 96.28
PF05673249 DUF815: Protein of unknown function (DUF815); Inte 96.27
TIGR03346852 chaperone_ClpB ATP-dependent chaperone ClpB. Membe 96.27
smart00382148 AAA ATPases associated with a variety of cellular 96.25
KOG0744423 consensus AAA+-type ATPase [Posttranslational modi 96.25
CHL00176638 ftsH cell division protein; Validated 96.24
PRK14953486 DNA polymerase III subunits gamma and tau; Provisi 96.23
PRK11331459 5-methylcytosine-specific restriction enzyme subun 96.22
PRK08699325 DNA polymerase III subunit delta'; Validated 96.21
PF04665241 Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 96.2
PRK06526254 transposase; Provisional 96.18
PRK00149450 dnaA chromosomal replication initiation protein; R 96.14
PRK12422445 chromosomal replication initiation protein; Provis 96.13
KOG0741744 consensus AAA+-type ATPase [Posttranslational modi 96.12
PRK14948620 DNA polymerase III subunits gamma and tau; Provisi 96.09
COG0542786 clpA ATP-binding subunits of Clp protease and DnaK 96.08
PRK14971614 DNA polymerase III subunits gamma and tau; Provisi 96.07
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 96.05
PRK10865857 protein disaggregation chaperone; Provisional 96.03
COG1223368 Predicted ATPase (AAA+ superfamily) [General funct 96.03
PF01695178 IstB_IS21: IstB-like ATP binding protein; InterPro 96.03
KOG0733802 consensus Nuclear AAA ATPase (VCP subfamily) [Post 96.01
KOG0728404 consensus 26S proteasome regulatory complex, ATPas 96.0
PRK08118167 topology modulation protein; Reviewed 95.98
PRK07133725 DNA polymerase III subunits gamma and tau; Validat 95.96
PRK12608380 transcription termination factor Rho; Provisional 95.95
PRK06647563 DNA polymerase III subunits gamma and tau; Validat 95.93
PF14516331 AAA_35: AAA-like domain 95.92
PRK13531498 regulatory ATPase RavA; Provisional 95.92
KOG0733802 consensus Nuclear AAA ATPase (VCP subfamily) [Post 95.9
PF00004132 AAA: ATPase family associated with various cellula 95.88
PRK10536262 hypothetical protein; Provisional 95.88
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 95.86
CHL00095821 clpC Clp protease ATP binding subunit 95.84
COG2812515 DnaX DNA polymerase III, gamma/tau subunits [DNA r 95.83
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 95.77
COG0593408 DnaA ATPase involved in DNA replication initiation 95.77
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 95.72
PTZ00454398 26S protease regulatory subunit 6B-like protein; P 95.72
TIGR01241495 FtsH_fam ATP-dependent metalloprotease FtsH. HflB( 95.68
TIGR00602637 rad24 checkpoint protein rad24. This family is bas 95.64
COG3267269 ExeA Type II secretory pathway, component ExeA (pr 95.63
KOG0735952 consensus AAA+-type ATPase [Posttranslational modi 95.62
cd01394218 radB RadB. The archaeal protein radB shares simila 95.61
PRK06964342 DNA polymerase III subunit delta'; Validated 95.61
COG0470325 HolB ATPase involved in DNA replication [DNA repli 95.59
PRK06835329 DNA replication protein DnaC; Validated 95.56
PRK09361225 radB DNA repair and recombination protein RadB; Pr 95.55
KOG0729435 consensus 26S proteasome regulatory complex, ATPas 95.55
PTZ00361438 26 proteosome regulatory subunit 4-like protein; P 95.54
KOG0741744 consensus AAA+-type ATPase [Posttranslational modi 95.53
PF04665241 Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 95.53
PRK08118167 topology modulation protein; Reviewed 95.49
PF05673249 DUF815: Protein of unknown function (DUF815); Inte 95.48
PRK14974336 cell division protein FtsY; Provisional 95.46
COG3267269 ExeA Type II secretory pathway, component ExeA (pr 95.45
KOG0734752 consensus AAA+-type ATPase containing the peptidas 95.44
KOG2982418 consensus Uncharacterized conserved protein [Funct 95.43
PF02562205 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH 95.4
cd01131198 PilT Pilus retraction ATPase PilT. PilT is a nucle 95.37
KOG2228408 consensus Origin recognition complex, subunit 4 [R 95.36
PRK08939306 primosomal protein DnaI; Reviewed 95.35
PRK04132846 replication factor C small subunit; Provisional 95.32
PF13207121 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6 95.3
TIGR02237209 recomb_radB DNA repair and recombination protein R 95.26
cd01120165 RecA-like_NTPases RecA-like NTPases. This family i 95.24
smart00763361 AAA_PrkA PrkA AAA domain. This is a family of PrkA 95.22
PF00448196 SRP54: SRP54-type protein, GTPase domain; InterPro 95.18
PF10443431 RNA12: RNA12 protein; InterPro: IPR018850 Mitochon 95.16
PRK07399314 DNA polymerase III subunit delta'; Validated 95.15
PRK07261171 topology modulation protein; Provisional 95.14
PRK07261171 topology modulation protein; Provisional 95.12
PRK12608380 transcription termination factor Rho; Provisional 95.11
PRK14965576 DNA polymerase III subunits gamma and tau; Provisi 95.1
COG1618179 Predicted nucleotide kinase [Nucleotide transport 95.09
cd01121372 Sms Sms (bacterial radA) DNA repair protein. This 95.08
PRK04296190 thymidine kinase; Provisional 95.06
COG2607287 Predicted ATPase (AAA+ superfamily) [General funct 95.04
PRK05707328 DNA polymerase III subunit delta'; Validated 95.03
PRK00771437 signal recognition particle protein Srp54; Provisi 95.0
PF14532138 Sigma54_activ_2: Sigma-54 interaction domain; PDB: 95.0
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 95.0
KOG0727408 consensus 26S proteasome regulatory complex, ATPas 94.99
TIGR02902531 spore_lonB ATP-dependent protease LonB. Members of 94.96
PRK11034758 clpA ATP-dependent Clp protease ATP-binding subuni 94.94
PHA00729226 NTP-binding motif containing protein 94.93
PRK10787784 DNA-binding ATP-dependent protease La; Provisional 94.9
COG1066456 Sms Predicted ATP-dependent serine protease [Postt 94.9
PF13671143 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1 94.9
COG0542786 clpA ATP-binding subunits of Clp protease and DnaK 94.88
PRK05541176 adenylylsulfate kinase; Provisional 94.87
COG1484254 DnaC DNA replication protein [DNA replication, rec 94.86
PRK12724432 flagellar biosynthesis regulator FlhF; Provisional 94.85
PRK05563559 DNA polymerase III subunits gamma and tau; Validat 94.84
TIGR00064272 ftsY signal recognition particle-docking protein F 94.84
PRK08116268 hypothetical protein; Validated 94.82
PRK10733644 hflB ATP-dependent metalloprotease; Reviewed 94.81
KOG0735952 consensus AAA+-type ATPase [Posttranslational modi 94.75
PRK06696223 uridine kinase; Validated 94.73
KOG0736953 consensus Peroxisome assembly factor 2 containing 94.71
TIGR00763775 lon ATP-dependent protease La. This protein is ind 94.71
KOG1947482 consensus Leucine rich repeat proteins, some prote 94.56
PRK07667193 uridine kinase; Provisional 94.48
PRK08181269 transposase; Validated 94.48
PRK11608326 pspF phage shock protein operon transcriptional ac 94.46
KOG0739439 consensus AAA+-type ATPase [Posttranslational modi 94.45
PRK11889436 flhF flagellar biosynthesis regulator FlhF; Provis 94.43
KOG0726440 consensus 26S proteasome regulatory complex, ATPas 94.39
cd03221144 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is 94.39
COG0466782 Lon ATP-dependent Lon protease, bacterial type [Po 94.36
TIGR00416454 sms DNA repair protein RadA. The gene protuct code 94.28
cd03214180 ABC_Iron-Siderophores_B12_Hemin ABC transporters, 94.28
TIGR02237209 recomb_radB DNA repair and recombination protein R 94.28
cd01129264 PulE-GspE PulE/GspE The type II secretory pathway 94.28
KOG0731774 consensus AAA+-type ATPase containing the peptidas 94.21
COG0464494 SpoVK ATPases of the AAA+ class [Posttranslational 94.2
PRK05703424 flhF flagellar biosynthesis regulator FlhF; Valida 94.2
PRK06067234 flagellar accessory protein FlaH; Validated 94.15
cd01124187 KaiC KaiC is a circadian clock protein primarily f 94.02
TIGR00959428 ffh signal recognition particle protein. This mode 93.98
KOG2004906 consensus Mitochondrial ATP-dependent protease PIM 93.95
PRK09183259 transposase/IS protein; Provisional 93.94
KOG2035351 consensus Replication factor C, subunit RFC3 [Cell 93.9
PRK10867433 signal recognition particle protein; Provisional 93.88
PRK08533230 flagellar accessory protein FlaH; Reviewed 93.88
PRK09361225 radB DNA repair and recombination protein RadB; Pr 93.85
COG2255332 RuvB Holliday junction resolvasome, helicase subun 93.83
COG4608268 AppF ABC-type oligopeptide transport system, ATPas 93.8
CHL00195489 ycf46 Ycf46; Provisional 93.78
KOG0651388 consensus 26S proteasome regulatory complex, ATPas 93.77
cd01393226 recA_like RecA is a bacterial enzyme which has rol 93.76
PRK11823446 DNA repair protein RadA; Provisional 93.75
cd00544169 CobU Adenosylcobinamide kinase / adenosylcobinamid 93.73
PF13604196 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL 93.72
TIGR01359183 UMP_CMP_kin_fam UMP-CMP kinase family. This subfam 93.72
TIGR01425429 SRP54_euk signal recognition particle protein SRP5 93.64
cd03228171 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein 93.62
PF13207121 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6 93.62
PF13238129 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB 93.61
TIGR01420343 pilT_fam pilus retraction protein PilT. This model 93.59
PF01583156 APS_kinase: Adenylylsulphate kinase; InterPro: IPR 93.57
PRK06217183 hypothetical protein; Validated 93.5
PF07726131 AAA_3: ATPase family associated with various cellu 93.49
cd00983325 recA RecA is a bacterial enzyme which has roles in 93.47
cd01393226 recA_like RecA is a bacterial enzyme which has rol 93.42
cd03216163 ABC_Carb_Monos_I This family represents the domain 93.42
PF00448196 SRP54: SRP54-type protein, GTPase domain; InterPro 93.4
PRK08769319 DNA polymerase III subunit delta'; Validated 93.39
PRK15429686 formate hydrogenlyase transcriptional activator Fh 93.39
PRK09280463 F0F1 ATP synthase subunit beta; Validated 93.36
KOG0991333 consensus Replication factor C, subunit RFC2 [Repl 93.35
PRK12377248 putative replication protein; Provisional 93.34
COG0465596 HflB ATP-dependent Zn proteases [Posttranslational 93.32
COG1875436 NYN ribonuclease and ATPase of PhoH family domains 93.29
TIGR02012321 tigrfam_recA protein RecA. This model describes or 93.29
PRK06526254 transposase; Provisional 93.27
cd01133274 F1-ATPase_beta F1 ATP synthase beta subunit, nucle 93.26
cd03115173 SRP The signal recognition particle (SRP) mediates 93.22
PRK05541176 adenylylsulfate kinase; Provisional 93.22
cd00561159 CobA_CobO_BtuR ATP:corrinoid adenosyltransferase B 93.21
cd03223166 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cass 93.2
TIGR02974329 phageshock_pspF psp operon transcriptional activat 93.11
cd01123235 Rad51_DMC1_radA Rad51_DMC1_radA,B. This group of r 93.11
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 93.09
PF00485194 PRK: Phosphoribulokinase / Uridine kinase family; 93.08
cd01123235 Rad51_DMC1_radA Rad51_DMC1_radA,B. This group of r 93.01
cd01394218 radB RadB. The archaeal protein radB shares simila 92.94
PRK05800170 cobU adenosylcobinamide kinase/adenosylcobinamide- 92.93
cd03247178 ABCC_cytochrome_bd The CYD subfamily implicated in 92.93
PRK09354349 recA recombinase A; Provisional 92.91
cd01125239 repA Hexameric Replicative Helicase RepA. RepA is 92.88
PRK12597461 F0F1 ATP synthase subunit beta; Provisional 92.87
TIGR03574249 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal. Mem 92.84
TIGR03499282 FlhF flagellar biosynthetic protein FlhF. 92.83
PRK15455644 PrkA family serine protein kinase; Provisional 92.83
cd03222177 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibi 92.81
PRK14722374 flhF flagellar biosynthesis regulator FlhF; Provis 92.78
PRK05973237 replicative DNA helicase; Provisional 92.76
TIGR01039461 atpD ATP synthase, F1 beta subunit. The sequences 92.75
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 92.74
PRK08058329 DNA polymerase III subunit delta'; Validated 92.72
TIGR01817534 nifA Nif-specific regulatory protein. This model r 92.68
PRK12678672 transcription termination factor Rho; Provisional 92.63
TIGR02640262 gas_vesic_GvpN gas vesicle protein GvpN. Members o 92.61
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 92.57
PF10443431 RNA12: RNA12 protein; InterPro: IPR018850 Mitochon 92.57
PRK03839180 putative kinase; Provisional 92.47
COG1484254 DnaC DNA replication protein [DNA replication, rec 92.46
PRK05022509 anaerobic nitric oxide reductase transcription reg 92.44
COG0572218 Udk Uridine kinase [Nucleotide transport and metab 92.43
KOG0734752 consensus AAA+-type ATPase containing the peptidas 92.42
PTZ00301210 uridine kinase; Provisional 92.42
PF08423256 Rad51: Rad51; InterPro: IPR013632 This domain is f 92.38
PRK12723388 flagellar biosynthesis regulator FlhF; Provisional 92.37
PF10236309 DAP3: Mitochondrial ribosomal death-associated pro 92.37
PRK00625173 shikimate kinase; Provisional 92.36
KOG0652424 consensus 26S proteasome regulatory complex, ATPas 92.34
cd01122271 GP4d_helicase GP4d_helicase is a homohexameric 5'- 92.29
cd01858157 NGP_1 NGP-1. Autoantigen NGP-1 (Nucleolar G-protei 92.28
cd0201969 NK Nucleoside/nucleotide kinase (NK) is a protein 92.26
PRK06921266 hypothetical protein; Provisional 92.25
PRK08233182 hypothetical protein; Provisional 92.25
CHL002062281 ycf2 Ycf2; Provisional 92.25
KOG1514767 consensus Origin recognition complex, subunit 1, a 92.23
PRK04040188 adenylate kinase; Provisional 92.23
>PLN03210 Resistant to P Back     alignment and domain information
Probab=100.00  E-value=4.6e-88  Score=936.75  Aligned_cols=554  Identities=38%  Similarity=0.639  Sum_probs=502.2

Q ss_pred             CCCCCCCCCCCCCCCccEEEccccccccCchHHHHHHHHhhCCCceEeeCCCCCCCCCchhHHHHhhhcceEEEEeccCc
Q 000202            1 MASSSSSPPRNDKKMYDVFLSFRGEDTRDNFTSHLYSALCQNNVETFIDNDLKRGDEIPESLLGTIEASTISIIIFSEKY   80 (1866)
Q Consensus         1 m~~~~~~~~~~~~~~~dvFis~~~~d~~~~~~~~l~~~L~~~g~~~~~d~~~~~g~~~~~~~~~~i~~s~~~i~v~S~~y   80 (1866)
                      |||||||+   +.++||||+||||+|+|++|++||+++|+++||.+|+|+++++|+.|.+++.+||++||++|||||++|
T Consensus         1 ~~~~~~~~---~~~~~~vf~sfrg~d~r~~f~~hl~~~l~~~~i~~f~d~~~~~g~~~~~~l~~~i~~s~~~ivv~s~~y   77 (1153)
T PLN03210          1 MASSSSSS---RNWVYDVFPSFSGEDVRITFLSHFLKELDRKLIIAFKDNEIERSQSLDPELKQAIRDSRIAVVVFSKNY   77 (1153)
T ss_pred             CCCCCCCC---CCCCCcEEeeCCCcccccCHHHHHHHHHHHCCCeEEccCCccCCCcccHHHHHHHHhCeEEEEEecCCc
Confidence            67666554   569999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             ccchhhHHHHHHHHHHHhhCCCEEEEEEEEecCCcccccccchhhhHHHHhhcc-hhhhhhHHHHHHhhhccCCCccccc
Q 000202           81 ASSKWCLDELLKILECKRNYGQIVIPVFYRVDPSHVRKQIGSFGDSFFMLEERF-PYKMRNWRSALTEAADLSGFDSCVI  159 (1866)
Q Consensus        81 ~~s~~c~~El~~~~~~~~~~~~~v~pvf~~v~p~~vr~~~g~~~~~~~~~~~~~-~~~~~~wr~al~~~a~~~g~~~~~~  159 (1866)
                      |+|+||++||++|++|+++.+++|+||||+|+|+|||+|+|.||+||.+|+.+. .+++++||+||++||+++||++..+
T Consensus        78 a~s~wcl~el~~i~~~~~~~~~~v~pvfy~v~p~~v~~~~g~f~~~f~~~~~~~~~~~~~~w~~al~~~~~~~g~~~~~~  157 (1153)
T PLN03210         78 ASSSWCLNELLEIVRCKEELGQLVIPVFYGLDPSHVRKQTGDFGEAFEKTCQNKTEDEKIQWKQALTDVANILGYHSQNW  157 (1153)
T ss_pred             ccchHHHHHHHHHHHhhhhcCceEEEEEecccHHHHhhccchHHHHHHHHhcccchhHHHHHHHHHHHHhCcCceecCCC
Confidence            999999999999999999999999999999999999999999999999998764 4789999999999999999999888


Q ss_pred             CccchhhhhhHHHHhhcccccccccCCCceeehhhHHHHHHhhhcCCCCcEEEEEEecCCCchhHHHHHHHHhhhccccc
Q 000202          160 RPESRLVADIANEVLERLDDTFQSESKDLIGVEWRIKEIESLLRTGSAGVYKLGIWGIGGIGKTTIAGAVFNKISRHFEG  239 (1866)
Q Consensus       160 ~~e~~~i~~i~~~v~~~l~~~~~~~~~~~vGr~~~l~~l~~~L~~~~~~~~~i~I~G~gGiGKTtLA~~~~~~~~~~f~~  239 (1866)
                      ..|+++|++||++|.+++...++...+++|||+.+++++.++|..+.+++++|+||||||+||||||+++|+++..+|++
T Consensus       158 ~~E~~~i~~Iv~~v~~~l~~~~~~~~~~~vG~~~~l~~l~~lL~l~~~~~~vvgI~G~gGiGKTTLA~~l~~~l~~~F~g  237 (1153)
T PLN03210        158 PNEAKMIEEIANDVLGKLNLTPSNDFEDFVGIEDHIAKMSSLLHLESEEVRMVGIWGSSGIGKTTIARALFSRLSRQFQS  237 (1153)
T ss_pred             CCHHHHHHHHHHHHHHhhccccCcccccccchHHHHHHHHHHHccccCceEEEEEEcCCCCchHHHHHHHHHHHhhcCCe
Confidence            88999999999999999998888888999999999999999998888889999999999999999999999999999999


Q ss_pred             eEEEEee--cccc---c------cccHHHHHHHHHHHHhccccccCccchhHHHHHHHhhcCcEEEEEecCCCHHHHHHH
Q 000202          240 SYFACNV--RAAE---E------TGRLDDLRKELLSKLLNDRNVKNFQNISVNFQSKRLARKKVLIVFDDVNHPRQIELL  308 (1866)
Q Consensus       240 ~~~~~~~--~~~~---~------~~~~~~l~~~ll~~~~~~~~~~~~~~~~~~~l~~~L~~k~~LlVlDdv~~~~~~~~l  308 (1866)
                      .+|+...  ....   .      ......++++++.++...... ...  ....++++++++|+||||||||+.++|+.+
T Consensus       238 ~vfv~~~~v~~~~~~~~~~~~~~~~~~~~l~~~~l~~il~~~~~-~~~--~~~~~~~~L~~krvLLVLDdv~~~~~l~~L  314 (1153)
T PLN03210        238 SVFIDRAFISKSMEIYSSANPDDYNMKLHLQRAFLSEILDKKDI-KIY--HLGAMEERLKHRKVLIFIDDLDDQDVLDAL  314 (1153)
T ss_pred             EEEeeccccccchhhcccccccccchhHHHHHHHHHHHhCCCCc-ccC--CHHHHHHHHhCCeEEEEEeCCCCHHHHHHH
Confidence            9998642  1100   0      001234566777776654431 111  225678889999999999999999999999


Q ss_pred             hhccCCCCCCCEEEEEccccchhccCccceeeecCCCCHHHHHHHHHhhcCCCCCCChhHHHHHHHHHHHhCCCcceeee
Q 000202          309 IGRLDRFASGSQVIITTRDKQVLTNCEVDHIYQMKELVHADAHKLFTQCAFRGDHLDAGYTELAHKALKYAQGVPLALKV  388 (1866)
Q Consensus       309 ~~~~~~~~~gs~IiiTTR~~~v~~~~~~~~~~~l~~L~~~ea~~Lf~~~a~~~~~~~~~~~~~~~~i~~~~~GlPLAl~~  388 (1866)
                      .....|+++||+||||||+++++..++..++|+|+.|+.+||++||+++||++..+++++.+++++|+++|+|+||||++
T Consensus       315 ~~~~~~~~~GsrIIiTTrd~~vl~~~~~~~~~~v~~l~~~ea~~LF~~~Af~~~~~~~~~~~l~~~iv~~c~GLPLAl~v  394 (1153)
T PLN03210        315 AGQTQWFGSGSRIIVITKDKHFLRAHGIDHIYEVCLPSNELALEMFCRSAFKKNSPPDGFMELASEVALRAGNLPLGLNV  394 (1153)
T ss_pred             HhhCccCCCCcEEEEEeCcHHHHHhcCCCeEEEecCCCHHHHHHHHHHHhcCCCCCcHHHHHHHHHHHHHhCCCcHHHHH
Confidence            99888999999999999999999887788999999999999999999999998878888999999999999999999999


Q ss_pred             ecccccCCCHHHHHHHHHHhccCCCchhhhhhhcccCCCChh-hH-----------------------------------
Q 000202          389 LGCYLCGRSKEEWESAMRKLEIVPHMEIQEVLKISYDSLDDS-QK-----------------------------------  432 (1866)
Q Consensus       389 ~g~~L~~~~~~~w~~~l~~l~~~~~~~i~~~l~~Sy~~L~~~-~k-----------------------------------  432 (1866)
                      +|++|++++..+|+.++++++...+.+|.++|++||++|+++ +|                                   
T Consensus       395 lgs~L~~k~~~~W~~~l~~L~~~~~~~I~~~L~~SYd~L~~~~~k~~Fl~ia~ff~~~~~~~v~~~l~~~~~~~~~~l~~  474 (1153)
T PLN03210        395 LGSYLRGRDKEDWMDMLPRLRNGLDGKIEKTLRVSYDGLNNKKDKAIFRHIACLFNGEKVNDIKLLLANSDLDVNIGLKN  474 (1153)
T ss_pred             HHHHHcCCCHHHHHHHHHHHHhCccHHHHHHHHHhhhccCccchhhhhheehhhcCCCCHHHHHHHHHhcCCCchhChHH
Confidence            999999999999999999999888889999999999999764 55                                   


Q ss_pred             --------------HHHHHHHHHhHHhhcccCCCCCCCeeeecchhHHHHHhhcCcccceEEEEEeecC-CCcccccccc
Q 000202          433 --------------RMHDLLRAMGREIVRKESIVDPGKRSRLWHDEDIYEVLKKNTGTEAIKDISLNMS-DNEKEIFART  497 (1866)
Q Consensus       433 --------------~~~~~l~~~~~~i~~~~~~~~~~~~~rlW~~e~~~~~~~~~~~~~~~~~i~l~~~-~~~~~~~~~~  497 (1866)
                                    .||+++++||++|+++++ ..|+++.|+|.++++.+++.+++|++.+++|++|++ .....+...+
T Consensus       475 L~~ksLi~~~~~~~~MHdLl~~~~r~i~~~~~-~~~~~r~~l~~~~di~~vl~~~~g~~~v~~i~l~~~~~~~~~i~~~a  553 (1153)
T PLN03210        475 LVDKSLIHVREDIVEMHSLLQEMGKEIVRAQS-NEPGEREFLVDAKDICDVLEDNTGTKKVLGITLDIDEIDELHIHENA  553 (1153)
T ss_pred             HHhcCCEEEcCCeEEhhhHHHHHHHHHHHhhc-CCCCcceeEeCHHHHHHHHHhCcccceeeEEEeccCccceeeecHHH
Confidence                          899999999999999987 689999999999999999999999999999999998 6678899999


Q ss_pred             cCCcccccceeecc--------------------CCCceeee---cCCCCCCCCCCCCCCeeEEEcCCCCCcccCCCccc
Q 000202          498 FSTMTNLGHLKAYE--------------------SREIKDVM---SDLEVVPFPEVYAKNLVSLKMWDGKVKERWDDVQK  554 (1866)
Q Consensus       498 f~~m~~l~~l~~~~--------------------~~~l~~l~---~~~~~lp~~~f~~~~l~~l~l~~s~~~~lw~~~~~  554 (1866)
                      |.+|.+|++|++|.                    |.+||+|+   ||++++| ++|.+++|++|+|++|+|+++|++.+.
T Consensus       554 F~~m~~L~~L~~~~~~~~~~~~~~~~lp~~~~~lp~~Lr~L~~~~~~l~~lP-~~f~~~~L~~L~L~~s~l~~L~~~~~~  632 (1153)
T PLN03210        554 FKGMRNLLFLKFYTKKWDQKKEVRWHLPEGFDYLPPKLRLLRWDKYPLRCMP-SNFRPENLVKLQMQGSKLEKLWDGVHS  632 (1153)
T ss_pred             HhcCccccEEEEecccccccccceeecCcchhhcCcccEEEEecCCCCCCCC-CcCCccCCcEEECcCcccccccccccc
Confidence            99999999999853                    56799999   9999999 999999999999999999999999998


Q ss_pred             Cccchhhcc
Q 000202          555 VDVECDRLD  563 (1866)
Q Consensus       555 l~~~~~~l~  563 (1866)
                      +.. +..++
T Consensus       633 l~~-Lk~L~  640 (1153)
T PLN03210        633 LTG-LRNID  640 (1153)
T ss_pred             CCC-CCEEE
Confidence            876 34444



syringae 6; Provisional

>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>PF00931 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is the NB-ARC domain, a novel signalling motif found in bacteria and eukaryotes, shared by plant resistance gene products and regulators of cell death in animals [] Back     alignment and domain information
>PLN03194 putative disease resistance protein; Provisional Back     alignment and domain information
>PF00931 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is the NB-ARC domain, a novel signalling motif found in bacteria and eukaryotes, shared by plant resistance gene products and regulators of cell death in animals [] Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>PF01582 TIR: TIR domain; InterPro: IPR000157 In Drosophila melanogaster the Toll protein is involved in establishment of dorso-ventral polarity in the embryo Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>smart00255 TIR Toll - interleukin 1 - resistance Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>PF13676 TIR_2: TIR domain; PDB: 3H16_B 3UB4_A 2Y92_A 3UB3_A 3UB2_A Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>PRK00411 cdc6 cell division control protein 6; Reviewed Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PF01637 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 This domain has been found in a number of bacterial and archaeal proteins, all of which contain a conserved P-loop motif that is involved in binding ATP Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>PF05729 NACHT: NACHT domain Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily Back     alignment and domain information
>PRK00411 cdc6 cell division control protein 6; Reviewed Back     alignment and domain information
>TIGR02928 orc1/cdc6 family replication initiation protein Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PF01637 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 This domain has been found in a number of bacterial and archaeal proteins, all of which contain a conserved P-loop motif that is involved in binding ATP Back     alignment and domain information
>COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit Back     alignment and domain information
>PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed Back     alignment and domain information
>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily Back     alignment and domain information
>PF05729 NACHT: NACHT domain Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>TIGR02928 orc1/cdc6 family replication initiation protein Back     alignment and domain information
>PRK06893 DNA replication initiation factor; Validated Back     alignment and domain information
>TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit Back     alignment and domain information
>COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>COG2909 MalT ATP-dependent transcriptional regulator [Transcription] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>PRK13342 recombination factor protein RarA; Reviewed Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed Back     alignment and domain information
>PRK06893 DNA replication initiation factor; Validated Back     alignment and domain information
>KOG3678 consensus SARM protein (with sterile alpha and armadillo motifs) [Extracellular structures] Back     alignment and domain information
>PRK07471 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>PRK14949 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK07003 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>PRK14961 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PRK12402 replication factor C small subunit 2; Reviewed Back     alignment and domain information
>PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda Back     alignment and domain information
>PF07725 LRR_3: Leucine Rich Repeat; InterPro: IPR011713 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PRK12323 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG3903 Predicted ATPase [General function prediction only] Back     alignment and domain information
>PRK14960 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PLN03025 replication factor C subunit; Provisional Back     alignment and domain information
>PRK14963 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK13342 recombination factor protein RarA; Reviewed Back     alignment and domain information
>PF13173 AAA_14: AAA domain Back     alignment and domain information
>TIGR01242 26Sp45 26S proteasome subunit P45 family Back     alignment and domain information
>PF13191 AAA_16: AAA ATPase domain; PDB: 2V1U_A Back     alignment and domain information
>PRK09112 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK04195 replication factor C large subunit; Provisional Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PTZ00202 tuzin; Provisional Back     alignment and domain information
>PRK14956 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG2028 consensus ATPase related to the helicase subunit of the Holliday junction resolvase [Replication, recombination and repair] Back     alignment and domain information
>PRK07994 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14957 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG2909 MalT ATP-dependent transcriptional regulator [Transcription] Back     alignment and domain information
>PRK08691 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK00440 rfc replication factor C small subunit; Reviewed Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PRK05564 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK08727 hypothetical protein; Validated Back     alignment and domain information
>PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed Back     alignment and domain information
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PF13173 AAA_14: AAA domain Back     alignment and domain information
>PTZ00112 origin recognition complex 1 protein; Provisional Back     alignment and domain information
>TIGR00678 holB DNA polymerase III, delta' subunit Back     alignment and domain information
>PRK07940 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK14962 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>cd01128 rho_factor Transcription termination factor rho is a bacterial ATP-dependent RNA/DNA helicase Back     alignment and domain information
>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda Back     alignment and domain information
>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B Back     alignment and domain information
>PRK14964 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14951 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK06645 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>COG3899 Predicted ATPase [General function prediction only] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK08903 DnaA regulatory inactivator Hda; Validated Back     alignment and domain information
>PRK14958 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>PRK09376 rho transcription termination factor Rho; Provisional Back     alignment and domain information
>KOG2028 consensus ATPase related to the helicase subunit of the Holliday junction resolvase [Replication, recombination and repair] Back     alignment and domain information
>PRK14955 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14969 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK05896 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR02397 dnaX_nterm DNA polymerase III, subunit gamma and tau Back     alignment and domain information
>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B Back     alignment and domain information
>PRK03992 proteasome-activating nucleotidase; Provisional Back     alignment and domain information
>PRK08084 DNA replication initiation factor; Provisional Back     alignment and domain information
>TIGR02903 spore_lon_C ATP-dependent protease, Lon family Back     alignment and domain information
>PRK05564 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK05642 DNA replication initiation factor; Validated Back     alignment and domain information
>PRK09087 hypothetical protein; Validated Back     alignment and domain information
>cd01128 rho_factor Transcription termination factor rho is a bacterial ATP-dependent RNA/DNA helicase Back     alignment and domain information
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>TIGR03689 pup_AAA proteasome ATPase Back     alignment and domain information
>PRK09376 rho transcription termination factor Rho; Provisional Back     alignment and domain information
>PRK14970 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14952 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK07764 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication Back     alignment and domain information
>PRK09111 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK04195 replication factor C large subunit; Provisional Back     alignment and domain information
>PHA02544 44 clamp loader, small subunit; Provisional Back     alignment and domain information
>PRK14087 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK14954 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK09087 hypothetical protein; Validated Back     alignment and domain information
>TIGR02881 spore_V_K stage V sporulation protein K Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>PRK06305 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK07003 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK07133 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PTZ00112 origin recognition complex 1 protein; Provisional Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>PRK14959 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14949 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>PRK14088 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed Back     alignment and domain information
>PRK08451 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK05707 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK14963 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR00767 rho transcription termination factor Rho Back     alignment and domain information
>PLN03025 replication factor C subunit; Provisional Back     alignment and domain information
>PRK12402 replication factor C small subunit 2; Reviewed Back     alignment and domain information
>TIGR02903 spore_lon_C ATP-dependent protease, Lon family Back     alignment and domain information
>PRK14953 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG3903 Predicted ATPase [General function prediction only] Back     alignment and domain information
>PRK08727 hypothetical protein; Validated Back     alignment and domain information
>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA Back     alignment and domain information
>COG1222 RPT1 ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF08937 DUF1863: MTH538 TIR-like domain (DUF1863); InterPro: IPR015032 This protein adopts the flavodoxin fold, that is, five parallel beta-strands and four helical segments Back     alignment and domain information
>TIGR00362 DnaA chromosomal replication initiator protein DnaA Back     alignment and domain information
>PRK12323 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14971 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14950 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK06620 hypothetical protein; Validated Back     alignment and domain information
>PRK00149 dnaA chromosomal replication initiation protein; Reviewed Back     alignment and domain information
>PRK08084 DNA replication initiation factor; Provisional Back     alignment and domain information
>PRK14961 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR00767 rho transcription termination factor Rho Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>PRK14960 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family Back     alignment and domain information
>PRK14957 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>PRK05563 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX Back     alignment and domain information
>PTZ00361 26 proteosome regulatory subunit 4-like protein; Provisional Back     alignment and domain information
>PRK06647 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PTZ00202 tuzin; Provisional Back     alignment and domain information
>PRK14948 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional Back     alignment and domain information
>PF13191 AAA_16: AAA ATPase domain; PDB: 2V1U_A Back     alignment and domain information
>PRK00440 rfc replication factor C small subunit; Reviewed Back     alignment and domain information
>PRK12422 chromosomal replication initiation protein; Provisional Back     alignment and domain information
>KOG0989 consensus Replication factor C, subunit RFC4 [Replication, recombination and repair] Back     alignment and domain information
>PRK06645 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR01242 26Sp45 26S proteasome subunit P45 family Back     alignment and domain information
>PRK14965 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14956 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14962 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair Back     alignment and domain information
>PRK07994 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>CHL00181 cbbX CbbX; Provisional Back     alignment and domain information
>PRK14086 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>TIGR00678 holB DNA polymerase III, delta' subunit Back     alignment and domain information
>CHL00095 clpC Clp protease ATP binding subunit Back     alignment and domain information
>PRK10865 protein disaggregation chaperone; Provisional Back     alignment and domain information
>PF14516 AAA_35: AAA-like domain Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>PRK07399 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK14955 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14958 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF05621 TniB: Bacterial TniB protein; InterPro: IPR008868 This family consists of several bacterial TniB NTP-binding proteins Back     alignment and domain information
>PRK07940 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>COG3899 Predicted ATPase [General function prediction only] Back     alignment and domain information
>PRK14087 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>CHL00176 ftsH cell division protein; Validated Back     alignment and domain information
>PRK08116 hypothetical protein; Validated Back     alignment and domain information
>PRK08691 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport Back     alignment and domain information
>PRK08769 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF05621 TniB: Bacterial TniB protein; InterPro: IPR008868 This family consists of several bacterial TniB NTP-binding proteins Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>PRK05642 DNA replication initiation factor; Validated Back     alignment and domain information
>PRK09112 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication Back     alignment and domain information
>TIGR01241 FtsH_fam ATP-dependent metalloprotease FtsH Back     alignment and domain information
>PRK14951 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK08058 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR02397 dnaX_nterm DNA polymerase III, subunit gamma and tau Back     alignment and domain information
>PRK14964 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK07471 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB Back     alignment and domain information
>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional Back     alignment and domain information
>PRK06090 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>PRK05896 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>KOG2227 consensus Pre-initiation complex, subunit CDC6, AAA+ superfamily ATPase [Replication, recombination and repair; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK14969 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK08903 DnaA regulatory inactivator Hda; Validated Back     alignment and domain information
>cd01133 F1-ATPase_beta F1 ATP synthase beta subunit, nucleotide-binding domain Back     alignment and domain information
>smart00382 AAA ATPases associated with a variety of cellular activities Back     alignment and domain information
>PRK07993 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>COG1373 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>KOG2543 consensus Origin recognition complex, subunit 5 [Replication, recombination and repair] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK14959 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX Back     alignment and domain information
>PRK07764 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK09111 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family Back     alignment and domain information
>COG1373 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>PRK08181 transposase; Validated Back     alignment and domain information
>PRK12377 putative replication protein; Provisional Back     alignment and domain information
>PRK14954 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR00602 rad24 checkpoint protein rad24 Back     alignment and domain information
>PRK06620 hypothetical protein; Validated Back     alignment and domain information
>PRK14950 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PLN00020 ribulose bisphosphate carboxylase/oxygenase activase -RuBisCO activase (RCA); Provisional Back     alignment and domain information
>CHL00195 ycf46 Ycf46; Provisional Back     alignment and domain information
>KOG0731 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13177 DNA_pol3_delta2: DNA polymerase III, delta subunit; PDB: 1NJF_B 3GLG_G 1XXH_I 1NJG_A 3GLF_B 3GLI_G 1IQP_E 2GNO_A 1SXJ_E 1A5T_A Back     alignment and domain information
>KOG2227 consensus Pre-initiation complex, subunit CDC6, AAA+ superfamily ATPase [Replication, recombination and repair; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG2543 consensus Origin recognition complex, subunit 5 [Replication, recombination and repair] Back     alignment and domain information
>PRK14970 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK06871 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>COG0593 DnaA ATPase involved in DNA replication initiation [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK07952 DNA replication protein DnaC; Validated Back     alignment and domain information
>PRK11331 5-methylcytosine-specific restriction enzyme subunit McrB; Provisional Back     alignment and domain information
>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>TIGR03689 pup_AAA proteasome ATPase Back     alignment and domain information
>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>PRK10536 hypothetical protein; Provisional Back     alignment and domain information
>PRK08451 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK03992 proteasome-activating nucleotidase; Provisional Back     alignment and domain information
>PRK14088 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PHA02544 44 clamp loader, small subunit; Provisional Back     alignment and domain information
>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA Back     alignment and domain information
>CHL00181 cbbX CbbX; Provisional Back     alignment and domain information
>COG2255 RuvB Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR02881 spore_V_K stage V sporulation protein K Back     alignment and domain information
>PRK14952 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK09183 transposase/IS protein; Provisional Back     alignment and domain information
>KOG0730 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF08357 SEFIR: SEFIR domain; InterPro: IPR013568 This domain is found in IL17 receptors (IL17Rs, e Back     alignment and domain information
>PRK06921 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN Back     alignment and domain information
>TIGR00362 DnaA chromosomal replication initiator protein DnaA Back     alignment and domain information
>PRK06305 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>KOG0989 consensus Replication factor C, subunit RFC4 [Replication, recombination and repair] Back     alignment and domain information
>PRK14086 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PF05673 DUF815: Protein of unknown function (DUF815); InterPro: IPR008533 This domain consists of several bacterial proteins of unknown function Back     alignment and domain information
>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB Back     alignment and domain information
>smart00382 AAA ATPases associated with a variety of cellular activities Back     alignment and domain information
>KOG0744 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>CHL00176 ftsH cell division protein; Validated Back     alignment and domain information
>PRK14953 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK11331 5-methylcytosine-specific restriction enzyme subunit McrB; Provisional Back     alignment and domain information
>PRK08699 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PF04665 Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 This entry contains uncharacterised proteins belonging to the B354L family which include the pox virus A32 protein Back     alignment and domain information
>PRK06526 transposase; Provisional Back     alignment and domain information
>PRK00149 dnaA chromosomal replication initiation protein; Reviewed Back     alignment and domain information
>PRK12422 chromosomal replication initiation protein; Provisional Back     alignment and domain information
>KOG0741 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14948 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG0542 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14971 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>PRK10865 protein disaggregation chaperone; Provisional Back     alignment and domain information
>COG1223 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif Back     alignment and domain information
>KOG0733 consensus Nuclear AAA ATPase (VCP subfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0728 consensus 26S proteasome regulatory complex, ATPase RPT6 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK08118 topology modulation protein; Reviewed Back     alignment and domain information
>PRK07133 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK12608 transcription termination factor Rho; Provisional Back     alignment and domain information
>PRK06647 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PF14516 AAA_35: AAA-like domain Back     alignment and domain information
>PRK13531 regulatory ATPase RavA; Provisional Back     alignment and domain information
>KOG0733 consensus Nuclear AAA ATPase (VCP subfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport Back     alignment and domain information
>PRK10536 hypothetical protein; Provisional Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>CHL00095 clpC Clp protease ATP binding subunit Back     alignment and domain information
>COG2812 DnaX DNA polymerase III, gamma/tau subunits [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>COG0593 DnaA ATPase involved in DNA replication initiation [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional Back     alignment and domain information
>TIGR01241 FtsH_fam ATP-dependent metalloprotease FtsH Back     alignment and domain information
>TIGR00602 rad24 checkpoint protein rad24 Back     alignment and domain information
>COG3267 ExeA Type II secretory pathway, component ExeA (predicted ATPase) [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG0735 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd01394 radB RadB Back     alignment and domain information
>PRK06964 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>COG0470 HolB ATPase involved in DNA replication [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK06835 DNA replication protein DnaC; Validated Back     alignment and domain information
>PRK09361 radB DNA repair and recombination protein RadB; Provisional Back     alignment and domain information
>KOG0729 consensus 26S proteasome regulatory complex, ATPase RPT1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PTZ00361 26 proteosome regulatory subunit 4-like protein; Provisional Back     alignment and domain information
>KOG0741 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF04665 Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 This entry contains uncharacterised proteins belonging to the B354L family which include the pox virus A32 protein Back     alignment and domain information
>PRK08118 topology modulation protein; Reviewed Back     alignment and domain information
>PF05673 DUF815: Protein of unknown function (DUF815); InterPro: IPR008533 This domain consists of several bacterial proteins of unknown function Back     alignment and domain information
>PRK14974 cell division protein FtsY; Provisional Back     alignment and domain information
>COG3267 ExeA Type II secretory pathway, component ExeA (predicted ATPase) [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG0734 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF02562 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH is a cytoplasmic protein and predicted ATPase that is induced by phosphate starvation and belongings to the phosphate regulon (pho) in Escherichia coli [] Back     alignment and domain information
>cd01131 PilT Pilus retraction ATPase PilT Back     alignment and domain information
>KOG2228 consensus Origin recognition complex, subunit 4 [Replication, recombination and repair] Back     alignment and domain information
>PRK08939 primosomal protein DnaI; Reviewed Back     alignment and domain information
>PRK04132 replication factor C small subunit; Provisional Back     alignment and domain information
>PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A Back     alignment and domain information
>TIGR02237 recomb_radB DNA repair and recombination protein RadB Back     alignment and domain information
>cd01120 RecA-like_NTPases RecA-like NTPases Back     alignment and domain information
>smart00763 AAA_PrkA PrkA AAA domain Back     alignment and domain information
>PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] Back     alignment and domain information
>PF10443 RNA12: RNA12 protein; InterPro: IPR018850 Mitochondrial escape protein 2 (also known as RNA12) plays a role in maintaining the mitochondrial genome and in controlling mtDNA escape [, ] Back     alignment and domain information
>PRK07399 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK07261 topology modulation protein; Provisional Back     alignment and domain information
>PRK07261 topology modulation protein; Provisional Back     alignment and domain information
>PRK12608 transcription termination factor Rho; Provisional Back     alignment and domain information
>PRK14965 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG1618 Predicted nucleotide kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>cd01121 Sms Sms (bacterial radA) DNA repair protein Back     alignment and domain information
>PRK04296 thymidine kinase; Provisional Back     alignment and domain information
>COG2607 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>PRK05707 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK00771 signal recognition particle protein Srp54; Provisional Back     alignment and domain information
>PF14532 Sigma54_activ_2: Sigma-54 interaction domain; PDB: 3CO5_B 3N70_H Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG0727 consensus 26S proteasome regulatory complex, ATPase RPT3 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02902 spore_lonB ATP-dependent protease LonB Back     alignment and domain information
>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional Back     alignment and domain information
>PHA00729 NTP-binding motif containing protein Back     alignment and domain information
>PRK10787 DNA-binding ATP-dependent protease La; Provisional Back     alignment and domain information
>COG1066 Sms Predicted ATP-dependent serine protease [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13671 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B Back     alignment and domain information
>COG0542 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK05541 adenylylsulfate kinase; Provisional Back     alignment and domain information
>COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK12724 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK05563 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR00064 ftsY signal recognition particle-docking protein FtsY Back     alignment and domain information
>PRK08116 hypothetical protein; Validated Back     alignment and domain information
>PRK10733 hflB ATP-dependent metalloprotease; Reviewed Back     alignment and domain information
>KOG0735 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK06696 uridine kinase; Validated Back     alignment and domain information
>KOG0736 consensus Peroxisome assembly factor 2 containing the AAA+-type ATPase domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00763 lon ATP-dependent protease La Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>PRK07667 uridine kinase; Provisional Back     alignment and domain information
>PRK08181 transposase; Validated Back     alignment and domain information
>PRK11608 pspF phage shock protein operon transcriptional activator; Provisional Back     alignment and domain information
>KOG0739 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>KOG0726 consensus 26S proteasome regulatory complex, ATPase RPT2 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd03221 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth Back     alignment and domain information
>COG0466 Lon ATP-dependent Lon protease, bacterial type [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00416 sms DNA repair protein RadA Back     alignment and domain information
>cd03214 ABC_Iron-Siderophores_B12_Hemin ABC transporters, involved in the uptake of siderophores, heme, and vitamin B12, are widely conserved in bacteria and archaea Back     alignment and domain information
>TIGR02237 recomb_radB DNA repair and recombination protein RadB Back     alignment and domain information
>cd01129 PulE-GspE PulE/GspE The type II secretory pathway is the main terminal branch of the general secretory pathway (GSP) Back     alignment and domain information
>KOG0731 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG0464 SpoVK ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>PRK06067 flagellar accessory protein FlaH; Validated Back     alignment and domain information
>cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs Back     alignment and domain information
>TIGR00959 ffh signal recognition particle protein Back     alignment and domain information
>KOG2004 consensus Mitochondrial ATP-dependent protease PIM1/LON [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK09183 transposase/IS protein; Provisional Back     alignment and domain information
>KOG2035 consensus Replication factor C, subunit RFC3 [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] Back     alignment and domain information
>PRK10867 signal recognition particle protein; Provisional Back     alignment and domain information
>PRK08533 flagellar accessory protein FlaH; Reviewed Back     alignment and domain information
>PRK09361 radB DNA repair and recombination protein RadB; Provisional Back     alignment and domain information
>COG2255 RuvB Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>COG4608 AppF ABC-type oligopeptide transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>CHL00195 ycf46 Ycf46; Provisional Back     alignment and domain information
>KOG0651 consensus 26S proteasome regulatory complex, ATPase RPT4 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd01393 recA_like RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response Back     alignment and domain information
>PRK11823 DNA repair protein RadA; Provisional Back     alignment and domain information
>cd00544 CobU Adenosylcobinamide kinase / adenosylcobinamide phosphate guanyltransferase (CobU) Back     alignment and domain information
>PF13604 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL_A 3E1S_A 3GP8_A Back     alignment and domain information
>TIGR01359 UMP_CMP_kin_fam UMP-CMP kinase family Back     alignment and domain information
>TIGR01425 SRP54_euk signal recognition particle protein SRP54 Back     alignment and domain information
>cd03228 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-like transporters are involved in drug, peptide, and lipid export Back     alignment and domain information
>PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A Back     alignment and domain information
>PF13238 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB_A 3IIM_A 2AXP_A 3KB2_A 1KHT_A 1NKS_A 3H86_C Back     alignment and domain information
>TIGR01420 pilT_fam pilus retraction protein PilT Back     alignment and domain information
>PF01583 APS_kinase: Adenylylsulphate kinase; InterPro: IPR002891 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases Back     alignment and domain information
>PRK06217 hypothetical protein; Validated Back     alignment and domain information
>PF07726 AAA_3: ATPase family associated with various cellular activities (AAA); InterPro: IPR011703 This entry includes some of the AAA proteins not detected by the IPR003959 from INTERPRO model Back     alignment and domain information
>cd00983 recA RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response Back     alignment and domain information
>cd01393 recA_like RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response Back     alignment and domain information
>cd03216 ABC_Carb_Monos_I This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information
>PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] Back     alignment and domain information
>PRK08769 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK15429 formate hydrogenlyase transcriptional activator FhlA; Provisional Back     alignment and domain information
>PRK09280 F0F1 ATP synthase subunit beta; Validated Back     alignment and domain information
>KOG0991 consensus Replication factor C, subunit RFC2 [Replication, recombination and repair] Back     alignment and domain information
>PRK12377 putative replication protein; Provisional Back     alignment and domain information
>COG0465 HflB ATP-dependent Zn proteases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1875 NYN ribonuclease and ATPase of PhoH family domains [General function prediction only] Back     alignment and domain information
>TIGR02012 tigrfam_recA protein RecA Back     alignment and domain information
>PRK06526 transposase; Provisional Back     alignment and domain information
>cd01133 F1-ATPase_beta F1 ATP synthase beta subunit, nucleotide-binding domain Back     alignment and domain information
>cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes Back     alignment and domain information
>PRK05541 adenylylsulfate kinase; Provisional Back     alignment and domain information
>cd00561 CobA_CobO_BtuR ATP:corrinoid adenosyltransferase BtuR/CobO/CobP Back     alignment and domain information
>cd03223 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette transporter (Pat) is involved in the import of very long-chain fatty acids (VLCFA) into the peroxisome Back     alignment and domain information
>TIGR02974 phageshock_pspF psp operon transcriptional activator PspF Back     alignment and domain information
>cd01123 Rad51_DMC1_radA Rad51_DMC1_radA,B Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF00485 PRK: Phosphoribulokinase / Uridine kinase family; InterPro: IPR006083 Phosphoribulokinase (PRK) 2 Back     alignment and domain information
>cd01123 Rad51_DMC1_radA Rad51_DMC1_radA,B Back     alignment and domain information
>cd01394 radB RadB Back     alignment and domain information
>PRK05800 cobU adenosylcobinamide kinase/adenosylcobinamide-phosphate guanylyltransferase; Validated Back     alignment and domain information
>cd03247 ABCC_cytochrome_bd The CYD subfamily implicated in cytochrome bd biogenesis Back     alignment and domain information
>PRK09354 recA recombinase A; Provisional Back     alignment and domain information
>cd01125 repA Hexameric Replicative Helicase RepA Back     alignment and domain information
>PRK12597 F0F1 ATP synthase subunit beta; Provisional Back     alignment and domain information
>TIGR03574 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal Back     alignment and domain information
>TIGR03499 FlhF flagellar biosynthetic protein FlhF Back     alignment and domain information
>PRK15455 PrkA family serine protein kinase; Provisional Back     alignment and domain information
>cd03222 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor (RLI) is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids Back     alignment and domain information
>PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK05973 replicative DNA helicase; Provisional Back     alignment and domain information
>TIGR01039 atpD ATP synthase, F1 beta subunit Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>PRK08058 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR01817 nifA Nif-specific regulatory protein Back     alignment and domain information
>PRK12678 transcription termination factor Rho; Provisional Back     alignment and domain information
>TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF10443 RNA12: RNA12 protein; InterPro: IPR018850 Mitochondrial escape protein 2 (also known as RNA12) plays a role in maintaining the mitochondrial genome and in controlling mtDNA escape [, ] Back     alignment and domain information
>PRK03839 putative kinase; Provisional Back     alignment and domain information
>COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK05022 anaerobic nitric oxide reductase transcription regulator; Provisional Back     alignment and domain information
>COG0572 Udk Uridine kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>KOG0734 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PTZ00301 uridine kinase; Provisional Back     alignment and domain information
>PF08423 Rad51: Rad51; InterPro: IPR013632 This domain is found at the C terminus of the DNA repair and recombination protein Rad51 Back     alignment and domain information
>PRK12723 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PF10236 DAP3: Mitochondrial ribosomal death-associated protein 3; InterPro: IPR019368 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>PRK00625 shikimate kinase; Provisional Back     alignment and domain information
>KOG0652 consensus 26S proteasome regulatory complex, ATPase RPT5 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd01122 GP4d_helicase GP4d_helicase is a homohexameric 5'-3' helicases Back     alignment and domain information
>cd01858 NGP_1 NGP-1 Back     alignment and domain information
>cd02019 NK Nucleoside/nucleotide kinase (NK) is a protein superfamily consisting of multiple families of enzymes that share structural similarity and are functionally related to the catalysis of the reversible phosphate group transfer from nucleoside triphosphates to nucleosides/nucleotides, nucleoside monophosphates, or sugars Back     alignment and domain information
>PRK06921 hypothetical protein; Provisional Back     alignment and domain information
>PRK08233 hypothetical protein; Provisional Back     alignment and domain information
>CHL00206 ycf2 Ycf2; Provisional Back     alignment and domain information
>KOG1514 consensus Origin recognition complex, subunit 1, and related proteins [Replication, recombination and repair] Back     alignment and domain information
>PRK04040 adenylate kinase; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1866
3jrn_A176 Crystal Structure Of Tir Domain From Arabidopsis Th 4e-30
3ozi_A204 Crystal Structure Of The Tir Domain From The Flax D 1e-24
4fcg_A328 Structure Of The Leucine-Rich Repeat Domain Of The 4e-04
2o6q_A270 Structural Diversity Of The Hagfish Variable Lympho 5e-04
>pdb|3JRN|A Chain A, Crystal Structure Of Tir Domain From Arabidopsis Thaliana Length = 176 Back     alignment and structure

Iteration: 1

Score = 131 bits (329), Expect = 4e-30, Method: Compositional matrix adjust. Identities = 71/160 (44%), Positives = 96/160 (60%), Gaps = 4/160 (2%) Query: 16 YDVFLSFRGEDTRDNFTSHLYSALCQNNVETFIDN-DLKRGDEIPESLLGTIEASTISII 74 YDVFLSFRG DTR NF S LY L + ++ TF D+ +L+ G L IE S +++ Sbjct: 9 YDVFLSFRGHDTRHNFISFLYKELVRRSIRTFKDDKELENGQRFSPELKSPIEVSRFAVV 68 Query: 75 IFSEKYASSKWCLDELLKILECKRNYGQIVIPVFYRVDPSHVRKQIGSFGDSFFMLEERF 134 + SE YA+S WCLDEL+ I++ ++ V+P+FY V+P+HVR Q G + F R Sbjct: 69 VVSENYAASSWCLDELVTIMDFEKKGSITVMPIFYGVEPNHVRWQTGVLAEQFKKHASRE 128 Query: 135 -PYKMRNWRSALTEAADLSGFDSCVIRPESRLVADIANEV 173 P K+ WR ALT A LSG C +S+LV IANE+ Sbjct: 129 DPEKVLKWRQALTNFAQLSG--DCSGDDDSKLVDKIANEI 166
>pdb|3OZI|A Chain A, Crystal Structure Of The Tir Domain From The Flax Disease Resistance Protein L6 Length = 204 Back     alignment and structure
>pdb|4FCG|A Chain A, Structure Of The Leucine-Rich Repeat Domain Of The Type Iii Effector Xcv3220 (Xopl) Length = 328 Back     alignment and structure
>pdb|2O6Q|A Chain A, Structural Diversity Of The Hagfish Variable Lymphocyte Receptors A29 Length = 270 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1866
3ozi_A204 L6TR; plant TIR domain, plant protein; 2.30A {Linu 2e-85
3jrn_A176 AT1G72930 protein; TIR domain arabidopsis thaliana 2e-83
3h16_A154 TIR protein; bacteria TIR domain, signaling protei 4e-64
1vt4_I1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-42
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-33
1vt4_I1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-23
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-13
1vt4_I1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-10
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-08
2a5y_B549 CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis 1e-37
2a5y_B549 CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis 3e-33
2a5y_B549 CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis 2e-15
1z6t_A591 APAF-1, apoptotic protease activating factor 1; ca 4e-33
1z6t_A591 APAF-1, apoptotic protease activating factor 1; ca 9e-29
1z6t_A591 APAF-1, apoptotic protease activating factor 1; ca 3e-16
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-24
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 8e-24
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 4e-18
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 4e-13
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 4e-23
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 8e-23
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 4e-22
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-05
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 5e-19
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-13
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-10
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-05
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 4e-17
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 3e-15
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-11
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 5e-11
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 7e-11
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 3e-09
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 3e-04
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 5e-17
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-14
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 7e-13
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-08
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 2e-16
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 3e-13
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 2e-12
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 1e-11
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 2e-08
3sfz_A1249 APAF-1, apoptotic peptidase activating factor 1; a 2e-16
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 2e-11
3sfz_A1249 APAF-1, apoptotic peptidase activating factor 1; a 2e-06
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 7e-16
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 8e-14
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-13
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-12
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-12
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-10
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 6e-06
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-15
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 8e-13
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-15
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 9e-15
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 6e-12
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 4e-11
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 6e-10
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-09
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-08
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-04
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 7e-04
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-15
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-14
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 8e-14
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 4e-13
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-12
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-12
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-12
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 9e-08
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-15
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 3e-14
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 3e-13
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 6e-13
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 8e-09
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 3e-07
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 5e-15
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-13
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-13
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-10
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-10
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-09
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-07
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-06
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 5e-15
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-14
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 4e-14
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-12
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-11
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-09
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 7e-04
4fmz_A347 Internalin; leucine rich repeat, structural genomi 6e-15
4fmz_A347 Internalin; leucine rich repeat, structural genomi 9e-13
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-12
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-12
4fmz_A347 Internalin; leucine rich repeat, structural genomi 9e-12
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-06
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-14
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 3e-12
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 4e-12
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-11
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-09
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 8e-08
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 2e-14
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 2e-14
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 2e-13
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 1e-12
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 5e-04
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-14
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 7e-14
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 8e-13
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-12
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 8e-12
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 9e-11
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-09
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-04
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 3e-14
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-12
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 3e-12
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 4e-08
1o6v_A466 Internalin A; bacterial infection, extracellular r 3e-14
1o6v_A466 Internalin A; bacterial infection, extracellular r 3e-13
1o6v_A466 Internalin A; bacterial infection, extracellular r 9e-13
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-11
1o6v_A466 Internalin A; bacterial infection, extracellular r 5e-11
1o6v_A466 Internalin A; bacterial infection, extracellular r 7e-09
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 7e-14
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 1e-13
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 2e-13
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-12
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 9e-12
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 7e-08
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 8e-14
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 4e-13
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 4e-10
3ub2_A146 TOLL/interleukin-1 receptor domain-containing ADA 1e-13
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-13
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 3e-13
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 7e-13
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-12
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 5e-12
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-11
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 3e-11
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 3e-07
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 6e-07
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-04
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 3e-13
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 9e-13
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 1e-11
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 1e-10
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 5e-13
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 8e-09
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 8e-13
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-09
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-09
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-09
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-08
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 9e-13
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 3e-10
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 1e-12
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 1e-11
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 1e-09
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 2e-12
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 3e-11
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 1e-09
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 6e-12
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 3e-09
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 8e-12
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-10
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 3e-10
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 3e-10
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 4e-10
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 2e-09
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-07
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-06
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 2e-04
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 9e-12
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 6e-11
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 8e-10
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 9e-10
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 1e-11
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 1e-08
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 6e-08
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 3e-11
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 6e-10
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 2e-06
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 4e-04
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 3e-11
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 5e-10
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 2e-08
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 8e-04
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 3e-11
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 7e-05
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 5e-11
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-10
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 5e-11
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 8e-11
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 3e-07
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 6e-11
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 5e-09
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 8e-09
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-08
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 4e-06
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 9e-06
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 7e-11
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-09
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 7e-09
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 8e-11
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 4e-08
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 3e-07
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 9e-11
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 2e-10
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 5e-08
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 1e-07
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 5e-10
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 1e-07
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 6e-10
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 1e-09
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-09
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-09
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 9e-06
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-09
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-04
4ezg_A197 Putative uncharacterized protein; internalin-A, le 7e-04
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 3e-09
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 5e-09
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-06
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 1e-08
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 1e-05
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 1e-04
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 1e-08
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 1e-08
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 1e-07
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 6e-08
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 5e-06
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 3e-05
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 8e-08
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 7e-05
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 2e-07
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 2e-07
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 5e-05
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 4e-07
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 9e-07
2j67_A178 TOLL like receptor 10; TIR, IL-1, TLR10, membrane, 1e-06
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 3e-06
1t3g_A159 X-linked interleukin-1 receptor accessory protein- 9e-06
3e6j_A229 Variable lymphocyte receptor diversity region; var 1e-05
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 3e-05
3m19_A251 Variable lymphocyte receptor A diversity region; a 3e-05
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 1e-04
1w8a_A192 SLIT protein; signaling protein, secreted protein, 3e-04
>3ozi_A L6TR; plant TIR domain, plant protein; 2.30A {Linum usitatissimum} Length = 204 Back     alignment and structure
 Score =  276 bits (709), Expect = 2e-85
 Identities = 63/181 (34%), Positives = 99/181 (54%), Gaps = 3/181 (1%)

Query: 1   MASSSSSPPRNDKKMYDVFLSFRGEDTRDNFTSHLYSALCQNNVETFIDND-LKRGDEIP 59
           ++ S++         Y+VFLSFRG DTR+ FT  LY +L +  + TF D+D L +G EI 
Sbjct: 21  ISDSTNPSGSFPSVEYEVFLSFRGPDTREQFTDFLYQSLRRYKIHTFRDDDELLKGKEIG 80

Query: 60  ESLLGTIEASTISIIIFSEKYASSKWCLDELLKILECKRNYG-QIVIPVFYRVDPSHVRK 118
            +LL  I+ S I + I S  YA SKWCL EL +I+  +     +I++P+FY VDPS VR 
Sbjct: 81  PNLLRAIDQSKIYVPIISSGYADSKWCLMELAEIVRRQEEDPRRIILPIFYMVDPSDVRH 140

Query: 119 QIGSFGDSFFMLEERF-PYKMRNWRSALTEAADLSGFDSCVIRPESRLVADIANEVLERL 177
           Q G +  +F     +F    ++NW+ AL +  DL G+       +  +   ++ ++   +
Sbjct: 141 QTGCYKKAFRKHANKFDGQTIQNWKDALKKVGDLKGWHIGKNDKQGAIADKVSADIWSHI 200

Query: 178 D 178
            
Sbjct: 201 S 201


>3jrn_A AT1G72930 protein; TIR domain arabidopsis thaliana, plant protein; 2.00A {Arabidopsis thaliana} Length = 176 Back     alignment and structure
>3h16_A TIR protein; bacteria TIR domain, signaling protein; 2.50A {Paracoccus denitrificans PD1222} Length = 154 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Length = 549 Back     alignment and structure
>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Length = 549 Back     alignment and structure
>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Length = 549 Back     alignment and structure
>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Length = 591 Back     alignment and structure
>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Length = 591 Back     alignment and structure
>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Length = 591 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Length = 1249 Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Length = 1249 Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Length = 1249 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>3ub2_A TOLL/interleukin-1 receptor domain-containing ADA protein; TIR domain, TLRS adaptor, immune system; 2.40A {Homo sapiens} PDB: 3ub3_A 3ub4_A 2y92_A Length = 146 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>2j67_A TOLL like receptor 10; TIR, IL-1, TLR10, membrane, innate immunity, immune response, leucine-rich repeat, glycoprotein, transmembrane; 2.20A {Homo sapiens} PDB: 1fyv_A Length = 178 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1t3g_A X-linked interleukin-1 receptor accessory protein-like 1; TIR, IL-1RAPL, IL-1R, TLR, membrane protein; 2.30A {Homo sapiens} Length = 159 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query1866
3ozi_A204 L6TR; plant TIR domain, plant protein; 2.30A {Linu 100.0
3jrn_A176 AT1G72930 protein; TIR domain arabidopsis thaliana 100.0
2a5y_B549 CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis 100.0
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 100.0
2a5y_B549 CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis 99.98
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 99.98
1z6t_A591 APAF-1, apoptotic protease activating factor 1; ca 99.96
1vt4_I1221 APAF-1 related killer DARK; drosophila apoptosome, 99.94
3sfz_A1249 APAF-1, apoptotic peptidase activating factor 1; a 99.94
3h16_A154 TIR protein; bacteria TIR domain, signaling protei 99.93
1z6t_A591 APAF-1, apoptotic protease activating factor 1; ca 99.92
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.87
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.86
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.85
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 99.85
3ub2_A146 TOLL/interleukin-1 receptor domain-containing ADA 99.85
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.85
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.85
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.84
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.84
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.84
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 99.84
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.83
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.83
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.83
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.82
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.82
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.82
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 99.82
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 99.81
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 99.81
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.81
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.81
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.8
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 99.8
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.79
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.79
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.79
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.79
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.78
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.78
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.78
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.77
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.76
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.76
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.76
2js7_A160 Myeloid differentiation primary response protein M 99.75
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.74
1fyx_A149 TOLL-like receptor 2; beta-alpha-beta fold, signal 99.74
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.74
1t3g_A159 X-linked interleukin-1 receptor accessory protein- 99.73
2j67_A178 TOLL like receptor 10; TIR, IL-1, TLR10, membrane, 99.73
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.7
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.7
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.69
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.68
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.67
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.67
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.67
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.66
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.66
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.64
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.64
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.62
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.6
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.6
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.59
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.59
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.58
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.57
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.55
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.54
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.51
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.51
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.5
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.5
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.49
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.49
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.48
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.46
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.45
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.45
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.44
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.44
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.43
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.43
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.42
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.41
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.4
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.4
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.4
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.39
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.39
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.39
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.38
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.38
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.36
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 99.35
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 99.34
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.33
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.31
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.31
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.3
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.29
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.24
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 99.24
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.23
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.23
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.22
2qen_A350 Walker-type ATPase; unknown function; HET: ADP; 2. 99.22
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.22
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.21
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.21
1w5s_A412 Origin recognition complex subunit 2 ORC2; replica 99.21
2fna_A357 Conserved hypothetical protein; structural genomic 99.21
1w5s_A412 Origin recognition complex subunit 2 ORC2; replica 99.21
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.2
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.19
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.19
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.19
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.19
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.19
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.18
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.18
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.16
2qen_A350 Walker-type ATPase; unknown function; HET: ADP; 2. 99.14
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 99.13
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 99.13
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.13
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.12
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.12
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.11
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.11
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.1
2fna_A357 Conserved hypothetical protein; structural genomic 99.1
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.08
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.08
2qby_B384 CDC6 homolog 3, cell division control protein 6 ho 99.08
3qfl_A115 MLA10; coiled-coil, (CC) domain, NLRS, nucleotide- 99.07
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.04
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.04
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 99.04
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.03
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.01
2qby_A386 CDC6 homolog 1, cell division control protein 6 ho 99.0
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.0
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.0
1njg_A250 DNA polymerase III subunit gamma; rossman-like fol 98.98
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 98.96
2v1u_A387 Cell division control protein 6 homolog; DNA repli 98.96
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 98.93
4b8c_D727 Glucose-repressible alcohol dehydrogenase transcr 98.92
2chg_A226 Replication factor C small subunit; DNA-binding pr 98.9
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 98.89
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 98.89
1w8a_A192 SLIT protein; signaling protein, secreted protein, 98.88
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 98.88
4b8c_D727 Glucose-repressible alcohol dehydrogenase transcr 98.87
2qby_B384 CDC6 homolog 3, cell division control protein 6 ho 98.86
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 98.86
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 98.84
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 98.83
2v1u_A387 Cell division control protein 6 homolog; DNA repli 98.83
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 98.83
1fnn_A389 CDC6P, cell division control protein 6; ORC1, AAA 98.77
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 98.7
2qby_A386 CDC6 homolog 1, cell division control protein 6 ho 98.7
1sxj_B323 Activator 1 37 kDa subunit; clamp loader, processi 98.69
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 98.69
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 98.68
1fnn_A389 CDC6P, cell division control protein 6; ORC1, AAA 98.61
1njg_A250 DNA polymerase III subunit gamma; rossman-like fol 98.57
1iqp_A327 RFCS; clamp loader, extended AAA-ATPase domain, co 98.54
2chg_A226 Replication factor C small subunit; DNA-binding pr 98.53
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 98.53
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 98.42
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 98.39
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 98.37
1jr3_A373 DNA polymerase III subunit gamma; processivity, pr 98.31
2chq_A319 Replication factor C small subunit; DNA-binding pr 98.31
1sxj_B323 Activator 1 37 kDa subunit; clamp loader, processi 98.26
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 98.23
1hqc_A324 RUVB; extended AAA-ATPase domain, complex with nuc 98.16
1hqc_A324 RUVB; extended AAA-ATPase domain, complex with nuc 98.13
4fdw_A401 Leucine rich hypothetical protein; putative cell s 98.13
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 98.13
1jbk_A195 CLPB protein; beta barrel, chaperone; 1.80A {Esche 98.12
3h4m_A285 Proteasome-activating nucleotidase; ATPase, PAN, A 98.08
3bos_A242 Putative DNA replication factor; P-loop containing 98.03
2z4s_A440 Chromosomal replication initiator protein DNAA; AA 98.03
1sxj_D353 Activator 1 41 kDa subunit; clamp loader, processi 98.02
1sxj_E354 Activator 1 40 kDa subunit; clamp loader, processi 98.0
3d8b_A357 Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s 97.98
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 97.97
3eie_A322 Vacuolar protein sorting-associated protein 4; AAA 97.95
1iqp_A327 RFCS; clamp loader, extended AAA-ATPase domain, co 97.93
3te6_A318 Regulatory protein SIR3; heterochromatin, gene sil 97.93
2qz4_A262 Paraplegin; AAA+, SPG7, protease, ADP, structural 97.93
3te6_A318 Regulatory protein SIR3; heterochromatin, gene sil 97.91
3pfi_A338 Holliday junction ATP-dependent DNA helicase RUVB; 97.9
1sxj_A516 Activator 1 95 kDa subunit; clamp loader, processi 97.87
3u61_B324 DNA polymerase accessory protein 44; AAA+, ATP hyd 97.86
3b9p_A297 CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc 97.84
3pvs_A447 Replication-associated recombination protein A; ma 97.81
1xwi_A322 SKD1 protein; VPS4B, AAA ATPase, protein transport 97.81
3uk6_A368 RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding 97.8
4fdw_A401 Leucine rich hypothetical protein; putative cell s 97.79
1d2n_A272 N-ethylmaleimide-sensitive fusion protein; hexamer 97.78
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 97.78
1l8q_A324 Chromosomal replication initiator protein DNAA; AA 97.77
2zan_A444 Vacuolar protein sorting-associating protein 4B; S 97.77
2qp9_X355 Vacuolar protein sorting-associated protein 4; ATP 97.76
1a5t_A334 Delta prime, HOLB; zinc finger, DNA replication; 2 97.74
2chq_A319 Replication factor C small subunit; DNA-binding pr 97.74
3vfd_A389 Spastin; ATPase, microtubule severing, hydrolase; 97.73
2p65_A187 Hypothetical protein PF08_0063; CLPB, malaria, str 97.69
1sxj_C340 Activator 1 40 kDa subunit; clamp loader, processi 97.67
3cf0_A301 Transitional endoplasmic reticulum ATPase; AAA, P9 97.67
3syl_A309 Protein CBBX; photosynthesis, rubisco activase, AA 97.67
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.62
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.61
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 97.61
3n70_A145 Transport activator; sigma-54, ntpase, PSI, MCSG, 97.56
1jbk_A195 CLPB protein; beta barrel, chaperone; 1.80A {Esche 97.51
2z4s_A440 Chromosomal replication initiator protein DNAA; AA 97.51
1jr3_A373 DNA polymerase III subunit gamma; processivity, pr 97.48
4b4t_J405 26S protease regulatory subunit 8 homolog; hydrola 97.46
4b4t_L437 26S protease subunit RPT4; hydrolase, AAA-atpases, 97.43
2qz4_A262 Paraplegin; AAA+, SPG7, protease, ADP, structural 97.41
3bos_A242 Putative DNA replication factor; P-loop containing 97.39
4b4t_M434 26S protease regulatory subunit 6A; hydrolase, AAA 97.36
3h4m_A285 Proteasome-activating nucleotidase; ATPase, PAN, A 97.35
3hu3_A489 Transitional endoplasmic reticulum ATPase; VCP, tr 97.34
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 97.33
3pvs_A447 Replication-associated recombination protein A; ma 97.3
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 97.29
4b4t_H467 26S protease regulatory subunit 7 homolog; hydrola 97.26
4b4t_I437 26S protease regulatory subunit 4 homolog; hydrola 97.24
1qvr_A854 CLPB protein; coiled coil, AAA ATPase, chaperone; 97.24
3pxg_A468 Negative regulator of genetic competence CLPC/MEC; 97.21
1sxj_D353 Activator 1 41 kDa subunit; clamp loader, processi 97.21
2w58_A202 DNAI, primosome component (helicase loader); ATP-b 97.2
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.17
3ec2_A180 DNA replication protein DNAC; helicase loader, rep 97.17
2gno_A305 DNA polymerase III, gamma subunit-related protein; 97.15
4b4t_K428 26S protease regulatory subunit 6B homolog; hydrol 97.14
4fcw_A311 Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 97.14
4gt6_A394 Cell surface protein; leucine rich repeats, putati 97.13
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 97.12
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.11
1sxj_E354 Activator 1 40 kDa subunit; clamp loader, processi 97.09
1lv7_A257 FTSH; alpha/beta domain, four helix bundle, hydrol 97.09
1ofh_A310 ATP-dependent HSL protease ATP-binding subunit HSL 97.02
1xwi_A322 SKD1 protein; VPS4B, AAA ATPase, protein transport 97.0
3co5_A143 Putative two-component system transcriptional RES 97.0
1r6b_X758 CLPA protein; AAA+, N-terminal domain, CLPS, cryst 96.99
2bjv_A265 PSP operon transcriptional activator; AAA, transcr 96.99
3pfi_A338 Holliday junction ATP-dependent DNA helicase RUVB; 96.98
1d2n_A272 N-ethylmaleimide-sensitive fusion protein; hexamer 96.98
2ce7_A476 Cell division protein FTSH; metalloprotease; HET: 96.97
1sxj_A516 Activator 1 95 kDa subunit; clamp loader, processi 96.96
3ec2_A180 DNA replication protein DNAC; helicase loader, rep 96.95
3pxi_A758 Negative regulator of genetic competence CLPC/MEC; 96.92
2r62_A268 Cell division protease FTSH homolog; ATPase domain 96.89
1ojl_A304 Transcriptional regulatory protein ZRAR; response 96.82
3d8b_A357 Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s 96.82
3syl_A309 Protein CBBX; photosynthesis, rubisco activase, AA 96.81
3u61_B324 DNA polymerase accessory protein 44; AAA+, ATP hyd 96.74
1sxj_C340 Activator 1 40 kDa subunit; clamp loader, processi 96.7
1a5t_A334 Delta prime, HOLB; zinc finger, DNA replication; 2 96.7
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 96.69
3cf2_A806 TER ATPase, transitional endoplasmic reticulum ATP 96.69
1in4_A334 RUVB, holliday junction DNA helicase RUVB; AAA+-cl 96.69
2kjq_A149 DNAA-related protein; solution structure, NESG, st 96.68
2c9o_A456 RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP- 96.66
3eie_A322 Vacuolar protein sorting-associated protein 4; AAA 96.66
3uk6_A368 RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding 96.65
1l8q_A324 Chromosomal replication initiator protein DNAA; AA 96.61
2zan_A444 Vacuolar protein sorting-associating protein 4B; S 96.53
2qp9_X355 Vacuolar protein sorting-associated protein 4; ATP 96.52
3pxi_A758 Negative regulator of genetic competence CLPC/MEC; 96.5
2p65_A187 Hypothetical protein PF08_0063; CLPB, malaria, str 96.49
3vfd_A389 Spastin; ATPase, microtubule severing, hydrolase; 96.46
4gt6_A394 Cell surface protein; leucine rich repeats, putati 96.44
3b9p_A297 CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc 96.44
3t15_A293 Ribulose bisphosphate carboxylase/oxygenase activ 96.4
2dhr_A499 FTSH; AAA+ protein, hexameric Zn metalloprotease, 96.33
1ixz_A254 ATP-dependent metalloprotease FTSH; AAA domain fol 96.32
3cf0_A301 Transitional endoplasmic reticulum ATPase; AAA, P9 96.29
2gno_A305 DNA polymerase III, gamma subunit-related protein; 96.11
1eiw_A111 Hypothetical protein MTH538; CHEY-like fold, flavo 96.09
2x8a_A274 Nuclear valosin-containing protein-like; nuclear p 96.08
2w58_A202 DNAI, primosome component (helicase loader); ATP-b 96.06
2r44_A331 Uncharacterized protein; putative ATPase, structur 96.05
1ypw_A806 Transitional endoplasmic reticulum ATPase; AAA, P9 96.01
4b4t_J405 26S protease regulatory subunit 8 homolog; hydrola 95.98
1iy2_A278 ATP-dependent metalloprotease FTSH; AAA domain fol 95.96
2ce7_A476 Cell division protein FTSH; metalloprotease; HET: 95.68
1um8_A376 ATP-dependent CLP protease ATP-binding subunit CL; 95.67
3n70_A145 Transport activator; sigma-54, ntpase, PSI, MCSG, 95.6
3pxg_A468 Negative regulator of genetic competence CLPC/MEC; 95.55
4b4t_L437 26S protease subunit RPT4; hydrolase, AAA-atpases, 95.52
3m6a_A543 ATP-dependent protease LA 1; alpha, beta, ATP-bind 95.52
1qvr_A854 CLPB protein; coiled coil, AAA ATPase, chaperone; 95.46
4b4t_H467 26S protease regulatory subunit 7 homolog; hydrola 95.44
4b4t_M434 26S protease regulatory subunit 6A; hydrolase, AAA 95.28
3co5_A143 Putative two-component system transcriptional RES 95.23
1lv7_A257 FTSH; alpha/beta domain, four helix bundle, hydrol 95.14
4b4t_I437 26S protease regulatory subunit 4 homolog; hydrola 95.12
4b4t_K428 26S protease regulatory subunit 6B homolog; hydrol 95.11
3hu3_A489 Transitional endoplasmic reticulum ATPase; VCP, tr 94.99
2vhj_A331 Ntpase P4, P4; non- hydrolysable ATP analogue, hyd 94.87
1r6b_X758 CLPA protein; AAA+, N-terminal domain, CLPS, cryst 94.84
1in4_A334 RUVB, holliday junction DNA helicase RUVB; AAA+-cl 94.82
2vhj_A331 Ntpase P4, P4; non- hydrolysable ATP analogue, hyd 94.64
2kjq_A149 DNAA-related protein; solution structure, NESG, st 94.64
2b8t_A223 Thymidine kinase; deoxyribonucleoside kinase, zinc 94.63
2r62_A268 Cell division protease FTSH homolog; ATPase domain 94.54
2qgz_A308 Helicase loader, putative primosome component; str 94.53
2cvh_A220 DNA repair and recombination protein RADB; filamen 94.51
2w0m_A235 SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus 94.33
4fcw_A311 Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 94.27
2cvh_A220 DNA repair and recombination protein RADB; filamen 94.25
3cf2_A806 TER ATPase, transitional endoplasmic reticulum ATP 94.2
1g5t_A196 COB(I)alamin adenosyltransferase; P-loop protein, 93.89
1sky_E473 F1-ATPase, F1-ATP synthase; F1FO ATP synthase, alp 93.66
1ixz_A254 ATP-dependent metalloprotease FTSH; AAA domain fol 93.58
1ye8_A178 Protein THEP1, hypothetical UPF0334 kinase-like pr 93.55
2orw_A184 Thymidine kinase; TMTK, TP4A, transferase; HET: 4T 93.46
2dhr_A499 FTSH; AAA+ protein, hexameric Zn metalloprotease, 93.19
1vma_A306 Cell division protein FTSY; TM0570, structural gen 93.18
3jvv_A356 Twitching mobility protein; hexameric P-loop ATPas 93.14
2eyu_A261 Twitching motility protein PILT; pilus retraction 92.94
3ice_A422 Transcription termination factor RHO; transcriptio 92.92
3e70_C328 DPA, signal recognition particle receptor; FTSY, S 92.9
3hr8_A356 Protein RECA; alpha and beta proteins (A/B, A+B), 92.87
1iy2_A278 ATP-dependent metalloprotease FTSH; AAA domain fol 92.82
1qhx_A178 CPT, protein (chloramphenicol phosphotransferase); 92.65
1ojl_A304 Transcriptional regulatory protein ZRAR; response 92.51
2xxa_A433 Signal recognition particle protein; protein trans 92.5
2ck3_D482 ATP synthase subunit beta\, mitochondrial; hydrola 92.47
2x8a_A274 Nuclear valosin-containing protein-like; nuclear p 92.42
1n0w_A243 DNA repair protein RAD51 homolog 1; DNA repair, ho 92.24
3dm5_A443 SRP54, signal recognition 54 kDa protein; protein- 92.17
2r8r_A228 Sensor protein; KDPD, PFAM02702, MCSG, structural 92.14
1rz3_A201 Hypothetical protein rbstp0775; MCSG, structural g 92.06
3hws_A363 ATP-dependent CLP protease ATP-binding subunit CL; 92.06
1s96_A219 Guanylate kinase, GMP kinase; E.coli, dimer, SAD, 91.98
3hyn_A189 Putative signal transduction protein; DUF1863 fami 91.91
3c8u_A208 Fructokinase; YP_612366.1, putative fructose trans 91.87
3kb2_A173 SPBC2 prophage-derived uncharacterized protein YOR 91.78
3bh0_A315 DNAB-like replicative helicase; ATPase, replicatio 91.78
3hr8_A356 Protein RECA; alpha and beta proteins (A/B, A+B), 91.7
3io5_A333 Recombination and repair protein; storage dimer, i 91.62
1fx0_B498 ATP synthase beta chain; latent ATPase, thermal st 91.6
1xp8_A366 RECA protein, recombinase A; recombination, radior 91.49
1v5w_A343 DMC1, meiotic recombination protein DMC1/LIM15 hom 91.47
3vaa_A199 Shikimate kinase, SK; structural genomics, center 91.45
3trf_A185 Shikimate kinase, SK; amino acid biosynthesis, tra 91.37
1xp8_A366 RECA protein, recombinase A; recombination, radior 91.35
3m6a_A543 ATP-dependent protease LA 1; alpha, beta, ATP-bind 91.3
2i1q_A322 DNA repair and recombination protein RADA; ATPase, 91.28
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 91.27
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 91.24
1odf_A290 YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser 91.17
3io5_A333 Recombination and repair protein; storage dimer, i 91.12
2z43_A324 DNA repair and recombination protein RADA; archaea 91.07
3lw7_A179 Adenylate kinase related protein (ADKA-like); AMP, 90.82
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 90.81
3sr0_A206 Adenylate kinase; phosphoryl transfer analogue, AL 90.72
2ga8_A359 Hypothetical 39.9 kDa protein; YFR007W, YFH7, unkn 90.71
2px0_A296 Flagellar biosynthesis protein FLHF; SRP GTPase, f 90.59
1jr3_D343 DNA polymerase III, delta subunit; processivity, p 90.53
2px0_A296 Flagellar biosynthesis protein FLHF; SRP GTPase, f 90.48
1nks_A194 Adenylate kinase; thermophilic, transferase; HET: 90.4
1u94_A356 RECA protein, recombinase A; homologous recombinat 90.39
1zuh_A168 Shikimate kinase; alpha-beta protein, transferase; 90.36
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 90.34
1ly1_A181 Polynucleotide kinase; PNK, phosphatase, transfera 90.29
1kag_A173 SKI, shikimate kinase I; transferase, structural g 90.22
3tlx_A243 Adenylate kinase 2; structural genomics, structura 90.2
1v5w_A343 DMC1, meiotic recombination protein DMC1/LIM15 hom 90.08
2rhm_A193 Putative kinase; P-loop containing nucleoside trip 90.04
1ex7_A186 Guanylate kinase; substrate-induced FIT, domain mo 90.04
1zu4_A320 FTSY; GTPase, signal recognition particle, SRP, re 90.03
3iij_A180 Coilin-interacting nuclear ATPase protein; alpha a 90.02
3uie_A200 Adenylyl-sulfate kinase 1, chloroplastic; rossmann 90.02
1jr3_D343 DNA polymerase III, delta subunit; processivity, p 89.99
2pt7_A330 CAG-ALFA; ATPase, protein-protein complex, type IV 89.95
3nbx_X500 ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structu 89.89
4a1f_A338 DNAB helicase, replicative DNA helicase; hydrolase 89.86
1g8p_A350 Magnesium-chelatase 38 kDa subunit; parallel beta 89.78
1zp6_A191 Hypothetical protein ATU3015; alpha-beta protein., 89.78
1tue_A212 Replication protein E1; helicase, replication, E1E 89.72
2ewv_A372 Twitching motility protein PILT; pilus retraction 89.62
2yvu_A186 Probable adenylyl-sulfate kinase; transferase, str 89.57
1via_A175 Shikimate kinase; structural genomics, transferase 89.55
2r2a_A199 Uncharacterized protein; zonular occludens toxin, 89.53
4eun_A200 Thermoresistant glucokinase; putative sugar kinase 89.52
2ze6_A253 Isopentenyl transferase; crown GALL tumor, cytokin 89.52
1kgd_A180 CASK, peripheral plasma membrane CASK; maguk, guan 89.51
2jaq_A205 Deoxyguanosine kinase; transferase, deoxyribonucle 89.29
2qgz_A308 Helicase loader, putative primosome component; str 89.27
1xjc_A169 MOBB protein homolog; structural genomics, midwest 89.23
3kl4_A433 SRP54, signal recognition 54 kDa protein; signal r 89.21
1kht_A192 Adenylate kinase; phosphotransferase, signaling pr 89.2
2zr9_A349 Protein RECA, recombinase A; recombination, RECA m 89.2
3t61_A202 Gluconokinase; PSI-biology, structural genomics, p 89.17
3l0o_A427 Transcription termination factor RHO; helicase, RH 89.16
3fwy_A314 Light-independent protochlorophyllide reductase I 89.11
2c95_A196 Adenylate kinase 1; transferase, AP4A, nucleotide 89.03
2vli_A183 Antibiotic resistance protein; transferase, tunica 89.01
2pjz_A263 Hypothetical protein ST1066; ATP binding protein, 88.88
2bdt_A189 BH3686; alpha-beta protein, structural genomics, P 88.76
1knq_A175 Gluconate kinase; ALFA/beta structure, transferase 88.67
2cbz_A237 Multidrug resistance-associated protein 1; ABC pro 88.61
1e6c_A173 Shikimate kinase; phosphoryl transfer, ADP, shikim 88.59
1y63_A184 LMAJ004144AAA protein; structural genomics, protei 88.57
1ukz_A203 Uridylate kinase; transferase; HET: ADP AMP; 1.90A 88.54
2iyv_A184 Shikimate kinase, SK; transferase, aromatic amino 88.54
1rz3_A201 Hypothetical protein rbstp0775; MCSG, structural g 88.53
2bwj_A199 Adenylate kinase 5; phosphoryl transfer reaction, 88.53
3cm0_A186 Adenylate kinase; ATP-binding, cytoplasm, nucleoti 88.49
3lw7_A179 Adenylate kinase related protein (ADKA-like); AMP, 88.43
1tev_A196 UMP-CMP kinase; ploop, NMP binding region, LID reg 88.42
2pt5_A168 Shikimate kinase, SK; aromatic amino acid biosynth 88.35
1uf9_A203 TT1252 protein; P-loop, nucleotide binding domain, 88.29
2plr_A213 DTMP kinase, probable thymidylate kinase; TMP-bind 88.29
1sky_E473 F1-ATPase, F1-ATP synthase; F1FO ATP synthase, alp 88.25
1uj2_A252 Uridine-cytidine kinase 2; alpha/beta mononucleoti 88.17
3tau_A208 Guanylate kinase, GMP kinase; structural genomics, 88.16
1nn5_A215 Similar to deoxythymidylate kinase (thymidylate K; 88.08
2j9r_A214 Thymidine kinase; TK1, DNK, lasso, transferase, AT 88.07
2qt1_A207 Nicotinamide riboside kinase 1; non-protein kinase 88.06
3p32_A355 Probable GTPase RV1496/MT1543; structural genomics 88.02
1aky_A220 Adenylate kinase; ATP:AMP phosphotransferase, myok 87.98
3a00_A186 Guanylate kinase, GMP kinase; domain movement, dim 87.89
1qf9_A194 UMP/CMP kinase, protein (uridylmonophosphate/cytid 87.88
2if2_A204 Dephospho-COA kinase; alpha-beta protein, structur 87.78
2qor_A204 Guanylate kinase; phosphotransferase, purine metab 87.76
2cdn_A201 Adenylate kinase; phosphoryl transfer, associative 87.68
3lda_A400 DNA repair protein RAD51; DNA binding protein, ATP 87.64
3kb2_A173 SPBC2 prophage-derived uncharacterized protein YOR 87.59
2grj_A192 Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosp 87.53
3c8u_A208 Fructokinase; YP_612366.1, putative fructose trans 87.32
3vr4_D465 V-type sodium ATPase subunit D; V-ATPase, rotary m 87.31
1ypw_A806 Transitional endoplasmic reticulum ATPase; AAA, P9 87.3
1gvn_B287 Zeta; postsegregational killing system, plasmid; 1 87.26
2dr3_A247 UPF0273 protein PH0284; RECA superfamily ATPase, h 87.19
2c61_A469 A-type ATP synthase non-catalytic subunit B; hydro 87.17
2xxa_A433 Signal recognition particle protein; protein trans 87.17
1g41_A444 Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dep 87.17
3e1s_A574 Exodeoxyribonuclease V, subunit RECD; alpha and be 87.15
1cke_A227 CK, MSSA, protein (cytidine monophosphate kinase); 87.14
1qhx_A178 CPT, protein (chloramphenicol phosphotransferase); 87.13
3ney_A197 55 kDa erythrocyte membrane protein; structural ge 87.1
2wwf_A212 Thymidilate kinase, putative; transferase, malaria 87.09
2pbr_A195 DTMP kinase, thymidylate kinase; transferase, nucl 87.09
3a4m_A260 L-seryl-tRNA(SEC) kinase; P-loop motif, walker A m 86.97
1pzn_A349 RAD51, DNA repair and recombination protein RAD51, 86.96
1tf7_A525 KAIC; homohexamer, hexamer, circadian clock protei 86.9
3ice_A422 Transcription termination factor RHO; transcriptio 86.9
3umf_A217 Adenylate kinase; rossmann fold, transferase; 2.05 86.88
2w0m_A235 SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus 86.84
1jjv_A206 Dephospho-COA kinase; P-loop nucleotide-binding fo 86.83
3tqc_A321 Pantothenate kinase; biosynthesis of cofactors, pr 86.82
1zp6_A191 Hypothetical protein ATU3015; alpha-beta protein., 86.81
2ffh_A425 Protein (FFH); SRP54, signal recognition particle, 86.75
1xx6_A191 Thymidine kinase; NESG, northeast structural genom 86.69
3bh0_A315 DNAB-like replicative helicase; ATPase, replicatio 86.67
4a74_A231 DNA repair and recombination protein RADA; hydrola 86.65
3vaa_A199 Shikimate kinase, SK; structural genomics, center 86.6
3gqb_B464 V-type ATP synthase beta chain; A3B3, V-ATPase, AT 86.55
3bgw_A444 DNAB-like replicative helicase; ATPase, replicatio 86.53
3k1j_A604 LON protease, ATP-dependent protease LON; ATP-bind 86.52
1zd8_A227 GTP:AMP phosphotransferase mitochondrial; ATP:AMP 86.45
3asz_A211 Uridine kinase; cytidine phosphorylation, transfer 86.44
1u94_A356 RECA protein, recombinase A; homologous recombinat 86.43
1zak_A222 Adenylate kinase; ATP:AMP-phosphotransferase, tran 86.37
2q6t_A444 DNAB replication FORK helicase; hydrolase; 2.90A { 86.37
4gp7_A171 Metallophosphoesterase; polynucleotide kinase phos 86.36
3nwj_A250 ATSK2; P loop, shikimate, nucleoside monophosphate 86.35
1n0w_A243 DNA repair protein RAD51 homolog 1; DNA repair, ho 86.35
1j8m_F297 SRP54, signal recognition 54 kDa protein; signalin 86.34
2j41_A207 Guanylate kinase; GMP, GMK, transferase, ATP-bindi 86.26
1g5t_A196 COB(I)alamin adenosyltransferase; P-loop protein, 86.21
3tr0_A205 Guanylate kinase, GMP kinase; purines, pyrimidines 86.18
3upu_A459 ATP-dependent DNA helicase DDA; RECA-like domain, 86.11
2pez_A179 Bifunctional 3'-phosphoadenosine 5'- phosphosulfat 86.09
3fb4_A216 Adenylate kinase; psychrophIle, phosphotransferase 86.03
1kgd_A180 CASK, peripheral plasma membrane CASK; maguk, guan 86.02
1gtv_A214 TMK, thymidylate kinase; transferase, transferase 85.94
2bbw_A246 Adenylate kinase 4, AK4; nucleotide kinase, nucleo 85.85
2zr9_A349 Protein RECA, recombinase A; recombination, RECA m 85.78
1ls1_A295 Signal recognition particle protein; FFH, SRP54, S 85.76
1kag_A173 SKI, shikimate kinase I; transferase, structural g 85.69
2p5t_B253 PEZT; postsegregational killing system, phosphoryl 85.68
2z0h_A197 DTMP kinase, thymidylate kinase; ATP-binding, nucl 85.68
3dl0_A216 Adenylate kinase; phosphotransferase, zinc coordin 85.61
2og2_A359 Putative signal recognition particle receptor; nuc 85.6
>3ozi_A L6TR; plant TIR domain, plant protein; 2.30A {Linum usitatissimum} Back     alignment and structure
Probab=100.00  E-value=1.8e-44  Score=382.69  Aligned_cols=172  Identities=35%  Similarity=0.661  Sum_probs=159.3

Q ss_pred             CCCCCCCCccEEEccccccccCchHHHHHHHHhhCCCceEeeC-CCCCCCCCchhHHHHhhhcceEEEEeccCcccchhh
Q 000202            8 PPRNDKKMYDVFLSFRGEDTRDNFTSHLYSALCQNNVETFIDN-DLKRGDEIPESLLGTIEASTISIIIFSEKYASSKWC   86 (1866)
Q Consensus         8 ~~~~~~~~~dvFis~~~~d~~~~~~~~l~~~L~~~g~~~~~d~-~~~~g~~~~~~~~~~i~~s~~~i~v~S~~y~~s~~c   86 (1866)
                      |++.+.++|||||||+|+|+|.+|++||+++|+++||++|+|+ ++++|+.|.++|.+||++||++|||||+||++|.||
T Consensus        28 s~~~~~~~yDVFISfrg~D~r~~Fv~~L~~aL~~~GI~~f~D~~el~~G~~I~~~l~~aIe~Sri~IvV~S~nYa~S~WC  107 (204)
T 3ozi_A           28 SGSFPSVEYEVFLSFRGPDTREQFTDFLYQSLRRYKIHTFRDDDELLKGKEIGPNLLRAIDQSKIYVPIISSGYADSKWC  107 (204)
T ss_dssp             ------CCCCEEEEECHHHHTTTHHHHHHHHHHHTTCCEEEEETTTCCGGGTTTTHHHHHHHCSEEEEEECTTGGGCHHH
T ss_pred             cCCCCCcCCeEEEeccccCCCHHHHHHHHHHHHHCCCcEEEeCCccCCCCchHHHHHHHHHhCcEeeEEEEcccccCcHH
Confidence            4456789999999999999999999999999999999999997 999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHhh-CCCEEEEEEEEecCCcccccccchhhhHHHHhhcch-hhhhhHHHHHHhhhccCCCcccccCccch
Q 000202           87 LDELLKILECKRN-YGQIVIPVFYRVDPSHVRKQIGSFGDSFFMLEERFP-YKMRNWRSALTEAADLSGFDSCVIRPESR  164 (1866)
Q Consensus        87 ~~El~~~~~~~~~-~~~~v~pvf~~v~p~~vr~~~g~~~~~~~~~~~~~~-~~~~~wr~al~~~a~~~g~~~~~~~~e~~  164 (1866)
                      ++||++|++|.++ ++++|+||||+|+|++||+|+|+||+||++|++++. +++++||.||++||+++||++.....+++
T Consensus       108 l~EL~~I~e~~~~~~~~~ViPIFY~VdPs~Vr~q~g~fg~af~~~~~~~~~~~v~~Wr~AL~~va~lsG~~~~~~~~e~~  187 (204)
T 3ozi_A          108 LMELAEIVRRQEEDPRRIILPIFYMVDPSDVRHQTGCYKKAFRKHANKFDGQTIQNWKDALKKVGDLKGWHIGKNDKQGA  187 (204)
T ss_dssp             HHHHHHHHHHHHHCTTSEECCEEESSCHHHHHHTCTTHHHHHHHHTTTSCHHHHHHHHHHHHHHHTSCBEEECTTSCHHH
T ss_pred             HHHHHHHHHHHHhcCCeeeEEEEeecCHHHHHhccccHHHHHHHHHHhhCHHHHHHHHHHHHHHhccCceecCCCCCHHH
Confidence            9999999999865 689999999999999999999999999999999875 67999999999999999999999888899


Q ss_pred             hhhhhHHHHhhcccc
Q 000202          165 LVADIANEVLERLDD  179 (1866)
Q Consensus       165 ~i~~i~~~v~~~l~~  179 (1866)
                      +|++|+++|+++|+.
T Consensus       188 ~i~~Iv~di~~kl~~  202 (204)
T 3ozi_A          188 IADKVSADIWSHISK  202 (204)
T ss_dssp             HHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHhcc
Confidence            999999999998763



>3jrn_A AT1G72930 protein; TIR domain arabidopsis thaliana, plant protein; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Back     alignment and structure
>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>3h16_A TIR protein; bacteria TIR domain, signaling protein; 2.50A {Paracoccus denitrificans PD1222} Back     alignment and structure
>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3ub2_A TOLL/interleukin-1 receptor domain-containing ADA protein; TIR domain, TLRS adaptor, immune system; 2.40A {Homo sapiens} PDB: 3ub3_A 3ub4_A 2y92_A Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>2js7_A Myeloid differentiation primary response protein MYD88; MYD88_human, TIR domain, TOLL like receptor adaptor domain, innate immune signaling; NMR {Homo sapiens} PDB: 2z5v_A Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>1fyx_A TOLL-like receptor 2; beta-alpha-beta fold, signaling protein; 2.80A {Homo sapiens} SCOP: c.23.2.1 PDB: 1fyw_A 1o77_A Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>1t3g_A X-linked interleukin-1 receptor accessory protein-like 1; TIR, IL-1RAPL, IL-1R, TLR, membrane protein; 2.30A {Homo sapiens} Back     alignment and structure
>2j67_A TOLL like receptor 10; TIR, IL-1, TLR10, membrane, innate immunity, immune response, leucine-rich repeat, glycoprotein, transmembrane; 2.20A {Homo sapiens} PDB: 1fyv_A Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2qen_A Walker-type ATPase; unknown function; HET: ADP; 2.25A {Pyrococcus abyssi} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A* Back     alignment and structure
>2fna_A Conserved hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE ADP; 2.00A {Sulfolobus solfataricus} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A* Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2qen_A Walker-type ATPase; unknown function; HET: ADP; 2.25A {Pyrococcus abyssi} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2fna_A Conserved hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE ADP; 2.00A {Sulfolobus solfataricus} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>3qfl_A MLA10; coiled-coil, (CC) domain, NLRS, nucleotide-binding domain, L rich repeat containing receptors, protein binding; 2.00A {Hordeum vulgare} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* Back     alignment and structure
>1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B* Back     alignment and structure
>2chq_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATP ATP-binding, nucleotide-binding; HET: ANP; 3.5A {Archaeoglobus fulgidus} PDB: 2chv_A Back     alignment and structure
>1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* Back     alignment and structure
>1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Back     alignment and structure
>3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A Back     alignment and structure
>2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* Back     alignment and structure
>1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C Back     alignment and structure
>1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} Back     alignment and structure
>3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} Back     alignment and structure
>1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B* Back     alignment and structure
>3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} Back     alignment and structure
>3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} Back     alignment and structure
>1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} Back     alignment and structure
>3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D* Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* Back     alignment and structure
>2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A Back     alignment and structure
>2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* Back     alignment and structure
>1a5t_A Delta prime, HOLB; zinc finger, DNA replication; 2.20A {Escherichia coli K12} SCOP: a.80.1.1 c.37.1.20 PDB: 1jr3_E* 1xxh_E* 1xxi_E* 3glf_E* 3glg_E* 3glh_E* 3gli_E* Back     alignment and structure
>2chq_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATP ATP-binding, nucleotide-binding; HET: ANP; 3.5A {Archaeoglobus fulgidus} PDB: 2chv_A Back     alignment and structure
>3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} Back     alignment and structure
>2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} Back     alignment and structure
>1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} Back     alignment and structure
>3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} Back     alignment and structure
>1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* Back     alignment and structure
>1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B* Back     alignment and structure
>4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_L 26S protease subunit RPT4; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} Back     alignment and structure
>3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A Back     alignment and structure
>4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Back     alignment and structure
>3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>4b4t_H 26S protease regulatory subunit 7 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_I 26S protease regulatory subunit 4 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 Back     alignment and structure
>3pxg_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 3.65A {Bacillus subtilis} Back     alignment and structure
>1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Back     alignment and structure
>2gno_A DNA polymerase III, gamma subunit-related protein; structural genomics, joint center for structural genomics, J protein structure initiative; HET: DNA; 2.00A {Thermotoga maritima} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A* Back     alignment and structure
>1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} Back     alignment and structure
>3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae} Back     alignment and structure
>1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* Back     alignment and structure
>2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A* Back     alignment and structure
>3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} Back     alignment and structure
>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* Back     alignment and structure
>2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* Back     alignment and structure
>1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Back     alignment and structure
>3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} Back     alignment and structure
>2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* Back     alignment and structure
>1ojl_A Transcriptional regulatory protein ZRAR; response regulator, two component system, AAA domain, NTRC family, DNA-binding; HET: ATP; 3.0A {Salmonella typhimurium} Back     alignment and structure
>3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} Back     alignment and structure
>3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* Back     alignment and structure
>3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B* Back     alignment and structure
>1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1a5t_A Delta prime, HOLB; zinc finger, DNA replication; 2.20A {Escherichia coli K12} SCOP: a.80.1.1 c.37.1.20 PDB: 1jr3_E* 1xxh_E* 1xxi_E* 3glf_E* 3glg_E* 3glh_E* 3gli_E* Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* Back     alignment and structure
>1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* Back     alignment and structure
>2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} Back     alignment and structure
>2c9o_A RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-binding, chromatin regulator, growth regulation, hydrolase, nuclear protein, DNA recombination; HET: ADP; 2.2A {Homo sapiens} PDB: 2xsz_A* Back     alignment and structure
>3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C Back     alignment and structure
>3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D* Back     alignment and structure
>1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* Back     alignment and structure
>2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A Back     alignment and structure
>2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* Back     alignment and structure
>3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} Back     alignment and structure
>2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} Back     alignment and structure
>3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} Back     alignment and structure
>3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A Back     alignment and structure
>2dhr_A FTSH; AAA+ protein, hexameric Zn metalloprotease, hydrolase; HET: ADP; 3.90A {Thermus thermophilus} Back     alignment and structure
>1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* Back     alignment and structure
>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} Back     alignment and structure
>2gno_A DNA polymerase III, gamma subunit-related protein; structural genomics, joint center for structural genomics, J protein structure initiative; HET: DNA; 2.00A {Thermotoga maritima} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1eiw_A Hypothetical protein MTH538; CHEY-like fold, flavodoxin-like fold, (A/B)5 doubly wound fold, parallel beta sheet; NMR {Methanothermobacterthermautotrophicus} SCOP: c.23.3.1 Back     alignment and structure
>2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} Back     alignment and structure
>2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} Back     alignment and structure
>2r44_A Uncharacterized protein; putative ATPase, structural genomics, joint center for struc genomics, JCSG; HET: MSE PG4; 2.00A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 Back     alignment and structure
>2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* Back     alignment and structure
>1um8_A ATP-dependent CLP protease ATP-binding subunit CL; CLPP binding loop, chaperone; HET: ADP; 2.60A {Helicobacter pylori} SCOP: c.37.1.20 Back     alignment and structure
>3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} Back     alignment and structure
>3pxg_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 3.65A {Bacillus subtilis} Back     alignment and structure
>4b4t_L 26S protease subunit RPT4; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3m6a_A ATP-dependent protease LA 1; alpha, beta, ATP-binding, hydrolase, nucleotide-binding, Pro serine protease, stress response; HET: ADP; 3.40A {Bacillus subtilis} PDB: 1x37_A Back     alignment and structure
>1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 Back     alignment and structure
>4b4t_H 26S protease regulatory subunit 7 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae} Back     alignment and structure
>1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>4b4t_I 26S protease regulatory subunit 4 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* Back     alignment and structure
>2vhj_A Ntpase P4, P4; non- hydrolysable ATP analogue, hydrolase, virus dsRNA, molecular motor, packaging ATPase, hexameric helicase; HET: ADP; 1.80A {Pseudomonas phage PHI12} PDB: 2vhq_A* 1w44_A* 1w46_A* 1w47_A* 1w48_A* 1w49_A* 1w4a_A* 1w4b_A* 1w4c_A 2vht_A* 2vhu_A* 2vhc_A* Back     alignment and structure
>1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* Back     alignment and structure
>1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* Back     alignment and structure
>2vhj_A Ntpase P4, P4; non- hydrolysable ATP analogue, hydrolase, virus dsRNA, molecular motor, packaging ATPase, hexameric helicase; HET: ADP; 1.80A {Pseudomonas phage PHI12} PDB: 2vhq_A* 1w44_A* 1w46_A* 1w47_A* 1w48_A* 1w49_A* 1w4a_A* 1w4b_A* 1w4c_A 2vht_A* 2vhu_A* 2vhc_A* Back     alignment and structure
>2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} Back     alignment and structure
>2b8t_A Thymidine kinase; deoxyribonucleoside kinase, zinc-binding domain, TK1, UU-TK, transferase; HET: THM; 2.00A {Ureaplasma parvum} SCOP: c.37.1.24 g.39.1.14 PDB: 2uz3_A* Back     alignment and structure
>2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* Back     alignment and structure
>2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} Back     alignment and structure
>2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* Back     alignment and structure
>2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} Back     alignment and structure
>4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* Back     alignment and structure
>2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* Back     alignment and structure
>3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* Back     alignment and structure
>1g5t_A COB(I)alamin adenosyltransferase; P-loop protein, cobalamin biosynthesis, RECA fold; HET: ATP; 1.80A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1g5r_A* 1g64_A* Back     alignment and structure
>1sky_E F1-ATPase, F1-ATP synthase; F1FO ATP synthase, alpha3BETA3 SUBC F1-ATPase, hydrolase; 3.20A {Bacillus SP} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 Back     alignment and structure
>1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* Back     alignment and structure
>1ye8_A Protein THEP1, hypothetical UPF0334 kinase-like protein AQ_1292; mixed alpha-beta protein, rossman fold, signaling protein, transferase; 1.40A {Aquifex aeolicus} SCOP: c.37.1.11 Back     alignment and structure
>2orw_A Thymidine kinase; TMTK, TP4A, transferase; HET: 4TA; 1.50A {Thermotoga maritima} PDB: 2qpo_A 2qq0_A* 2qqe_A* Back     alignment and structure
>2dhr_A FTSH; AAA+ protein, hexameric Zn metalloprotease, hydrolase; HET: ADP; 3.90A {Thermus thermophilus} Back     alignment and structure
>1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 Back     alignment and structure
>3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A* Back     alignment and structure
>2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus} Back     alignment and structure
>3ice_A Transcription termination factor RHO; transcription, ATPase, hexamer, helicase, RNA, RECA, OB fold ATP-binding, hydrolase; HET: MSE ADP SPD; 2.80A {Escherichia coli k-12} PDB: 1pv4_A 1pvo_A* 1xpo_A* 1xpr_A* 1xpu_A* 2ht1_A Back     alignment and structure
>3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B* Back     alignment and structure
>3hr8_A Protein RECA; alpha and beta proteins (A/B, A+B), ATP-binding, cytoplasm, damage, DNA recombination, DNA repair, DNA-binding; 1.95A {Thermotoga maritima} Back     alignment and structure
>1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 Back     alignment and structure
>1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A* Back     alignment and structure
>1ojl_A Transcriptional regulatory protein ZRAR; response regulator, two component system, AAA domain, NTRC family, DNA-binding; HET: ATP; 3.0A {Salmonella typhimurium} Back     alignment and structure
>2xxa_A Signal recognition particle protein; protein transport, RNA/RNA binding protein, hydrolase, gtpas; HET: GCP; 3.94A {Escherichia coli} PDB: 2j28_9 Back     alignment and structure
>2ck3_D ATP synthase subunit beta\, mitochondrial; hydrolase; HET: ANP ADP; 1.9A {Bos taurus} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 PDB: 1cow_D* 1bmf_D* 1e1q_D* 1e1r_D* 1efr_D* 1e79_D* 1h8h_D* 1ohh_D* 1qo1_D 1w0j_D* 1w0k_D* 1h8e_D* 2jdi_D* 2jiz_D* 2jj1_D* 2jj2_D* 2v7q_D* 2wss_D* 2w6j_D 2w6e_D ... Back     alignment and structure
>2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} Back     alignment and structure
>1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} Back     alignment and structure
>2r8r_A Sensor protein; KDPD, PFAM02702, MCSG, structural genomics, protein structure initiative, midwest center for structural genomics, kinase; 2.30A {Pseudomonas syringae PV} Back     alignment and structure
>1rz3_A Hypothetical protein rbstp0775; MCSG, structural genomics, PSI, protein structure initiative; 1.90A {Geobacillus stearothermophilus} SCOP: c.37.1.6 Back     alignment and structure
>3hws_A ATP-dependent CLP protease ATP-binding subunit CL; CLPXP, AAA+ molecular machine, hexamer, asymmetric,, ATP-BIN chaperone, metal-binding; HET: ADP; 3.25A {Escherichia coli} PDB: 3hte_A Back     alignment and structure
>1s96_A Guanylate kinase, GMP kinase; E.coli, dimer, SAD, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.1 PDB: 2an9_A* 2anb_A* 2anc_A 2f3r_A* 2f3t_A* Back     alignment and structure
>3hyn_A Putative signal transduction protein; DUF1863 family protein, nucleotide-binding protein, structur genomics; HET: MSE; 1.20A {Eubacterium rectale atcc 33656} Back     alignment and structure
>3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP} Back     alignment and structure
>3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} SCOP: c.37.1.1 PDB: 2axp_A* Back     alignment and structure
>3bh0_A DNAB-like replicative helicase; ATPase, replication; 2.35A {Bacillus phage SPP1} Back     alignment and structure
>3hr8_A Protein RECA; alpha and beta proteins (A/B, A+B), ATP-binding, cytoplasm, damage, DNA recombination, DNA repair, DNA-binding; 1.95A {Thermotoga maritima} Back     alignment and structure
>3io5_A Recombination and repair protein; storage dimer, inactive conformation, RECA like core domain, binding, DNA damage, DNA recombination; 2.40A {Enterobacteria phage T4} Back     alignment and structure
>1fx0_B ATP synthase beta chain; latent ATPase, thermal stability, potential tentoxin binding hydrolase; 3.20A {Spinacia oleracea} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 PDB: 1kmh_B* Back     alignment and structure
>1xp8_A RECA protein, recombinase A; recombination, radioresistance, DNA-repair, ATPase, DNA-BIND protein, DNA binding protein; HET: AGS; 2.50A {Deinococcus radiodurans} SCOP: c.37.1.11 d.48.1.1 Back     alignment and structure
>1v5w_A DMC1, meiotic recombination protein DMC1/LIM15 homolog; DNA-binding protein, ring protein, octamer, AAA ATPase; 3.20A {Homo sapiens} SCOP: c.37.1.11 PDB: 2zjb_A Back     alignment and structure
>3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii} Back     alignment and structure
>1xp8_A RECA protein, recombinase A; recombination, radioresistance, DNA-repair, ATPase, DNA-BIND protein, DNA binding protein; HET: AGS; 2.50A {Deinococcus radiodurans} SCOP: c.37.1.11 d.48.1.1 Back     alignment and structure
>3m6a_A ATP-dependent protease LA 1; alpha, beta, ATP-binding, hydrolase, nucleotide-binding, Pro serine protease, stress response; HET: ADP; 3.40A {Bacillus subtilis} PDB: 1x37_A Back     alignment and structure
>2i1q_A DNA repair and recombination protein RADA; ATPase, recombinase, ATP complex, calcium stimulation, RECA, DMC1; HET: DNA ANP; 1.90A {Methanococcus voltae} SCOP: a.60.4.1 c.37.1.11 PDB: 1xu4_A* 2b21_A* 2fpk_A* 2fpl_A* 2fpm_A* 1t4g_A* 3fyh_A* 2f1j_A* 2f1i_A* 2f1h_A* 3ntu_A* 3ewa_A* 3ew9_A* 3etl_A* 4dc9_A* 2gdj_A* Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>1odf_A YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser2 intergenic region; yeast protein, ATP binding protein; 2.25A {Saccharomyces cerevisiae} SCOP: c.37.1.6 Back     alignment and structure
>3io5_A Recombination and repair protein; storage dimer, inactive conformation, RECA like core domain, binding, DNA damage, DNA recombination; 2.40A {Enterobacteria phage T4} Back     alignment and structure
>2z43_A DNA repair and recombination protein RADA; archaea, filament, DNA binding, molecular SWI RECA, DMC1; HET: DNA; 1.93A {Sulfolobus solfataricus} PDB: 2bke_A* 2dfl_A* 2zub_A* 2zuc_A* 2zud_A* Back     alignment and structure
>3lw7_A Adenylate kinase related protein (ADKA-like); AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 2.30A {Sulfolobus solfataricus} PDB: 3h0k_A Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>3sr0_A Adenylate kinase; phosphoryl transfer analogue, ALF4, transferase (phosphotran phosphoryl transfer, nucleotide-binding; HET: ADP AMP; 1.56A {Aquifex aeolicus} PDB: 2rh5_A 2rgx_A* Back     alignment and structure
>2ga8_A Hypothetical 39.9 kDa protein; YFR007W, YFH7, unknown function; HET: CME; 1.77A {Saccharomyces cerevisiae} PDB: 2gaa_A* Back     alignment and structure
>2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* Back     alignment and structure
>1jr3_D DNA polymerase III, delta subunit; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1jqj_C* 1xxh_A* 1xxi_A* 3glf_A* 3glg_A* 3glh_A* 3gli_A* Back     alignment and structure
>2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* Back     alignment and structure
>1nks_A Adenylate kinase; thermophilic, transferase; HET: AMP ADP; 2.57A {Sulfolobus acidocaldarius} SCOP: c.37.1.1 Back     alignment and structure
>1u94_A RECA protein, recombinase A; homologous recombination, ATPase, DNA repair, DNA binding protein; 1.90A {Escherichia coli} SCOP: c.37.1.11 d.48.1.1 PDB: 1u98_A 1u99_A 1xms_A* 1xmv_A* 2rec_A 2reb_A 1n03_A* 1rea_A 1aa3_A Back     alignment and structure
>1zuh_A Shikimate kinase; alpha-beta protein, transferase; 1.80A {Helicobacter pylori} PDB: 1zui_A* 3hr7_A 3muf_A* 3mrs_A 3n2e_A* Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>1ly1_A Polynucleotide kinase; PNK, phosphatase, transferase; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 Back     alignment and structure
>1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2 Back     alignment and structure
>3tlx_A Adenylate kinase 2; structural genomics, structural genomics consortium, SGC, RO fold, transferase, ATP binding, phosphorylation; HET: ADP ATP AMP; 2.75A {Plasmodium falciparum} Back     alignment and structure
>1v5w_A DMC1, meiotic recombination protein DMC1/LIM15 homolog; DNA-binding protein, ring protein, octamer, AAA ATPase; 3.20A {Homo sapiens} SCOP: c.37.1.11 PDB: 2zjb_A Back     alignment and structure
>2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus} Back     alignment and structure
>1ex7_A Guanylate kinase; substrate-induced FIT, domain movement, GMP, ATP, substrate specificity, X-RAY diffraction, transferase; HET: 5GP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1ex6_A* 1gky_A* 3sqk_A 4f4j_A Back     alignment and structure
>1zu4_A FTSY; GTPase, signal recognition particle, SRP, receptor, protein transport; 1.95A {Mycoplasma mycoides} PDB: 1zu5_A Back     alignment and structure
>3iij_A Coilin-interacting nuclear ATPase protein; alpha and beta proteins (A/B), protein binding, transferase, phosphotransferase; HET: ADP; 1.76A {Homo sapiens} SCOP: c.37.1.1 PDB: 3iik_A 3iil_A* 3iim_A* 1rkb_A Back     alignment and structure
>3uie_A Adenylyl-sulfate kinase 1, chloroplastic; rossmann fold, transferase-transferase complex; HET: ADX ANP; 1.79A {Arabidopsis thaliana} SCOP: c.37.1.0 PDB: 4fxp_A* Back     alignment and structure
>1jr3_D DNA polymerase III, delta subunit; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1jqj_C* 1xxh_A* 1xxi_A* 3glf_A* 3glg_A* 3glh_A* 3gli_A* Back     alignment and structure
>2pt7_A CAG-ALFA; ATPase, protein-protein complex, type IV secretion, hydrolas binding complex; 2.40A {Helicobacter pylori} SCOP: c.37.1.11 PDB: 1nly_A* 1nlz_A 1opx_A* 1g6o_A Back     alignment and structure
>3nbx_X ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structure, rossman fold, hydro; HET: ADP; 2.91A {Escherichia coli} Back     alignment and structure
>4a1f_A DNAB helicase, replicative DNA helicase; hydrolase, DNA replication, ATPase; HET: FLC; 2.50A {Helicobacter pylori} Back     alignment and structure
>1g8p_A Magnesium-chelatase 38 kDa subunit; parallel beta sheet, P-loop, rossman fold, AAA+, photosynthesis, metal transport; 2.10A {Rhodobacter capsulatus} SCOP: c.37.1.20 PDB: 2x31_G Back     alignment and structure
>1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 Back     alignment and structure
>1tue_A Replication protein E1; helicase, replication, E1E2 complex, AAA+ protein; 2.10A {Human papillomavirus type 18} SCOP: c.37.1.20 Back     alignment and structure
>2ewv_A Twitching motility protein PILT; pilus retraction motor, ATPase, hexameric PILT, protein TRAN; HET: ADP; 2.80A {Aquifex aeolicus} PDB: 2eww_A* 2gsz_A* Back     alignment and structure
>2yvu_A Probable adenylyl-sulfate kinase; transferase, structural genomics, NPPSFA, national P protein structural and functional analyses; 2.10A {Aeropyrum pernix} Back     alignment and structure
>1via_A Shikimate kinase; structural genomics, transferase; HET: MSE; 1.57A {Campylobacter jejuni} SCOP: c.37.1.2 Back     alignment and structure
>2r2a_A Uncharacterized protein; zonular occludens toxin, structural genomics, APC84050.2, PS protein structure initiative; HET: MSE; 1.82A {Neisseria meningitidis MC58} Back     alignment and structure
>4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} Back     alignment and structure
>2ze6_A Isopentenyl transferase; crown GALL tumor, cytokinin biosynthesis; HET: DST AMP; 2.10A {Agrobacterium tumefaciens} PDB: 2ze5_A* 2ze7_A* 2ze8_A Back     alignment and structure
>1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>2jaq_A Deoxyguanosine kinase; transferase, deoxyribonucleoside kinase; HET: DCP; 2.3A {Mycoplasma mycoides subsp} PDB: 2jat_A* 2jas_A* Back     alignment and structure
>2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} Back     alignment and structure
>1xjc_A MOBB protein homolog; structural genomics, midwest center for structural GEN PSI, protein structure initiative, MCSG; 2.10A {Geobacillus stearothermophilus} SCOP: c.37.1.10 Back     alignment and structure
>3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A Back     alignment and structure
>1kht_A Adenylate kinase; phosphotransferase, signaling protein, transferase; HET: AMP; 2.50A {Methanococcus voltae} SCOP: c.37.1.1 PDB: 3h86_B* 1ki9_A Back     alignment and structure
>2zr9_A Protein RECA, recombinase A; recombination, RECA mutants, DNA-repair, ATP-binding, DNA DA recombination, DNA repair, DNA-binding; HET: DTP; 2.50A {Mycobacterium smegmatis str} PDB: 2zr0_A* 2zra_A* 2zrb_A 2zrm_A* 1ubc_A* 1ubf_A* 1ubg_A* 1ube_A* 2g88_A* 2odw_A* 2oe2_A 2oep_A* 2oes_A 2ofo_A 2zr7_A 2odn_A* 2zrn_A 2zro_A* 2zrp_A* 2zre_A* ... Back     alignment and structure
>3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti} Back     alignment and structure
>3l0o_A Transcription termination factor RHO; helicase, RHO factor, RNA capture mechanism, ATP-binding, hydrolase, nucleotide-binding, RN binding; 2.35A {Thermotoga maritima} Back     alignment and structure
>3fwy_A Light-independent protochlorophyllide reductase I ATP-binding protein; BCHL, electron donor, DPOR, Fe protein, nitrogenase; HET: ADP; 1.63A {Rhodobacter sphaeroides 2} Back     alignment and structure
>2c95_A Adenylate kinase 1; transferase, AP4A, nucleotide kinase, transferase ATP-bindi; HET: B4P; 1.71A {Homo sapiens} PDB: 1z83_A* 3adk_A Back     alignment and structure
>2vli_A Antibiotic resistance protein; transferase, tunicamycin, phosphotransferase; 1.95A {Deinococcus radiodurans} Back     alignment and structure
>2pjz_A Hypothetical protein ST1066; ATP binding protein, structural genomics, NPPSFA; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG, function; 2.40A {Bacillus halodurans} SCOP: c.37.1.25 Back     alignment and structure
>1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A* Back     alignment and structure
>2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens} Back     alignment and structure
>1e6c_A Shikimate kinase; phosphoryl transfer, ADP, shikimate pathway, P-loop protein, transferase; 1.8A {Erwinia chrysanthemi} SCOP: c.37.1.2 PDB: 1shk_A 2shk_A* Back     alignment and structure
>1y63_A LMAJ004144AAA protein; structural genomics, protein structure initiative, PSI, SGPP structural genomics of pathogenic protozoa consortium; HET: ADP; 1.70A {Leishmania major} SCOP: c.37.1.1 Back     alignment and structure
>1ukz_A Uridylate kinase; transferase; HET: ADP AMP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1uky_A* Back     alignment and structure
>2iyv_A Shikimate kinase, SK; transferase, aromatic amino acid biosynthesis, P-loop kinase, metal- binding, shikimate pathway; HET: ADP; 1.35A {Mycobacterium tuberculosis} SCOP: c.37.1.2 PDB: 2iyr_A* 2iyq_A* 2iyt_A 2iyu_A* 2iys_A* 2iyw_A* 2iyx_A* 2iyy_A* 2iyz_A* 2g1k_A* 1l4y_A* 1u8a_A* 1we2_A* 1zyu_A* 2dfn_A* 2dft_A* 2g1j_A 1l4u_A* 3baf_A* Back     alignment and structure
>1rz3_A Hypothetical protein rbstp0775; MCSG, structural genomics, PSI, protein structure initiative; 1.90A {Geobacillus stearothermophilus} SCOP: c.37.1.6 Back     alignment and structure
>2bwj_A Adenylate kinase 5; phosphoryl transfer reaction, transferase; HET: AMP; 2.3A {Homo sapiens} Back     alignment and structure
>3cm0_A Adenylate kinase; ATP-binding, cytoplasm, nucleotide biosynthesis, nucleotide-binding, transferase, structural genomics; 1.80A {Thermus thermophilus} Back     alignment and structure
>3lw7_A Adenylate kinase related protein (ADKA-like); AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 2.30A {Sulfolobus solfataricus} PDB: 3h0k_A Back     alignment and structure
>1tev_A UMP-CMP kinase; ploop, NMP binding region, LID region, conformational changes, transferase; 2.10A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>2pt5_A Shikimate kinase, SK; aromatic amino acid biosynthesis, P-loop kinase, SHI kinase, shikimate pathway; 2.10A {Aquifex aeolicus} Back     alignment and structure
>1uf9_A TT1252 protein; P-loop, nucleotide binding domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: ATP; 2.80A {Thermus thermophilus} SCOP: c.37.1.1 Back     alignment and structure
>2plr_A DTMP kinase, probable thymidylate kinase; TMP-binding, ATP-binding, structural GEN NPPSFA; HET: 1PE PGE EPE PG4; 1.60A {Sulfolobus tokodaii} Back     alignment and structure
>1sky_E F1-ATPase, F1-ATP synthase; F1FO ATP synthase, alpha3BETA3 SUBC F1-ATPase, hydrolase; 3.20A {Bacillus SP} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 Back     alignment and structure
>1uj2_A Uridine-cytidine kinase 2; alpha/beta mononucleotide-binding HOLD, transferase; HET: C5P ADP; 1.80A {Homo sapiens} SCOP: c.37.1.6 PDB: 1uei_A* 1uej_A* 1udw_A 1ufq_A* 1xrj_A* Back     alignment and structure
>3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1nn5_A Similar to deoxythymidylate kinase (thymidylate K; P-loop, D4TMP, transferase; HET: 2DT ANP; 1.50A {Homo sapiens} SCOP: c.37.1.1 PDB: 1e2e_A* 1e2d_A* 1e2g_A* 1e2q_A* 1e99_A* 1e9a_A* 1e9b_A* 1nmx_A* 1nmz_A* 1nn0_A* 1nn1_A* 1e2f_A* 1nn3_A* 2xx3_A* 1e9c_A* 1e9d_A* 1e9e_A* 1e98_A* 1nmy_A* 1e9f_A* Back     alignment and structure
>2j9r_A Thymidine kinase; TK1, DNK, lasso, transferase, ATP-binding, deoxyribonucleoside kinase, DNA synthesis, phosphate accept nucleotide-binding; HET: THM; 2.7A {Bacillus anthracis} PDB: 2ja1_A* Back     alignment and structure
>2qt1_A Nicotinamide riboside kinase 1; non-protein kinase, NAD+, NRK1, nicotinic acid riboside kinase activity, NAD biosynthesis; HET: NNR; 1.32A {Homo sapiens} PDB: 2qsy_A* 2qsz_A* 2qt0_A* 2p0e_A* 2qg6_A* 2ql6_A* Back     alignment and structure
>3p32_A Probable GTPase RV1496/MT1543; structural genomics, seattle structural genomics center for infectious disease, ssgcid, MEAB, MMAA; HET: GDP PGE; 1.90A {Mycobacterium tuberculosis} PDB: 3md0_A* 4gt1_A* 3nxs_A* 3tk1_A* Back     alignment and structure
>1aky_A Adenylate kinase; ATP:AMP phosphotransferase, myokinase, transferase (phosphotransferase); HET: AP5; 1.63A {Saccharomyces cerevisiae} SCOP: c.37.1.1 g.41.2.1 PDB: 2aky_A* 3aky_A* 1dvr_A* Back     alignment and structure
>1qf9_A UMP/CMP kinase, protein (uridylmonophosphate/cytidylmonophosphate kinase); nucleoside monophosphate kinase, NMP kinase; HET: ADP C5P; 1.70A {Dictyostelium discoideum} SCOP: c.37.1.1 PDB: 1uke_A* 2ukd_A* 3ukd_A* 4ukd_A* 5ukd_A* Back     alignment and structure
>2if2_A Dephospho-COA kinase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 3.00A {Aquifex aeolicus} Back     alignment and structure
>2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax} Back     alignment and structure
>2cdn_A Adenylate kinase; phosphoryl transfer, associative mechanism, ATP-binding, nucleotide biosynthesis, nucleotide-binding, transferase; HET: ADP; 1.9A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1p4s_A Back     alignment and structure
>3lda_A DNA repair protein RAD51; DNA binding protein, ATP-binding, DNA damage, DNA recombinat repair, nucleotide-binding; HET: DNA; 2.50A {Saccharomyces cerevisiae} PDB: 1szp_A* Back     alignment and structure
>3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} SCOP: c.37.1.1 PDB: 2axp_A* Back     alignment and structure
>2grj_A Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosphocoenzyme kinase, structural genomics, joint center for structural GE JCSG; HET: ADP COD; 2.60A {Thermotoga maritima} Back     alignment and structure
>3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP} Back     alignment and structure
>3vr4_D V-type sodium ATPase subunit D; V-ATPase, rotary motor, P-loop, hydrolas ATPase, ATP binding; HET: MSE B3P; 2.17A {Enterococcus hirae} PDB: 3vr3_D* 3vr2_D* 3vr5_D 3vr6_D* Back     alignment and structure
>1gvn_B Zeta; postsegregational killing system, plasmid; 1.95A {Streptococcus pyogenes} SCOP: c.37.1.21 PDB: 3q8x_B* Back     alignment and structure
>2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii} Back     alignment and structure
>2c61_A A-type ATP synthase non-catalytic subunit B; hydrolase, H+ ATPase, A1AO, ATP synthesis, hydrogen ION transport, ION transport; 1.5A {Methanosarcina mazei GO1} PDB: 3dsr_A* 3b2q_A* 2rkw_A* 3eiu_A* Back     alignment and structure
>2xxa_A Signal recognition particle protein; protein transport, RNA/RNA binding protein, hydrolase, gtpas; HET: GCP; 3.94A {Escherichia coli} PDB: 2j28_9 Back     alignment and structure
>1g41_A Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dependent proteolysis, chaperone; HET: ADP; 2.30A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1g3i_A* 1im2_A* 1kyi_A* 1g4a_E* 1g4b_E 1yyf_A* 1do0_A* 1do2_A* 1e94_E* 1hqy_E* 1ht1_E* 1ht2_E* Back     alignment and structure
>3e1s_A Exodeoxyribonuclease V, subunit RECD; alpha and beta protein, ATP-binding, nucleotide-binding, HYD; 2.20A {Deinococcus radiodurans} PDB: 3gp8_A 3gpl_A* Back     alignment and structure
>1cke_A CK, MSSA, protein (cytidine monophosphate kinase); nucleotide monophosphate kinase,, transferase; 1.75A {Escherichia coli} SCOP: c.37.1.1 PDB: 1kdo_A* 1kdp_A* 1kdr_A* 1kdt_A* 2cmk_A* 2fem_A 2feo_A* Back     alignment and structure
>1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A* Back     alignment and structure
>3ney_A 55 kDa erythrocyte membrane protein; structural genomics consortium, SGC, 55 kDa erythrocyte MEMB protein; 2.26A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>2wwf_A Thymidilate kinase, putative; transferase, malaria; HET: TMP ADP; 1.89A {Plasmodium falciparum} PDB: 2wwg_A* 2wwh_A* 2wwi_A* Back     alignment and structure
>2pbr_A DTMP kinase, thymidylate kinase; transferase, nucleotide biosynthesis, TMP-binding, A binding, structural genomics, NPPSFA; 1.96A {Aquifex aeolicus} Back     alignment and structure
>3a4m_A L-seryl-tRNA(SEC) kinase; P-loop motif, walker A motif, ATP binding motif, ATP- binding, nucleotide-binding, transferase; HET: ADP; 1.79A {Methanocaldococcus jannaschii} PDB: 3a4l_A* 3a4n_A 3am1_A* 3add_A* 3adc_A* 3adb_A* Back     alignment and structure
>1pzn_A RAD51, DNA repair and recombination protein RAD51, RADA; heptameric ring, heptamer, ring, oligomer, RAD51 polymerizat motif; HET: DNA; 2.85A {Pyrococcus furiosus} SCOP: a.60.4.1 c.37.1.11 Back     alignment and structure
>1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* Back     alignment and structure
>3ice_A Transcription termination factor RHO; transcription, ATPase, hexamer, helicase, RNA, RECA, OB fold ATP-binding, hydrolase; HET: MSE ADP SPD; 2.80A {Escherichia coli k-12} PDB: 1pv4_A 1pvo_A* 1xpo_A* 1xpr_A* 1xpu_A* 2ht1_A Back     alignment and structure
>3umf_A Adenylate kinase; rossmann fold, transferase; 2.05A {Schistosoma mansoni} Back     alignment and structure
>2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} Back     alignment and structure
>1jjv_A Dephospho-COA kinase; P-loop nucleotide-binding fold, structure 2 function project, S2F, structural genomics, transferase; HET: ATP; 2.00A {Haemophilus influenzae} SCOP: c.37.1.1 Back     alignment and structure
>3tqc_A Pantothenate kinase; biosynthesis of cofactors, prosthetic groups, carriers, TRAN; HET: ADP; 2.30A {Coxiella burnetii} Back     alignment and structure
>1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 Back     alignment and structure
>2ffh_A Protein (FFH); SRP54, signal recognition particle, GTPase, M domain, RNA-binding, signal sequence-binding, helix-turn-helix, protein targeting; 3.20A {Thermus aquaticus} SCOP: a.24.13.1 a.36.1.1 c.37.1.10 PDB: 2iy3_A Back     alignment and structure
>1xx6_A Thymidine kinase; NESG, northeast structural genomics consortium, protein STRU initiative, PSI, structural genomics, DNA synthesis; HET: ADP; 2.00A {Clostridium acetobutylicum} SCOP: c.37.1.24 g.39.1.14 Back     alignment and structure
>3bh0_A DNAB-like replicative helicase; ATPase, replication; 2.35A {Bacillus phage SPP1} Back     alignment and structure
>4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A* Back     alignment and structure
>3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3gqb_B V-type ATP synthase beta chain; A3B3, V-ATPase, ATP synthesis, ATP-binding, hydrogen ION TRA hydrolase, ION transport; 2.80A {Thermus thermophilus HB8} PDB: 3a5c_D* 3a5d_D 3j0j_D* Back     alignment and structure
>3bgw_A DNAB-like replicative helicase; ATPase, replication; 3.91A {Bacillus phage SPP1} Back     alignment and structure
>3k1j_A LON protease, ATP-dependent protease LON; ATP-binding, nucleotide-binding, Pro hydrolase; HET: ADP PE8; 2.00A {Thermococcus onnurineus} Back     alignment and structure
>1zd8_A GTP:AMP phosphotransferase mitochondrial; ATP:AMP phosphotransferase, myokinase, structural genomics, structural genomics consortium, SGC; 1.48A {Homo sapiens} PDB: 2ak3_A* Back     alignment and structure
>3asz_A Uridine kinase; cytidine phosphorylation, transferase; HET: C5P; 2.25A {Thermus thermophilus} PDB: 3asy_A* Back     alignment and structure
>1u94_A RECA protein, recombinase A; homologous recombination, ATPase, DNA repair, DNA binding protein; 1.90A {Escherichia coli} SCOP: c.37.1.11 d.48.1.1 PDB: 1u98_A 1u99_A 1xms_A* 1xmv_A* 2rec_A 2reb_A 1n03_A* 1rea_A 1aa3_A Back     alignment and structure
>1zak_A Adenylate kinase; ATP:AMP-phosphotransferase, transferase; HET: AP5; 3.50A {Zea mays} SCOP: c.37.1.1 g.41.2.1 Back     alignment and structure
>2q6t_A DNAB replication FORK helicase; hydrolase; 2.90A {Thermus aquaticus} Back     alignment and structure
>4gp7_A Metallophosphoesterase; polynucleotide kinase phosphatase, RNA repair, transferase; HET: ATP CIT; 2.00A {Clostridium thermocellum} PDB: 4gp6_A* Back     alignment and structure
>3nwj_A ATSK2; P loop, shikimate, nucleoside monophosphate kinase, shikimat ATP binding, chloroplast, transferase; 2.35A {Arabidopsis thaliana} Back     alignment and structure
>1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>1j8m_F SRP54, signal recognition 54 kDa protein; signaling protein; 2.00A {Acidianus ambivalens} SCOP: a.24.13.1 c.37.1.10 PDB: 1j8y_F Back     alignment and structure
>2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus} Back     alignment and structure
>1g5t_A COB(I)alamin adenosyltransferase; P-loop protein, cobalamin biosynthesis, RECA fold; HET: ATP; 1.80A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1g5r_A* 1g64_A* Back     alignment and structure
>3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii} Back     alignment and structure
>3upu_A ATP-dependent DNA helicase DDA; RECA-like domain, SH3 domain, PIN-tower interface, coupling hydrolysis to DNA unwinding, ssDNA; 3.30A {Enterobacteria phage T4} Back     alignment and structure
>2pez_A Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthetase 1 (PAPS synthetase...; NMP-kinase fold, protein in complex with nucleic acid; HET: GGZ DAT; 1.40A {Homo sapiens} PDB: 2pey_A* 2ax4_A* Back     alignment and structure
>3fb4_A Adenylate kinase; psychrophIle, phosphotransferase, ATP-binding, nucleotide-binding, transferase; HET: AP5; 2.00A {Marinibacillus marinus} Back     alignment and structure
>1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>1gtv_A TMK, thymidylate kinase; transferase, transferase (ATP:TMP phosphotransferase); HET: TYD TMP; 1.55A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1g3u_A* 1gsi_A* 1mrn_A* 1mrs_A* 1n5i_A* 1n5j_A* 1n5k_A* 1n5l_A* 1w2g_A* 1w2h_A* Back     alignment and structure
>2bbw_A Adenylate kinase 4, AK4; nucleotide kinase, nucleotide binding, human, structura genomics, structural genomics consortium, SGC, transferase; HET: GP5; 2.05A {Homo sapiens} PDB: 2ar7_A* 3ndp_A Back     alignment and structure
>2zr9_A Protein RECA, recombinase A; recombination, RECA mutants, DNA-repair, ATP-binding, DNA DA recombination, DNA repair, DNA-binding; HET: DTP; 2.50A {Mycobacterium smegmatis str} PDB: 2zr0_A* 2zra_A* 2zrb_A 2zrm_A* 1ubc_A* 1ubf_A* 1ubg_A* 1ube_A* 2g88_A* 2odw_A* 2oe2_A 2oep_A* 2oes_A 2ofo_A 2zr7_A 2odn_A* 2zrn_A 2zro_A* 2zrp_A* 2zre_A* ... Back     alignment and structure
>1ls1_A Signal recognition particle protein; FFH, SRP54, SRP, GTPase, ultrahigh resolution, protein transport; 1.10A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 1jpn_B* 1jpj_A* 1ry1_U* 2j45_A* 1o87_A* 2c04_A* 2j46_A* 1rj9_B* 2c03_A* 2j7p_A* 1okk_A* 2cnw_A* 1ng1_A* 2xkv_A 3ng1_A 1ffh_A 2ng1_A* Back     alignment and structure
>1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2 Back     alignment and structure
>2p5t_B PEZT; postsegregational killing system, phosphoryltransferase, HEL helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae} Back     alignment and structure
>3dl0_A Adenylate kinase; phosphotransferase, zinc coordination, ATP-binding, binding, nucleotide biosynthesis, nucleotide-binding, trans; HET: AP5; 1.58A {Bacillus subtilis} PDB: 1p3j_A* 2ori_A* 2eu8_A* 2oo7_A* 2p3s_A* 2qaj_A* 2osb_A* 3dkv_A* 1zin_A* 1zio_A* 1zip_A* 1s3g_A* Back     alignment and structure
>2og2_A Putative signal recognition particle receptor; nucleotide-binding, protein transport; 2.00A {Arabidopsis thaliana} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 1866
d2a5yb3277 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenor 5e-37
d2a5yb3277 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenor 1e-27
d2a5yb3277 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenor 1e-08
d1fyva_161 c.23.2.1 (A:) Toll-like receptor 1, TLR1 {Human (H 2e-16
d1fyxa_149 c.23.2.1 (A:) Toll-like receptor 2, TLR2 {Human (H 4e-14
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 8e-10
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 1e-08
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 4e-06
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 2e-07
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 3e-06
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 0.001
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 2e-06
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 5e-04
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 6e-06
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 1e-04
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 4e-04
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 9e-04
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 0.001
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: CED-4, NB-ARC domain
species: Caenorhabditis elegans [TaxId: 6239]
 Score =  139 bits (351), Expect = 5e-37
 Identities = 42/253 (16%), Positives = 82/253 (32%), Gaps = 20/253 (7%)

Query: 198 IESLLRTGSAGVYKLGIWGIGGIGKTTIAGAVFNK----ISRHFEGSYFACNVRAAEETG 253
           I+ L        + L + G  G GK+ IA    +K    I  +++   +           
Sbjct: 33  IKKLDEMCDLDSFFLFLHGRAGSGKSVIASQALSKSDQLIGINYDSIVWLK-DSGTAPKS 91

Query: 254 RLDDLRKELLSKLLNDRNVKNFQNI-------SVNFQSKRLARKKVLIVFDDVNHPRQIE 306
             D     LL     D  +                  +  + R   L VFDDV     I 
Sbjct: 92  TFDLFTDILLMLKSEDDLLNFPSVEHVTSVVLKRMICNALIDRPNTLFVFDDVVQEETIR 151

Query: 307 LLIGRLDRFASGSQVIITTRDKQVLTNCEVD-HIYQMKELVHADAHKLFTQCAFRGDHLD 365
                        + ++TTRD ++           ++  L   + +            + 
Sbjct: 152 WA------QELRLRCLVTTRDVEISNAASQTCEFIEVTSLEIDECYDFLEAYGMP-MPVG 204

Query: 366 AGYTELAHKALKYAQGVPLALKVLGCYLCGRSKEEWESAMRKLEIVPHMEIQEVLKISYD 425
               ++ +K ++ + G P  L +       ++ E+      KLE    + ++ +   SY 
Sbjct: 205 EKEEDVLNKTIELSSGNPATLMMFFKSCEPKTFEKMAQLNNKLESRGLVGVECITPYSYK 264

Query: 426 SLDDSQKRMHDLL 438
           SL  + +R  ++L
Sbjct: 265 SLAMALQRCVEVL 277


>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d1fyva_ c.23.2.1 (A:) Toll-like receptor 1, TLR1 {Human (Homo sapiens) [TaxId: 9606]} Length = 161 Back     information, alignment and structure
>d1fyxa_ c.23.2.1 (A:) Toll-like receptor 2, TLR2 {Human (Homo sapiens) [TaxId: 9606]} Length = 149 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query1866
d2a5yb3277 CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI 100.0
d2a5yb3277 CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI 100.0
d1fyva_161 Toll-like receptor 1, TLR1 {Human (Homo sapiens) [ 99.62
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.61
d1fyxa_149 Toll-like receptor 2, TLR2 {Human (Homo sapiens) [ 99.55
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.54
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.51
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.38
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.37
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.34
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.33
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.33
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.29
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.29
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.26
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.23
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.15
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.14
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.13
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.1
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.09
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.08
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.07
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.04
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.01
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.01
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.0
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 98.98
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 98.97
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 98.89
d2fnaa2283 Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ 98.85
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 98.83
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 98.77
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 98.66
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.6
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 98.55
d2fnaa2283 Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ 98.4
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.39
d1sxjc2227 Replication factor C3 {Baker's yeast (Saccharomyce 98.34
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 98.28
d1sxjb2224 Replication factor C4 {Baker's yeast (Saccharomyce 98.28
d1njfa_239 delta prime subunit of DNA polymerase III, N-domai 98.26
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 98.26
d1sxjd2237 Replication factor C2 {Baker's yeast (Saccharomyce 98.23
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 98.23
d1sxje2252 Replication factor C5 {Baker's yeast (Saccharomyce 98.19
d1r6bx2268 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 98.17
d1fnna2276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 98.14
d1a5ta2207 delta prime subunit of DNA polymerase III, N-domai 98.08
d1jbka_195 ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} 98.06
d1w5sa2287 CDC6-like protein APE0152, N-terminal domain {Aero 97.85
d1ixza_247 AAA domain of cell division protein FtsH {Thermus 97.82
d1e32a2258 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 97.78
d1sxjb2224 Replication factor C4 {Baker's yeast (Saccharomyce 97.78
d1sxjc2227 Replication factor C3 {Baker's yeast (Saccharomyce 97.73
d1sxja2253 Replication factor C1 {Baker's yeast (Saccharomyce 97.72
d1qvra2387 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 97.69
d1r6bx2268 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 97.64
d1l8qa2213 Chromosomal replication initiation factor DnaA {Aq 97.62
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 97.62
d1lv7a_256 AAA domain of cell division protein FtsH {Escheric 97.59
d1ixsb2239 Holliday junction helicase RuvB {Thermus thermophi 97.58
d1sxjd2237 Replication factor C2 {Baker's yeast (Saccharomyce 97.56
d1r7ra3265 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 97.5
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 97.49
d1sxje2252 Replication factor C5 {Baker's yeast (Saccharomyce 97.48
d1fnna2276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 97.48
d1in4a2238 Holliday junction helicase RuvB {Thermotoga mariti 97.45
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 97.35
d1d2na_246 Hexamerization domain of N-ethylmalemide-sensitive 97.34
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.34
d1njfa_239 delta prime subunit of DNA polymerase III, N-domai 97.31
d1jbka_195 ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} 97.19
d1w5sa2287 CDC6-like protein APE0152, N-terminal domain {Aero 96.99
d1ixza_247 AAA domain of cell division protein FtsH {Thermus 96.91
d1a5ta2207 delta prime subunit of DNA polymerase III, N-domai 96.9
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 96.83
d1lv7a_256 AAA domain of cell division protein FtsH {Escheric 96.74
d1sxja2253 Replication factor C1 {Baker's yeast (Saccharomyce 96.69
d1in4a2238 Holliday junction helicase RuvB {Thermotoga mariti 96.56
d1qvra2387 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 96.52
d1e32a2258 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 96.49
d2gnoa2198 gamma subunit of DNA polymerase III, N-domain {The 96.32
d1ixsb2239 Holliday junction helicase RuvB {Thermus thermophi 96.29
d1d2na_246 Hexamerization domain of N-ethylmalemide-sensitive 96.04
d1r7ra3265 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 95.64
d1m8pa3183 ATP sulfurylase C-terminal domain {Fungus (Penicil 95.33
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 95.3
d1lw7a2192 Transcriptional regulator NadR, ribosylnicotinamid 95.14
d1l8qa2213 Chromosomal replication initiation factor DnaA {Aq 95.13
d1rz3a_198 Hypothetical protein rbstp0775 {Bacillus stearothe 95.12
d1kaga_169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 94.96
d1r6bx3315 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 94.6
d1ny5a2247 Transcriptional activator sigm54 (NtrC1), C-termin 94.54
d2bdta1176 Hypothetical protein BH3686 {Bacillus halodurans [ 94.54
d1np6a_170 Molybdopterin-guanine dinucleotide biosynthesis pr 94.52
d1qvra3315 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 94.51
d1x6va3195 Adenosine-5'phosphosulfate kinase (APS kinase) {Hu 94.47
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 94.36
d2i3ba1189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 94.33
d1gvnb_273 Plasmid maintenance system epsilon/zeta, toxin zet 94.3
d1rkba_173 Adenylate kinase {Human (Homo sapiens), isoenzyme 94.24
d1yj5a2172 5' polynucleotide kinase-3' phosphatase, C-termina 94.24
d2iyva1165 Shikimate kinase (AroK) {Mycobacterium tuberculosi 94.14
d1viaa_161 Shikimate kinase (AroK) {Campylobacter jejuni [Tax 94.04
d1bifa1213 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata 94.02
d1qhxa_178 Chloramphenicol phosphotransferase {Streptomyces v 93.88
d2qy9a2211 GTPase domain of the signal recognition particle r 93.86
d1knqa_171 Gluconate kinase {Escherichia coli [TaxId: 562]} 93.77
d1khta_190 Adenylate kinase {Archaeon Methanococcus voltae [T 93.63
d1e6ca_170 Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax 93.52
d2jdid3276 Central domain of beta subunit of F1 ATP synthase 93.46
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 93.4
d1xjca_165 Molybdopterin-guanine dinucleotide biosynthesis pr 93.39
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 93.33
d1zp6a1176 Hypothetical protein Atu3015 {Agrobacterium tumefa 93.28
d2gnoa2198 gamma subunit of DNA polymerase III, N-domain {The 93.26
d1qf9a_194 UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 93.0
d1vmaa2213 GTPase domain of the signal recognition particle r 92.95
d1y63a_174 Probable kinase LmjF30.1890 {Leishmania major [Tax 92.93
d1m7ga_208 Adenosine-5'phosphosulfate kinase (APS kinase) {Fu 92.81
d1ls1a2207 GTPase domain of the signal sequence recognition p 92.8
d1nksa_194 Adenylate kinase {Archaeon Sulfolobus acidocaldari 92.7
d1ukza_196 Uridylate kinase {Baker's yeast (Saccharomyces cer 92.64
d1np6a_170 Molybdopterin-guanine dinucleotide biosynthesis pr 92.63
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 92.51
d1lw7a2192 Transcriptional regulator NadR, ribosylnicotinamid 92.49
d1kaga_169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 92.42
d2bdta1176 Hypothetical protein BH3686 {Bacillus halodurans [ 92.24
d1mo6a1269 RecA protein, ATPase-domain {Mycobacterium tubercu 92.04
d1j8yf2211 GTPase domain of the signal sequence recognition p 92.03
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 91.92
d1m8pa3183 ATP sulfurylase C-terminal domain {Fungus (Penicil 91.88
d1ofha_309 HslU {Haemophilus influenzae [TaxId: 727]} 91.87
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 91.75
d1cp2a_269 Nitrogenase iron protein {Clostridium pasteurianum 91.65
d1u94a1263 RecA protein, ATPase-domain {Escherichia coli [Tax 91.52
d1tf7a2242 Circadian clock protein KaiC {Synechococcus sp. st 91.51
d1rz3a_198 Hypothetical protein rbstp0775 {Bacillus stearothe 91.48
d1xpua3289 Transcription termination factor Rho, ATPase domai 91.37
d1w44a_321 NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} 91.32
d2p67a1327 LAO/AO transport system kinase ArgK {Escherichia c 91.13
d2pmka1241 Haemolysin B ATP-binding protein {Escherichia coli 91.1
d1x6va3195 Adenosine-5'phosphosulfate kinase (APS kinase) {Hu 91.07
d1okkd2207 GTPase domain of the signal recognition particle r 91.05
d2qm8a1323 Metallochaperone MeaB {Methylobacterium extorquens 91.01
d1rkba_173 Adenylate kinase {Human (Homo sapiens), isoenzyme 90.96
d1uj2a_213 Uridine-cytidine kinase 2 {Human (Homo sapiens) [T 90.91
d1ak2a1190 Adenylate kinase {Cow (Bos taurus), mitochondrial 90.87
d1xjca_165 Molybdopterin-guanine dinucleotide biosynthesis pr 90.57
d1xp8a1268 RecA protein, ATPase-domain {Deinococcus radiodura 90.56
d1ihua2279 Arsenite-translocating ATPase ArsA {Escherichia co 90.52
d1lvga_190 Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 90.49
d1u94a1263 RecA protein, ATPase-domain {Escherichia coli [Tax 90.46
d2i3ba1189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 90.42
d2iyva1165 Shikimate kinase (AroK) {Mycobacterium tuberculosi 90.37
d1y63a_174 Probable kinase LmjF30.1890 {Leishmania major [Tax 90.34
d1gkya_186 Guanylate kinase {Baker's yeast (Saccharomyces cer 90.28
d1okkd2207 GTPase domain of the signal recognition particle r 90.18
d1qf9a_194 UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 90.15
d1mo6a1269 RecA protein, ATPase-domain {Mycobacterium tubercu 90.14
d1zaka1189 Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} 90.11
d1ckea_225 CMP kinase {Escherichia coli [TaxId: 562]} 90.0
d1teva_194 UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] 89.93
d1viaa_161 Shikimate kinase (AroK) {Campylobacter jejuni [Tax 89.91
d1svma_362 Papillomavirus large T antigen helicase domain {Si 89.9
d1zina1182 Adenylate kinase {Bacillus stearothermophilus [Tax 89.82
d1sq5a_308 Pantothenate kinase PanK {Escherichia coli [TaxId: 89.75
d2ak3a1189 Adenylate kinase {Cow (Bos taurus), mitochondrial 89.68
d2qy9a2211 GTPase domain of the signal recognition particle r 89.58
d1nn5a_209 Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 89.56
d1r0wa_281 Cystic fibrosis transmembrane conductance regulato 89.53
d1khta_190 Adenylate kinase {Archaeon Methanococcus voltae [T 89.52
d2hyda1255 Putative multidrug export ATP-binding/permease pro 89.48
d1qhxa_178 Chloramphenicol phosphotransferase {Streptomyces v 89.42
d1kgda_178 Guanylate kinase-like domain of Cask {Human (Homo 89.4
d1zp6a1176 Hypothetical protein Atu3015 {Agrobacterium tumefa 89.21
d1odfa_286 Hypothetical protein Ygr205W {Baker's yeast (Sacch 89.16
d1e6ca_170 Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax 89.11
d2jdid3276 Central domain of beta subunit of F1 ATP synthase 89.07
d3adka_194 Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} 89.02
d1yj5a2172 5' polynucleotide kinase-3' phosphatase, C-termina 89.01
d1s3ga1182 Adenylate kinase {Bacillus globisporus [TaxId: 145 88.97
d2cdna1181 Adenylate kinase {Mycobacterium tuberculosis [TaxI 88.91
d1ukza_196 Uridylate kinase {Baker's yeast (Saccharomyces cer 88.85
d1knqa_171 Gluconate kinase {Escherichia coli [TaxId: 562]} 88.84
d2afhe1289 Nitrogenase iron protein {Azotobacter vinelandii [ 88.54
d1q3ta_223 CMP kinase {Streptococcus pneumoniae [TaxId: 1313] 88.42
d1bifa1213 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata 88.27
d1xp8a1268 RecA protein, ATPase-domain {Deinococcus radiodura 88.06
d1uf9a_191 Dephospho-CoA kinase {Thermus thermophilus [TaxId: 88.04
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 87.88
d1akya1180 Adenylate kinase {Baker's yeast (Saccharomyces cer 87.81
d1qvra3315 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 87.67
d1nksa_194 Adenylate kinase {Archaeon Sulfolobus acidocaldari 87.51
d1e4va1179 Adenylate kinase {Escherichia coli [TaxId: 562]} 87.34
d1gvnb_273 Plasmid maintenance system epsilon/zeta, toxin zet 87.21
d2jdia3285 Central domain of alpha subunit of F1 ATP synthase 87.16
d1p9ra_401 Extracellular secretion NTPase EpsE {Vibrio choler 87.03
d1j8yf2211 GTPase domain of the signal sequence recognition p 86.91
d1cp2a_269 Nitrogenase iron protein {Clostridium pasteurianum 86.77
d1ihua2279 Arsenite-translocating ATPase ArsA {Escherichia co 86.68
d1hyqa_232 Cell division regulator MinD {Archaeon Archaeoglob 86.51
d1znwa1182 Guanylate kinase {Mycobacterium tuberculosis [TaxI 86.49
d1tf7a2242 Circadian clock protein KaiC {Synechococcus sp. st 86.45
d1ckea_225 CMP kinase {Escherichia coli [TaxId: 562]} 86.12
d1ihua1296 Arsenite-translocating ATPase ArsA {Escherichia co 86.1
d1uj2a_213 Uridine-cytidine kinase 2 {Human (Homo sapiens) [T 85.9
d1fx0a3276 Central domain of alpha subunit of F1 ATP synthase 85.78
d1pzna2254 DNA repair protein Rad51, catalytic domain {Archae 85.56
d1a7ja_288 Phosphoribulokinase {Rhodobacter sphaeroides [TaxI 85.52
d1m7ga_208 Adenosine-5'phosphosulfate kinase (APS kinase) {Fu 85.08
d1ls1a2207 GTPase domain of the signal sequence recognition p 84.92
d1g3qa_237 Cell division regulator MinD {Archaeon Pyrococcus 84.84
d1uf9a_191 Dephospho-CoA kinase {Thermus thermophilus [TaxId: 84.77
d2qm8a1323 Metallochaperone MeaB {Methylobacterium extorquens 84.74
d1n0wa_242 DNA repair protein Rad51, catalytic domain {Human 84.66
d1teva_194 UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] 84.56
d1sq5a_308 Pantothenate kinase PanK {Escherichia coli [TaxId: 84.55
d2vp4a1197 Deoxyribonucleoside kinase {Fruit fly (Drosophila 84.5
d1w44a_321 NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} 84.37
d1vmaa2213 GTPase domain of the signal recognition particle r 84.16
d1w36d1359 Exodeoxyribonuclease V alpha chain (RecD) {Escheri 84.07
d1v5wa_258 Meiotic recombination protein DMC1/LIM15 homolog { 83.9
d1ofha_309 HslU {Haemophilus influenzae [TaxId: 727]} 83.88
d1yrba1244 ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss 83.67
d1xpua3289 Transcription termination factor Rho, ATPase domai 83.43
d2p67a1327 LAO/AO transport system kinase ArgK {Escherichia c 83.42
d2afhe1289 Nitrogenase iron protein {Azotobacter vinelandii [ 83.18
d1zaka1189 Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} 82.93
d1gsia_208 Thymidylate kinase {Mycobacterium tuberculosis [Ta 82.83
d1zina1182 Adenylate kinase {Bacillus stearothermophilus [Tax 82.76
d2ocpa1241 Deoxyguanosine kinase {Human (Homo sapiens) [TaxId 82.61
d1g8pa_333 ATPase subunit of magnesium chelatase, BchI {Rhodo 82.45
d2ak3a1189 Adenylate kinase {Cow (Bos taurus), mitochondrial 82.38
d3adka_194 Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} 82.08
d1q3ta_223 CMP kinase {Streptococcus pneumoniae [TaxId: 1313] 81.83
d1tf7a1242 Circadian clock protein KaiC {Synechococcus sp. st 81.79
d1szpa2251 DNA repair protein Rad51, catalytic domain {Baker' 81.66
d1s3ga1182 Adenylate kinase {Bacillus globisporus [TaxId: 145 81.63
d2cdna1181 Adenylate kinase {Mycobacterium tuberculosis [TaxI 81.59
d1puja_273 Probable GTPase YlqF {Bacillus subtilis [TaxId: 14 81.47
d1vhta_208 Dephospho-CoA kinase {Escherichia coli [TaxId: 562 81.43
d1znwa1182 Guanylate kinase {Mycobacterium tuberculosis [TaxI 81.16
d1lvga_190 Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 81.14
d1fx0a3276 Central domain of alpha subunit of F1 ATP synthase 80.92
d2vp4a1197 Deoxyribonucleoside kinase {Fruit fly (Drosophila 80.46
d2i1qa2258 DNA repair protein Rad51, catalytic domain {Archae 80.42
d1s96a_205 Guanylate kinase {Escherichia coli [TaxId: 562]} 80.4
d1f6ba_186 SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 80.4
d1r8sa_160 ADP-ribosylation factor {Human (Homo sapiens), ARF 80.37
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: CED-4, NB-ARC domain
species: Caenorhabditis elegans [TaxId: 6239]
Probab=100.00  E-value=1.8e-35  Score=344.30  Aligned_cols=247  Identities=18%  Similarity=0.192  Sum_probs=197.1

Q ss_pred             cCCCceeehhhHHHHHHhhhc-CCCCcEEEEEEecCCCchhHHHHHHHHh----hhccccceEEEEeeccccccccHHHH
Q 000202          184 ESKDLIGVEWRIKEIESLLRT-GSAGVYKLGIWGIGGIGKTTIAGAVFNK----ISRHFEGSYFACNVRAAEETGRLDDL  258 (1866)
Q Consensus       184 ~~~~~vGr~~~l~~l~~~L~~-~~~~~~~i~I~G~gGiGKTtLA~~~~~~----~~~~f~~~~~~~~~~~~~~~~~~~~l  258 (1866)
                      ....++||+.++++|.++|.. .+.+.++|+|+|||||||||||+++|++    ....|++++|+.+.+.++.. .....
T Consensus        18 ~~~~~~gR~~~~~~i~~~L~~~~~~~~~~v~I~GmgGiGKTtLA~~v~~~~~~~~~~~f~~~~Wv~vs~~~~~~-~l~~~   96 (277)
T d2a5yb3          18 KQMTCYIREYHVDRVIKKLDEMCDLDSFFLFLHGRAGSGKSVIASQALSKSDQLIGINYDSIVWLKDSGTAPKS-TFDLF   96 (277)
T ss_dssp             CCCCSCCCHHHHHHHHHHHHHHTTSSSEEEEEECSTTSSHHHHHHHHHHHCSSTBTTTBSEEEEEECCCCSTTH-HHHHH
T ss_pred             CCCceeCcHHHHHHHHHHHHhccCCCceEEEEECCCCCCHHHHHHHHHHhhhhhhhhcCceEEEEEecCCCCHH-HHHHH
Confidence            345678999999999999864 4456889999999999999999999985    55668999999877764322 22223


Q ss_pred             HHHHHHHHhcccccc---Cccchh----HHHHHHHhhcCcEEEEEecCCCHHHHHHHhhccCCCCCCCEEEEEccccchh
Q 000202          259 RKELLSKLLNDRNVK---NFQNIS----VNFQSKRLARKKVLIVFDDVNHPRQIELLIGRLDRFASGSQVIITTRDKQVL  331 (1866)
Q Consensus       259 ~~~ll~~~~~~~~~~---~~~~~~----~~~l~~~L~~k~~LlVlDdv~~~~~~~~l~~~~~~~~~gs~IiiTTR~~~v~  331 (1866)
                      ...++..........   ......    ...+.+.+.++|+|+||||||+.++++.+..      .|||||||||++.++
T Consensus        97 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~L~~kr~LlVLDDv~~~~~~~~~~~------~~srilvTTR~~~v~  170 (277)
T d2a5yb3          97 TDILLMLKSEDDLLNFPSVEHVTSVVLKRMICNALIDRPNTLFVFDDVVQEETIRWAQE------LRLRCLVTTRDVEIS  170 (277)
T ss_dssp             HHHHHHHTTTSCCTTCCCCTTCCHHHHHHHHHHHHTTSTTEEEEEEEECCHHHHHHHHH------TTCEEEEEESBGGGG
T ss_pred             HHHHHHHhcchhhcCCccchhhhhHHHHHHHHHHHhccCCeeEecchhhHHhhhhhhcc------cCceEEEEeehHHHH
Confidence            333333333222111   111111    1346677899999999999999999988754      389999999999999


Q ss_pred             ccCccc-eeeecCCCCHHHHHHHHHhhcCCCCCCChhHHHHHHHHHHHhCCCcceeeeecccccCCCHHHHHHHHHHhcc
Q 000202          332 TNCEVD-HIYQMKELVHADAHKLFTQCAFRGDHLDAGYTELAHKALKYAQGVPLALKVLGCYLCGRSKEEWESAMRKLEI  410 (1866)
Q Consensus       332 ~~~~~~-~~~~l~~L~~~ea~~Lf~~~a~~~~~~~~~~~~~~~~i~~~~~GlPLAl~~~g~~L~~~~~~~w~~~l~~l~~  410 (1866)
                      ..+... ++|+|++|+.+||++||++++|....+ +..++++++|+++|+|+||||+++|+.|+.++.++|.+..++|+.
T Consensus       171 ~~~~~~~~~~~l~~L~~~ea~~Lf~~~~~~~~~~-~~~~~~~~~iv~~c~GlPLAl~~ig~~l~~k~~~~~~~~~~~L~~  249 (277)
T d2a5yb3         171 NAASQTCEFIEVTSLEIDECYDFLEAYGMPMPVG-EKEEDVLNKTIELSSGNPATLMMFFKSCEPKTFEKMAQLNNKLES  249 (277)
T ss_dssp             GGCCSCEEEEECCCCCHHHHHHHHHHTSCCCC---CHHHHHHHHHHHHHTTCHHHHHHHHTTCCSSSHHHHHHHHHHHHH
T ss_pred             HhcCCCCceEECCCCCHHHHHHHHHHHhCCccCc-hhhHHHHHHHHHHhCCCHHHHHHHHHHhccCCHHHHHHHHHHHhc
Confidence            876544 789999999999999999999876544 456788999999999999999999999999999999999999988


Q ss_pred             CCCchhhhhhhcccCCCChhhHHHHHHH
Q 000202          411 VPHMEIQEVLKISYDSLDDSQKRMHDLL  438 (1866)
Q Consensus       411 ~~~~~i~~~l~~Sy~~L~~~~k~~~~~l  438 (1866)
                      ....+|..++.+||++||.+.|.|+.+|
T Consensus       250 ~~~~~v~~il~~sY~~L~~~lk~c~~~l  277 (277)
T d2a5yb3         250 RGLVGVECITPYSYKSLAMALQRCVEVL  277 (277)
T ss_dssp             HCSSTTCCCSSSSSSSHHHHHHHHHHTS
T ss_pred             CcHHHHHHHHHHHHhcccHHHHHHHHhC
Confidence            7788899999999999999999999864



>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1fyva_ c.23.2.1 (A:) Toll-like receptor 1, TLR1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1fyxa_ c.23.2.1 (A:) Toll-like receptor 2, TLR2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ny5a2 c.37.1.20 (A:138-384) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d2jdid3 c.37.1.11 (D:82-357) Central domain of beta subunit of F1 ATP synthase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1cp2a_ c.37.1.10 (A:) Nitrogenase iron protein {Clostridium pasteurianum [TaxId: 1501]} Back     information, alignment and structure
>d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1xpua3 c.37.1.11 (A:129-417) Transcription termination factor Rho, ATPase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Back     information, alignment and structure
>d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} Back     information, alignment and structure
>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1ihua2 c.37.1.10 (A:308-586) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Back     information, alignment and structure
>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d2jdid3 c.37.1.11 (D:82-357) Central domain of beta subunit of F1 ATP synthase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} Back     information, alignment and structure
>d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2afhe1 c.37.1.10 (E:1-289) Nitrogenase iron protein {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d2jdia3 c.37.1.11 (A:95-379) Central domain of alpha subunit of F1 ATP synthase {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d1cp2a_ c.37.1.10 (A:) Nitrogenase iron protein {Clostridium pasteurianum [TaxId: 1501]} Back     information, alignment and structure
>d1ihua2 c.37.1.10 (A:308-586) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hyqa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ihua1 c.37.1.10 (A:1-296) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fx0a3 c.37.1.11 (A:97-372) Central domain of alpha subunit of F1 ATP synthase {Spinach (Spinacia oleracea), chloroplast [TaxId: 3562]} Back     information, alignment and structure
>d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1g3qa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1xpua3 c.37.1.11 (A:129-417) Transcription termination factor Rho, ATPase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2afhe1 c.37.1.10 (E:1-289) Nitrogenase iron protein {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2ocpa1 c.37.1.1 (A:37-277) Deoxyguanosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} Back     information, alignment and structure
>d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} Back     information, alignment and structure
>d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1puja_ c.37.1.8 (A:) Probable GTPase YlqF {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1vhta_ c.37.1.1 (A:) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fx0a3 c.37.1.11 (A:97-372) Central domain of alpha subunit of F1 ATP synthase {Spinach (Spinacia oleracea), chloroplast [TaxId: 3562]} Back     information, alignment and structure
>d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} Back     information, alignment and structure