Citrus Sinensis ID: 000227
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 1826 | ||||||
| 359481849 | 1879 | PREDICTED: protein RRP5 homolog [Vitis v | 0.937 | 0.910 | 0.711 | 0.0 | |
| 297739784 | 1862 | unnamed protein product [Vitis vinifera] | 0.933 | 0.915 | 0.712 | 0.0 | |
| 356533079 | 1885 | PREDICTED: protein RRP5 homolog [Glycine | 0.951 | 0.921 | 0.641 | 0.0 | |
| 449453908 | 1898 | PREDICTED: protein RRP5 homolog [Cucumis | 0.953 | 0.917 | 0.606 | 0.0 | |
| 240255326 | 1896 | RNA binding protein [Arabidopsis thalian | 0.932 | 0.897 | 0.608 | 0.0 | |
| 10998136 | 1765 | pre-rRNA processing protein RRP5 [Arabid | 0.881 | 0.911 | 0.612 | 0.0 | |
| 297833988 | 1843 | S1 RNA-binding domain-containing protein | 0.829 | 0.821 | 0.615 | 0.0 | |
| 222636634 | 1898 | hypothetical protein OsJ_23484 [Oryza sa | 0.901 | 0.867 | 0.549 | 0.0 | |
| 242043296 | 1862 | hypothetical protein SORBIDRAFT_02g00600 | 0.874 | 0.857 | 0.550 | 0.0 | |
| 218199275 | 1848 | hypothetical protein OsI_25303 [Oryza sa | 0.889 | 0.878 | 0.543 | 0.0 |
| >gi|359481849|ref|XP_002276633.2| PREDICTED: protein RRP5 homolog [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 2487 bits (6447), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 1277/1795 (71%), Positives = 1482/1795 (82%), Gaps = 84/1795 (4%)
Query: 18 KFNKASKNQFKNSKKQINDAVEAQDLALPPDDDVPVFPRGGGHSLTQRERDEIHAEVDAE 77
K ASK FK +Q N+AV ++ LAL +DDVP FPRGGG L+++E D I AEVDAE
Sbjct: 18 KLRGASKKPFKPRMRQ-NEAVPSESLALQMEDDVPDFPRGGGSLLSRQEHDAIRAEVDAE 76
Query: 78 FEAVERGLHKKNKKKKKKTERKANETVDDLGSLFGDGISGKLPRYANKITLKNISAGMKL 137
FEA ER KKNK KK + A E DD+GSLFGDGI+GKLPR+ANKITLKNIS GMKL
Sbjct: 77 FEAGERKTKKKNKNAKKTKKNYALE--DDMGSLFGDGITGKLPRFANKITLKNISPGMKL 134
Query: 138 WGVVAEVNEKDLVICLPGGLRGLARAADALDPILDNEIEANEDNLLPTIFHVGQLVSCIV 197
WGVVAEVNEKDL I LPGGLRGL RA++A DP+ NEI+ E LP IFH+GQLVSC+V
Sbjct: 135 WGVVAEVNEKDLGISLPGGLRGLVRASEAFDPLFSNEIKDAEGIFLPRIFHIGQLVSCVV 194
Query: 198 LQLDDDKKEIGKRKIWLSLRLSLLYKGLSLETVQEGMVLTAYVKSIEDHGYILHFGLPSF 257
LQLDDDKKE GKR+IWLSLRLSLL+KG +L+ +QEGMVLTAYVKSIEDHGYILHFGLPSF
Sbjct: 195 LQLDDDKKEKGKRRIWLSLRLSLLHKGFTLDALQEGMVLTAYVKSIEDHGYILHFGLPSF 254
Query: 258 TGFLPRNNLAENSGIDVKPGLLLQGVVRSIDRTRKVVYLSSDPDTVSKCVTKDLKGISID 317
TGFLP+++ A+ + I++ G +LQGV+RSID+ KVVYLSSDPDT+SKCVTKDLKGISID
Sbjct: 255 TGFLPKSSQADQN-IEINTGQILQGVIRSIDKAHKVVYLSSDPDTISKCVTKDLKGISID 313
Query: 318 LLVPGMMVSTRVQSILENGVMLSFLTYFTGTVDIFHLQNTFPTTNWKNDYNQHKKVNARI 377
LL+PGMMV+ RVQS ENGVMLSFLTYFTGTVDIFHLQ TFP++NWK+DYNQ+KKVNARI
Sbjct: 314 LLIPGMMVNARVQSTFENGVMLSFLTYFTGTVDIFHLQTTFPSSNWKDDYNQNKKVNARI 373
Query: 378 LFVDPTSRAVGLTLNPYLLHNRAPPSHVKVGDIYDQSKVVRVDRGLGLLLDIPSTPVSTP 437
LF+DP++RAVGLTLNP+L++N+APP VK GDIYD SKV+RVDRGLGLLL++PSTP STP
Sbjct: 374 LFIDPSTRAVGLTLNPHLVNNKAPPCPVKTGDIYDHSKVIRVDRGLGLLLEVPSTPASTP 433
Query: 438 AYVTISDVAEEEVRKLEKKYKEGSCVRVRILGFRHLEGLATGILKASAFEGLVFTHSDVK 497
YVT YKEGS VRVRILGFR+LEGLA G LKASAFEG VFTHSDVK
Sbjct: 434 TYVT---------------YKEGSHVRVRILGFRNLEGLAMGTLKASAFEGSVFTHSDVK 478
Query: 498 PGMVVKGKVIAVDSFGAIVQFPGGVKALCPLPHMSEFEIVKPGKKFKVGAELVFRVLGVK 557
PGMVVK KVIAVDSFGAIVQFP GVKALCPL HMSEF+IVKP KKFKVGAEL+FRVLG K
Sbjct: 479 PGMVVKAKVIAVDSFGAIVQFPSGVKALCPLRHMSEFDIVKPRKKFKVGAELIFRVLGCK 538
Query: 558 SKRITVTHKKTLVKSKLAILSSYAEATDRLITHGWITKIEKHGCFVRFYNGVQGFAPRSE 617
SKRITVTHKKTL+KSKL I+SSY +AT+ LITHGWITKIEKHGCF+RFYNGVQGFAP SE
Sbjct: 539 SKRITVTHKKTLLKSKLGIISSYTDATEGLITHGWITKIEKHGCFIRFYNGVQGFAPSSE 598
Query: 618 LGLDPGCEPSSMYHVGQVVKCRIMSSIPASRRINLSFMMKPTRVSEDDLVKLGSLVSGVV 677
LGL+PGC S MYHVGQVVKCR+ S+PASRRINL +D+VKLGS+V GVV
Sbjct: 599 LGLEPGCNTSLMYHVGQVVKCRVKGSVPASRRINL-----------NDMVKLGSVVGGVV 647
Query: 678 DVVTPNAVVVYVIAKGYSKGTIPTEHLADHLEHATVMKSVIKPGYEFDQLLVLDNESSNL 737
D VTP+A++V V AKGY KGTI TEHLADH HA +MKS +KPGYEFDQLLVLD E +N
Sbjct: 648 DRVTPHAIIVNVSAKGYLKGTISTEHLADHQGHAALMKSTLKPGYEFDQLLVLDVEGNNF 707
Query: 738 LLSAKYSLINSAQQLPSDASHIHPNSVVHGYVCNIIETGCFVRFLGRLTGFAPRSKAVDG 797
+LSAKYSLINSAQQLP D + IHPNSVVHGY+CNIIETGCFVRFLGRLTGF+PR+K +D
Sbjct: 708 ILSAKYSLINSAQQLPLDLTQIHPNSVVHGYICNIIETGCFVRFLGRLTGFSPRNKVMDD 767
Query: 798 QRADLSKTYYVGQSVRSNILDVNSETGRITLSLKQSCCSSTDASFMQEHFLLEEKIAMLQ 857
QRA S+ +++GQSVRSNILDVNSETGRITLSLKQSCCSSTDASF+QE+FLLEEKIA LQ
Sbjct: 768 QRAVPSEAFFIGQSVRSNILDVNSETGRITLSLKQSCCSSTDASFIQEYFLLEEKIAKLQ 827
Query: 858 SSKHNGSELKWVEGFIIGSVIEGKVHESNDFGVVVSFEEHSDVYGFITHHQLAGATVESG 917
S SELKW EGF IG+VIEGK+H++ DFGVV+SFE+++DV+GFITH+QL T E G
Sbjct: 828 LSDSEHSELKWAEGFNIGTVIEGKIHDAKDFGVVISFEKYNDVFGFITHYQL---TAERG 884
Query: 918 SVIQAAILDVAKAERLVDLSLKTVFIDRFREANSNRQAQKKKRKREASKDLGVHQTVNAI 977
S +QA +LDVAK ERLVDLSLK F+DR +E +SN QA KKKR+REA K+L HQTVNAI
Sbjct: 885 STVQAVVLDVAKTERLVDLSLKPEFLDRHKEDSSNSQAGKKKRRREAYKELQPHQTVNAI 944
Query: 978 VEIVKENYLVLSLPEYNHSIGYASVSDYNTQKFPQKQFLNGQSVIATVMALPSSSTAGRL 1037
VEIVKENYLVLSLPEYN++IGYASVSDYNTQKF QKQFL+GQSVIA+VMALPS ST GRL
Sbjct: 945 VEIVKENYLVLSLPEYNYAIGYASVSDYNTQKFAQKQFLHGQSVIASVMALPSPSTVGRL 1004
Query: 1038 LLLLKAISE-TETSSSKRAKKKSSYDVGSLVQAEITEIKPLELRLKFGIGFHGRIHITEV 1096
LL+LK++SE TETSSSKRAKKKSSY+VGSLVQAEITEIKPLELRLKFGIGFHGR+HITEV
Sbjct: 1005 LLVLKSVSEATETSSSKRAKKKSSYNVGSLVQAEITEIKPLELRLKFGIGFHGRVHITEV 1064
Query: 1097 NDDKSNVVENLFSNFKIGQTVTARIIAKSNKPDMK-KSFLWELSIKPSMLTVS-EIGSKL 1154
D+ NV+EN FSNF+IGQTV+ARI+AK+NK + K+ WELSIKP MLT S E+ +KL
Sbjct: 1065 CDE--NVIENPFSNFRIGQTVSARIVAKANKSENNGKNHQWELSIKPEMLTGSIEVENKL 1122
Query: 1155 LFEECDVSIGQRVTGYVYKVDNEWALLTISRHLKAQLFILDSAYEPSELQEFQRRFHIGK 1214
+ E +S GQRVTGYVYKV+NEW LTISRH+KAQLF+LD++ EP+ELQEFQ+RF +GK
Sbjct: 1123 VDAEFRISTGQRVTGYVYKVENEWIWLTISRHIKAQLFLLDTSCEPNELQEFQKRFEVGK 1182
Query: 1215 AVTGHVLSINKEKKLLRLVLRPF--QDGISD-KTVDISN-------DNMQTFIHEGDIVG 1264
AV+G+VLS NKEKKLLR+VL F +G D K ++I N +N+ IH+GD +G
Sbjct: 1183 AVSGYVLSANKEKKLLRMVLHQFSVSNGTLDGKVLNIDNQHCNPPIENLIPHIHKGDTLG 1242
Query: 1265 GRISKILSGVGGLVVQIGPHLYGRVHFTELKNICVSDPLSGYDEGQFDPLSGYDEGQFVK 1324
GRISKIL GVGGL+VQIGPHLYG+VHFTELK+ VSDPL SGY EGQFVK
Sbjct: 1243 GRISKILPGVGGLLVQIGPHLYGKVHFTELKDSWVSDPL-----------SGYHEGQFVK 1291
Query: 1325 CKVLEISRTVRGTFHVELSLRSSLDGMSSTNSSDLSTDVDTPGKHLEKIEDLSPNMIVQG 1384
CKVLEI + +GT HV+LSL SSL+GM S NS +EKI++L +M+VQG
Sbjct: 1292 CKVLEIGHSEKGTVHVDLSLWSSLNGMHSPNS------------RVEKIDNLHSDMLVQG 1339
Query: 1385 YVKNVTSKGCFIMLSRKLDAKVLLSNLSDGYVESPEKEFPIGKLVAGRVLSVEPLSKRVE 1444
YVKNVTSKGCFI+LSRKLDA++LL+NLSDGYVE PE+EFPIGKLV+GRVLSVEPLS+RVE
Sbjct: 1340 YVKNVTSKGCFILLSRKLDARILLANLSDGYVEKPEREFPIGKLVSGRVLSVEPLSRRVE 1399
Query: 1445 VTLKTSDSRTASQSEINNLSNLHVGDIVIGQIKRVESYGLFITIENTNLVGLCHVSELSE 1504
VTLKTS + + +SE+N+ S++ VGDI+ G IKRVESYGLFITI++TN+VGLCH+SELS+
Sbjct: 1400 VTLKTSSATSVQKSEVNDFSSILVGDIIFGTIKRVESYGLFITIDDTNMVGLCHISELSD 1459
Query: 1505 DHVDNIETIYRAGEKVKVKILKVDKEKRRISLGMKSSYFKNDADNLQMSSEEESDEAIEE 1564
DH+ NIET Y+AGE+V KILKVD+E+ RISLGMK+SY K N
Sbjct: 1460 DHISNIETKYKAGERVAAKILKVDEERHRISLGMKNSYIKETTQNNGF------------ 1507
Query: 1565 VGSYNRSSLLENSSVAVQDMDMESEDGGSLVLAQIESRASVPPLEVNLDD-EQPDMDNGI 1623
V S+ LEN+S +Q++D+E ED VL+Q+ESRAS+ PLEV+LDD ++D+ +
Sbjct: 1508 VDDTQLSTFLENNSREIQNLDVEYEDEEYPVLSQVESRASILPLEVDLDDVNHSNLDDAV 1567
Query: 1624 SQNQGHTDEAKTIDEKNNRHAKKKEKEEREQEIRAAEERLLEKDAPRTPDEFERLVRSSP 1683
QN +T+E TIDEK+ R AKKK KEE+EQEIRAAEERL+ D PRT DEFE+LVR SP
Sbjct: 1568 GQNHIYTNETNTIDEKSKRRAKKKAKEEKEQEIRAAEERLMLNDVPRTADEFEKLVRGSP 1627
Query: 1684 NSSFVWIKYMAFMLSMADVEKARSIAERALQTINIREENEKLNIWVAYFNLENEYGNPPE 1743
NSSF+WIKYMA MLS+AD+EKARSIAERAL+TINIREE+EKLNIW+AYFNLENEYGNPPE
Sbjct: 1628 NSSFLWIKYMALMLSLADIEKARSIAERALRTINIREESEKLNIWMAYFNLENEYGNPPE 1687
Query: 1744 EAVVKVFQRALQYCDPKKVHLALLGLYERTEQNKLADELLYKMIKKFKHSCKVII 1798
EAVVKVFQRALQYCDPKKVHLALLG+YERTEQ+KLADELL KM KKFKHSCKV +
Sbjct: 1688 EAVVKVFQRALQYCDPKKVHLALLGMYERTEQHKLADELLEKMTKKFKHSCKVWL 1742
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|297739784|emb|CBI29966.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|356533079|ref|XP_003535096.1| PREDICTED: protein RRP5 homolog [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|449453908|ref|XP_004144698.1| PREDICTED: protein RRP5 homolog [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|240255326|ref|NP_187803.4| RNA binding protein [Arabidopsis thaliana] gi|332641610|gb|AEE75131.1| RNA binding protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|10998136|dbj|BAB03107.1| pre-rRNA processing protein RRP5 [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|297833988|ref|XP_002884876.1| S1 RNA-binding domain-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297330716|gb|EFH61135.1| S1 RNA-binding domain-containing protein [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|222636634|gb|EEE66766.1| hypothetical protein OsJ_23484 [Oryza sativa Japonica Group] | Back alignment and taxonomy information |
|---|
| >gi|242043296|ref|XP_002459519.1| hypothetical protein SORBIDRAFT_02g006000 [Sorghum bicolor] gi|241922896|gb|EER96040.1| hypothetical protein SORBIDRAFT_02g006000 [Sorghum bicolor] | Back alignment and taxonomy information |
|---|
| >gi|218199275|gb|EEC81702.1| hypothetical protein OsI_25303 [Oryza sativa Indica Group] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 1826 | ||||||
| TAIR|locus:2088644 | 1896 | RRP5 "Ribosomal RNA Processing | 0.716 | 0.689 | 0.571 | 0.0 | |
| RGD|1304933 | 1876 | Pdcd11 "programmed cell death | 0.477 | 0.464 | 0.276 | 3.9e-125 | |
| MGI|MGI:1341788 | 1862 | Pdcd11 "programmed cell death | 0.513 | 0.503 | 0.272 | 2.3e-124 | |
| UNIPROTKB|G5E5C4 | 1874 | PDCD11 "Protein RRP5 homolog" | 0.686 | 0.668 | 0.266 | 3.5e-122 | |
| UNIPROTKB|A7MB10 | 1874 | PDCD11 "Protein RRP5 homolog" | 0.686 | 0.668 | 0.266 | 4.7e-121 | |
| UNIPROTKB|F1PLK8 | 1870 | PDCD11 "Uncharacterized protei | 0.686 | 0.670 | 0.260 | 4.2e-120 | |
| UNIPROTKB|Q14690 | 1871 | PDCD11 "Protein RRP5 homolog" | 0.693 | 0.677 | 0.253 | 6.6e-119 | |
| UNIPROTKB|F1S842 | 1859 | LOC100157027 "Uncharacterized | 0.722 | 0.710 | 0.254 | 7e-117 | |
| UNIPROTKB|F1S843 | 1876 | LOC100157027 "Uncharacterized | 0.722 | 0.703 | 0.252 | 7.6e-117 | |
| UNIPROTKB|F1P3T9 | 1841 | PDCD11 "Uncharacterized protei | 0.386 | 0.383 | 0.281 | 8.6e-113 |
| TAIR|locus:2088644 RRP5 "Ribosomal RNA Processing 5" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 3758 (1327.9 bits), Expect = 0., Sum P(2) = 0.
Identities = 775/1357 (57%), Positives = 973/1357 (71%)
Query: 457 YKEGSCVRVRILGFRHLEGLATGILKASAFEGLVFTHSDVKPGMVVKGKVIAVDSFGAIV 516
+KEG+ +RVR+LG + +EGLA G LK SAFEG VFTHSDVKPGMV K KVI+VD+FGAIV
Sbjct: 433 FKEGNHIRVRVLGLKQMEGLAVGTLKESAFEGPVFTHSDVKPGMVTKAKVISVDTFGAIV 492
Query: 517 QFPGGVKALCPLPHMSEFEIVKPGKKFKVGAELVFRVLGVKSKRITVTHKKTLVKSKLAI 576
QF GG+KA+CPL HMSEFE+ KP KKFKVGAELVFRVLG KSKRITVT+KKTLVKSKL I
Sbjct: 493 QFSGGLKAMCPLRHMSEFEVTKPRKKFKVGAELVFRVLGCKSKRITVTYKKTLVKSKLPI 552
Query: 577 LSSYAEATDRLITHGWITKIEKHGCFVRFYNGVQGFAPRSELGLDPGCEPSSMYHVGQVV 636
LSSY +AT+ L+THGWITKIEKHGCFVRFYNGVQGF PR ELGL+PG +P S++HVG+VV
Sbjct: 553 LSSYTDATEGLVTHGWITKIEKHGCFVRFYNGVQGFVPRFELGLEPGSDPDSVFHVGEVV 612
Query: 637 KCRIMSSIPASRRINLSFMMKPTRVSEDXXXXXXXXXXXXXXXXXXXXXXXXXIAKGYSK 696
KCR+ S++ ++RI L+ +K + +K K
Sbjct: 613 KCRVTSAVHGTQRITLNDSIKLGSIVSGIIDTITSQAVIVRVK-----------SKSVVK 661
Query: 697 GTIPTEHLADHLEHATVMKSVIKPGYEFDQLLVLDNESSNLLLSAKYSLINSAQQLPSDA 756
GTI EHLADH E A ++ S+++PGYE D+LLVLD E +N+ LS+KYSLI A++LPSD
Sbjct: 662 GTISAEHLADHHEQAKLIMSLLRPGYELDKLLVLDIEGNNMALSSKYSLIKLAEELPSDF 721
Query: 757 SHIHPNSVVHGYVCNIIETGCFVRFLGRLTGFAPRSKAVDGQRADLSKTYYVGQSVRSNI 816
+ + PNSVVHGYVCN+IE GCFVRFLGRLTGFAPRSKA+D +AD+S++++VGQSVR+NI
Sbjct: 722 NQLQPNSVVHGYVCNLIENGCFVRFLGRLTGFAPRSKAIDDPKADVSESFFVGQSVRANI 781
Query: 817 LDVNSETGRITLSLKQSCCSSTDASFMQEHFLLEEKIAMLQSSKHNGSELKWVEGFIIGS 876
+DVN E RITLSLKQS C+S DASF+QE+FL++EKI+ LQSS S+ WVE F IGS
Sbjct: 782 VDVNQEKSRITLSLKQSSCASVDASFVQEYFLMDEKISDLQSSDITKSDCSWVEKFSIGS 841
Query: 877 VIEGKVHESNDFGVVVSFEEHSDVYGFITHHQLAGATVESGSVIQAAILDVAKAERLVDL 936
+I+G + E ND GVVV+F+ ++V GFI H + GAT+ GSV+ A +LD+++AERLVDL
Sbjct: 842 LIKGTIQEQNDLGVVVNFDNINNVLGFIPQHHMGGATLVPGSVVNAVVLDISRAERLVDL 901
Query: 937 SLKTVFIDRFREAXXXXXXXXXXXXXXXXXDLGVHQTVNAIVEIVKENYLVLSLPEYNHS 996
SL+ ++ + +L VHQ V+A+VEIVKE +LVLS+PE+ ++
Sbjct: 902 SLRPELLNNLTKEVSNSSKKKRKRGISK--ELEVHQRVSAVVEIVKEQHLVLSIPEHGYT 959
Query: 997 IGYASVSDYNTQKFPQKQFLNGQSVIATVMALPSSSTAGRLLLLLKAIXXXXXXXXXXXX 1056
IGYASVSDYNTQK P KQF GQSV+A+V A+ + T+GRLLLLL ++
Sbjct: 960 IGYASVSDYNTQKLPVKQFSTGQSVVASVKAVQNPLTSGRLLLLLDSVSGTSETSRSKRA 1019
Query: 1057 XX-XXYDVGSLVQAEITEIKPLELRLKFGIGFHGRIHITEVNDDKSNVVENLFSNFKIGQ 1115
+VGS+V AEITEIKP ELR+ FG F GRIHITEV + ++ + F+ F++GQ
Sbjct: 1020 KKKSSCEVGSVVHAEITEIKPFELRVNFGNSFRGRIHITEVLVNDASTSDEPFAKFRVGQ 1079
Query: 1116 TVTARIIAKSNKPDMKKSFLWELSIKPSMLT-VSEIGSKLLFEECDVSIGQRVTGYVYKV 1174
+++AR++AK D+KK+ LWELS+KP+ML SE E+ + + GQ V GYVYKV
Sbjct: 1080 SISARVVAKPCHTDIKKTQLWELSVKPAMLKDSSEFNDTQESEQLEFAAGQCVIGYVYKV 1139
Query: 1175 DNEWALLTISRHLKAQLFILDSAYEPSELQEFQRRFHIGKAVTGHVLSINKEKKLLRLVL 1234
D EW L +SR++ A++FILD++ + EL+EF+RRF IGKAV+G+VL+ NKEKK LRLV
Sbjct: 1140 DKEWVWLAVSRNVTARIFILDTSCKAHELEEFERRFPIGKAVSGYVLTYNKEKKTLRLVQ 1199
Query: 1235 RPF-------QDGISDKT----VDISNDNMQTFIHEGDIVGGRISKILSGVGGLVVQIGP 1283
RP +G KT I D+ FIHEGDI+GGRISKIL GVGGL VQ+GP
Sbjct: 1200 RPLLFIHKSIANGGGSKTDKPDSSIPGDDDTLFIHEGDILGGRISKILPGVGGLRVQLGP 1259
Query: 1284 HLYGRVHFTELKNICVSDPLSGYDEGQFDPLSGYDEGQFVKCKVLEISRTVRGTFHVELS 1343
+++GRVHFTE+ + V P DPL G+ EGQFVKCKVLEIS + +GT+ +ELS
Sbjct: 1260 YVFGRVHFTEINDSWV--P---------DPLDGFREGQFVKCKVLEISSSSKGTWQIELS 1308
Query: 1344 LRSSLDGMSSTN--SSDLSTDVDTPGKHLEKIEDLSPNMIVQGYVKNVTSKGCFIMLSRK 1401
LR+SLDGMSS + S DL + D K E+IEDLSP+M VQGYVKN SKGCFI+LSR
Sbjct: 1309 LRTSLDGMSSADHLSEDLKNN-DNVCKRFERIEDLSPDMGVQGYVKNTMSKGCFIILSRT 1367
Query: 1402 LDAKVLLSNLSDGYVESPEKEFPIGKLVAGRVLSVEPLSKRVEVTLKTSDSRTASQSEIN 1461
++AKV LSNL D +V+ PEKEFP+GKLV GRVL+VEPLSKR+EVTLKT ++ +SE
Sbjct: 1368 VEAKVRLSNLCDTFVKEPEKEFPVGKLVTGRVLNVEPLSKRIEVTLKTVNAGGRPKSESY 1427
Query: 1462 NLSNLHVGDIVIGQIKRVESYGLFITIENTNLVGLCHVSELSEDHVDNIETIYRAGEKVK 1521
+L LHVGD++ G+I+RVE +GLFI I+ T +VGLCH+S+LS+D ++N++ Y+AGE V+
Sbjct: 1428 DLKKLHVGDMISGRIRRVEPFGLFIDIDQTGMVGLCHISQLSDDRMENVQARYKAGESVR 1487
Query: 1522 VKILKVDKEKRRISLGMKSSYFKNDADNLQMXXXXXXXXXXXXXXXYNRSSLLENSSVAV 1581
KILK+D+EK+RISLGMKSSY N D+ +S +L AV
Sbjct: 1488 AKILKLDEEKKRISLGMKSSYLMNGDDDKAQPLSEDNTSMECDPINDPKSEVL----AAV 1543
Query: 1582 QDMDMESEDGG-SLVLAQIESRASVPPLEVNLDD-EQPDMDNGISQNQGHTDEAKTIDXX 1639
D + GG SLVLAQ+ESRAS+PPLEV+LDD E+ D D+ SQNQ A D
Sbjct: 1544 DDFGFQETSGGTSLVLAQVESRASIPPLEVDLDDIEETDFDS--SQNQEKLLGANK-DEK 1600
Query: 1640 XXXXXXXXXXXXXXXXXXXXXXXXXXXDAPRTPDEFERLVRSSPNSSFVWIKYMAFMLSM 1699
AP DEFE+LVRSSPNSSFVWIKYMAFMLS+
Sbjct: 1601 SKRREKQKDKEEREKKIQAAEGRLLEHHAPENADEFEKLVRSSPNSSFVWIKYMAFMLSL 1660
Query: 1700 ADVEKARSIAERALQTINIREENEKLNIWVAYFNLENEYGNPPEEAVVKVFQRALQYCDP 1759
AD+EKARSIAERAL+TINIREE EKLNIWVAYFNLENE+GNPPEE+V KVF+RA QYCDP
Sbjct: 1661 ADIEKARSIAERALRTINIREEEEKLNIWVAYFNLENEHGNPPEESVKKVFERARQYCDP 1720
Query: 1760 KKVHLALLGLYERTEQNKLADELLYKMIKKFKHSCKV 1796
KKV+LALLG+YERTEQ KLAD+LL +MIKKFK SCK+
Sbjct: 1721 KKVYLALLGVYERTEQYKLADKLLDEMIKKFKQSCKI 1757
|
|
| RGD|1304933 Pdcd11 "programmed cell death 11" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1341788 Pdcd11 "programmed cell death 11" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|G5E5C4 PDCD11 "Protein RRP5 homolog" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|A7MB10 PDCD11 "Protein RRP5 homolog" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1PLK8 PDCD11 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q14690 PDCD11 "Protein RRP5 homolog" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1S842 LOC100157027 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1S843 LOC100157027 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1P3T9 PDCD11 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 1826 | |||
| cd05708 | 77 | cd05708, S1_Rrp5_repeat_sc12, S1_Rrp5_repeat_sc12: | 1e-29 | |
| COG0539 | 541 | COG0539, RpsA, Ribosomal protein S1 [Translation, | 9e-28 | |
| cd04461 | 83 | cd04461, S1_Rrp5_repeat_hs8_sc7, S1_Rrp5_repeat_hs | 5e-27 | |
| COG0539 | 541 | COG0539, RpsA, Ribosomal protein S1 [Translation, | 2e-25 | |
| COG0539 | 541 | COG0539, RpsA, Ribosomal protein S1 [Translation, | 4e-25 | |
| COG0539 | 541 | COG0539, RpsA, Ribosomal protein S1 [Translation, | 2e-24 | |
| TIGR00717 | 516 | TIGR00717, rpsA, ribosomal protein S1 | 3e-24 | |
| cd05694 | 74 | cd05694, S1_Rrp5_repeat_hs2_sc2, S1_Rrp5_repeat_hs | 3e-23 | |
| cd05698 | 70 | cd05698, S1_Rrp5_repeat_hs6_sc5, S1_Rrp5_repeat_hs | 4e-23 | |
| COG0539 | 541 | COG0539, RpsA, Ribosomal protein S1 [Translation, | 3e-22 | |
| PRK06299 | 565 | PRK06299, rpsA, 30S ribosomal protein S1; Reviewed | 6e-22 | |
| COG0539 | 541 | COG0539, RpsA, Ribosomal protein S1 [Translation, | 1e-21 | |
| cd05703 | 73 | cd05703, S1_Rrp5_repeat_hs12_sc9, S1_Rrp5_repeat_h | 2e-21 | |
| cd05695 | 66 | cd05695, S1_Rrp5_repeat_hs3, S1_Rrp5_repeat_hs3: R | 4e-21 | |
| PRK06676 | 390 | PRK06676, rpsA, 30S ribosomal protein S1; Reviewed | 1e-20 | |
| TIGR00717 | 516 | TIGR00717, rpsA, ribosomal protein S1 | 2e-18 | |
| PRK00087 | 647 | PRK00087, PRK00087, 4-hydroxy-3-methylbut-2-enyl d | 4e-18 | |
| TIGR00717 | 516 | TIGR00717, rpsA, ribosomal protein S1 | 5e-18 | |
| COG0539 | 541 | COG0539, RpsA, Ribosomal protein S1 [Translation, | 6e-18 | |
| cd05702 | 70 | cd05702, S1_Rrp5_repeat_hs11_sc8, S1_Rrp5_repeat_h | 9e-18 | |
| smart00316 | 72 | smart00316, S1, Ribosomal protein S1-like RNA-bind | 6e-17 | |
| TIGR00717 | 516 | TIGR00717, rpsA, ribosomal protein S1 | 1e-16 | |
| cd05693 | 100 | cd05693, S1_Rrp5_repeat_hs1_sc1, S1_Rrp5_repeat_hs | 1e-16 | |
| pfam00575 | 74 | pfam00575, S1, S1 RNA binding domain | 2e-16 | |
| PRK06299 | 565 | PRK06299, rpsA, 30S ribosomal protein S1; Reviewed | 1e-15 | |
| cd05707 | 68 | cd05707, S1_Rrp5_repeat_sc11, S1_Rrp5_repeat_sc11: | 7e-15 | |
| cd05688 | 68 | cd05688, S1_RPS1_repeat_ec3, S1_RPS1_repeat_ec3: R | 1e-14 | |
| TIGR00717 | 516 | TIGR00717, rpsA, ribosomal protein S1 | 3e-14 | |
| PRK06299 | 565 | PRK06299, rpsA, 30S ribosomal protein S1; Reviewed | 3e-14 | |
| PRK06299 | 565 | PRK06299, rpsA, 30S ribosomal protein S1; Reviewed | 4e-14 | |
| cd04461 | 83 | cd04461, S1_Rrp5_repeat_hs8_sc7, S1_Rrp5_repeat_hs | 1e-13 | |
| PRK13806 | 491 | PRK13806, rpsA, 30S ribosomal protein S1; Provisio | 1e-13 | |
| cd05692 | 69 | cd05692, S1_RPS1_repeat_hs4, S1_RPS1_repeat_hs4: R | 1e-13 | |
| PRK11824 | 693 | PRK11824, PRK11824, polynucleotide phosphorylase/p | 2e-13 | |
| COG0539 | 541 | COG0539, RpsA, Ribosomal protein S1 [Translation, | 4e-13 | |
| PRK06299 | 565 | PRK06299, rpsA, 30S ribosomal protein S1; Reviewed | 7e-13 | |
| smart00316 | 72 | smart00316, S1, Ribosomal protein S1-like RNA-bind | 2e-12 | |
| PRK07899 | 486 | PRK07899, rpsA, 30S ribosomal protein S1; Reviewed | 2e-12 | |
| TIGR00717 | 516 | TIGR00717, rpsA, ribosomal protein S1 | 4e-12 | |
| COG1098 | 129 | COG1098, VacB, Predicted RNA binding protein (cont | 4e-12 | |
| PRK08059 | 123 | PRK08059, PRK08059, general stress protein 13; Val | 5e-12 | |
| COG0539 | 541 | COG0539, RpsA, Ribosomal protein S1 [Translation, | 6e-12 | |
| cd05698 | 70 | cd05698, S1_Rrp5_repeat_hs6_sc5, S1_Rrp5_repeat_hs | 1e-11 | |
| PRK06299 | 565 | PRK06299, rpsA, 30S ribosomal protein S1; Reviewed | 1e-11 | |
| cd00164 | 65 | cd00164, S1_like, S1_like: Ribosomal protein S1-li | 1e-11 | |
| cd00164 | 65 | cd00164, S1_like, S1_like: Ribosomal protein S1-li | 1e-11 | |
| cd05684 | 79 | cd05684, S1_DHX8_helicase, S1_DHX8_helicase: The N | 2e-11 | |
| PRK07400 | 318 | PRK07400, PRK07400, 30S ribosomal protein S1; Revi | 3e-11 | |
| smart00316 | 72 | smart00316, S1, Ribosomal protein S1-like RNA-bind | 7e-11 | |
| smart00316 | 72 | smart00316, S1, Ribosomal protein S1-like RNA-bind | 8e-11 | |
| cd04471 | 83 | cd04471, S1_RNase_R, S1_RNase_R: RNase R C-termina | 8e-11 | |
| PRK00087 | 647 | PRK00087, PRK00087, 4-hydroxy-3-methylbut-2-enyl d | 1e-10 | |
| smart00316 | 72 | smart00316, S1, Ribosomal protein S1-like RNA-bind | 2e-10 | |
| COG1093 | 269 | COG1093, SUI2, Translation initiation factor 2, al | 2e-10 | |
| COG0539 | 541 | COG0539, RpsA, Ribosomal protein S1 [Translation, | 3e-10 | |
| cd04461 | 83 | cd04461, S1_Rrp5_repeat_hs8_sc7, S1_Rrp5_repeat_hs | 3e-10 | |
| PRK03987 | 262 | PRK03987, PRK03987, translation initiation factor | 3e-10 | |
| cd04452 | 76 | cd04452, S1_IF2_alpha, S1_IF2_alpha: The alpha sub | 3e-10 | |
| TIGR00717 | 516 | TIGR00717, rpsA, ribosomal protein S1 | 4e-10 | |
| COG1185 | 692 | COG1185, Pnp, Polyribonucleotide nucleotidyltransf | 5e-10 | |
| cd05690 | 69 | cd05690, S1_RPS1_repeat_ec5, S1_RPS1_repeat_ec5: R | 6e-10 | |
| PRK12269 | 863 | PRK12269, PRK12269, bifunctional cytidylate kinase | 6e-10 | |
| cd05697 | 69 | cd05697, S1_Rrp5_repeat_hs5, S1_Rrp5_repeat_hs5: R | 6e-10 | |
| PRK12269 | 863 | PRK12269, PRK12269, bifunctional cytidylate kinase | 8e-10 | |
| COG2183 | 780 | COG2183, Tex, Transcriptional accessory protein [T | 1e-09 | |
| cd04461 | 83 | cd04461, S1_Rrp5_repeat_hs8_sc7, S1_Rrp5_repeat_hs | 2e-09 | |
| cd05697 | 69 | cd05697, S1_Rrp5_repeat_hs5, S1_Rrp5_repeat_hs5: R | 2e-09 | |
| PRK06299 | 565 | PRK06299, rpsA, 30S ribosomal protein S1; Reviewed | 3e-09 | |
| cd05685 | 68 | cd05685, S1_Tex, S1_Tex: The C-terminal S1 domain | 3e-09 | |
| cd05708 | 77 | cd05708, S1_Rrp5_repeat_sc12, S1_Rrp5_repeat_sc12: | 4e-09 | |
| TIGR02063 | 709 | TIGR02063, RNase_R, ribonuclease R | 5e-09 | |
| TIGR03591 | 684 | TIGR03591, polynuc_phos, polyribonucleotide nucleo | 6e-09 | |
| PRK12269 | 863 | PRK12269, PRK12269, bifunctional cytidylate kinase | 7e-09 | |
| PRK06299 | 565 | PRK06299, rpsA, 30S ribosomal protein S1; Reviewed | 8e-09 | |
| PRK13806 | 491 | PRK13806, rpsA, 30S ribosomal protein S1; Provisio | 8e-09 | |
| pfam00575 | 74 | pfam00575, S1, S1 RNA binding domain | 9e-09 | |
| PRK13806 | 491 | PRK13806, rpsA, 30S ribosomal protein S1; Provisio | 2e-08 | |
| PRK05807 | 136 | PRK05807, PRK05807, hypothetical protein; Provisio | 2e-08 | |
| cd05691 | 73 | cd05691, S1_RPS1_repeat_ec6, S1_RPS1_repeat_ec6: R | 2e-08 | |
| cd05698 | 70 | cd05698, S1_Rrp5_repeat_hs6_sc5, S1_Rrp5_repeat_hs | 3e-08 | |
| PRK06676 | 390 | PRK06676, rpsA, 30S ribosomal protein S1; Reviewed | 3e-08 | |
| cd00164 | 65 | cd00164, S1_like, S1_like: Ribosomal protein S1-li | 3e-08 | |
| COG0539 | 541 | COG0539, RpsA, Ribosomal protein S1 [Translation, | 5e-08 | |
| COG2183 | 780 | COG2183, Tex, Transcriptional accessory protein [T | 5e-08 | |
| TIGR00717 | 516 | TIGR00717, rpsA, ribosomal protein S1 | 7e-08 | |
| cd04472 | 68 | cd04472, S1_PNPase, S1_PNPase: Polynucleotide phos | 7e-08 | |
| cd05698 | 70 | cd05698, S1_Rrp5_repeat_hs6_sc5, S1_Rrp5_repeat_hs | 1e-07 | |
| PRK07899 | 486 | PRK07899, rpsA, 30S ribosomal protein S1; Reviewed | 1e-07 | |
| PRK07252 | 120 | PRK07252, PRK07252, hypothetical protein; Provisio | 1e-07 | |
| cd04461 | 83 | cd04461, S1_Rrp5_repeat_hs8_sc7, S1_Rrp5_repeat_hs | 2e-07 | |
| PRK00087 | 647 | PRK00087, PRK00087, 4-hydroxy-3-methylbut-2-enyl d | 2e-07 | |
| cd00164 | 65 | cd00164, S1_like, S1_like: Ribosomal protein S1-li | 2e-07 | |
| cd00164 | 65 | cd00164, S1_like, S1_like: Ribosomal protein S1-li | 2e-07 | |
| cd05696 | 71 | cd05696, S1_Rrp5_repeat_hs4, S1_Rrp5_repeat_hs4: R | 4e-07 | |
| cd05705 | 74 | cd05705, S1_Rrp5_repeat_hs14, S1_Rrp5_repeat_hs14: | 4e-07 | |
| PRK13806 | 491 | PRK13806, rpsA, 30S ribosomal protein S1; Provisio | 5e-07 | |
| COG0557 | 706 | COG0557, VacB, Exoribonuclease R [Transcription] | 5e-07 | |
| PRK00087 | 647 | PRK00087, PRK00087, 4-hydroxy-3-methylbut-2-enyl d | 6e-07 | |
| smart00316 | 72 | smart00316, S1, Ribosomal protein S1-like RNA-bind | 1e-06 | |
| PRK06676 | 390 | PRK06676, rpsA, 30S ribosomal protein S1; Reviewed | 2e-06 | |
| cd05693 | 100 | cd05693, S1_Rrp5_repeat_hs1_sc1, S1_Rrp5_repeat_hs | 2e-06 | |
| PRK13806 | 491 | PRK13806, rpsA, 30S ribosomal protein S1; Provisio | 2e-06 | |
| cd05686 | 73 | cd05686, S1_pNO40, S1_pNO40: pNO40 , S1-like RNA-b | 4e-06 | |
| PRK06299 | 565 | PRK06299, rpsA, 30S ribosomal protein S1; Reviewed | 6e-06 | |
| PRK12269 | 863 | PRK12269, PRK12269, bifunctional cytidylate kinase | 7e-06 | |
| cd05689 | 72 | cd05689, S1_RPS1_repeat_ec4, S1_RPS1_repeat_ec4: R | 9e-06 | |
| PRK06299 | 565 | PRK06299, rpsA, 30S ribosomal protein S1; Reviewed | 1e-05 | |
| PRK00087 | 647 | PRK00087, PRK00087, 4-hydroxy-3-methylbut-2-enyl d | 1e-05 | |
| pfam00575 | 74 | pfam00575, S1, S1 RNA binding domain | 1e-05 | |
| PLN00207 | 891 | PLN00207, PLN00207, polyribonucleotide nucleotidyl | 1e-05 | |
| pfam00575 | 74 | pfam00575, S1, S1 RNA binding domain | 3e-05 | |
| cd05691 | 73 | cd05691, S1_RPS1_repeat_ec6, S1_RPS1_repeat_ec6: R | 3e-05 | |
| PRK06676 | 390 | PRK06676, rpsA, 30S ribosomal protein S1; Reviewed | 4e-05 | |
| cd05703 | 73 | cd05703, S1_Rrp5_repeat_hs12_sc9, S1_Rrp5_repeat_h | 6e-05 | |
| cd05685 | 68 | cd05685, S1_Tex, S1_Tex: The C-terminal S1 domain | 6e-05 | |
| pfam00575 | 74 | pfam00575, S1, S1 RNA binding domain | 7e-05 | |
| PRK13806 | 491 | PRK13806, rpsA, 30S ribosomal protein S1; Provisio | 7e-05 | |
| PRK12269 | 863 | PRK12269, PRK12269, bifunctional cytidylate kinase | 7e-05 | |
| PRK11642 | 813 | PRK11642, PRK11642, exoribonuclease R; Provisional | 8e-05 | |
| cd05789 | 86 | cd05789, S1_Rrp4, S1_Rrp4: Rrp4 S1-like RNA-bindin | 8e-05 | |
| cd05706 | 73 | cd05706, S1_Rrp5_repeat_sc10, S1_Rrp5_repeat_sc10: | 8e-05 | |
| cd05704 | 72 | cd05704, S1_Rrp5_repeat_hs13, S1_Rrp5_repeat_hs13: | 9e-05 | |
| COG1098 | 129 | COG1098, VacB, Predicted RNA binding protein (cont | 1e-04 | |
| cd05697 | 69 | cd05697, S1_Rrp5_repeat_hs5, S1_Rrp5_repeat_hs5: R | 1e-04 | |
| cd05698 | 70 | cd05698, S1_Rrp5_repeat_hs6_sc5, S1_Rrp5_repeat_hs | 3e-04 | |
| cd05707 | 68 | cd05707, S1_Rrp5_repeat_sc11, S1_Rrp5_repeat_sc11: | 3e-04 | |
| PRK08582 | 139 | PRK08582, PRK08582, hypothetical protein; Provisio | 3e-04 | |
| cd05692 | 69 | cd05692, S1_RPS1_repeat_hs4, S1_RPS1_repeat_hs4: R | 5e-04 | |
| PRK07899 | 486 | PRK07899, rpsA, 30S ribosomal protein S1; Reviewed | 5e-04 | |
| TIGR00358 | 654 | TIGR00358, 3_prime_RNase, VacB and RNase II family | 5e-04 | |
| cd05707 | 68 | cd05707, S1_Rrp5_repeat_sc11, S1_Rrp5_repeat_sc11: | 6e-04 | |
| cd05707 | 68 | cd05707, S1_Rrp5_repeat_sc11, S1_Rrp5_repeat_sc11: | 6e-04 | |
| PRK06299 | 565 | PRK06299, rpsA, 30S ribosomal protein S1; Reviewed | 7e-04 | |
| smart00316 | 72 | smart00316, S1, Ribosomal protein S1-like RNA-bind | 7e-04 | |
| cd04461 | 83 | cd04461, S1_Rrp5_repeat_hs8_sc7, S1_Rrp5_repeat_hs | 8e-04 | |
| COG1185 | 692 | COG1185, Pnp, Polyribonucleotide nucleotidyltransf | 9e-04 | |
| cd05702 | 70 | cd05702, S1_Rrp5_repeat_hs11_sc8, S1_Rrp5_repeat_h | 0.001 | |
| smart00316 | 72 | smart00316, S1, Ribosomal protein S1-like RNA-bind | 0.001 | |
| cd05697 | 69 | cd05697, S1_Rrp5_repeat_hs5, S1_Rrp5_repeat_hs5: R | 0.001 | |
| PRK04163 | 235 | PRK04163, PRK04163, exosome complex RNA-binding pr | 0.001 | |
| PRK06676 | 390 | PRK06676, rpsA, 30S ribosomal protein S1; Reviewed | 0.002 | |
| COG1098 | 129 | COG1098, VacB, Predicted RNA binding protein (cont | 0.002 | |
| TIGR00717 | 516 | TIGR00717, rpsA, ribosomal protein S1 | 0.003 | |
| PRK06676 | 390 | PRK06676, rpsA, 30S ribosomal protein S1; Reviewed | 0.003 | |
| cd05707 | 68 | cd05707, S1_Rrp5_repeat_sc11, S1_Rrp5_repeat_sc11: | 0.003 | |
| PRK12269 | 863 | PRK12269, PRK12269, bifunctional cytidylate kinase | 0.003 | |
| cd05706 | 73 | cd05706, S1_Rrp5_repeat_sc10, S1_Rrp5_repeat_sc10: | 0.003 | |
| cd05706 | 73 | cd05706, S1_Rrp5_repeat_sc10, S1_Rrp5_repeat_sc10: | 0.003 | |
| cd05706 | 73 | cd05706, S1_Rrp5_repeat_sc10, S1_Rrp5_repeat_sc10: | 0.003 |
| >gnl|CDD|240213 cd05708, S1_Rrp5_repeat_sc12, S1_Rrp5_repeat_sc12: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
Score = 112 bits (283), Expect = 1e-29
Identities = 40/77 (51%), Positives = 59/77 (76%)
Query: 1467 HVGDIVIGQIKRVESYGLFITIENTNLVGLCHVSELSEDHVDNIETIYRAGEKVKVKILK 1526
VG + G ++RVE YG+FI I+ TN+ GLCH SE+S++ V + ++R G+KV+ K+LK
Sbjct: 1 KVGQKIDGTVRRVEDYGVFIDIDGTNVSGLCHKSEISDNRVADASKLFRVGDKVRAKVLK 60
Query: 1527 VDKEKRRISLGMKSSYF 1543
+D EK+RISLG+K+SYF
Sbjct: 61 IDAEKKRISLGLKASYF 77
|
Rrp5 has two distinct regions, an N-terminal region containing tandemly repeated S1 RNA-binding domains (12 S1 repeats in Saccharomyces cerevisiae Rrp5 and 14 S1 repeats in Homo sapiens Rrp5) and a C-terminal region containing tetratricopeptide repeat (TPR) motifs thought to be involved in protein-protein interactions. Mutational studies have shown that each region represents a specific functional domain. Deletions within the S1-containing region inhibit pre-rRNA processing at either site A3 or A2, whereas deletions within the TPR region confer an inability to support cleavage of A0-A2. This CD includes S. cerevisiae S1 repeat 12 (sc12). Rrp5 is found in eukaryotes but not in prokaryotes or archaea. Length = 77 |
| >gnl|CDD|223613 COG0539, RpsA, Ribosomal protein S1 [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >gnl|CDD|239908 cd04461, S1_Rrp5_repeat_hs8_sc7, S1_Rrp5_repeat_hs8_sc7: Rrp5 Homo sapiens S1 repeat 8 (hs8) and Saccharomyces cerevisiae S1 repeat 7 (sc7)-like domains | Back alignment and domain information |
|---|
| >gnl|CDD|223613 COG0539, RpsA, Ribosomal protein S1 [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >gnl|CDD|223613 COG0539, RpsA, Ribosomal protein S1 [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >gnl|CDD|223613 COG0539, RpsA, Ribosomal protein S1 [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >gnl|CDD|233102 TIGR00717, rpsA, ribosomal protein S1 | Back alignment and domain information |
|---|
| >gnl|CDD|240199 cd05694, S1_Rrp5_repeat_hs2_sc2, S1_Rrp5_repeat_hs2_sc2: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >gnl|CDD|240203 cd05698, S1_Rrp5_repeat_hs6_sc5, S1_Rrp5_repeat_hs6_sc5: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >gnl|CDD|223613 COG0539, RpsA, Ribosomal protein S1 [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >gnl|CDD|235775 PRK06299, rpsA, 30S ribosomal protein S1; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|223613 COG0539, RpsA, Ribosomal protein S1 [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >gnl|CDD|240208 cd05703, S1_Rrp5_repeat_hs12_sc9, S1_Rrp5_repeat_hs12_sc9: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >gnl|CDD|240200 cd05695, S1_Rrp5_repeat_hs3, S1_Rrp5_repeat_hs3: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >gnl|CDD|235851 PRK06676, rpsA, 30S ribosomal protein S1; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|233102 TIGR00717, rpsA, ribosomal protein S1 | Back alignment and domain information |
|---|
| >gnl|CDD|234623 PRK00087, PRK00087, 4-hydroxy-3-methylbut-2-enyl diphosphate reductase/S1 RNA-binding domain protein; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|233102 TIGR00717, rpsA, ribosomal protein S1 | Back alignment and domain information |
|---|
| >gnl|CDD|223613 COG0539, RpsA, Ribosomal protein S1 [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >gnl|CDD|240207 cd05702, S1_Rrp5_repeat_hs11_sc8, S1_Rrp5_repeat_hs11_sc8: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >gnl|CDD|197648 smart00316, S1, Ribosomal protein S1-like RNA-binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|233102 TIGR00717, rpsA, ribosomal protein S1 | Back alignment and domain information |
|---|
| >gnl|CDD|240198 cd05693, S1_Rrp5_repeat_hs1_sc1, S1_Rrp5_repeat_hs1_sc1: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >gnl|CDD|216000 pfam00575, S1, S1 RNA binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|235775 PRK06299, rpsA, 30S ribosomal protein S1; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|240212 cd05707, S1_Rrp5_repeat_sc11, S1_Rrp5_repeat_sc11: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >gnl|CDD|240193 cd05688, S1_RPS1_repeat_ec3, S1_RPS1_repeat_ec3: Ribosomal protein S1 (RPS1) domain | Back alignment and domain information |
|---|
| >gnl|CDD|233102 TIGR00717, rpsA, ribosomal protein S1 | Back alignment and domain information |
|---|
| >gnl|CDD|235775 PRK06299, rpsA, 30S ribosomal protein S1; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|235775 PRK06299, rpsA, 30S ribosomal protein S1; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|239908 cd04461, S1_Rrp5_repeat_hs8_sc7, S1_Rrp5_repeat_hs8_sc7: Rrp5 Homo sapiens S1 repeat 8 (hs8) and Saccharomyces cerevisiae S1 repeat 7 (sc7)-like domains | Back alignment and domain information |
|---|
| >gnl|CDD|237516 PRK13806, rpsA, 30S ribosomal protein S1; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240197 cd05692, S1_RPS1_repeat_hs4, S1_RPS1_repeat_hs4: Ribosomal protein S1 (RPS1) domain | Back alignment and domain information |
|---|
| >gnl|CDD|236995 PRK11824, PRK11824, polynucleotide phosphorylase/polyadenylase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223613 COG0539, RpsA, Ribosomal protein S1 [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >gnl|CDD|235775 PRK06299, rpsA, 30S ribosomal protein S1; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|197648 smart00316, S1, Ribosomal protein S1-like RNA-binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|236126 PRK07899, rpsA, 30S ribosomal protein S1; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|233102 TIGR00717, rpsA, ribosomal protein S1 | Back alignment and domain information |
|---|
| >gnl|CDD|224023 COG1098, VacB, Predicted RNA binding protein (contains ribosomal protein S1 domain) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >gnl|CDD|181215 PRK08059, PRK08059, general stress protein 13; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|223613 COG0539, RpsA, Ribosomal protein S1 [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >gnl|CDD|240203 cd05698, S1_Rrp5_repeat_hs6_sc5, S1_Rrp5_repeat_hs6_sc5: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >gnl|CDD|235775 PRK06299, rpsA, 30S ribosomal protein S1; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|238094 cd00164, S1_like, S1_like: Ribosomal protein S1-like RNA-binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|238094 cd00164, S1_like, S1_like: Ribosomal protein S1-like RNA-binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|240189 cd05684, S1_DHX8_helicase, S1_DHX8_helicase: The N-terminal S1 domain of human ATP-dependent RNA helicase DHX8, a DEAH (Asp-Glu-Ala-His) box polypeptide | Back alignment and domain information |
|---|
| >gnl|CDD|180960 PRK07400, PRK07400, 30S ribosomal protein S1; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|197648 smart00316, S1, Ribosomal protein S1-like RNA-binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|197648 smart00316, S1, Ribosomal protein S1-like RNA-binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|239917 cd04471, S1_RNase_R, S1_RNase_R: RNase R C-terminal S1 domain | Back alignment and domain information |
|---|
| >gnl|CDD|234623 PRK00087, PRK00087, 4-hydroxy-3-methylbut-2-enyl diphosphate reductase/S1 RNA-binding domain protein; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|197648 smart00316, S1, Ribosomal protein S1-like RNA-binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|224018 COG1093, SUI2, Translation initiation factor 2, alpha subunit (eIF-2alpha) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >gnl|CDD|223613 COG0539, RpsA, Ribosomal protein S1 [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >gnl|CDD|239908 cd04461, S1_Rrp5_repeat_hs8_sc7, S1_Rrp5_repeat_hs8_sc7: Rrp5 Homo sapiens S1 repeat 8 (hs8) and Saccharomyces cerevisiae S1 repeat 7 (sc7)-like domains | Back alignment and domain information |
|---|
| >gnl|CDD|235188 PRK03987, PRK03987, translation initiation factor IF-2 subunit alpha; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|239899 cd04452, S1_IF2_alpha, S1_IF2_alpha: The alpha subunit of translation Initiation Factor 2, S1-like RNA-binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|233102 TIGR00717, rpsA, ribosomal protein S1 | Back alignment and domain information |
|---|
| >gnl|CDD|224106 COG1185, Pnp, Polyribonucleotide nucleotidyltransferase (polynucleotide phosphorylase) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >gnl|CDD|240195 cd05690, S1_RPS1_repeat_ec5, S1_RPS1_repeat_ec5: Ribosomal protein S1 (RPS1) domain | Back alignment and domain information |
|---|
| >gnl|CDD|105491 PRK12269, PRK12269, bifunctional cytidylate kinase/ribosomal protein S1; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240202 cd05697, S1_Rrp5_repeat_hs5, S1_Rrp5_repeat_hs5: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >gnl|CDD|105491 PRK12269, PRK12269, bifunctional cytidylate kinase/ribosomal protein S1; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|225094 COG2183, Tex, Transcriptional accessory protein [Transcription] | Back alignment and domain information |
|---|
| >gnl|CDD|239908 cd04461, S1_Rrp5_repeat_hs8_sc7, S1_Rrp5_repeat_hs8_sc7: Rrp5 Homo sapiens S1 repeat 8 (hs8) and Saccharomyces cerevisiae S1 repeat 7 (sc7)-like domains | Back alignment and domain information |
|---|
| >gnl|CDD|240202 cd05697, S1_Rrp5_repeat_hs5, S1_Rrp5_repeat_hs5: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >gnl|CDD|235775 PRK06299, rpsA, 30S ribosomal protein S1; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|240190 cd05685, S1_Tex, S1_Tex: The C-terminal S1 domain of a transcription accessory factor called Tex, which has been characterized in Bordetella pertussis and Pseudomonas aeruginosa | Back alignment and domain information |
|---|
| >gnl|CDD|240213 cd05708, S1_Rrp5_repeat_sc12, S1_Rrp5_repeat_sc12: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >gnl|CDD|233703 TIGR02063, RNase_R, ribonuclease R | Back alignment and domain information |
|---|
| >gnl|CDD|234271 TIGR03591, polynuc_phos, polyribonucleotide nucleotidyltransferase | Back alignment and domain information |
|---|
| >gnl|CDD|105491 PRK12269, PRK12269, bifunctional cytidylate kinase/ribosomal protein S1; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235775 PRK06299, rpsA, 30S ribosomal protein S1; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|237516 PRK13806, rpsA, 30S ribosomal protein S1; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|216000 pfam00575, S1, S1 RNA binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|237516 PRK13806, rpsA, 30S ribosomal protein S1; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235614 PRK05807, PRK05807, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240196 cd05691, S1_RPS1_repeat_ec6, S1_RPS1_repeat_ec6: Ribosomal protein S1 (RPS1) domain | Back alignment and domain information |
|---|
| >gnl|CDD|240203 cd05698, S1_Rrp5_repeat_hs6_sc5, S1_Rrp5_repeat_hs6_sc5: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >gnl|CDD|235851 PRK06676, rpsA, 30S ribosomal protein S1; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|238094 cd00164, S1_like, S1_like: Ribosomal protein S1-like RNA-binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|223613 COG0539, RpsA, Ribosomal protein S1 [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >gnl|CDD|225094 COG2183, Tex, Transcriptional accessory protein [Transcription] | Back alignment and domain information |
|---|
| >gnl|CDD|233102 TIGR00717, rpsA, ribosomal protein S1 | Back alignment and domain information |
|---|
| >gnl|CDD|239918 cd04472, S1_PNPase, S1_PNPase: Polynucleotide phosphorylase (PNPase), ), S1-like RNA-binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|240203 cd05698, S1_Rrp5_repeat_hs6_sc5, S1_Rrp5_repeat_hs6_sc5: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >gnl|CDD|236126 PRK07899, rpsA, 30S ribosomal protein S1; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|180908 PRK07252, PRK07252, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|239908 cd04461, S1_Rrp5_repeat_hs8_sc7, S1_Rrp5_repeat_hs8_sc7: Rrp5 Homo sapiens S1 repeat 8 (hs8) and Saccharomyces cerevisiae S1 repeat 7 (sc7)-like domains | Back alignment and domain information |
|---|
| >gnl|CDD|234623 PRK00087, PRK00087, 4-hydroxy-3-methylbut-2-enyl diphosphate reductase/S1 RNA-binding domain protein; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|238094 cd00164, S1_like, S1_like: Ribosomal protein S1-like RNA-binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|238094 cd00164, S1_like, S1_like: Ribosomal protein S1-like RNA-binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|240201 cd05696, S1_Rrp5_repeat_hs4, S1_Rrp5_repeat_hs4: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >gnl|CDD|240210 cd05705, S1_Rrp5_repeat_hs14, S1_Rrp5_repeat_hs14: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >gnl|CDD|237516 PRK13806, rpsA, 30S ribosomal protein S1; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223631 COG0557, VacB, Exoribonuclease R [Transcription] | Back alignment and domain information |
|---|
| >gnl|CDD|234623 PRK00087, PRK00087, 4-hydroxy-3-methylbut-2-enyl diphosphate reductase/S1 RNA-binding domain protein; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|197648 smart00316, S1, Ribosomal protein S1-like RNA-binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|235851 PRK06676, rpsA, 30S ribosomal protein S1; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|240198 cd05693, S1_Rrp5_repeat_hs1_sc1, S1_Rrp5_repeat_hs1_sc1: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >gnl|CDD|237516 PRK13806, rpsA, 30S ribosomal protein S1; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240191 cd05686, S1_pNO40, S1_pNO40: pNO40 , S1-like RNA-binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|235775 PRK06299, rpsA, 30S ribosomal protein S1; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|105491 PRK12269, PRK12269, bifunctional cytidylate kinase/ribosomal protein S1; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240194 cd05689, S1_RPS1_repeat_ec4, S1_RPS1_repeat_ec4: Ribosomal protein S1 (RPS1) domain | Back alignment and domain information |
|---|
| >gnl|CDD|235775 PRK06299, rpsA, 30S ribosomal protein S1; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|234623 PRK00087, PRK00087, 4-hydroxy-3-methylbut-2-enyl diphosphate reductase/S1 RNA-binding domain protein; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|216000 pfam00575, S1, S1 RNA binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|215104 PLN00207, PLN00207, polyribonucleotide nucleotidyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|216000 pfam00575, S1, S1 RNA binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|240196 cd05691, S1_RPS1_repeat_ec6, S1_RPS1_repeat_ec6: Ribosomal protein S1 (RPS1) domain | Back alignment and domain information |
|---|
| >gnl|CDD|235851 PRK06676, rpsA, 30S ribosomal protein S1; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|240208 cd05703, S1_Rrp5_repeat_hs12_sc9, S1_Rrp5_repeat_hs12_sc9: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >gnl|CDD|240190 cd05685, S1_Tex, S1_Tex: The C-terminal S1 domain of a transcription accessory factor called Tex, which has been characterized in Bordetella pertussis and Pseudomonas aeruginosa | Back alignment and domain information |
|---|
| >gnl|CDD|216000 pfam00575, S1, S1 RNA binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|237516 PRK13806, rpsA, 30S ribosomal protein S1; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|105491 PRK12269, PRK12269, bifunctional cytidylate kinase/ribosomal protein S1; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236944 PRK11642, PRK11642, exoribonuclease R; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240215 cd05789, S1_Rrp4, S1_Rrp4: Rrp4 S1-like RNA-binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|240211 cd05706, S1_Rrp5_repeat_sc10, S1_Rrp5_repeat_sc10: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >gnl|CDD|240209 cd05704, S1_Rrp5_repeat_hs13, S1_Rrp5_repeat_hs13: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >gnl|CDD|224023 COG1098, VacB, Predicted RNA binding protein (contains ribosomal protein S1 domain) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >gnl|CDD|240202 cd05697, S1_Rrp5_repeat_hs5, S1_Rrp5_repeat_hs5: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >gnl|CDD|240203 cd05698, S1_Rrp5_repeat_hs6_sc5, S1_Rrp5_repeat_hs6_sc5: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >gnl|CDD|240212 cd05707, S1_Rrp5_repeat_sc11, S1_Rrp5_repeat_sc11: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >gnl|CDD|236305 PRK08582, PRK08582, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240197 cd05692, S1_RPS1_repeat_hs4, S1_RPS1_repeat_hs4: Ribosomal protein S1 (RPS1) domain | Back alignment and domain information |
|---|
| >gnl|CDD|236126 PRK07899, rpsA, 30S ribosomal protein S1; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|232937 TIGR00358, 3_prime_RNase, VacB and RNase II family 3'-5' exoribonucleases | Back alignment and domain information |
|---|
| >gnl|CDD|240212 cd05707, S1_Rrp5_repeat_sc11, S1_Rrp5_repeat_sc11: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >gnl|CDD|240212 cd05707, S1_Rrp5_repeat_sc11, S1_Rrp5_repeat_sc11: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >gnl|CDD|235775 PRK06299, rpsA, 30S ribosomal protein S1; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|197648 smart00316, S1, Ribosomal protein S1-like RNA-binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|239908 cd04461, S1_Rrp5_repeat_hs8_sc7, S1_Rrp5_repeat_hs8_sc7: Rrp5 Homo sapiens S1 repeat 8 (hs8) and Saccharomyces cerevisiae S1 repeat 7 (sc7)-like domains | Back alignment and domain information |
|---|
| >gnl|CDD|224106 COG1185, Pnp, Polyribonucleotide nucleotidyltransferase (polynucleotide phosphorylase) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >gnl|CDD|240207 cd05702, S1_Rrp5_repeat_hs11_sc8, S1_Rrp5_repeat_hs11_sc8: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >gnl|CDD|197648 smart00316, S1, Ribosomal protein S1-like RNA-binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|240202 cd05697, S1_Rrp5_repeat_hs5, S1_Rrp5_repeat_hs5: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >gnl|CDD|235233 PRK04163, PRK04163, exosome complex RNA-binding protein Rrp4; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235851 PRK06676, rpsA, 30S ribosomal protein S1; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|224023 COG1098, VacB, Predicted RNA binding protein (contains ribosomal protein S1 domain) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >gnl|CDD|233102 TIGR00717, rpsA, ribosomal protein S1 | Back alignment and domain information |
|---|
| >gnl|CDD|235851 PRK06676, rpsA, 30S ribosomal protein S1; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|240212 cd05707, S1_Rrp5_repeat_sc11, S1_Rrp5_repeat_sc11: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >gnl|CDD|105491 PRK12269, PRK12269, bifunctional cytidylate kinase/ribosomal protein S1; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240211 cd05706, S1_Rrp5_repeat_sc10, S1_Rrp5_repeat_sc10: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >gnl|CDD|240211 cd05706, S1_Rrp5_repeat_sc10, S1_Rrp5_repeat_sc10: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >gnl|CDD|240211 cd05706, S1_Rrp5_repeat_sc10, S1_Rrp5_repeat_sc10: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 1826 | |||
| KOG1070 | 1710 | consensus rRNA processing protein Rrp5 [RNA proces | 100.0 | |
| KOG1070 | 1710 | consensus rRNA processing protein Rrp5 [RNA proces | 100.0 | |
| COG0539 | 541 | RpsA Ribosomal protein S1 [Translation, ribosomal | 100.0 | |
| COG0539 | 541 | RpsA Ribosomal protein S1 [Translation, ribosomal | 100.0 | |
| PRK12269 | 863 | bifunctional cytidylate kinase/ribosomal protein S | 100.0 | |
| PRK06299 | 565 | rpsA 30S ribosomal protein S1; Reviewed | 100.0 | |
| PRK12269 | 863 | bifunctional cytidylate kinase/ribosomal protein S | 100.0 | |
| PRK06299 | 565 | rpsA 30S ribosomal protein S1; Reviewed | 100.0 | |
| TIGR00717 | 516 | rpsA ribosomal protein S1. This model provides tru | 100.0 | |
| TIGR00717 | 516 | rpsA ribosomal protein S1. This model provides tru | 100.0 | |
| PRK13806 | 491 | rpsA 30S ribosomal protein S1; Provisional | 100.0 | |
| PRK13806 | 491 | rpsA 30S ribosomal protein S1; Provisional | 100.0 | |
| PRK07899 | 486 | rpsA 30S ribosomal protein S1; Reviewed | 100.0 | |
| PRK07899 | 486 | rpsA 30S ribosomal protein S1; Reviewed | 100.0 | |
| PRK06676 | 390 | rpsA 30S ribosomal protein S1; Reviewed | 100.0 | |
| PRK06676 | 390 | rpsA 30S ribosomal protein S1; Reviewed | 100.0 | |
| PRK00087 | 647 | 4-hydroxy-3-methylbut-2-enyl diphosphate reductase | 100.0 | |
| PRK00087 | 647 | 4-hydroxy-3-methylbut-2-enyl diphosphate reductase | 100.0 | |
| PRK07400 | 318 | 30S ribosomal protein S1; Reviewed | 100.0 | |
| PRK07400 | 318 | 30S ribosomal protein S1; Reviewed | 99.98 | |
| KOG1915 | 677 | consensus Cell cycle control protein (crooked neck | 99.72 | |
| KOG0495 | 913 | consensus HAT repeat protein [RNA processing and m | 99.67 | |
| PTZ00248 | 319 | eukaryotic translation initiation factor 2 subunit | 99.56 | |
| COG1098 | 129 | VacB Predicted RNA binding protein (contains ribos | 99.55 | |
| KOG1915 | 677 | consensus Cell cycle control protein (crooked neck | 99.46 | |
| COG2996 | 287 | Predicted RNA-bindining protein (contains S1 and H | 99.44 | |
| KOG0495 | 913 | consensus HAT repeat protein [RNA processing and m | 99.42 | |
| cd05705 | 74 | S1_Rrp5_repeat_hs14 S1_Rrp5_repeat_hs14: Rrp5 is a | 99.41 | |
| COG1098 | 129 | VacB Predicted RNA binding protein (contains ribos | 99.4 | |
| cd05705 | 74 | S1_Rrp5_repeat_hs14 S1_Rrp5_repeat_hs14: Rrp5 is a | 99.38 | |
| PTZ00248 | 319 | eukaryotic translation initiation factor 2 subunit | 99.37 | |
| COG2996 | 287 | Predicted RNA-bindining protein (contains S1 and H | 99.37 | |
| cd05694 | 74 | S1_Rrp5_repeat_hs2_sc2 S1_Rrp5_repeat_hs2_sc2: Rrp | 99.37 | |
| cd05693 | 100 | S1_Rrp5_repeat_hs1_sc1 S1_Rrp5_repeat_hs1_sc1: Rrp | 99.36 | |
| cd05694 | 74 | S1_Rrp5_repeat_hs2_sc2 S1_Rrp5_repeat_hs2_sc2: Rrp | 99.33 | |
| cd05703 | 73 | S1_Rrp5_repeat_hs12_sc9 S1_Rrp5_repeat_hs12_sc9: R | 99.32 | |
| cd05703 | 73 | S1_Rrp5_repeat_hs12_sc9 S1_Rrp5_repeat_hs12_sc9: R | 99.32 | |
| cd04461 | 83 | S1_Rrp5_repeat_hs8_sc7 S1_Rrp5_repeat_hs8_sc7: Rrp | 99.27 | |
| PF05843 | 280 | Suf: Suppressor of forked protein (Suf); InterPro: | 99.26 | |
| cd05686 | 73 | S1_pNO40 S1_pNO40: pNO40 , S1-like RNA-binding dom | 99.24 | |
| cd05704 | 72 | S1_Rrp5_repeat_hs13 S1_Rrp5_repeat_hs13: Rrp5 is a | 99.24 | |
| cd05698 | 70 | S1_Rrp5_repeat_hs6_sc5 S1_Rrp5_repeat_hs6_sc5: Rrp | 99.23 | |
| cd05708 | 77 | S1_Rrp5_repeat_sc12 S1_Rrp5_repeat_sc12: Rrp5 is a | 99.23 | |
| cd05706 | 73 | S1_Rrp5_repeat_sc10 S1_Rrp5_repeat_sc10: Rrp5 is a | 99.21 | |
| PF00575 | 74 | S1: S1 RNA binding domain; InterPro: IPR003029 Rib | 99.21 | |
| cd05706 | 73 | S1_Rrp5_repeat_sc10 S1_Rrp5_repeat_sc10: Rrp5 is a | 99.2 | |
| cd05696 | 71 | S1_Rrp5_repeat_hs4 S1_Rrp5_repeat_hs4: Rrp5 is a t | 99.2 | |
| cd04461 | 83 | S1_Rrp5_repeat_hs8_sc7 S1_Rrp5_repeat_hs8_sc7: Rrp | 99.2 | |
| PF00575 | 74 | S1: S1 RNA binding domain; InterPro: IPR003029 Rib | 99.2 | |
| cd05698 | 70 | S1_Rrp5_repeat_hs6_sc5 S1_Rrp5_repeat_hs6_sc5: Rrp | 99.19 | |
| cd05704 | 72 | S1_Rrp5_repeat_hs13 S1_Rrp5_repeat_hs13: Rrp5 is a | 99.19 | |
| cd05697 | 69 | S1_Rrp5_repeat_hs5 S1_Rrp5_repeat_hs5: Rrp5 is a t | 99.17 | |
| PRK08582 | 139 | hypothetical protein; Provisional | 99.15 | |
| PRK08582 | 139 | hypothetical protein; Provisional | 99.14 | |
| cd05707 | 68 | S1_Rrp5_repeat_sc11 S1_Rrp5_repeat_sc11: Rrp5 is a | 99.14 | |
| cd05697 | 69 | S1_Rrp5_repeat_hs5 S1_Rrp5_repeat_hs5: Rrp5 is a t | 99.13 | |
| cd05707 | 68 | S1_Rrp5_repeat_sc11 S1_Rrp5_repeat_sc11: Rrp5 is a | 99.13 | |
| cd04452 | 76 | S1_IF2_alpha S1_IF2_alpha: The alpha subunit of tr | 99.12 | |
| cd05696 | 71 | S1_Rrp5_repeat_hs4 S1_Rrp5_repeat_hs4: Rrp5 is a t | 99.12 | |
| cd05693 | 100 | S1_Rrp5_repeat_hs1_sc1 S1_Rrp5_repeat_hs1_sc1: Rrp | 99.11 | |
| cd05690 | 69 | S1_RPS1_repeat_ec5 S1_RPS1_repeat_ec5: Ribosomal p | 99.1 | |
| PRK07252 | 120 | hypothetical protein; Provisional | 99.09 | |
| PRK05807 | 136 | hypothetical protein; Provisional | 99.06 | |
| PRK07252 | 120 | hypothetical protein; Provisional | 99.06 | |
| PF05843 | 280 | Suf: Suppressor of forked protein (Suf); InterPro: | 99.05 | |
| cd05691 | 73 | S1_RPS1_repeat_ec6 S1_RPS1_repeat_ec6: Ribosomal p | 99.05 | |
| cd05699 | 72 | S1_Rrp5_repeat_hs7 S1_Rrp5_repeat_hs7: Rrp5 is a t | 99.05 | |
| cd05689 | 72 | S1_RPS1_repeat_ec4 S1_RPS1_repeat_ec4: Ribosomal p | 99.04 | |
| cd05690 | 69 | S1_RPS1_repeat_ec5 S1_RPS1_repeat_ec5: Ribosomal p | 99.04 | |
| cd05708 | 77 | S1_Rrp5_repeat_sc12 S1_Rrp5_repeat_sc12: Rrp5 is a | 99.03 | |
| cd04452 | 76 | S1_IF2_alpha S1_IF2_alpha: The alpha subunit of tr | 99.03 | |
| cd05691 | 73 | S1_RPS1_repeat_ec6 S1_RPS1_repeat_ec6: Ribosomal p | 99.02 | |
| cd05695 | 66 | S1_Rrp5_repeat_hs3 S1_Rrp5_repeat_hs3: Rrp5 is a t | 99.01 | |
| cd05684 | 79 | S1_DHX8_helicase S1_DHX8_helicase: The N-terminal | 98.99 | |
| cd05686 | 73 | S1_pNO40 S1_pNO40: pNO40 , S1-like RNA-binding dom | 98.99 | |
| cd05687 | 70 | S1_RPS1_repeat_ec1_hs1 S1_RPS1_repeat_ec1_hs1: Rib | 98.99 | |
| cd05689 | 72 | S1_RPS1_repeat_ec4 S1_RPS1_repeat_ec4: Ribosomal p | 98.98 | |
| cd05687 | 70 | S1_RPS1_repeat_ec1_hs1 S1_RPS1_repeat_ec1_hs1: Rib | 98.97 | |
| PRK08059 | 123 | general stress protein 13; Validated | 98.97 | |
| cd05695 | 66 | S1_Rrp5_repeat_hs3 S1_Rrp5_repeat_hs3: Rrp5 is a t | 98.97 | |
| cd05692 | 69 | S1_RPS1_repeat_hs4 S1_RPS1_repeat_hs4: Ribosomal p | 98.95 | |
| PRK05807 | 136 | hypothetical protein; Provisional | 98.94 | |
| PRK08059 | 123 | general stress protein 13; Validated | 98.94 | |
| PHA02945 | 88 | interferon resistance protein; Provisional | 98.93 | |
| cd05685 | 68 | S1_Tex S1_Tex: The C-terminal S1 domain of a trans | 98.93 | |
| cd04465 | 67 | S1_RPS1_repeat_ec2_hs2 S1_RPS1_repeat_ec2_hs2: Rib | 98.87 | |
| cd05692 | 69 | S1_RPS1_repeat_hs4 S1_RPS1_repeat_hs4: Ribosomal p | 98.85 | |
| cd05685 | 68 | S1_Tex S1_Tex: The C-terminal S1 domain of a trans | 98.84 | |
| cd04465 | 67 | S1_RPS1_repeat_ec2_hs2 S1_RPS1_repeat_ec2_hs2: Rib | 98.84 | |
| TIGR02696 | 719 | pppGpp_PNP guanosine pentaphosphate synthetase I/p | 98.84 | |
| COG1093 | 269 | SUI2 Translation initiation factor 2, alpha subuni | 98.84 | |
| cd05688 | 68 | S1_RPS1_repeat_ec3 S1_RPS1_repeat_ec3: Ribosomal p | 98.82 | |
| cd05789 | 86 | S1_Rrp4 S1_Rrp4: Rrp4 S1-like RNA-binding domain. | 98.82 | |
| cd05684 | 79 | S1_DHX8_helicase S1_DHX8_helicase: The N-terminal | 98.82 | |
| PLN00207 | 891 | polyribonucleotide nucleotidyltransferase; Provisi | 98.81 | |
| cd04472 | 68 | S1_PNPase S1_PNPase: Polynucleotide phosphorylase | 98.81 | |
| cd04471 | 83 | S1_RNase_R S1_RNase_R: RNase R C-terminal S1 domai | 98.79 | |
| smart00316 | 72 | S1 Ribosomal protein S1-like RNA-binding domain. | 98.77 | |
| PRK03987 | 262 | translation initiation factor IF-2 subunit alpha; | 98.77 | |
| cd04453 | 88 | S1_RNase_E S1_RNase_E: RNase E and RNase G, S1-lik | 98.77 | |
| smart00316 | 72 | S1 Ribosomal protein S1-like RNA-binding domain. | 98.76 | |
| cd04472 | 68 | S1_PNPase S1_PNPase: Polynucleotide phosphorylase | 98.76 | |
| PHA02945 | 88 | interferon resistance protein; Provisional | 98.75 | |
| cd04473 | 77 | S1_RecJ_like S1_RecJ_like: The S1 domain of the ar | 98.72 | |
| cd05688 | 68 | S1_RPS1_repeat_ec3 S1_RPS1_repeat_ec3: Ribosomal p | 98.72 | |
| COG2183 | 780 | Tex Transcriptional accessory protein [Transcripti | 98.71 | |
| PLN00207 | 891 | polyribonucleotide nucleotidyltransferase; Provisi | 98.69 | |
| COG2183 | 780 | Tex Transcriptional accessory protein [Transcripti | 98.69 | |
| cd05789 | 86 | S1_Rrp4 S1_Rrp4: Rrp4 S1-like RNA-binding domain. | 98.68 | |
| PRK09521 | 189 | exosome complex RNA-binding protein Csl4; Provisio | 98.65 | |
| cd05702 | 70 | S1_Rrp5_repeat_hs11_sc8 S1_Rrp5_repeat_hs11_sc8: R | 98.64 | |
| COG1185 | 692 | Pnp Polyribonucleotide nucleotidyltransferase (pol | 98.63 | |
| cd04471 | 83 | S1_RNase_R S1_RNase_R: RNase R C-terminal S1 domai | 98.62 | |
| cd04454 | 82 | S1_Rrp4_like S1_Rrp4_like: Rrp4-like, S1-like RNA- | 98.62 | |
| PRK11824 | 693 | polynucleotide phosphorylase/polyadenylase; Provis | 98.6 | |
| cd05702 | 70 | S1_Rrp5_repeat_hs11_sc8 S1_Rrp5_repeat_hs11_sc8: R | 98.59 | |
| cd04454 | 82 | S1_Rrp4_like S1_Rrp4_like: Rrp4-like, S1-like RNA- | 98.58 | |
| cd04453 | 88 | S1_RNase_E S1_RNase_E: RNase E and RNase G, S1-lik | 98.57 | |
| PRK03987 | 262 | translation initiation factor IF-2 subunit alpha; | 98.57 | |
| cd04473 | 77 | S1_RecJ_like S1_RecJ_like: The S1 domain of the ar | 98.56 | |
| TIGR02696 | 719 | pppGpp_PNP guanosine pentaphosphate synthetase I/p | 98.56 | |
| COG1093 | 269 | SUI2 Translation initiation factor 2, alpha subuni | 98.54 | |
| cd00164 | 65 | S1_like S1_like: Ribosomal protein S1-like RNA-bin | 98.52 | |
| KOG2047 | 835 | consensus mRNA splicing factor [RNA processing and | 98.52 | |
| KOG2047 | 835 | consensus mRNA splicing factor [RNA processing and | 98.5 | |
| cd00164 | 65 | S1_like S1_like: Ribosomal protein S1-like RNA-bin | 98.48 | |
| cd04460 | 99 | S1_RpoE S1_RpoE: RpoE, S1-like RNA-binding domain. | 98.46 | |
| PRK11824 | 693 | polynucleotide phosphorylase/polyadenylase; Provis | 98.39 | |
| PRK09521 | 189 | exosome complex RNA-binding protein Csl4; Provisio | 98.38 | |
| TIGR03591 | 684 | polynuc_phos polyribonucleotide nucleotidyltransfe | 98.36 | |
| PRK04163 | 235 | exosome complex RNA-binding protein Rrp4; Provisio | 98.22 | |
| cd04460 | 99 | S1_RpoE S1_RpoE: RpoE, S1-like RNA-binding domain. | 98.22 | |
| PRK04163 | 235 | exosome complex RNA-binding protein Rrp4; Provisio | 98.19 | |
| TIGR00990 | 615 | 3a0801s09 mitochondrial precursor proteins import | 98.18 | |
| TIGR03591 | 684 | polynuc_phos polyribonucleotide nucleotidyltransfe | 98.17 | |
| TIGR02521 | 234 | type_IV_pilW type IV pilus biogenesis/stability pr | 98.17 | |
| PF13429 | 280 | TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 | 98.16 | |
| PRK09202 | 470 | nusA transcription elongation factor NusA; Validat | 98.09 | |
| cd04455 | 67 | S1_NusA S1_NusA: N-utilizing substance A protein ( | 98.09 | |
| cd05699 | 72 | S1_Rrp5_repeat_hs7 S1_Rrp5_repeat_hs7: Rrp5 is a t | 98.08 | |
| TIGR00448 | 179 | rpoE DNA-directed RNA polymerase (rpoE), archaeal | 98.07 | |
| PRK09202 | 470 | nusA transcription elongation factor NusA; Validat | 98.06 | |
| cd04455 | 67 | S1_NusA S1_NusA: N-utilizing substance A protein ( | 98.06 | |
| TIGR02063 | 709 | RNase_R ribonuclease R. This family consists of an | 98.06 | |
| TIGR02521 | 234 | type_IV_pilW type IV pilus biogenesis/stability pr | 98.02 | |
| COG1185 | 692 | Pnp Polyribonucleotide nucleotidyltransferase (pol | 98.02 | |
| COG1095 | 183 | RPB7 DNA-directed RNA polymerase, subunit E' [Tran | 98.0 | |
| KOG1258 | 577 | consensus mRNA processing protein [RNA processing | 97.99 | |
| PRK11642 | 813 | exoribonuclease R; Provisional | 97.95 | |
| PF13429 | 280 | TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 | 97.92 | |
| COG3063 | 250 | PilF Tfp pilus assembly protein PilF [Cell motilit | 97.9 | |
| PF08424 | 321 | NRDE-2: NRDE-2, necessary for RNA interference; In | 97.89 | |
| PRK11788 | 389 | tetratricopeptide repeat protein; Provisional | 97.85 | |
| cd05791 | 92 | S1_CSL4 S1_CSL4: CSL4, S1-like RNA-binding domain. | 97.84 | |
| TIGR00358 | 654 | 3_prime_RNase VacB and RNase II family 3'-5' exori | 97.84 | |
| TIGR00448 | 179 | rpoE DNA-directed RNA polymerase (rpoE), archaeal | 97.83 | |
| PRK15359 | 144 | type III secretion system chaperone protein SscB; | 97.83 | |
| TIGR01953 | 341 | NusA transcription termination factor NusA. This m | 97.79 | |
| cd05791 | 92 | S1_CSL4 S1_CSL4: CSL4, S1-like RNA-binding domain. | 97.78 | |
| KOG1067 | 760 | consensus Predicted RNA-binding polyribonucleotide | 97.78 | |
| PRK10370 | 198 | formate-dependent nitrite reductase complex subuni | 97.76 | |
| PRK08563 | 187 | DNA-directed RNA polymerase subunit E'; Provisiona | 97.74 | |
| TIGR02552 | 135 | LcrH_SycD type III secretion low calcium response | 97.71 | |
| KOG1067 | 760 | consensus Predicted RNA-binding polyribonucleotide | 97.68 | |
| TIGR02063 | 709 | RNase_R ribonuclease R. This family consists of an | 97.68 | |
| PRK11788 | 389 | tetratricopeptide repeat protein; Provisional | 97.68 | |
| PRK12370 | 553 | invasion protein regulator; Provisional | 97.67 | |
| TIGR03302 | 235 | OM_YfiO outer membrane assembly lipoprotein YfiO. | 97.66 | |
| TIGR00990 | 615 | 3a0801s09 mitochondrial precursor proteins import | 97.66 | |
| cd05701 | 69 | S1_Rrp5_repeat_hs10 S1_Rrp5_repeat_hs10: Rrp5 is a | 97.65 | |
| PRK12370 | 553 | invasion protein regulator; Provisional | 97.64 | |
| TIGR01953 | 341 | NusA transcription termination factor NusA. This m | 97.61 | |
| TIGR02917 | 899 | PEP_TPR_lipo putative PEP-CTERM system TPR-repeat | 97.6 | |
| KOG1914 | 656 | consensus mRNA cleavage and polyadenylation factor | 97.58 | |
| KOG2396 | 568 | consensus HAT (Half-A-TPR) repeat-containing prote | 97.58 | |
| TIGR02917 | 899 | PEP_TPR_lipo putative PEP-CTERM system TPR-repeat | 97.55 | |
| PRK12327 | 362 | nusA transcription elongation factor NusA; Provisi | 97.54 | |
| PRK15174 | 656 | Vi polysaccharide export protein VexE; Provisional | 97.52 | |
| PRK12327 | 362 | nusA transcription elongation factor NusA; Provisi | 97.51 | |
| COG1095 | 183 | RPB7 DNA-directed RNA polymerase, subunit E' [Tran | 97.49 | |
| PRK11642 | 813 | exoribonuclease R; Provisional | 97.47 | |
| PRK11447 | 1157 | cellulose synthase subunit BcsC; Provisional | 97.47 | |
| TIGR00358 | 654 | 3_prime_RNase VacB and RNase II family 3'-5' exori | 97.46 | |
| PF08424 | 321 | NRDE-2: NRDE-2, necessary for RNA interference; In | 97.43 | |
| PRK08563 | 187 | DNA-directed RNA polymerase subunit E'; Provisiona | 97.43 | |
| KOG2076 | 895 | consensus RNA polymerase III transcription factor | 97.42 | |
| PF09976 | 145 | TPR_21: Tetratricopeptide repeat; InterPro: IPR018 | 97.37 | |
| PRK11447 | 1157 | cellulose synthase subunit BcsC; Provisional | 97.37 | |
| KOG1914 | 656 | consensus mRNA cleavage and polyadenylation factor | 97.37 | |
| PRK15179 | 694 | Vi polysaccharide biosynthesis protein TviE; Provi | 97.3 | |
| PRK09782 | 987 | bacteriophage N4 receptor, outer membrane subunit; | 97.28 | |
| PHA02858 | 86 | EIF2a-like PKR inhibitor; Provisional | 97.24 | |
| PRK10747 | 398 | putative protoheme IX biogenesis protein; Provisio | 97.24 | |
| cd04462 | 88 | S1_RNAPII_Rpb7 S1_RNAPII_Rpb7: Eukaryotic RNA poly | 97.19 | |
| PRK09782 | 987 | bacteriophage N4 receptor, outer membrane subunit; | 97.16 | |
| cd05700 | 65 | S1_Rrp5_repeat_hs9 S1_Rrp5_repeat_hs9: Rrp5 is a t | 97.15 | |
| TIGR00540 | 409 | hemY_coli hemY protein. This is an uncharacterized | 97.14 | |
| PRK15174 | 656 | Vi polysaccharide export protein VexE; Provisional | 97.14 | |
| PF08311 | 126 | Mad3_BUB1_I: Mad3/BUB1 homology region 1; InterPro | 97.12 | |
| PRK05054 | 644 | exoribonuclease II; Provisional | 97.1 | |
| KOG1258 | 577 | consensus mRNA processing protein [RNA processing | 97.1 | |
| PRK15179 | 694 | Vi polysaccharide biosynthesis protein TviE; Provi | 97.09 | |
| PRK10049 | 765 | pgaA outer membrane protein PgaA; Provisional | 97.09 | |
| PRK10747 | 398 | putative protoheme IX biogenesis protein; Provisio | 97.05 | |
| KOG0547 | 606 | consensus Translocase of outer mitochondrial membr | 97.03 | |
| cd00189 | 100 | TPR Tetratricopeptide repeat domain; typically con | 97.03 | |
| PRK10049 | 765 | pgaA outer membrane protein PgaA; Provisional | 97.0 | |
| PRK11189 | 296 | lipoprotein NlpI; Provisional | 96.98 | |
| cd04462 | 88 | S1_RNAPII_Rpb7 S1_RNAPII_Rpb7: Eukaryotic RNA poly | 96.93 | |
| smart00386 | 33 | HAT HAT (Half-A-TPR) repeats. Present in several R | 96.9 | |
| KOG0128 | 881 | consensus RNA-binding protein SART3 (RRM superfami | 96.83 | |
| PRK11189 | 296 | lipoprotein NlpI; Provisional | 96.82 | |
| PHA02858 | 86 | EIF2a-like PKR inhibitor; Provisional | 96.79 | |
| COG1096 | 188 | Predicted RNA-binding protein (consists of S1 doma | 96.74 | |
| PF14559 | 68 | TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN | 96.74 | |
| COG1107 | 715 | Archaea-specific RecJ-like exonuclease, contains D | 96.73 | |
| PF02184 | 32 | HAT: HAT (Half-A-TPR) repeat; InterPro: IPR003107 | 96.69 | |
| KOG4626 | 966 | consensus O-linked N-acetylglucosamine transferase | 96.68 | |
| PF10447 | 82 | EXOSC1: Exosome component EXOSC1/CSL4; InterPro: I | 96.66 | |
| PLN03088 | 356 | SGT1, suppressor of G2 allele of SKP1; Provisional | 96.66 | |
| cd05804 | 355 | StaR_like StaR_like; a well-conserved protein foun | 96.61 | |
| KOG1155 | 559 | consensus Anaphase-promoting complex (APC), Cdc23 | 96.61 | |
| PF13428 | 44 | TPR_14: Tetratricopeptide repeat | 96.56 | |
| COG1097 | 239 | RRP4 RNA-binding protein Rrp4 and related proteins | 96.51 | |
| PTZ00162 | 176 | DNA-directed RNA polymerase II subunit 7; Provisio | 96.47 | |
| TIGR02795 | 119 | tol_pal_ybgF tol-pal system protein YbgF. Members | 96.47 | |
| smart00777 | 125 | Mad3_BUB1_I Mad3/BUB1 hoMad3/BUB1 homology region | 96.45 | |
| KOG2396 | 568 | consensus HAT (Half-A-TPR) repeat-containing prote | 96.44 | |
| PRK14574 | 822 | hmsH outer membrane protein; Provisional | 96.44 | |
| COG0557 | 706 | VacB Exoribonuclease R [Transcription] | 96.37 | |
| PRK10803 | 263 | tol-pal system protein YbgF; Provisional | 96.36 | |
| TIGR00540 | 409 | hemY_coli hemY protein. This is an uncharacterized | 96.35 | |
| cd00189 | 100 | TPR Tetratricopeptide repeat domain; typically con | 96.35 | |
| PF13432 | 65 | TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL | 96.35 | |
| TIGR02062 | 639 | RNase_B exoribonuclease II. This family consists o | 96.31 | |
| COG1107 | 715 | Archaea-specific RecJ-like exonuclease, contains D | 96.3 | |
| PRK12328 | 374 | nusA transcription elongation factor NusA; Provisi | 96.29 | |
| TIGR03302 | 235 | OM_YfiO outer membrane assembly lipoprotein YfiO. | 96.27 | |
| cd05790 | 86 | S1_Rrp40 S1_Rrp40: Rrp40 S1-like RNA-binding domai | 96.2 | |
| PRK10153 | 517 | DNA-binding transcriptional activator CadC; Provis | 96.18 | |
| COG5191 | 435 | Uncharacterized conserved protein, contains HAT (H | 96.11 | |
| KOG2076 | 895 | consensus RNA polymerase III transcription factor | 96.05 | |
| KOG2916 | 304 | consensus Translation initiation factor 2, alpha s | 96.04 | |
| KOG1856 | 1299 | consensus Transcription elongation factor SPT6 [RN | 96.02 | |
| TIGR00757 | 414 | RNaseEG ribonuclease, Rne/Rng family. The C-termin | 96.0 | |
| PRK05054 | 644 | exoribonuclease II; Provisional | 95.97 | |
| PLN03088 | 356 | SGT1, suppressor of G2 allele of SKP1; Provisional | 95.96 | |
| KOG4626 | 966 | consensus O-linked N-acetylglucosamine transferase | 95.87 | |
| COG1096 | 188 | Predicted RNA-binding protein (consists of S1 doma | 95.86 | |
| KOG1856 | 1299 | consensus Transcription elongation factor SPT6 [RN | 95.82 | |
| COG4783 | 484 | Putative Zn-dependent protease, contains TPR repea | 95.81 | |
| PTZ00162 | 176 | DNA-directed RNA polymerase II subunit 7; Provisio | 95.73 | |
| PF13509 | 61 | S1_2: S1 domain; PDB: 3GO5_A. | 95.73 | |
| KOG1126 | 638 | consensus DNA-binding cell division cycle control | 95.71 | |
| PRK10370 | 198 | formate-dependent nitrite reductase complex subuni | 95.71 | |
| COG1097 | 239 | RRP4 RNA-binding protein Rrp4 and related proteins | 95.7 | |
| TIGR02552 | 135 | LcrH_SycD type III secretion low calcium response | 95.68 | |
| PRK12328 | 374 | nusA transcription elongation factor NusA; Provisi | 95.68 | |
| COG3063 | 250 | PilF Tfp pilus assembly protein PilF [Cell motilit | 95.58 | |
| PRK02603 | 172 | photosystem I assembly protein Ycf3; Provisional | 95.48 | |
| PRK14574 | 822 | hmsH outer membrane protein; Provisional | 95.47 | |
| TIGR00757 | 414 | RNaseEG ribonuclease, Rne/Rng family. The C-termin | 95.45 | |
| PF13509 | 61 | S1_2: S1 domain; PDB: 3GO5_A. | 95.45 | |
| COG4783 | 484 | Putative Zn-dependent protease, contains TPR repea | 95.41 | |
| PRK15359 | 144 | type III secretion system chaperone protein SscB; | 95.37 | |
| TIGR02795 | 119 | tol_pal_ybgF tol-pal system protein YbgF. Members | 95.3 | |
| cd05804 | 355 | StaR_like StaR_like; a well-conserved protein foun | 95.28 | |
| PLN03218 | 1060 | maturation of RBCL 1; Provisional | 95.27 | |
| PF10447 | 82 | EXOSC1: Exosome component EXOSC1/CSL4; InterPro: I | 95.27 | |
| PF08311 | 126 | Mad3_BUB1_I: Mad3/BUB1 homology region 1; InterPro | 95.26 | |
| KOG0547 | 606 | consensus Translocase of outer mitochondrial membr | 95.25 | |
| PF14559 | 68 | TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN | 95.17 | |
| PRK02603 | 172 | photosystem I assembly protein Ycf3; Provisional | 95.16 | |
| PLN03218 | 1060 | maturation of RBCL 1; Provisional | 95.16 | |
| KOG2003 | 840 | consensus TPR repeat-containing protein [General f | 95.11 | |
| PF09295 | 395 | ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter | 95.0 | |
| cd05790 | 86 | S1_Rrp40 S1_Rrp40: Rrp40 S1-like RNA-binding domai | 94.86 | |
| KOG2916 | 304 | consensus Translation initiation factor 2, alpha s | 94.83 | |
| COG5191 | 435 | Uncharacterized conserved protein, contains HAT (H | 94.82 | |
| smart00386 | 33 | HAT HAT (Half-A-TPR) repeats. Present in several R | 94.81 | |
| PLN02789 | 320 | farnesyltranstransferase | 94.79 | |
| PF13525 | 203 | YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M | 94.69 | |
| COG5010 | 257 | TadD Flp pilus assembly protein TadD, contains TPR | 94.68 | |
| PF09295 | 395 | ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter | 94.66 | |
| PF12895 | 84 | Apc3: Anaphase-promoting complex, cyclosome, subun | 94.66 | |
| CHL00033 | 168 | ycf3 photosystem I assembly protein Ycf3 | 94.66 | |
| PF13431 | 34 | TPR_17: Tetratricopeptide repeat | 94.62 | |
| TIGR02062 | 639 | RNase_B exoribonuclease II. This family consists o | 94.59 | |
| PF02184 | 32 | HAT: HAT (Half-A-TPR) repeat; InterPro: IPR003107 | 94.44 | |
| COG0557 | 706 | VacB Exoribonuclease R [Transcription] | 94.38 | |
| COG5107 | 660 | RNA14 Pre-mRNA 3'-end processing (cleavage and pol | 94.38 | |
| PRK14720 | 906 | transcript cleavage factor/unknown domain fusion p | 94.3 | |
| PF12688 | 120 | TPR_5: Tetratrico peptide repeat | 94.21 | |
| PRK12329 | 449 | nusA transcription elongation factor NusA; Provisi | 94.16 | |
| KOG2002 | 1018 | consensus TPR-containing nuclear phosphoprotein th | 94.01 | |
| KOG1128 | 777 | consensus Uncharacterized conserved protein, conta | 93.87 | |
| PF04733 | 290 | Coatomer_E: Coatomer epsilon subunit; InterPro: IP | 93.86 | |
| COG5107 | 660 | RNA14 Pre-mRNA 3'-end processing (cleavage and pol | 93.85 | |
| PF12895 | 84 | Apc3: Anaphase-promoting complex, cyclosome, subun | 93.7 | |
| PLN03081 | 697 | pentatricopeptide (PPR) repeat-containing protein; | 93.69 | |
| KOG1840 | 508 | consensus Kinesin light chain [Cytoskeleton] | 93.63 | |
| PF13414 | 69 | TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A | 93.63 | |
| KOG1155 | 559 | consensus Anaphase-promoting complex (APC), Cdc23 | 93.58 | |
| COG4235 | 287 | Cytochrome c biogenesis factor [Posttranslational | 93.53 | |
| PF13414 | 69 | TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A | 93.13 | |
| KOG0553 | 304 | consensus TPR repeat-containing protein [General f | 93.07 | |
| KOG1125 | 579 | consensus TPR repeat-containing protein [General f | 93.07 | |
| PRK12329 | 449 | nusA transcription elongation factor NusA; Provisi | 93.01 | |
| PF13428 | 44 | TPR_14: Tetratricopeptide repeat | 92.92 | |
| PLN03081 | 697 | pentatricopeptide (PPR) repeat-containing protein; | 92.29 | |
| PF13432 | 65 | TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL | 92.21 | |
| smart00777 | 125 | Mad3_BUB1_I Mad3/BUB1 hoMad3/BUB1 homology region | 92.2 | |
| KOG1173 | 611 | consensus Anaphase-promoting complex (APC), Cdc16 | 92.12 | |
| PRK14720 | 906 | transcript cleavage factor/unknown domain fusion p | 92.09 | |
| PF13371 | 73 | TPR_9: Tetratricopeptide repeat | 92.06 | |
| PF13371 | 73 | TPR_9: Tetratricopeptide repeat | 92.0 | |
| PRK10866 | 243 | outer membrane biogenesis protein BamD; Provisiona | 91.99 | |
| KOG1126 | 638 | consensus DNA-binding cell division cycle control | 91.78 | |
| PRK15363 | 157 | pathogenicity island 2 chaperone protein SscA; Pro | 91.59 | |
| PRK10803 | 263 | tol-pal system protein YbgF; Provisional | 91.52 | |
| KOG0128 | 881 | consensus RNA-binding protein SART3 (RRM superfami | 91.49 | |
| PRK10811 | 1068 | rne ribonuclease E; Reviewed | 91.36 | |
| PLN03077 | 857 | Protein ECB2; Provisional | 91.28 | |
| PRK10866 | 243 | outer membrane biogenesis protein BamD; Provisiona | 91.18 | |
| PF13525 | 203 | YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M | 91.05 | |
| PLN02789 | 320 | farnesyltranstransferase | 91.05 | |
| COG3071 | 400 | HemY Uncharacterized enzyme of heme biosynthesis [ | 90.91 | |
| PF13512 | 142 | TPR_18: Tetratricopeptide repeat | 90.8 | |
| CHL00033 | 168 | ycf3 photosystem I assembly protein Ycf3 | 90.74 | |
| PLN03077 | 857 | Protein ECB2; Provisional | 90.69 | |
| PRK10811 | 1068 | rne ribonuclease E; Reviewed | 90.67 | |
| PRK15363 | 157 | pathogenicity island 2 chaperone protein SscA; Pro | 90.62 | |
| PF09976 | 145 | TPR_21: Tetratricopeptide repeat; InterPro: IPR018 | 90.61 | |
| PF02259 | 352 | FAT: FAT domain; InterPro: IPR003151 The FAT domai | 90.3 | |
| KOG2002 | 1018 | consensus TPR-containing nuclear phosphoprotein th | 90.24 | |
| PF13174 | 33 | TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ | 90.15 | |
| PRK10153 | 517 | DNA-binding transcriptional activator CadC; Provis | 90.08 | |
| PRK11906 | 458 | transcriptional regulator; Provisional | 89.87 | |
| KOG4234 | 271 | consensus TPR repeat-containing protein [General f | 89.75 | |
| PRK11712 | 489 | ribonuclease G; Provisional | 89.53 | |
| COG3118 | 304 | Thioredoxin domain-containing protein [Posttransla | 89.38 | |
| PF12569 | 517 | NARP1: NMDA receptor-regulated protein 1 ; InterPr | 89.19 | |
| COG2956 | 389 | Predicted N-acetylglucosaminyl transferase [Carboh | 89.08 | |
| COG2956 | 389 | Predicted N-acetylglucosaminyl transferase [Carboh | 88.97 | |
| KOG1173 | 611 | consensus Anaphase-promoting complex (APC), Cdc16 | 88.81 | |
| KOG1840 | 508 | consensus Kinesin light chain [Cytoskeleton] | 88.45 | |
| PF14938 | 282 | SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 | 88.4 | |
| KOG0553 | 304 | consensus TPR repeat-containing protein [General f | 88.21 | |
| KOG3298 | 170 | consensus DNA-directed RNA polymerase subunit E' [ | 87.81 | |
| PF07719 | 34 | TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 | 87.72 | |
| cd05701 | 69 | S1_Rrp5_repeat_hs10 S1_Rrp5_repeat_hs10: Rrp5 is a | 87.37 | |
| KOG3785 | 557 | consensus Uncharacterized conserved protein [Funct | 87.28 | |
| COG0457 | 291 | NrfG FOG: TPR repeat [General function prediction | 87.07 | |
| PRK11712 | 489 | ribonuclease G; Provisional | 86.95 | |
| KOG1129 | 478 | consensus TPR repeat-containing protein [General f | 86.92 | |
| KOG1128 | 777 | consensus Uncharacterized conserved protein, conta | 86.77 | |
| KOG0543 | 397 | consensus FKBP-type peptidyl-prolyl cis-trans isom | 86.77 | |
| PF03704 | 146 | BTAD: Bacterial transcriptional activator domain; | 86.62 | |
| KOG3409 | 193 | consensus Exosomal 3'-5' exoribonuclease complex, | 85.84 | |
| PF12688 | 120 | TPR_5: Tetratrico peptide repeat | 85.62 | |
| PF13424 | 78 | TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 | 85.55 | |
| KOG3298 | 170 | consensus DNA-directed RNA polymerase subunit E' [ | 85.25 | |
| PF10246 | 104 | MRP-S35: Mitochondrial ribosomal protein MRP-S35; | 85.22 | |
| PF10602 | 177 | RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 | 84.98 | |
| PRK11906 | 458 | transcriptional regulator; Provisional | 84.9 | |
| COG5010 | 257 | TadD Flp pilus assembly protein TadD, contains TPR | 84.3 | |
| KOG3060 | 289 | consensus Uncharacterized conserved protein [Funct | 84.27 | |
| KOG4162 | 799 | consensus Predicted calmodulin-binding protein [Si | 84.12 | |
| KOG3409 | 193 | consensus Exosomal 3'-5' exoribonuclease complex, | 84.08 | |
| COG3071 | 400 | HemY Uncharacterized enzyme of heme biosynthesis [ | 83.88 | |
| PF08292 | 122 | RNA_pol_Rbc25: RNA polymerase III subunit Rpc25; I | 83.39 | |
| COG4700 | 251 | Uncharacterized protein conserved in bacteria cont | 83.23 | |
| PRK12442 | 87 | translation initiation factor IF-1; Reviewed | 83.2 | |
| KOG0624 | 504 | consensus dsRNA-activated protein kinase inhibitor | 83.15 | |
| PF08292 | 122 | RNA_pol_Rbc25: RNA polymerase III subunit Rpc25; I | 82.99 | |
| KOG1832 | 1516 | consensus HIV-1 Vpr-binding protein [Cell cycle co | 82.8 | |
| KOG2471 | 696 | consensus TPR repeat-containing protein [General f | 81.21 | |
| PF13176 | 36 | TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ | 81.02 | |
| PF13424 | 78 | TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 | 80.78 | |
| TIGR00008 | 68 | infA translation initiation factor IF-1. This fami | 80.72 | |
| KOG1156 | 700 | consensus N-terminal acetyltransferase [Chromatin | 80.49 | |
| KOG1166 | 974 | consensus Mitotic checkpoint serine/threonine prot | 80.19 | |
| COG0457 | 291 | NrfG FOG: TPR repeat [General function prediction | 80.03 |
| >KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] | Back alignment and domain information |
|---|
Probab=100.00 E-value=4.8e-185 Score=1718.34 Aligned_cols=1519 Identities=35% Similarity=0.507 Sum_probs=1187.8
Q ss_pred cCCCCCCCCCcCCCCCCCCCCchhhhhhhhh--hcccccccccc---c--ccccccccccccccccccccccCCccCCCc
Q 000227 43 LALPPDDDVPVFPRGGGHSLTQRERDEIHAE--VDAEFEAVERG---L--HKKNKKKKKKTERKANETVDDLGSLFGDGI 115 (1826)
Q Consensus 43 ~~~~~~~~e~~FPRGg~~~lt~~e~~~~~~~--~d~lf~~~~~~---~--~kk~~~~~~~~~~~~~~~~~~~~~~~~~~~ 115 (1826)
..+...+++++|||||+|.|||+|++++..| .|.+|+....+ . .+++++.++..++-+. .++...
T Consensus 27 ~~l~~~t~~~~fprgg~s~lt~~e~~kv~~E~~~e~l~~~~~vke~~~~~~~~~k~vk~~~s~~s~--------~~~~~~ 98 (1710)
T KOG1070|consen 27 SSLKRKTAAPDFPRGGASKLTPLEIEKVEEEAFIEGLTGFGVVKEVFDDGRPKKKTVKKSASKVSK--------KFTENF 98 (1710)
T ss_pred ccccccccccccccccccccChHHHHHHHHHHHhhhhhcccceecccCCCCccccccccchhhHHH--------hhhccc
Confidence 3446677899999999999999999999554 45555532111 0 1111111111111010 000011
Q ss_pred CCCCCceeeccccCCcCcCcEEEEEEEEEecccEEEEcCCCcEEEEeccccCchhhhcccccccCCCCCccccCCCEEEE
Q 000227 116 SGKLPRYANKITLKNISAGMKLWGVVAEVNEKDLVICLPGGLRGLARAADALDPILDNEIEANEDNLLPTIFHVGQLVSC 195 (1826)
Q Consensus 116 ~~~~~~~ve~l~~k~l~~G~~vlG~V~~i~~~~l~vsLp~~l~G~v~~t~is~~~~~~~~~~~~~~~L~~~f~vGq~v~~ 195 (1826)
...-+..+++++|++++|||+|||+|++|+..|+.+|+|++|+|||+.+++|+.+
T Consensus 99 ~~~k~~~~~~~~~k~isPG~~llgvIs~i~~~Dl~isv~~~l~g~v~~t~lS~~~------------------------- 153 (1710)
T KOG1070|consen 99 NEEKPEIINAFQLKNISPGMLLLGVISKINGNDLKISVKGGLNGYVLNTHLSDEM------------------------- 153 (1710)
T ss_pred cccchhhhhhccccccCCcceeeeeeeeccccceeEEccCcccccccccccCHhH-------------------------
Confidence 1112556899999999999999999999999999999999999999999999862
Q ss_pred EEEEEecCccccceeEEEEecchhhhccCCCcccccCCcEEEEEEEEEeeceEEEEeCCCCeEEEeeCCCCCcCCCCCCC
Q 000227 196 IVLQLDDDKKEIGKRKIWLSLRLSLLYKGLSLETVQEGMVLTAYVKSIEDHGYILHFGLPSFTGFLPRNNLAENSGIDVK 275 (1826)
Q Consensus 196 ~V~~~~~~~~~~~~~~i~LSl~p~~vn~~l~~~~l~~G~~l~~~V~svEDhG~ild~Gi~~~~gFl~~~~~~~~~~~~l~ 275 (1826)
+.+||.|.+.|.|+||||+++|+|++..+||+...+++.. +..|+
T Consensus 154 ----------------------------------~~~~~~l~~~v~S~ed~g~~l~~g~~~~~~~~e~~q~pn~-~~~lK 198 (1710)
T KOG1070|consen 154 ----------------------------------LAAGEVLDTAVVSIEDHGAILDVGLDEITGFIEKSQFPNL-GAKLK 198 (1710)
T ss_pred ----------------------------------hhhhhhhccccccccccccchhcCCccccchhhhccCchh-hhhcc
Confidence 2357889999999999999999999999999999987632 33799
Q ss_pred CCcEEEEEEEEEcCCCCEEEEecCccccccccccccccccccccCCCceEEEEEEEEecCeEEEEeCCCeEEEEeccccc
Q 000227 276 PGLLLQGVVRSIDRTRKVVYLSSDPDTVSKCVTKDLKGISIDLLVPGMMVSTRVQSILENGVMLSFLTYFTGTVDIFHLQ 355 (1826)
Q Consensus 276 ~G~~~~~~V~~~~~~~~~v~ls~~~~~~~~~~~~~~~~~s~~~l~pG~~V~~~V~~V~~~Gl~v~~~~~~~G~v~~~hl~ 355 (1826)
+||+++|+|++++. +.+++|..+..+....+++.++++++.|+|||+|+|.|++|++||+.++|+++|+|+++..||.
T Consensus 199 vGq~l~~~V~k~~s--~~v~ks~~~~~~~t~~~t~~~~~~~~~LvpGt~vqa~V~sv~~~Gi~~dil~~ftG~l~~~hl~ 276 (1710)
T KOG1070|consen 199 VGQWLRVSVTKSTS--ERVVKSTKFVEVLTLNPTSCNGLALNDLVPGTMVQAEVQSVEDHGITLDILNGFTGFLDKKHLP 276 (1710)
T ss_pred cCceEEEEEEeccC--ceEEecccceeeecccchhccccchhhcCCcceEEEEecceecCcEEEEecccccceeehhhCC
Confidence 99999999999875 4888999998888888888899999999999999999999999999999999999999999998
Q ss_pred CCCCCCCccccCCCCCEEEEEEEEEeCCccEEEEeeChhhccCCCCCCCCCCCCEEEeEEEEEEeCCceEEEEcCCCCCc
Q 000227 356 NTFPTTNWKNDYNQHKKVNARILFVDPTSRAVGLTLNPYLLHNRAPPSHVKVGDIYDQSKVVRVDRGLGLLLDIPSTPVS 435 (1826)
Q Consensus 356 ~~~~~~~~~~~y~~G~~v~arVl~v~~~~k~v~LSl~p~~~~~~~~~~~~~~G~iv~~~~V~~v~~~~Gl~v~i~~~~~~ 435 (1826)
+++ .|..|+...|.|+. +..+ ...++.++.+....+... |+..-++.
T Consensus 277 ~~~-------~~~~~~~~l~~vi~--~s~R-------------------v~~~~f~~ka~ki~~l~~-~v~ai~p~---- 323 (1710)
T KOG1070|consen 277 PFL-------RYFENQEKLGKVIH--KSDR-------------------VFVVDFFDKASKILVLKA-GVDAIAPS---- 323 (1710)
T ss_pred chh-------hccccHHHhhcccc--hhhh-------------------eeeechhhccceEEEecC-ccceEccC----
Confidence 764 48888888877532 2222 222344444444444443 44444432
Q ss_pred cceeeeccchhhHHHHhhhhhccCCCEEEEEEEEEEeCCCeEEEEeccccccccccccccCCCCcEEEEEEEEEecCcEE
Q 000227 436 TPAYVTISDVAEEEVRKLEKKYKEGSCVRVRILGFRHLEGLATGILKASAFEGLVFTHSDVKPGMVVKGKVIAVDSFGAI 515 (1826)
Q Consensus 436 v~gfv~~s~~~~~~v~~~~~~~~vG~~~~~rVi~~~~~d~~~~ls~k~~~~~~~~~~~~~l~~G~iv~g~V~~v~~~G~~ 515 (1826)
+.+. +-. ...++.|.+++|||+++..+|.++..+++.+.++.++..+.+++||.++.+.+ .+.++
T Consensus 324 -------~~~~---~~~-~e~~k~G~~~K~~vi~~~~~~~~~~~tl~~s~ie~k~~~~s~V~~r~l~~~~~-svdt~--- 388 (1710)
T KOG1070|consen 324 -------RIEK---VLS-FEIFKIGNKVKCRVIDVLQMDSLALFTLKESAIEGKFSLVSDVSPRGLLKKPV-SVDTE--- 388 (1710)
T ss_pred -------Cccc---ccc-hhhcccCceEEEEEEEEeeccceEEeecchhhccCceEEEeccCCceEEEecc-cCChh---
Confidence 1111 011 12489999999999999999999999999999999999999999999999998 77665
Q ss_pred EEeCCCeEEeecCCCcccccccCCCCCcCCCCEEEEEEEEEeCCeEEEEecchhhccchhhccccccccCCcEEEEEEEE
Q 000227 516 VQFPGGVKALCPLPHMSEFEIVKPGKKFKVGAELVFRVLGVKSKRITVTHKKTLVKSKLAILSSYAEATDRLITHGWITK 595 (1826)
Q Consensus 516 V~i~~~v~G~Vp~~hlsd~~l~~p~~~fkvG~~Vk~rVL~v~~~~i~LSlK~~Lv~~~~~~~~s~~~~~~G~~~~G~V~~ 595 (1826)
..|++|+.|++++...+|+.+|..|..|.||||.+..+.+.+|+| .+..+++|.++.|.++.+ ..+|++.+
T Consensus 389 ------~~~l~~L~hv~~f~~a~p~~~~~~~~di~~~vl~~~ak~~~vt~~-v~~~sK~pvis~y~~~~~--~t~~~l~~ 459 (1710)
T KOG1070|consen 389 ------EVGLSPLPHVLGFEYADPSKKISDGKDIGFRVLTCKAKCGSVTLK-VLCVSKLPVISMYADAVK--LTHGMLSK 459 (1710)
T ss_pred ------hhhccccchhhceeecCCCcccccccceeeEEeeccceeeeeeee-eeEeecCcceEEEeeccc--cCcchhhc
Confidence 679999999999999999999999999999999999899999999 999999999999998877 77888887
Q ss_pred EecceEEEEEcCCeEEEEeCcccCCCCCCCCCCCccCCCEEEEEEEEEccCCCEEEEEEeeCCCCCcccccccCCCEEEE
Q 000227 596 IEKHGCFVRFYNGVQGFAPRSELGLDPGCEPSSMYHVGQVVKCRIMSSIPASRRINLSFMMKPTRVSEDDLVKLGSLVSG 675 (1826)
Q Consensus 596 i~~~G~~V~~~~gv~G~vp~sel~~~~~~~~~~~~~vGq~V~vrVl~vd~~~~ri~lS~k~~~~~~~~~~~~~vG~iv~g 675 (1826)
+. .|++|+-+++.....++-.+|.+|+.+.|++.. ..+.+++ ....++++|++|+|
T Consensus 460 v~------------q~~v~~~e~~te~~~rv~~v~~v~~v~~v~~~~-----svl~lk~-------~~~nDI~iG~~V~~ 515 (1710)
T KOG1070|consen 460 VP------------QGMVPIYEVGTEVKSRVWQVFYVGKVVIVSVRE-----SVLGLKF-------LRVNDIEIGQLVPG 515 (1710)
T ss_pred cc------------cCCCCceecCCcccCccceecccCcEEEEEEeh-----Hhhcccc-------cccccccccceeee
Confidence 76 667776666655555555566666665555541 2222222 23456999999999
Q ss_pred EEEEEecCeEEEEEEecCceEEEeeCcccccccccccccccccCCCCEEEEEEEeecCCCeEEEecccccccccccCCCc
Q 000227 676 VVDVVTPNAVVVYVIAKGYSKGTIPTEHLADHLEHATVMKSVIKPGYEFDQLLVLDNESSNLLLSAKYSLINSAQQLPSD 755 (1826)
Q Consensus 676 ~V~~v~~~g~~V~l~~~~~v~G~i~~~hLsd~~~~~~~l~~~lk~G~~i~~vl~id~~~~~v~ls~K~sl~~~~~~i~~~ 755 (1826)
+|..+++.|+.|.+. .++++|+||..||+|++.+.+....++..|.++ |||+++.+.+++.||+|++|++-..++|.+
T Consensus 516 ~I~~vt~~Gv~v~v~-~~ni~g~lp~~hlsd~~~~~p~~~f~v~~~~k~-RVl~~~~~~~~v~l~~K~slv~~~~plp~d 593 (1710)
T KOG1070|consen 516 VIRKVTPQGVEVLVT-FGNIKGVLPKEHLSDHPLQPPLRDFKVGSGVKL-RVLSVNRDRNRVALTLKKSLVNTQLPLPSD 593 (1710)
T ss_pred EEEEecCCcEEEEEe-cCceeeecChHhhhhcccccccceeeeccccEE-EEEEEEccCCeeEEEechhhhcccCCCccc
Confidence 999999999999995 367999999999999999999888888888888 899999999999999999999998899999
Q ss_pred cccCCCCCEEEEEEEEEeeceEEEEECCCeEEEEeCCCcCcccccCcccCCCCCCEEEEEEEEeeCCCCeEEEEeccccc
Q 000227 756 ASHIHPNSVVHGYVCNIIETGCFVRFLGRLTGFAPRSKAVDGQRADLSKTYYVGQSVRSNILDVNSETGRITLSLKQSCC 835 (1826)
Q Consensus 756 ~~~~~~G~~~~G~V~~i~~~GvfV~f~~gl~Glv~~s~l~~~~~~~~~~~f~vGq~V~~~V~~id~e~~rl~LSlk~~~~ 835 (1826)
|+++++|++++|+|+++.++||||+|+||++||+|.+++++.++.+++++|.+||||.|+|.++|++++||.|+++++.|
T Consensus 594 ~~~~~pg~~~~G~l~~~~~~g~~V~F~g~lsGf~p~s~~sd~~v~~~~ehf~vGqTv~~~i~nvd~ek~rm~l~~r~s~~ 673 (1710)
T KOG1070|consen 594 FEQAIPGKITKGTLCAIKENGAFVTFTGGLSGFAPVSEMSDDFVLSDSEHFPVGQTVRAKIVNVDDEKRRMPLGLRASSC 673 (1710)
T ss_pred hhhcCCCceEEEEEeeeccCCeEEEecCccccccchhhhhhhhhcChhhhcccccEEEEEEEecCchhceeehhhhhhhh
Confidence 99999999999999999999999999999999999999999999999999999999999999999999999999999998
Q ss_pred CCCcchhhHHHHHHHHHHHHhhcccCCCcccccccccCCCcEEEEEEEEEecCceEEEecccCceEEEEeeeccCCcccc
Q 000227 836 SSTDASFMQEHFLLEEKIAMLQSSKHNGSELKWVEGFIIGSVIEGKVHESNDFGVVVSFEEHSDVYGFITHHQLAGATVE 915 (1826)
Q Consensus 836 ~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~vG~~V~g~V~~i~~~Gv~v~l~~~~~v~g~i~~~~ls~~~~~ 915 (1826)
+.++..+..+||..- .+..+...+... ..-|..-...|-.--|++....+-++++....-+.+.+..+.. .+.
T Consensus 674 ~~a~~~~~~e~~~~g-~v~s~~~~~~tk-d~viVei~~~~~~~v~~~~~L~dg~v~~~~~~~~kl~~~t~~~-----~lv 746 (1710)
T KOG1070|consen 674 ARACVKRSVENFVKG-GVKSLKSIDKTK-DSVIVEIVDQGITGVGVFGELVDGSVVVNKVLENKLRKNTSLL-----HLV 746 (1710)
T ss_pred HHHHHHHHHHHhhcc-ccccceeehhcc-ccEEEEccCcceEEEEEEEEEccCceEEccchhhhhhhcchhh-----eee
Confidence 766666666666543 333332211111 1122233333333333333333333332222111222222222 278
Q ss_pred CCCeEEEEEEEeecccCEEEEeehHhhhhhhhhhchhhHHhhhhhccccccccCCCCEEEEEEEEEEccEEEEEecCCCc
Q 000227 916 SGSVIQAAILDVAKAERLVDLSLKTVFIDRFREANSNRQAQKKKRKREASKDLGVHQTVNAIVEIVKENYLVLSLPEYNH 995 (1826)
Q Consensus 916 ~G~~v~~~Vl~vd~~~~~v~lS~k~~lv~~~~~~~~~~~~~~~~~~~~~~~~L~~G~~v~g~V~~i~~~~v~vsl~~~~~ 995 (1826)
+|+.+.++|++++..++.+.+++++.|.... .+|..|....|+|.++..+++|+++. +.
T Consensus 747 ~gq~~~~~i~~isl~k~lv~~s~~~~L~~~~-------------------~~l~k~~~~~~~v~~is~~~~~~a~~--~~ 805 (1710)
T KOG1070|consen 747 VGQVTVGVILSISLKKSLVLISLCTDLPNNA-------------------TKLLKGSYALALVRSISKEGKFVAFV--SN 805 (1710)
T ss_pred ecceeEEEEEEeehhhhhhhccccccccchH-------------------HHHhcCchhHHHHHhhhhheeheeec--cc
Confidence 9999999999999999999999988876543 23667778889999999999999995 55
Q ss_pred eEEEEeccccc-ccCCCcccccCCCEEEEEEEeecCC-----------CcccceeeeeccccccccchhHHhhcccCCCC
Q 000227 996 SIGYASVSDYN-TQKFPQKQFLNGQSVIATVMALPSS-----------STAGRLLLLLKAISETETSSSKRAKKKSSYDV 1063 (1826)
Q Consensus 996 ~~g~~~~~~~n-~~~~~~~~f~vGq~v~a~V~~~~~~-----------~~~~~l~Ll~~~~~~~~~~~~~~~~~~~~~~~ 1063 (1826)
++++++.+|.+ +...+......||++.++...+... ...++..+........+-+...+.++.+++.+
T Consensus 806 ~i~~v~~s~~v~s~~~d~~~~~y~Q~v~~~~~st~~~~~~~~~a~e~p~~K~~~~~~~~~~~~~d~~Vd~a~k~~~~~~i 885 (1710)
T KOG1070|consen 806 LIALVKVSHLVDSELDDLTKAEYGQSVTVKLLSTEPKVVKDLKAVEKPKKKKEKKFIKVSSNDSDNEVDLAIKSTEDLSI 885 (1710)
T ss_pred ccceeeccccccccccccceeeeecccceEEEecChhHHHHHHhhcchhhccceeEEEeccccCCCccccccccccceee
Confidence 99999999987 5555667777789999999887621 01111111111110111222335677899999
Q ss_pred CCEEEEEEEEEeCCeEEEEeCCCeeEEEEceeccCCcccccccccccccCCCEEEEEEEeee-cC----C-CCccceeEE
Q 000227 1064 GSLVQAEITEIKPLELRLKFGIGFHGRIHITEVNDDKSNVVENLFSNFKIGQTVTARIIAKS-NK----P-DMKKSFLWE 1137 (1826)
Q Consensus 1064 G~~v~~~V~~ik~~~l~V~l~~~~~G~i~~se~~d~~~~~~~~P~~~~~~G~~v~~~Vl~~~-~~----~-~~~k~~~ve 1137 (1826)
|.+|.|+|++|+++||+|.|+.+.+||||++|++|++.++.. |+++|++|+.|.|||+|.| .+ + ...+..++|
T Consensus 886 gsiv~a~v~svKp~~L~v~l~~~~~gri~isev~d~~~eitD-p~~k~~vG~~I~vrviG~~D~k~lpith~i~k~~v~E 964 (1710)
T KOG1070|consen 886 GSIVRAYVKSVKPDQLNVLLAANHHGRIHISEVLDNLHEITD-PLDKFKVGDGIFVRVIGGHDVKDLPITHLISKEQVLE 964 (1710)
T ss_pred eeEEEEEEeeecccceEEeccccccCceehHHhhccccccCC-hhhhcccCCeEEEEEEcCCccccCccccccchhhhhh
Confidence 999999999999999999999999999999999999876555 9999999999999999996 11 1 223468999
Q ss_pred EeeccccccccccccccccccccCCCCCEEEEEEEEEeCCEEEEEECCCceEEEEccccCCCCchhhhhccccCCCCEEE
Q 000227 1138 LSIKPSMLTVSEIGSKLLFEECDVSIGQRVTGYVYKVDNEWALLTISRHLKAQLFILDSAYEPSELQEFQRRFHIGKAVT 1217 (1826)
Q Consensus 1138 LS~r~~~l~~~~~~~~~~~~~~~~~~G~~v~g~V~~v~~~~l~V~i~~~~~g~l~~~~~s~~~~~l~~~~~~f~vG~~v~ 1217 (1826)
||+||+.++.... .. -+..+++.||+|+|||+++..+|+|+.++|.++||||+++++.+.+.+++|+..|++|++++
T Consensus 965 lSvkps~les~~~-~t--~s~~q~~~gq~vtGfV~nv~ke~~w~~isp~v~~RIplld~s~~~~~le~~e~~F~~g~al~ 1041 (1710)
T KOG1070|consen 965 LSVKPSELESDEF-NT--TSTKQFKAGQEVTGFVNNVSKEWLWVRISPFVDGRIPLLDTSLDLHVLELPESLFPLGKALD 1041 (1710)
T ss_pred hccChhhhccccc-cc--cchhhhhcCCeEEEEEEccccceeEEEccccccceeeeeeccchhhhhhCchhhccccccee
Confidence 9999999984331 11 11125799999999999999999999999999999999999999999999999999999999
Q ss_pred EEEEEEeCCCcEEEEEecccccCCCCcccccccccccccccCCCEEEEEEEEEEcCcCeEEEEECCceEEEEecc-cccc
Q 000227 1218 GHVLSINKEKKLLRLVLRPFQDGISDKTVDISNDNMQTFIHEGDIVGGRISKILSGVGGLVVQIGPHLYGRVHFT-ELKN 1296 (1826)
Q Consensus 1218 v~V~~vd~~~~~l~LS~~~~~~~~~~~~~~~~~~~~~~~l~~G~iv~g~V~~v~~~~~g~~V~l~~~~~G~v~~s-el~d 1296 (1826)
++|+..+..+-...++.... ... ..+|+++.|+|.++.++ ++.++++.++.|+++.+ +++|
T Consensus 1042 ~~V~~~~~~~tv~~iG~~~~-----------~k~-----~s~G~~l~Grv~kv~~~--~~~l~~~~~~~G~~~~i~~~~d 1103 (1710)
T KOG1070|consen 1042 EYVVRNDKSKTVRAIGFSKS-----------DKN-----PSPGDILFGRVSKVLPG--YLILQLPFKVFGRVSFIEDMSD 1103 (1710)
T ss_pred eEEecccceeEEEecccccC-----------CCC-----CCcchhhcceeeeeccc--eeEEecCCccccceEEeeehhc
Confidence 99999873322222221111 011 12899999999999999 89999999999977777 9999
Q ss_pred cccCCCCCCCCCCCCCCCCCCCCCCEEEEEEEEEecccCCceEEEEEeeeccCCCCCCCCCCCCCCCCCCcccccccccC
Q 000227 1297 ICVSDPLSGYDEGQFDPLSGYDEGQFVKCKVLEISRTVRGTFHVELSLRSSLDGMSSTNSSDLSTDVDTPGKHLEKIEDL 1376 (1826)
Q Consensus 1297 ~~~~~~~~~~~~~~~~p~~~f~~G~~V~~~Vl~id~~~~g~~~i~LS~r~s~~~~~~~~~~~~~~~~~~~~~~~~~~~~l 1376 (1826)
+|... |...|..++.+.|++|.++.. ++.++||+|.+++.+.. ....++.+.+++++
T Consensus 1104 ~~~~~-----------P~~~f~~~~~v~~~~L~vs~~---n~~leLslr~sr~~~t~---------~~~kd~~iks~eDl 1160 (1710)
T KOG1070|consen 1104 SYSMT-----------PVEHFTKIQIVYVCVLSVSAL---NKGLELSLRESRTKITP---------VDSKDGSIKSIEDL 1160 (1710)
T ss_pred cccCC-----------hHHhcccccEEEEEEEEEecc---cccceeecccccccCcc---------ccccCCcccchhhc
Confidence 99887 999999999999999999986 44599999998843222 23467889999999
Q ss_pred CCCCEEEEEEEEEecceEEEEeCCCeEEEEEccccCCCccCCCCccCCCCcEEEEEEEEEeCCCCeEEEEEecccccccc
Q 000227 1377 SPNMIVQGYVKNVTSKGCFIMLSRKLDAKVLLSNLSDGYVESPEKEFPIGKLVAGRVLSVEPLSKRVEVTLKTSDSRTAS 1456 (1826)
Q Consensus 1377 ~~G~~v~G~V~~v~~~GvFV~l~~~v~g~v~iselsd~~v~~~~~~f~vGq~V~~kVl~vd~e~~rI~lSlk~s~~~~~~ 1456 (1826)
++|++++|||.++.++|+||.|++++.|+++++++++.|.+.|++.|++||+|.++|+++++..+|++||||++......
T Consensus 1161 k~g~iv~G~V~nv~~~glfi~ls~~v~a~v~is~~~ds~~k~w~k~~~~gklv~~rv~~ve~~s~riel~Lk~s~~~d~~ 1240 (1710)
T KOG1070|consen 1161 KIGDIVRGFVKNVETKGLFIALSRKVEAFVPISGLSDSFEKEWEKHLPVGKLVTGRVLSVEEDSKRIELSLKNSDIKDTV 1240 (1710)
T ss_pred ccCceeEEEEEEecCCcEEEEEccceEEEEEccccccchhhhhhccCCccceeeeEEEEeeccCceEEEEEeccccCCch
Confidence 99999999999999999999999999999999999999999999999999999999999999999999999999876433
Q ss_pred ccccccccccCCCCEEEEEEEEEeeceEEEEEecC-ceEEEEEccccCcccccCccccCCCCCEEEEEEEEEeCCCCeEE
Q 000227 1457 QSEINNLSNLHVGDIVIGQIKRVESYGLFITIENT-NLVGLCHVSELSEDHVDNIETIYRAGEKVKVKILKVDKEKRRIS 1535 (1826)
Q Consensus 1457 ~~~~~~~~~~~~G~iv~G~V~~v~~~GvFV~l~~~-~v~Gl~h~sels~~~~~~~~~~~~~Gd~Vk~kVl~id~e~~rI~ 1535 (1826)
. ....+.++++||.+.|+|.++.+||+||+++++ ++.|+||++++++.+.++....|..|++|+|.+++++.+++||+
T Consensus 1241 ~-~~~~~~~l~~gd~~~g~v~~~~~~G~fi~l~~tv~~~g~~~~~e~~d~~~e~it~~~~~~~~V~a~~lk~~~ek~rIs 1319 (1710)
T KOG1070|consen 1241 K-LLKDSKDLKKGDREDGTVEVVDPFGLFIKLDVTVNMVGLCHISEEADDRGENITALYYAGDRVKACVLKEDSEKKRIS 1319 (1710)
T ss_pred h-hhhhhhhhhccccccceEEEecCCceEEEecCcceecccccceeecchhhhhcccceeccceeeeEeeeccchhhhhh
Confidence 3 344578999999999999999999999999987 68999999999999999999999999999999999999999999
Q ss_pred EeeeccccCCCccccccCcccchhHHHHhhcccCcccccc---cCccccccccCcccCCCc-ccccccccccCCCCc-cc
Q 000227 1536 LGMKSSYFKNDADNLQMSSEEESDEAIEEVGSYNRSSLLE---NSSVAVQDMDMESEDGGS-LVLAQIESRASVPPL-EV 1610 (1826)
Q Consensus 1536 LslK~s~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~---~~~~~~~~~~~e~~~~~~-~~~~~~~~~~~~~~l-~~ 1610 (1826)
+++|.+||..+++.-..+. .++.-+ +.....++|. +...+|.+.+ .+..+. -.....+..+..|++ +-
T Consensus 1320 l~~k~s~~~~~dd~~~~~~-~~e~v~----~~~~~~~d~~s~~~~~~~d~g~q--~~~~g~~~e~~~d~~~~~~p~~le~ 1392 (1710)
T KOG1070|consen 1320 LGLKSSYLSSEDDARITSY-GEEGVE----MEEESHSDPKSMEEVAAEDPGFQ--SSSGGFNLEDAVDEMSETLPDALED 1392 (1710)
T ss_pred hhhhhhccCChhhhhcccc-cccCcc----hhcccccCccchhhhcccCCCcc--ccccceehhhhhhhccccCCchhhh
Confidence 9999999966543221100 000000 0000000000 0000000000 000000 000111222223333 22
Q ss_pred c-CCCCCCCcCcC-CCCCCCCcccccchhhhhhhhhhhHhHHHHHHHHHHHHHHhcccCCCCCHHHHHHHHHhCCCchhH
Q 000227 1611 N-LDDEQPDMDNG-ISQNQGHTDEAKTIDEKNNRHAKKKEKEEREQEIRAAEERLLEKDAPRTPDEFERLVRSSPNSSFV 1688 (1826)
Q Consensus 1611 ~-w~~~~~~~~~~-~~~~~~~~~~~~~~~kk~~~~~k~~~k~~~e~~~~~~~~~~~~~~~p~s~~~fer~l~~~p~ss~l 1688 (1826)
+ |++++.|+.-+ ...++|+++ ++++..++++|+.....++++++ ++|+|++||+|+++++||||.+
T Consensus 1393 s~~td~e~d~~~~~~e~~qde~d-----------ee~e~~kee~e~~~~~~e~~dl~-~~pesaeDferlvrssPNSSi~ 1460 (1710)
T KOG1070|consen 1393 SCETDSEVDEEVEDEELDQDEKD-----------EEKEKDKEEREENRSDEEERDLS-RAPESAEDFERLVRSSPNSSIL 1460 (1710)
T ss_pred cccchhhhhhccccccccccccc-----------hhhhhhhhhccccccchhhcccc-cCCcCHHHHHHHHhcCCCcchH
Confidence 2 77655543111 111111111 12222233444455666666766 8999999999999999999999
Q ss_pred HHHHHHHHHhcCCHHHHHHHHHHHHhhcccchhhhHHHHHHHHHHHHHHcCCCCHHHHHHHHHHHHhcCCcHHHHHHHHH
Q 000227 1689 WIKYMAFMLSMADVEKARSIAERALQTINIREENEKLNIWVAYFNLENEYGNPPEEAVVKVFQRALQYCDPKKVHLALLG 1768 (1826)
Q Consensus 1689 Wi~y~~f~l~~~ei~kAR~i~erAl~~i~~re~~e~~niW~a~l~lE~~~G~~~~e~~~~vf~~a~~~~~~~kv~~~~~~ 1768 (1826)
||+||+|+++++||++||+||||||+||||||++||+|||+||+|||+.|| ++|++.++|+||||||++++||++++.
T Consensus 1461 WI~YMaf~LelsEiekAR~iaerAL~tIN~REeeEKLNiWiA~lNlEn~yG--~eesl~kVFeRAcqycd~~~V~~~L~~ 1538 (1710)
T KOG1070|consen 1461 WIRYMAFHLELSEIEKARKIAERALKTINFREEEEKLNIWIAYLNLENAYG--TEESLKKVFERACQYCDAYTVHLKLLG 1538 (1710)
T ss_pred HHHHHHHHhhhhhhHHHHHHHHHHhhhCCcchhHHHHHHHHHHHhHHHhhC--cHHHHHHHHHHHHHhcchHHHHHHHHH
Confidence 999999999999999999999999999999999999999999999999999 999999999999999999999999999
Q ss_pred HHHHcCChHHHHHHHHHHHHHcCCCHHHHHHHHHHHHhccc
Q 000227 1769 LYERTEQNKLADELLYKMIKKFKHSCKVIIELLSFHFTSIL 1809 (1826)
Q Consensus 1769 i~~~~~~~~~a~~~~~~~~kk~~~~~~~w~~~~~~~~~~~~ 1809 (1826)
||..++++++|.|+|+.|+|||++..++|++|+.|++++-.
T Consensus 1539 iy~k~ek~~~A~ell~~m~KKF~q~~~vW~~y~~fLl~~ne 1579 (1710)
T KOG1070|consen 1539 IYEKSEKNDEADELLRLMLKKFGQTRKVWIMYADFLLRQNE 1579 (1710)
T ss_pred HHHHhhcchhHHHHHHHHHHHhcchhhHHHHHHHHHhcccH
Confidence 99999999999999999999999999999999999998754
|
|
| >KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] | Back alignment and domain information |
|---|
| >COG0539 RpsA Ribosomal protein S1 [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >COG0539 RpsA Ribosomal protein S1 [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PRK12269 bifunctional cytidylate kinase/ribosomal protein S1; Provisional | Back alignment and domain information |
|---|
| >PRK06299 rpsA 30S ribosomal protein S1; Reviewed | Back alignment and domain information |
|---|
| >PRK12269 bifunctional cytidylate kinase/ribosomal protein S1; Provisional | Back alignment and domain information |
|---|
| >PRK06299 rpsA 30S ribosomal protein S1; Reviewed | Back alignment and domain information |
|---|
| >TIGR00717 rpsA ribosomal protein S1 | Back alignment and domain information |
|---|
| >TIGR00717 rpsA ribosomal protein S1 | Back alignment and domain information |
|---|
| >PRK13806 rpsA 30S ribosomal protein S1; Provisional | Back alignment and domain information |
|---|
| >PRK13806 rpsA 30S ribosomal protein S1; Provisional | Back alignment and domain information |
|---|
| >PRK07899 rpsA 30S ribosomal protein S1; Reviewed | Back alignment and domain information |
|---|
| >PRK07899 rpsA 30S ribosomal protein S1; Reviewed | Back alignment and domain information |
|---|
| >PRK06676 rpsA 30S ribosomal protein S1; Reviewed | Back alignment and domain information |
|---|
| >PRK06676 rpsA 30S ribosomal protein S1; Reviewed | Back alignment and domain information |
|---|
| >PRK00087 4-hydroxy-3-methylbut-2-enyl diphosphate reductase/S1 RNA-binding domain protein; Reviewed | Back alignment and domain information |
|---|
| >PRK00087 4-hydroxy-3-methylbut-2-enyl diphosphate reductase/S1 RNA-binding domain protein; Reviewed | Back alignment and domain information |
|---|
| >PRK07400 30S ribosomal protein S1; Reviewed | Back alignment and domain information |
|---|
| >PRK07400 30S ribosomal protein S1; Reviewed | Back alignment and domain information |
|---|
| >KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0495 consensus HAT repeat protein [RNA processing and modification] | Back alignment and domain information |
|---|
| >PTZ00248 eukaryotic translation initiation factor 2 subunit 1; Provisional | Back alignment and domain information |
|---|
| >COG1098 VacB Predicted RNA binding protein (contains ribosomal protein S1 domain) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >COG2996 Predicted RNA-bindining protein (contains S1 and HTH domains) [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0495 consensus HAT repeat protein [RNA processing and modification] | Back alignment and domain information |
|---|
| >cd05705 S1_Rrp5_repeat_hs14 S1_Rrp5_repeat_hs14: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >COG1098 VacB Predicted RNA binding protein (contains ribosomal protein S1 domain) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >cd05705 S1_Rrp5_repeat_hs14 S1_Rrp5_repeat_hs14: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >PTZ00248 eukaryotic translation initiation factor 2 subunit 1; Provisional | Back alignment and domain information |
|---|
| >COG2996 Predicted RNA-bindining protein (contains S1 and HTH domains) [General function prediction only] | Back alignment and domain information |
|---|
| >cd05694 S1_Rrp5_repeat_hs2_sc2 S1_Rrp5_repeat_hs2_sc2: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >cd05693 S1_Rrp5_repeat_hs1_sc1 S1_Rrp5_repeat_hs1_sc1: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >cd05694 S1_Rrp5_repeat_hs2_sc2 S1_Rrp5_repeat_hs2_sc2: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >cd05703 S1_Rrp5_repeat_hs12_sc9 S1_Rrp5_repeat_hs12_sc9: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >cd05703 S1_Rrp5_repeat_hs12_sc9 S1_Rrp5_repeat_hs12_sc9: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >cd04461 S1_Rrp5_repeat_hs8_sc7 S1_Rrp5_repeat_hs8_sc7: Rrp5 Homo sapiens S1 repeat 8 (hs8) and Saccharomyces cerevisiae S1 repeat 7 (sc7)-like domains | Back alignment and domain information |
|---|
| >PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins | Back alignment and domain information |
|---|
| >cd05686 S1_pNO40 S1_pNO40: pNO40 , S1-like RNA-binding domain | Back alignment and domain information |
|---|
| >cd05704 S1_Rrp5_repeat_hs13 S1_Rrp5_repeat_hs13: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >cd05698 S1_Rrp5_repeat_hs6_sc5 S1_Rrp5_repeat_hs6_sc5: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >cd05708 S1_Rrp5_repeat_sc12 S1_Rrp5_repeat_sc12: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >cd05706 S1_Rrp5_repeat_sc10 S1_Rrp5_repeat_sc10: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >PF00575 S1: S1 RNA binding domain; InterPro: IPR003029 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms | Back alignment and domain information |
|---|
| >cd05706 S1_Rrp5_repeat_sc10 S1_Rrp5_repeat_sc10: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >cd05696 S1_Rrp5_repeat_hs4 S1_Rrp5_repeat_hs4: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >cd04461 S1_Rrp5_repeat_hs8_sc7 S1_Rrp5_repeat_hs8_sc7: Rrp5 Homo sapiens S1 repeat 8 (hs8) and Saccharomyces cerevisiae S1 repeat 7 (sc7)-like domains | Back alignment and domain information |
|---|
| >PF00575 S1: S1 RNA binding domain; InterPro: IPR003029 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms | Back alignment and domain information |
|---|
| >cd05698 S1_Rrp5_repeat_hs6_sc5 S1_Rrp5_repeat_hs6_sc5: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >cd05704 S1_Rrp5_repeat_hs13 S1_Rrp5_repeat_hs13: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >cd05697 S1_Rrp5_repeat_hs5 S1_Rrp5_repeat_hs5: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >PRK08582 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK08582 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >cd05707 S1_Rrp5_repeat_sc11 S1_Rrp5_repeat_sc11: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >cd05697 S1_Rrp5_repeat_hs5 S1_Rrp5_repeat_hs5: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >cd05707 S1_Rrp5_repeat_sc11 S1_Rrp5_repeat_sc11: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >cd04452 S1_IF2_alpha S1_IF2_alpha: The alpha subunit of translation Initiation Factor 2, S1-like RNA-binding domain | Back alignment and domain information |
|---|
| >cd05696 S1_Rrp5_repeat_hs4 S1_Rrp5_repeat_hs4: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >cd05693 S1_Rrp5_repeat_hs1_sc1 S1_Rrp5_repeat_hs1_sc1: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >cd05690 S1_RPS1_repeat_ec5 S1_RPS1_repeat_ec5: Ribosomal protein S1 (RPS1) domain | Back alignment and domain information |
|---|
| >PRK07252 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK05807 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK07252 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins | Back alignment and domain information |
|---|
| >cd05691 S1_RPS1_repeat_ec6 S1_RPS1_repeat_ec6: Ribosomal protein S1 (RPS1) domain | Back alignment and domain information |
|---|
| >cd05699 S1_Rrp5_repeat_hs7 S1_Rrp5_repeat_hs7: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >cd05689 S1_RPS1_repeat_ec4 S1_RPS1_repeat_ec4: Ribosomal protein S1 (RPS1) domain | Back alignment and domain information |
|---|
| >cd05690 S1_RPS1_repeat_ec5 S1_RPS1_repeat_ec5: Ribosomal protein S1 (RPS1) domain | Back alignment and domain information |
|---|
| >cd05708 S1_Rrp5_repeat_sc12 S1_Rrp5_repeat_sc12: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >cd04452 S1_IF2_alpha S1_IF2_alpha: The alpha subunit of translation Initiation Factor 2, S1-like RNA-binding domain | Back alignment and domain information |
|---|
| >cd05691 S1_RPS1_repeat_ec6 S1_RPS1_repeat_ec6: Ribosomal protein S1 (RPS1) domain | Back alignment and domain information |
|---|
| >cd05695 S1_Rrp5_repeat_hs3 S1_Rrp5_repeat_hs3: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >cd05684 S1_DHX8_helicase S1_DHX8_helicase: The N-terminal S1 domain of human ATP-dependent RNA helicase DHX8, a DEAH (Asp-Glu-Ala-His) box polypeptide | Back alignment and domain information |
|---|
| >cd05686 S1_pNO40 S1_pNO40: pNO40 , S1-like RNA-binding domain | Back alignment and domain information |
|---|
| >cd05687 S1_RPS1_repeat_ec1_hs1 S1_RPS1_repeat_ec1_hs1: Ribosomal protein S1 (RPS1) domain | Back alignment and domain information |
|---|
| >cd05689 S1_RPS1_repeat_ec4 S1_RPS1_repeat_ec4: Ribosomal protein S1 (RPS1) domain | Back alignment and domain information |
|---|
| >cd05687 S1_RPS1_repeat_ec1_hs1 S1_RPS1_repeat_ec1_hs1: Ribosomal protein S1 (RPS1) domain | Back alignment and domain information |
|---|
| >PRK08059 general stress protein 13; Validated | Back alignment and domain information |
|---|
| >cd05695 S1_Rrp5_repeat_hs3 S1_Rrp5_repeat_hs3: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >cd05692 S1_RPS1_repeat_hs4 S1_RPS1_repeat_hs4: Ribosomal protein S1 (RPS1) domain | Back alignment and domain information |
|---|
| >PRK05807 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK08059 general stress protein 13; Validated | Back alignment and domain information |
|---|
| >PHA02945 interferon resistance protein; Provisional | Back alignment and domain information |
|---|
| >cd05685 S1_Tex S1_Tex: The C-terminal S1 domain of a transcription accessory factor called Tex, which has been characterized in Bordetella pertussis and Pseudomonas aeruginosa | Back alignment and domain information |
|---|
| >cd04465 S1_RPS1_repeat_ec2_hs2 S1_RPS1_repeat_ec2_hs2: Ribosomal protein S1 (RPS1) domain | Back alignment and domain information |
|---|
| >cd05692 S1_RPS1_repeat_hs4 S1_RPS1_repeat_hs4: Ribosomal protein S1 (RPS1) domain | Back alignment and domain information |
|---|
| >cd05685 S1_Tex S1_Tex: The C-terminal S1 domain of a transcription accessory factor called Tex, which has been characterized in Bordetella pertussis and Pseudomonas aeruginosa | Back alignment and domain information |
|---|
| >cd04465 S1_RPS1_repeat_ec2_hs2 S1_RPS1_repeat_ec2_hs2: Ribosomal protein S1 (RPS1) domain | Back alignment and domain information |
|---|
| >TIGR02696 pppGpp_PNP guanosine pentaphosphate synthetase I/polynucleotide phosphorylase | Back alignment and domain information |
|---|
| >COG1093 SUI2 Translation initiation factor 2, alpha subunit (eIF-2alpha) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >cd05688 S1_RPS1_repeat_ec3 S1_RPS1_repeat_ec3: Ribosomal protein S1 (RPS1) domain | Back alignment and domain information |
|---|
| >cd05789 S1_Rrp4 S1_Rrp4: Rrp4 S1-like RNA-binding domain | Back alignment and domain information |
|---|
| >cd05684 S1_DHX8_helicase S1_DHX8_helicase: The N-terminal S1 domain of human ATP-dependent RNA helicase DHX8, a DEAH (Asp-Glu-Ala-His) box polypeptide | Back alignment and domain information |
|---|
| >PLN00207 polyribonucleotide nucleotidyltransferase; Provisional | Back alignment and domain information |
|---|
| >cd04472 S1_PNPase S1_PNPase: Polynucleotide phosphorylase (PNPase), ), S1-like RNA-binding domain | Back alignment and domain information |
|---|
| >cd04471 S1_RNase_R S1_RNase_R: RNase R C-terminal S1 domain | Back alignment and domain information |
|---|
| >smart00316 S1 Ribosomal protein S1-like RNA-binding domain | Back alignment and domain information |
|---|
| >PRK03987 translation initiation factor IF-2 subunit alpha; Validated | Back alignment and domain information |
|---|
| >cd04453 S1_RNase_E S1_RNase_E: RNase E and RNase G, S1-like RNA-binding domain | Back alignment and domain information |
|---|
| >smart00316 S1 Ribosomal protein S1-like RNA-binding domain | Back alignment and domain information |
|---|
| >cd04472 S1_PNPase S1_PNPase: Polynucleotide phosphorylase (PNPase), ), S1-like RNA-binding domain | Back alignment and domain information |
|---|
| >PHA02945 interferon resistance protein; Provisional | Back alignment and domain information |
|---|
| >cd04473 S1_RecJ_like S1_RecJ_like: The S1 domain of the archaea-specific RecJ-like exonuclease | Back alignment and domain information |
|---|
| >cd05688 S1_RPS1_repeat_ec3 S1_RPS1_repeat_ec3: Ribosomal protein S1 (RPS1) domain | Back alignment and domain information |
|---|
| >COG2183 Tex Transcriptional accessory protein [Transcription] | Back alignment and domain information |
|---|
| >PLN00207 polyribonucleotide nucleotidyltransferase; Provisional | Back alignment and domain information |
|---|
| >COG2183 Tex Transcriptional accessory protein [Transcription] | Back alignment and domain information |
|---|
| >cd05789 S1_Rrp4 S1_Rrp4: Rrp4 S1-like RNA-binding domain | Back alignment and domain information |
|---|
| >PRK09521 exosome complex RNA-binding protein Csl4; Provisional | Back alignment and domain information |
|---|
| >cd05702 S1_Rrp5_repeat_hs11_sc8 S1_Rrp5_repeat_hs11_sc8: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >COG1185 Pnp Polyribonucleotide nucleotidyltransferase (polynucleotide phosphorylase) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >cd04471 S1_RNase_R S1_RNase_R: RNase R C-terminal S1 domain | Back alignment and domain information |
|---|
| >cd04454 S1_Rrp4_like S1_Rrp4_like: Rrp4-like, S1-like RNA-binding domain | Back alignment and domain information |
|---|
| >PRK11824 polynucleotide phosphorylase/polyadenylase; Provisional | Back alignment and domain information |
|---|
| >cd05702 S1_Rrp5_repeat_hs11_sc8 S1_Rrp5_repeat_hs11_sc8: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >cd04454 S1_Rrp4_like S1_Rrp4_like: Rrp4-like, S1-like RNA-binding domain | Back alignment and domain information |
|---|
| >cd04453 S1_RNase_E S1_RNase_E: RNase E and RNase G, S1-like RNA-binding domain | Back alignment and domain information |
|---|
| >PRK03987 translation initiation factor IF-2 subunit alpha; Validated | Back alignment and domain information |
|---|
| >cd04473 S1_RecJ_like S1_RecJ_like: The S1 domain of the archaea-specific RecJ-like exonuclease | Back alignment and domain information |
|---|
| >TIGR02696 pppGpp_PNP guanosine pentaphosphate synthetase I/polynucleotide phosphorylase | Back alignment and domain information |
|---|
| >COG1093 SUI2 Translation initiation factor 2, alpha subunit (eIF-2alpha) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >cd00164 S1_like S1_like: Ribosomal protein S1-like RNA-binding domain | Back alignment and domain information |
|---|
| >KOG2047 consensus mRNA splicing factor [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG2047 consensus mRNA splicing factor [RNA processing and modification] | Back alignment and domain information |
|---|
| >cd00164 S1_like S1_like: Ribosomal protein S1-like RNA-binding domain | Back alignment and domain information |
|---|
| >cd04460 S1_RpoE S1_RpoE: RpoE, S1-like RNA-binding domain | Back alignment and domain information |
|---|
| >PRK11824 polynucleotide phosphorylase/polyadenylase; Provisional | Back alignment and domain information |
|---|
| >PRK09521 exosome complex RNA-binding protein Csl4; Provisional | Back alignment and domain information |
|---|
| >TIGR03591 polynuc_phos polyribonucleotide nucleotidyltransferase | Back alignment and domain information |
|---|
| >PRK04163 exosome complex RNA-binding protein Rrp4; Provisional | Back alignment and domain information |
|---|
| >cd04460 S1_RpoE S1_RpoE: RpoE, S1-like RNA-binding domain | Back alignment and domain information |
|---|
| >PRK04163 exosome complex RNA-binding protein Rrp4; Provisional | Back alignment and domain information |
|---|
| >TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) | Back alignment and domain information |
|---|
| >TIGR03591 polynuc_phos polyribonucleotide nucleotidyltransferase | Back alignment and domain information |
|---|
| >TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW | Back alignment and domain information |
|---|
| >PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B | Back alignment and domain information |
|---|
| >PRK09202 nusA transcription elongation factor NusA; Validated | Back alignment and domain information |
|---|
| >cd04455 S1_NusA S1_NusA: N-utilizing substance A protein (NusA), S1-like RNA-binding domain | Back alignment and domain information |
|---|
| >cd05699 S1_Rrp5_repeat_hs7 S1_Rrp5_repeat_hs7: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >TIGR00448 rpoE DNA-directed RNA polymerase (rpoE), archaeal and eukaryotic form | Back alignment and domain information |
|---|
| >PRK09202 nusA transcription elongation factor NusA; Validated | Back alignment and domain information |
|---|
| >cd04455 S1_NusA S1_NusA: N-utilizing substance A protein (NusA), S1-like RNA-binding domain | Back alignment and domain information |
|---|
| >TIGR02063 RNase_R ribonuclease R | Back alignment and domain information |
|---|
| >TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW | Back alignment and domain information |
|---|
| >COG1185 Pnp Polyribonucleotide nucleotidyltransferase (polynucleotide phosphorylase) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >COG1095 RPB7 DNA-directed RNA polymerase, subunit E' [Transcription] | Back alignment and domain information |
|---|
| >KOG1258 consensus mRNA processing protein [RNA processing and modification] | Back alignment and domain information |
|---|
| >PRK11642 exoribonuclease R; Provisional | Back alignment and domain information |
|---|
| >PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B | Back alignment and domain information |
|---|
| >COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >PF08424 NRDE-2: NRDE-2, necessary for RNA interference; InterPro: IPR013633 This is domain is found in eukaryotic proteins of unknown function | Back alignment and domain information |
|---|
| >PRK11788 tetratricopeptide repeat protein; Provisional | Back alignment and domain information |
|---|
| >cd05791 S1_CSL4 S1_CSL4: CSL4, S1-like RNA-binding domain | Back alignment and domain information |
|---|
| >TIGR00358 3_prime_RNase VacB and RNase II family 3'-5' exoribonucleases | Back alignment and domain information |
|---|
| >TIGR00448 rpoE DNA-directed RNA polymerase (rpoE), archaeal and eukaryotic form | Back alignment and domain information |
|---|
| >PRK15359 type III secretion system chaperone protein SscB; Provisional | Back alignment and domain information |
|---|
| >TIGR01953 NusA transcription termination factor NusA | Back alignment and domain information |
|---|
| >cd05791 S1_CSL4 S1_CSL4: CSL4, S1-like RNA-binding domain | Back alignment and domain information |
|---|
| >KOG1067 consensus Predicted RNA-binding polyribonucleotide nucleotidyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional | Back alignment and domain information |
|---|
| >PRK08563 DNA-directed RNA polymerase subunit E'; Provisional | Back alignment and domain information |
|---|
| >TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD | Back alignment and domain information |
|---|
| >KOG1067 consensus Predicted RNA-binding polyribonucleotide nucleotidyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR02063 RNase_R ribonuclease R | Back alignment and domain information |
|---|
| >PRK11788 tetratricopeptide repeat protein; Provisional | Back alignment and domain information |
|---|
| >PRK12370 invasion protein regulator; Provisional | Back alignment and domain information |
|---|
| >TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO | Back alignment and domain information |
|---|
| >TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) | Back alignment and domain information |
|---|
| >cd05701 S1_Rrp5_repeat_hs10 S1_Rrp5_repeat_hs10: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >PRK12370 invasion protein regulator; Provisional | Back alignment and domain information |
|---|
| >TIGR01953 NusA transcription termination factor NusA | Back alignment and domain information |
|---|
| >TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein | Back alignment and domain information |
|---|
| >KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG2396 consensus HAT (Half-A-TPR) repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein | Back alignment and domain information |
|---|
| >PRK12327 nusA transcription elongation factor NusA; Provisional | Back alignment and domain information |
|---|
| >PRK15174 Vi polysaccharide export protein VexE; Provisional | Back alignment and domain information |
|---|
| >PRK12327 nusA transcription elongation factor NusA; Provisional | Back alignment and domain information |
|---|
| >COG1095 RPB7 DNA-directed RNA polymerase, subunit E' [Transcription] | Back alignment and domain information |
|---|
| >PRK11642 exoribonuclease R; Provisional | Back alignment and domain information |
|---|
| >PRK11447 cellulose synthase subunit BcsC; Provisional | Back alignment and domain information |
|---|
| >TIGR00358 3_prime_RNase VacB and RNase II family 3'-5' exoribonucleases | Back alignment and domain information |
|---|
| >PF08424 NRDE-2: NRDE-2, necessary for RNA interference; InterPro: IPR013633 This is domain is found in eukaryotic proteins of unknown function | Back alignment and domain information |
|---|
| >PRK08563 DNA-directed RNA polymerase subunit E'; Provisional | Back alignment and domain information |
|---|
| >KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] | Back alignment and domain information |
|---|
| >PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function | Back alignment and domain information |
|---|
| >PRK11447 cellulose synthase subunit BcsC; Provisional | Back alignment and domain information |
|---|
| >KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] | Back alignment and domain information |
|---|
| >PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional | Back alignment and domain information |
|---|
| >PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional | Back alignment and domain information |
|---|
| >PHA02858 EIF2a-like PKR inhibitor; Provisional | Back alignment and domain information |
|---|
| >PRK10747 putative protoheme IX biogenesis protein; Provisional | Back alignment and domain information |
|---|
| >cd04462 S1_RNAPII_Rpb7 S1_RNAPII_Rpb7: Eukaryotic RNA polymerase II (RNAPII) Rpb7 subunit C-terminal S1 domain | Back alignment and domain information |
|---|
| >PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional | Back alignment and domain information |
|---|
| >cd05700 S1_Rrp5_repeat_hs9 S1_Rrp5_repeat_hs9: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >TIGR00540 hemY_coli hemY protein | Back alignment and domain information |
|---|
| >PRK15174 Vi polysaccharide export protein VexE; Provisional | Back alignment and domain information |
|---|
| >PF08311 Mad3_BUB1_I: Mad3/BUB1 homology region 1; InterPro: IPR013212 Proteins containing this domain are checkpoint proteins involved in cell division | Back alignment and domain information |
|---|
| >PRK05054 exoribonuclease II; Provisional | Back alignment and domain information |
|---|
| >KOG1258 consensus mRNA processing protein [RNA processing and modification] | Back alignment and domain information |
|---|
| >PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional | Back alignment and domain information |
|---|
| >PRK10049 pgaA outer membrane protein PgaA; Provisional | Back alignment and domain information |
|---|
| >PRK10747 putative protoheme IX biogenesis protein; Provisional | Back alignment and domain information |
|---|
| >KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C | Back alignment and domain information |
|---|
| >PRK10049 pgaA outer membrane protein PgaA; Provisional | Back alignment and domain information |
|---|
| >PRK11189 lipoprotein NlpI; Provisional | Back alignment and domain information |
|---|
| >cd04462 S1_RNAPII_Rpb7 S1_RNAPII_Rpb7: Eukaryotic RNA polymerase II (RNAPII) Rpb7 subunit C-terminal S1 domain | Back alignment and domain information |
|---|
| >smart00386 HAT HAT (Half-A-TPR) repeats | Back alignment and domain information |
|---|
| >KOG0128 consensus RNA-binding protein SART3 (RRM superfamily) [RNA processing and modification] | Back alignment and domain information |
|---|
| >PRK11189 lipoprotein NlpI; Provisional | Back alignment and domain information |
|---|
| >PHA02858 EIF2a-like PKR inhibitor; Provisional | Back alignment and domain information |
|---|
| >COG1096 Predicted RNA-binding protein (consists of S1 domain and a Zn-ribbon domain) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A | Back alignment and domain information |
|---|
| >COG1107 Archaea-specific RecJ-like exonuclease, contains DnaJ-type Zn finger domain [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PF02184 HAT: HAT (Half-A-TPR) repeat; InterPro: IPR003107 The HAT (Half A TPR) repeat has a repetitive pattern characterised by three aromatic residues with a conserved spacing | Back alignment and domain information |
|---|
| >KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF10447 EXOSC1: Exosome component EXOSC1/CSL4; InterPro: IPR019495 The exosome mediates degradation of unstable mRNAs that contain AU-rich elements (AREs) within their 3' untranslated regions [] | Back alignment and domain information |
|---|
| >PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional | Back alignment and domain information |
|---|
| >cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals | Back alignment and domain information |
|---|
| >KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF13428 TPR_14: Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >COG1097 RRP4 RNA-binding protein Rrp4 and related proteins (contain S1 domain and KH domain) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PTZ00162 DNA-directed RNA polymerase II subunit 7; Provisional | Back alignment and domain information |
|---|
| >TIGR02795 tol_pal_ybgF tol-pal system protein YbgF | Back alignment and domain information |
|---|
| >smart00777 Mad3_BUB1_I Mad3/BUB1 hoMad3/BUB1 homology region 1 | Back alignment and domain information |
|---|
| >KOG2396 consensus HAT (Half-A-TPR) repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >PRK14574 hmsH outer membrane protein; Provisional | Back alignment and domain information |
|---|
| >COG0557 VacB Exoribonuclease R [Transcription] | Back alignment and domain information |
|---|
| >PRK10803 tol-pal system protein YbgF; Provisional | Back alignment and domain information |
|---|
| >TIGR00540 hemY_coli hemY protein | Back alignment and domain information |
|---|
| >cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C | Back alignment and domain information |
|---|
| >PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B | Back alignment and domain information |
|---|
| >TIGR02062 RNase_B exoribonuclease II | Back alignment and domain information |
|---|
| >COG1107 Archaea-specific RecJ-like exonuclease, contains DnaJ-type Zn finger domain [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK12328 nusA transcription elongation factor NusA; Provisional | Back alignment and domain information |
|---|
| >TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO | Back alignment and domain information |
|---|
| >cd05790 S1_Rrp40 S1_Rrp40: Rrp40 S1-like RNA-binding domain | Back alignment and domain information |
|---|
| >PRK10153 DNA-binding transcriptional activator CadC; Provisional | Back alignment and domain information |
|---|
| >COG5191 Uncharacterized conserved protein, contains HAT (Half-A-TPR) repeat [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] | Back alignment and domain information |
|---|
| >KOG2916 consensus Translation initiation factor 2, alpha subunit (eIF-2alpha) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >KOG1856 consensus Transcription elongation factor SPT6 [RNA processing and modification] | Back alignment and domain information |
|---|
| >TIGR00757 RNaseEG ribonuclease, Rne/Rng family | Back alignment and domain information |
|---|
| >PRK05054 exoribonuclease II; Provisional | Back alignment and domain information |
|---|
| >PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional | Back alignment and domain information |
|---|
| >KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >COG1096 Predicted RNA-binding protein (consists of S1 domain and a Zn-ribbon domain) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >KOG1856 consensus Transcription elongation factor SPT6 [RNA processing and modification] | Back alignment and domain information |
|---|
| >COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] | Back alignment and domain information |
|---|
| >PTZ00162 DNA-directed RNA polymerase II subunit 7; Provisional | Back alignment and domain information |
|---|
| >PF13509 S1_2: S1 domain; PDB: 3GO5_A | Back alignment and domain information |
|---|
| >KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional | Back alignment and domain information |
|---|
| >COG1097 RRP4 RNA-binding protein Rrp4 and related proteins (contain S1 domain and KH domain) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD | Back alignment and domain information |
|---|
| >PRK12328 nusA transcription elongation factor NusA; Provisional | Back alignment and domain information |
|---|
| >COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >PRK02603 photosystem I assembly protein Ycf3; Provisional | Back alignment and domain information |
|---|
| >PRK14574 hmsH outer membrane protein; Provisional | Back alignment and domain information |
|---|
| >TIGR00757 RNaseEG ribonuclease, Rne/Rng family | Back alignment and domain information |
|---|
| >PF13509 S1_2: S1 domain; PDB: 3GO5_A | Back alignment and domain information |
|---|
| >COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] | Back alignment and domain information |
|---|
| >PRK15359 type III secretion system chaperone protein SscB; Provisional | Back alignment and domain information |
|---|
| >TIGR02795 tol_pal_ybgF tol-pal system protein YbgF | Back alignment and domain information |
|---|
| >cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals | Back alignment and domain information |
|---|
| >PLN03218 maturation of RBCL 1; Provisional | Back alignment and domain information |
|---|
| >PF10447 EXOSC1: Exosome component EXOSC1/CSL4; InterPro: IPR019495 The exosome mediates degradation of unstable mRNAs that contain AU-rich elements (AREs) within their 3' untranslated regions [] | Back alignment and domain information |
|---|
| >PF08311 Mad3_BUB1_I: Mad3/BUB1 homology region 1; InterPro: IPR013212 Proteins containing this domain are checkpoint proteins involved in cell division | Back alignment and domain information |
|---|
| >KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A | Back alignment and domain information |
|---|
| >PRK02603 photosystem I assembly protein Ycf3; Provisional | Back alignment and domain information |
|---|
| >PLN03218 maturation of RBCL 1; Provisional | Back alignment and domain information |
|---|
| >KOG2003 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi | Back alignment and domain information |
|---|
| >cd05790 S1_Rrp40 S1_Rrp40: Rrp40 S1-like RNA-binding domain | Back alignment and domain information |
|---|
| >KOG2916 consensus Translation initiation factor 2, alpha subunit (eIF-2alpha) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >COG5191 Uncharacterized conserved protein, contains HAT (Half-A-TPR) repeat [General function prediction only] | Back alignment and domain information |
|---|
| >smart00386 HAT HAT (Half-A-TPR) repeats | Back alignment and domain information |
|---|
| >PLN02789 farnesyltranstransferase | Back alignment and domain information |
|---|
| >PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A | Back alignment and domain information |
|---|
| >COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi | Back alignment and domain information |
|---|
| >PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A | Back alignment and domain information |
|---|
| >CHL00033 ycf3 photosystem I assembly protein Ycf3 | Back alignment and domain information |
|---|
| >PF13431 TPR_17: Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >TIGR02062 RNase_B exoribonuclease II | Back alignment and domain information |
|---|
| >PF02184 HAT: HAT (Half-A-TPR) repeat; InterPro: IPR003107 The HAT (Half A TPR) repeat has a repetitive pattern characterised by three aromatic residues with a conserved spacing | Back alignment and domain information |
|---|
| >COG0557 VacB Exoribonuclease R [Transcription] | Back alignment and domain information |
|---|
| >COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] | Back alignment and domain information |
|---|
| >PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional | Back alignment and domain information |
|---|
| >PF12688 TPR_5: Tetratrico peptide repeat | Back alignment and domain information |
|---|
| >PRK12329 nusA transcription elongation factor NusA; Provisional | Back alignment and domain information |
|---|
| >KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] | Back alignment and domain information |
|---|
| >PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment | Back alignment and domain information |
|---|
| >COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] | Back alignment and domain information |
|---|
| >PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A | Back alignment and domain information |
|---|
| >PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional | Back alignment and domain information |
|---|
| >KOG1840 consensus Kinesin light chain [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A | Back alignment and domain information |
|---|
| >KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A | Back alignment and domain information |
|---|
| >KOG0553 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1125 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >PRK12329 nusA transcription elongation factor NusA; Provisional | Back alignment and domain information |
|---|
| >PF13428 TPR_14: Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional | Back alignment and domain information |
|---|
| >PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B | Back alignment and domain information |
|---|
| >smart00777 Mad3_BUB1_I Mad3/BUB1 hoMad3/BUB1 homology region 1 | Back alignment and domain information |
|---|
| >KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional | Back alignment and domain information |
|---|
| >PF13371 TPR_9: Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >PF13371 TPR_9: Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >PRK10866 outer membrane biogenesis protein BamD; Provisional | Back alignment and domain information |
|---|
| >KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional | Back alignment and domain information |
|---|
| >PRK10803 tol-pal system protein YbgF; Provisional | Back alignment and domain information |
|---|
| >KOG0128 consensus RNA-binding protein SART3 (RRM superfamily) [RNA processing and modification] | Back alignment and domain information |
|---|
| >PRK10811 rne ribonuclease E; Reviewed | Back alignment and domain information |
|---|
| >PLN03077 Protein ECB2; Provisional | Back alignment and domain information |
|---|
| >PRK10866 outer membrane biogenesis protein BamD; Provisional | Back alignment and domain information |
|---|
| >PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A | Back alignment and domain information |
|---|
| >PLN02789 farnesyltranstransferase | Back alignment and domain information |
|---|
| >COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PF13512 TPR_18: Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >CHL00033 ycf3 photosystem I assembly protein Ycf3 | Back alignment and domain information |
|---|
| >PLN03077 Protein ECB2; Provisional | Back alignment and domain information |
|---|
| >PRK10811 rne ribonuclease E; Reviewed | Back alignment and domain information |
|---|
| >PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional | Back alignment and domain information |
|---|
| >PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function | Back alignment and domain information |
|---|
| >PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases | Back alignment and domain information |
|---|
| >KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A | Back alignment and domain information |
|---|
| >PRK10153 DNA-binding transcriptional activator CadC; Provisional | Back alignment and domain information |
|---|
| >PRK11906 transcriptional regulator; Provisional | Back alignment and domain information |
|---|
| >KOG4234 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >PRK11712 ribonuclease G; Provisional | Back alignment and domain information |
|---|
| >COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala | Back alignment and domain information |
|---|
| >COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1840 consensus Kinesin light chain [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A | Back alignment and domain information |
|---|
| >KOG0553 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG3298 consensus DNA-directed RNA polymerase subunit E' [Transcription] | Back alignment and domain information |
|---|
| >PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] | Back alignment and domain information |
|---|
| >cd05701 S1_Rrp5_repeat_hs10 S1_Rrp5_repeat_hs10: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >KOG3785 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >COG0457 NrfG FOG: TPR repeat [General function prediction only] | Back alignment and domain information |
|---|
| >PRK11712 ribonuclease G; Provisional | Back alignment and domain information |
|---|
| >KOG1129 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production | Back alignment and domain information |
|---|
| >KOG3409 consensus Exosomal 3'-5' exoribonuclease complex, subunit ski4 (Csl4) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PF12688 TPR_5: Tetratrico peptide repeat | Back alignment and domain information |
|---|
| >PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H | Back alignment and domain information |
|---|
| >KOG3298 consensus DNA-directed RNA polymerase subunit E' [Transcription] | Back alignment and domain information |
|---|
| >PF10246 MRP-S35: Mitochondrial ribosomal protein MRP-S35; InterPro: IPR019375 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms | Back alignment and domain information |
|---|
| >PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome | Back alignment and domain information |
|---|
| >PRK11906 transcriptional regulator; Provisional | Back alignment and domain information |
|---|
| >COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >KOG3060 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG3409 consensus Exosomal 3'-5' exoribonuclease complex, subunit ski4 (Csl4) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PF08292 RNA_pol_Rbc25: RNA polymerase III subunit Rpc25; InterPro: IPR013238 Rpc25 is a strongly conserved subunit of RNA polymerase III and has homology to Rpa43 in RNA polymerase I, Rpb7 in RNA polymerase II and the archaeal RpoE subunit | Back alignment and domain information |
|---|
| >COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] | Back alignment and domain information |
|---|
| >PRK12442 translation initiation factor IF-1; Reviewed | Back alignment and domain information |
|---|
| >KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] | Back alignment and domain information |
|---|
| >PF08292 RNA_pol_Rbc25: RNA polymerase III subunit Rpc25; InterPro: IPR013238 Rpc25 is a strongly conserved subunit of RNA polymerase III and has homology to Rpa43 in RNA polymerase I, Rpb7 in RNA polymerase II and the archaeal RpoE subunit | Back alignment and domain information |
|---|
| >KOG1832 consensus HIV-1 Vpr-binding protein [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG2471 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A | Back alignment and domain information |
|---|
| >PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H | Back alignment and domain information |
|---|
| >TIGR00008 infA translation initiation factor IF-1 | Back alignment and domain information |
|---|
| >KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >KOG1166 consensus Mitotic checkpoint serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >COG0457 NrfG FOG: TPR repeat [General function prediction only] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 1826 | ||||
| 2oce_A | 780 | Crystal Structure Of Tex Family Protein Pa5201 From | 1e-06 | ||
| 2oce_A | 780 | Crystal Structure Of Tex Family Protein Pa5201 From | 1e-06 | ||
| 3bzc_A | 785 | Crystal Structure Of The Tex Protein From Pseudomon | 1e-06 | ||
| 3bzc_A | 785 | Crystal Structure Of The Tex Protein From Pseudomon | 1e-06 | ||
| 2k4k_A | 130 | Solution Structure Of Gsp13 From Bacillus Subtilis | 1e-06 | ||
| 1yz6_A | 274 | Crystal Structure Of Intact Alpha Subunit Of Aif2 F | 7e-05 | ||
| 3cdi_A | 723 | Crystal Structure Of E. Coli Pnpase Length = 723 | 7e-05 | ||
| 3aev_A | 275 | Crystal Structure Of AEIF2ALPHA-Adim2p-Rrna Complex | 8e-05 | ||
| 1q8k_A | 308 | Solution Structure Of Alpha Subunit Of Human Eif2 L | 8e-05 | ||
| 1sro_A | 76 | S1 Rna Binding Domain, Nmr, 20 Structures Length = | 2e-04 | ||
| 1wi5_A | 119 | Solution Structure Of The S1 Rna Binding Domain Fro | 2e-04 |
| >pdb|2OCE|A Chain A, Crystal Structure Of Tex Family Protein Pa5201 From Pseudomonas Aeruginosa Length = 780 | Back alignment and structure |
|
| >pdb|2OCE|A Chain A, Crystal Structure Of Tex Family Protein Pa5201 From Pseudomonas Aeruginosa Length = 780 | Back alignment and structure |
| >pdb|3BZC|A Chain A, Crystal Structure Of The Tex Protein From Pseudomonas Aeruginosa, Crystal Form I Length = 785 | Back alignment and structure |
| >pdb|3BZC|A Chain A, Crystal Structure Of The Tex Protein From Pseudomonas Aeruginosa, Crystal Form I Length = 785 | Back alignment and structure |
| >pdb|2K4K|A Chain A, Solution Structure Of Gsp13 From Bacillus Subtilis Length = 130 | Back alignment and structure |
| >pdb|1YZ6|A Chain A, Crystal Structure Of Intact Alpha Subunit Of Aif2 From Pyrococcus Abyssi Length = 274 | Back alignment and structure |
| >pdb|3CDI|A Chain A, Crystal Structure Of E. Coli Pnpase Length = 723 | Back alignment and structure |
| >pdb|3AEV|A Chain A, Crystal Structure Of AEIF2ALPHA-Adim2p-Rrna Complex From Pyrococcus Horikoshii Ot3 Length = 275 | Back alignment and structure |
| >pdb|1Q8K|A Chain A, Solution Structure Of Alpha Subunit Of Human Eif2 Length = 308 | Back alignment and structure |
| >pdb|1SRO|A Chain A, S1 Rna Binding Domain, Nmr, 20 Structures Length = 76 | Back alignment and structure |
| >pdb|1WI5|A Chain A, Solution Structure Of The S1 Rna Binding Domain From Human Hypothetical Protein Baa11502 Length = 119 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 1826 | |||
| 1wi5_A | 119 | RRP5 protein homolog; S1 domain, OB-fold, structur | 2e-22 | |
| 1wi5_A | 119 | RRP5 protein homolog; S1 domain, OB-fold, structur | 2e-07 | |
| 1wi5_A | 119 | RRP5 protein homolog; S1 domain, OB-fold, structur | 3e-07 | |
| 1wi5_A | 119 | RRP5 protein homolog; S1 domain, OB-fold, structur | 4e-06 | |
| 1wi5_A | 119 | RRP5 protein homolog; S1 domain, OB-fold, structur | 1e-05 | |
| 1wi5_A | 119 | RRP5 protein homolog; S1 domain, OB-fold, structur | 6e-05 | |
| 2khj_A | 109 | 30S ribosomal protein S1; OB fold, acetylation, ph | 9e-21 | |
| 2khj_A | 109 | 30S ribosomal protein S1; OB fold, acetylation, ph | 3e-08 | |
| 2khj_A | 109 | 30S ribosomal protein S1; OB fold, acetylation, ph | 6e-07 | |
| 2khj_A | 109 | 30S ribosomal protein S1; OB fold, acetylation, ph | 1e-06 | |
| 2khj_A | 109 | 30S ribosomal protein S1; OB fold, acetylation, ph | 5e-06 | |
| 2khj_A | 109 | 30S ribosomal protein S1; OB fold, acetylation, ph | 2e-05 | |
| 2khj_A | 109 | 30S ribosomal protein S1; OB fold, acetylation, ph | 8e-04 | |
| 2k4k_A | 130 | GSP13, general stress protein 13; cytoplasm, stres | 3e-19 | |
| 2k4k_A | 130 | GSP13, general stress protein 13; cytoplasm, stres | 4e-11 | |
| 2k4k_A | 130 | GSP13, general stress protein 13; cytoplasm, stres | 1e-09 | |
| 2k4k_A | 130 | GSP13, general stress protein 13; cytoplasm, stres | 4e-07 | |
| 2k4k_A | 130 | GSP13, general stress protein 13; cytoplasm, stres | 5e-04 | |
| 1kl9_A | 182 | Eukaryotic translation initiation factor 2 subuni; | 2e-18 | |
| 1kl9_A | 182 | Eukaryotic translation initiation factor 2 subuni; | 6e-09 | |
| 1kl9_A | 182 | Eukaryotic translation initiation factor 2 subuni; | 1e-08 | |
| 1kl9_A | 182 | Eukaryotic translation initiation factor 2 subuni; | 9e-06 | |
| 1kl9_A | 182 | Eukaryotic translation initiation factor 2 subuni; | 3e-05 | |
| 1kl9_A | 182 | Eukaryotic translation initiation factor 2 subuni; | 5e-04 | |
| 2a19_A | 175 | EIF-2- alpha, eukaryotic translation initiation fa | 9e-18 | |
| 2a19_A | 175 | EIF-2- alpha, eukaryotic translation initiation fa | 2e-13 | |
| 2a19_A | 175 | EIF-2- alpha, eukaryotic translation initiation fa | 9e-08 | |
| 2a19_A | 175 | EIF-2- alpha, eukaryotic translation initiation fa | 2e-05 | |
| 2a19_A | 175 | EIF-2- alpha, eukaryotic translation initiation fa | 3e-04 | |
| 2khi_A | 115 | 30S ribosomal protein S1; acetylation, phosphoprot | 4e-17 | |
| 2khi_A | 115 | 30S ribosomal protein S1; acetylation, phosphoprot | 4e-06 | |
| 2khi_A | 115 | 30S ribosomal protein S1; acetylation, phosphoprot | 2e-04 | |
| 2khi_A | 115 | 30S ribosomal protein S1; acetylation, phosphoprot | 9e-04 | |
| 2cqo_A | 119 | Nucleolar protein of 40 kDa; S1 domain, OB-fold, s | 7e-17 | |
| 2k52_A | 80 | Uncharacterized protein MJ1198; metal-binding, zin | 9e-17 | |
| 2k52_A | 80 | Uncharacterized protein MJ1198; metal-binding, zin | 2e-07 | |
| 2k52_A | 80 | Uncharacterized protein MJ1198; metal-binding, zin | 6e-05 | |
| 2k52_A | 80 | Uncharacterized protein MJ1198; metal-binding, zin | 2e-04 | |
| 3aev_A | 275 | Translation initiation factor 2 subunit alpha; pro | 9e-16 | |
| 3aev_A | 275 | Translation initiation factor 2 subunit alpha; pro | 2e-05 | |
| 1q8k_A | 308 | Eukaryotic translation initiation factor 2 subunit | 2e-15 | |
| 1q8k_A | 308 | Eukaryotic translation initiation factor 2 subunit | 4e-07 | |
| 1q8k_A | 308 | Eukaryotic translation initiation factor 2 subunit | 1e-06 | |
| 1q8k_A | 308 | Eukaryotic translation initiation factor 2 subunit | 4e-04 | |
| 1q8k_A | 308 | Eukaryotic translation initiation factor 2 subunit | 9e-04 | |
| 3cw2_C | 266 | Translation initiation factor 2 subunit alpha; AIF | 5e-15 | |
| 3cw2_C | 266 | Translation initiation factor 2 subunit alpha; AIF | 1e-05 | |
| 3cw2_C | 266 | Translation initiation factor 2 subunit alpha; AIF | 3e-04 | |
| 3psf_A | 1030 | Transcription elongation factor SPT6; nucleus; 2.5 | 1e-13 | |
| 3psf_A | 1030 | Transcription elongation factor SPT6; nucleus; 2.5 | 2e-11 | |
| 3psf_A | 1030 | Transcription elongation factor SPT6; nucleus; 2.5 | 3e-05 | |
| 3psf_A | 1030 | Transcription elongation factor SPT6; nucleus; 2.5 | 4e-05 | |
| 3psf_A | 1030 | Transcription elongation factor SPT6; nucleus; 2.5 | 5e-04 | |
| 3psf_A | 1030 | Transcription elongation factor SPT6; nucleus; 2.5 | 5e-04 | |
| 3psf_A | 1030 | Transcription elongation factor SPT6; nucleus; 2.5 | 6e-04 | |
| 3psi_A | 1219 | Transcription elongation factor SPT6; nucleus; 3.3 | 2e-13 | |
| 3psi_A | 1219 | Transcription elongation factor SPT6; nucleus; 3.3 | 2e-11 | |
| 3psi_A | 1219 | Transcription elongation factor SPT6; nucleus; 3.3 | 2e-05 | |
| 3psi_A | 1219 | Transcription elongation factor SPT6; nucleus; 3.3 | 6e-05 | |
| 3psi_A | 1219 | Transcription elongation factor SPT6; nucleus; 3.3 | 5e-04 | |
| 3psi_A | 1219 | Transcription elongation factor SPT6; nucleus; 3.3 | 8e-04 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 2e-13 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 2e-12 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 1e-10 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 1e-10 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 3e-08 | |
| 2ooe_A | 530 | Cleavage stimulation factor 77 kDa subunit; HAT do | 3e-13 | |
| 2ooe_A | 530 | Cleavage stimulation factor 77 kDa subunit; HAT do | 4e-13 | |
| 2ooe_A | 530 | Cleavage stimulation factor 77 kDa subunit; HAT do | 3e-08 | |
| 2ooe_A | 530 | Cleavage stimulation factor 77 kDa subunit; HAT do | 5e-08 | |
| 2ooe_A | 530 | Cleavage stimulation factor 77 kDa subunit; HAT do | 9e-07 | |
| 2ooe_A | 530 | Cleavage stimulation factor 77 kDa subunit; HAT do | 1e-06 | |
| 2ooe_A | 530 | Cleavage stimulation factor 77 kDa subunit; HAT do | 2e-05 | |
| 2eqs_A | 103 | ATP-dependent RNA helicase DHX8; S1 domain, OB-fol | 4e-13 | |
| 2eqs_A | 103 | ATP-dependent RNA helicase DHX8; S1 domain, OB-fol | 8e-05 | |
| 2ond_A | 308 | Cleavage stimulation factor 77 kDa subunit; HAT do | 2e-12 | |
| 2ond_A | 308 | Cleavage stimulation factor 77 kDa subunit; HAT do | 8e-12 | |
| 2ond_A | 308 | Cleavage stimulation factor 77 kDa subunit; HAT do | 1e-11 | |
| 2ond_A | 308 | Cleavage stimulation factor 77 kDa subunit; HAT do | 7e-11 | |
| 2ond_A | 308 | Cleavage stimulation factor 77 kDa subunit; HAT do | 3e-04 | |
| 2uy1_A | 493 | Cleavage stimulation factor 77; RNA-binding protei | 3e-11 | |
| 2uy1_A | 493 | Cleavage stimulation factor 77; RNA-binding protei | 8e-09 | |
| 2uy1_A | 493 | Cleavage stimulation factor 77; RNA-binding protei | 3e-07 | |
| 3bzc_A | 785 | TEX; helix-turn-helix, helix-hairpin-helix, S1 dom | 8e-11 | |
| 3bzc_A | 785 | TEX; helix-turn-helix, helix-hairpin-helix, S1 dom | 2e-10 | |
| 3cdi_A | 723 | Polynucleotide phosphorylase; mRNA turnover, RNAse | 1e-10 | |
| 4aid_A | 726 | Polyribonucleotide nucleotidyltransferase; transfe | 1e-10 | |
| 4e6h_A | 679 | MRNA 3'-END-processing protein RNA14; HAT domain, | 2e-10 | |
| 4e6h_A | 679 | MRNA 3'-END-processing protein RNA14; HAT domain, | 9e-07 | |
| 4e6h_A | 679 | MRNA 3'-END-processing protein RNA14; HAT domain, | 1e-05 | |
| 1e3p_A | 757 | Guanosine pentaphosphate synthetase; polyribonucle | 4e-09 | |
| 3go5_A | 285 | Multidomain protein with S1 RNA-binding domains; s | 5e-08 | |
| 3go5_A | 285 | Multidomain protein with S1 RNA-binding domains; s | 5e-06 | |
| 3go5_A | 285 | Multidomain protein with S1 RNA-binding domains; s | 4e-05 | |
| 4ayb_E | 180 | DNA-directed RNA polymerase; transferase, multi-su | 5e-07 | |
| 2id0_A | 644 | Exoribonuclease 2; RNAse, exonuclease, hydrolyase, | 8e-07 | |
| 2r7d_A | 469 | Ribonuclease II family protein; structural genomic | 5e-05 | |
| 3m7n_A | 179 | Putative uncharacterized protein AF_0206; exosome, | 7e-05 | |
| 2wp8_J | 977 | Exosome complex exonuclease DIS3; nucleus, hydrola | 5e-04 | |
| 3h0g_G | 172 | DNA-directed RNA polymerase II subunit RPB7; trans | 6e-04 | |
| 2vnu_D | 760 | Exosome complex exonuclease RRP44; hydrolase-RNA c | 7e-04 |
| >1wi5_A RRP5 protein homolog; S1 domain, OB-fold, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.40.4.5 Length = 119 | Back alignment and structure |
|---|
Score = 93.2 bits (231), Expect = 2e-22
Identities = 32/106 (30%), Positives = 50/106 (47%), Gaps = 5/106 (4%)
Query: 219 SLLYKGLSLETVQEGMVLTAYVKSIEDHGYILHFGLPSFTGFLPRNNLAE-----NSGID 273
+ + LS E ++ GM+LT V S+EDHGY++ G+ FLP E N G
Sbjct: 8 KNVNRVLSAEALKPGMLLTGTVSSLEDHGYLVDIGVDGTRAFLPLLKAQEYIRQKNKGAK 67
Query: 274 VKPGLLLQGVVRSIDRTRKVVYLSSDPDTVSKCVTKDLKGISIDLL 319
+K G L +V + VV LS VS + + + +++ L
Sbjct: 68 LKVGQYLNCIVEKVKGNGGVVSLSVGHSEVSTAIATEQQSWNLNNL 113
|
| >1wi5_A RRP5 protein homolog; S1 domain, OB-fold, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.40.4.5 Length = 119 | Back alignment and structure |
|---|
| >1wi5_A RRP5 protein homolog; S1 domain, OB-fold, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.40.4.5 Length = 119 | Back alignment and structure |
|---|
| >1wi5_A RRP5 protein homolog; S1 domain, OB-fold, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.40.4.5 Length = 119 | Back alignment and structure |
|---|
| >1wi5_A RRP5 protein homolog; S1 domain, OB-fold, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.40.4.5 Length = 119 | Back alignment and structure |
|---|
| >1wi5_A RRP5 protein homolog; S1 domain, OB-fold, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.40.4.5 Length = 119 | Back alignment and structure |
|---|
| >2khj_A 30S ribosomal protein S1; OB fold, acetylation, phosphoprotein, ribonucleoprotein, RNA-binding; NMR {Escherichia coli} Length = 109 | Back alignment and structure |
|---|
| >2khj_A 30S ribosomal protein S1; OB fold, acetylation, phosphoprotein, ribonucleoprotein, RNA-binding; NMR {Escherichia coli} Length = 109 | Back alignment and structure |
|---|
| >2khj_A 30S ribosomal protein S1; OB fold, acetylation, phosphoprotein, ribonucleoprotein, RNA-binding; NMR {Escherichia coli} Length = 109 | Back alignment and structure |
|---|
| >2khj_A 30S ribosomal protein S1; OB fold, acetylation, phosphoprotein, ribonucleoprotein, RNA-binding; NMR {Escherichia coli} Length = 109 | Back alignment and structure |
|---|
| >2khj_A 30S ribosomal protein S1; OB fold, acetylation, phosphoprotein, ribonucleoprotein, RNA-binding; NMR {Escherichia coli} Length = 109 | Back alignment and structure |
|---|
| >2khj_A 30S ribosomal protein S1; OB fold, acetylation, phosphoprotein, ribonucleoprotein, RNA-binding; NMR {Escherichia coli} Length = 109 | Back alignment and structure |
|---|
| >2khj_A 30S ribosomal protein S1; OB fold, acetylation, phosphoprotein, ribonucleoprotein, RNA-binding; NMR {Escherichia coli} Length = 109 | Back alignment and structure |
|---|
| >2k4k_A GSP13, general stress protein 13; cytoplasm, stress response, RNA binding protein; NMR {Bacillus subtilis} Length = 130 | Back alignment and structure |
|---|
| >2k4k_A GSP13, general stress protein 13; cytoplasm, stress response, RNA binding protein; NMR {Bacillus subtilis} Length = 130 | Back alignment and structure |
|---|
| >2k4k_A GSP13, general stress protein 13; cytoplasm, stress response, RNA binding protein; NMR {Bacillus subtilis} Length = 130 | Back alignment and structure |
|---|
| >2k4k_A GSP13, general stress protein 13; cytoplasm, stress response, RNA binding protein; NMR {Bacillus subtilis} Length = 130 | Back alignment and structure |
|---|
| >2k4k_A GSP13, general stress protein 13; cytoplasm, stress response, RNA binding protein; NMR {Bacillus subtilis} Length = 130 | Back alignment and structure |
|---|
| >1kl9_A Eukaryotic translation initiation factor 2 subuni; OB fold, helical domain; 1.90A {Homo sapiens} SCOP: a.60.14.1 b.40.4.5 Length = 182 | Back alignment and structure |
|---|
| >1kl9_A Eukaryotic translation initiation factor 2 subuni; OB fold, helical domain; 1.90A {Homo sapiens} SCOP: a.60.14.1 b.40.4.5 Length = 182 | Back alignment and structure |
|---|
| >1kl9_A Eukaryotic translation initiation factor 2 subuni; OB fold, helical domain; 1.90A {Homo sapiens} SCOP: a.60.14.1 b.40.4.5 Length = 182 | Back alignment and structure |
|---|
| >1kl9_A Eukaryotic translation initiation factor 2 subuni; OB fold, helical domain; 1.90A {Homo sapiens} SCOP: a.60.14.1 b.40.4.5 Length = 182 | Back alignment and structure |
|---|
| >1kl9_A Eukaryotic translation initiation factor 2 subuni; OB fold, helical domain; 1.90A {Homo sapiens} SCOP: a.60.14.1 b.40.4.5 Length = 182 | Back alignment and structure |
|---|
| >1kl9_A Eukaryotic translation initiation factor 2 subuni; OB fold, helical domain; 1.90A {Homo sapiens} SCOP: a.60.14.1 b.40.4.5 Length = 182 | Back alignment and structure |
|---|
| >2a19_A EIF-2- alpha, eukaryotic translation initiation factor 2 alpha; transferase, protein biosynthesis, protein synthesis transferase complex; HET: TPO ANP; 2.50A {Saccharomyces cerevisiae} PDB: 2a1a_A* 1q46_A Length = 175 | Back alignment and structure |
|---|
| >2a19_A EIF-2- alpha, eukaryotic translation initiation factor 2 alpha; transferase, protein biosynthesis, protein synthesis transferase complex; HET: TPO ANP; 2.50A {Saccharomyces cerevisiae} PDB: 2a1a_A* 1q46_A Length = 175 | Back alignment and structure |
|---|
| >2a19_A EIF-2- alpha, eukaryotic translation initiation factor 2 alpha; transferase, protein biosynthesis, protein synthesis transferase complex; HET: TPO ANP; 2.50A {Saccharomyces cerevisiae} PDB: 2a1a_A* 1q46_A Length = 175 | Back alignment and structure |
|---|
| >2a19_A EIF-2- alpha, eukaryotic translation initiation factor 2 alpha; transferase, protein biosynthesis, protein synthesis transferase complex; HET: TPO ANP; 2.50A {Saccharomyces cerevisiae} PDB: 2a1a_A* 1q46_A Length = 175 | Back alignment and structure |
|---|
| >2a19_A EIF-2- alpha, eukaryotic translation initiation factor 2 alpha; transferase, protein biosynthesis, protein synthesis transferase complex; HET: TPO ANP; 2.50A {Saccharomyces cerevisiae} PDB: 2a1a_A* 1q46_A Length = 175 | Back alignment and structure |
|---|
| >2khi_A 30S ribosomal protein S1; acetylation, phosphoprotein, ribonucleoprotein, RNA-binding; NMR {Escherichia coli} Length = 115 | Back alignment and structure |
|---|
| >2khi_A 30S ribosomal protein S1; acetylation, phosphoprotein, ribonucleoprotein, RNA-binding; NMR {Escherichia coli} Length = 115 | Back alignment and structure |
|---|
| >2khi_A 30S ribosomal protein S1; acetylation, phosphoprotein, ribonucleoprotein, RNA-binding; NMR {Escherichia coli} Length = 115 | Back alignment and structure |
|---|
| >2khi_A 30S ribosomal protein S1; acetylation, phosphoprotein, ribonucleoprotein, RNA-binding; NMR {Escherichia coli} Length = 115 | Back alignment and structure |
|---|
| >2cqo_A Nucleolar protein of 40 kDa; S1 domain, OB-fold, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 119 | Back alignment and structure |
|---|
| >2k52_A Uncharacterized protein MJ1198; metal-binding, zinc, zinc-finger, structural genomics, PSI-2, protein structure initiative; NMR {Methanocaldococcus jannaschii} Length = 80 | Back alignment and structure |
|---|
| >2k52_A Uncharacterized protein MJ1198; metal-binding, zinc, zinc-finger, structural genomics, PSI-2, protein structure initiative; NMR {Methanocaldococcus jannaschii} Length = 80 | Back alignment and structure |
|---|
| >2k52_A Uncharacterized protein MJ1198; metal-binding, zinc, zinc-finger, structural genomics, PSI-2, protein structure initiative; NMR {Methanocaldococcus jannaschii} Length = 80 | Back alignment and structure |
|---|
| >2k52_A Uncharacterized protein MJ1198; metal-binding, zinc, zinc-finger, structural genomics, PSI-2, protein structure initiative; NMR {Methanocaldococcus jannaschii} Length = 80 | Back alignment and structure |
|---|
| >3aev_A Translation initiation factor 2 subunit alpha; proteins-rRNA complex, 16S rRNA, RNA-binding; 2.80A {Pyrococcus horikoshii} PDB: 1yz6_A Length = 275 | Back alignment and structure |
|---|
| >3aev_A Translation initiation factor 2 subunit alpha; proteins-rRNA complex, 16S rRNA, RNA-binding; 2.80A {Pyrococcus horikoshii} PDB: 1yz6_A Length = 275 | Back alignment and structure |
|---|
| >1q8k_A Eukaryotic translation initiation factor 2 subunit 1; NMR {Homo sapiens} SCOP: a.60.14.1 b.40.4.5 d.58.51.1 Length = 308 | Back alignment and structure |
|---|
| >1q8k_A Eukaryotic translation initiation factor 2 subunit 1; NMR {Homo sapiens} SCOP: a.60.14.1 b.40.4.5 d.58.51.1 Length = 308 | Back alignment and structure |
|---|
| >1q8k_A Eukaryotic translation initiation factor 2 subunit 1; NMR {Homo sapiens} SCOP: a.60.14.1 b.40.4.5 d.58.51.1 Length = 308 | Back alignment and structure |
|---|
| >1q8k_A Eukaryotic translation initiation factor 2 subunit 1; NMR {Homo sapiens} SCOP: a.60.14.1 b.40.4.5 d.58.51.1 Length = 308 | Back alignment and structure |
|---|
| >1q8k_A Eukaryotic translation initiation factor 2 subunit 1; NMR {Homo sapiens} SCOP: a.60.14.1 b.40.4.5 d.58.51.1 Length = 308 | Back alignment and structure |
|---|
| >3cw2_C Translation initiation factor 2 subunit alpha; AIF2, intact AIF2, initiation factor 2 alpha subunit, initiation factor 2 beta subunit; 2.80A {Sulfolobus solfataricus} PDB: 2aho_B 3v11_B* Length = 266 | Back alignment and structure |
|---|
| >3cw2_C Translation initiation factor 2 subunit alpha; AIF2, intact AIF2, initiation factor 2 alpha subunit, initiation factor 2 beta subunit; 2.80A {Sulfolobus solfataricus} PDB: 2aho_B 3v11_B* Length = 266 | Back alignment and structure |
|---|
| >3cw2_C Translation initiation factor 2 subunit alpha; AIF2, intact AIF2, initiation factor 2 alpha subunit, initiation factor 2 beta subunit; 2.80A {Sulfolobus solfataricus} PDB: 2aho_B 3v11_B* Length = 266 | Back alignment and structure |
|---|
| >3psf_A Transcription elongation factor SPT6; nucleus; 2.59A {Saccharomyces cerevisiae} Length = 1030 | Back alignment and structure |
|---|
| >3psf_A Transcription elongation factor SPT6; nucleus; 2.59A {Saccharomyces cerevisiae} Length = 1030 | Back alignment and structure |
|---|
| >3psf_A Transcription elongation factor SPT6; nucleus; 2.59A {Saccharomyces cerevisiae} Length = 1030 | Back alignment and structure |
|---|
| >3psf_A Transcription elongation factor SPT6; nucleus; 2.59A {Saccharomyces cerevisiae} Length = 1030 | Back alignment and structure |
|---|
| >3psf_A Transcription elongation factor SPT6; nucleus; 2.59A {Saccharomyces cerevisiae} Length = 1030 | Back alignment and structure |
|---|
| >3psf_A Transcription elongation factor SPT6; nucleus; 2.59A {Saccharomyces cerevisiae} Length = 1030 | Back alignment and structure |
|---|
| >3psf_A Transcription elongation factor SPT6; nucleus; 2.59A {Saccharomyces cerevisiae} Length = 1030 | Back alignment and structure |
|---|
| >3psi_A Transcription elongation factor SPT6; nucleus; 3.30A {Saccharomyces cerevisiae} Length = 1219 | Back alignment and structure |
|---|
| >3psi_A Transcription elongation factor SPT6; nucleus; 3.30A {Saccharomyces cerevisiae} Length = 1219 | Back alignment and structure |
|---|
| >3psi_A Transcription elongation factor SPT6; nucleus; 3.30A {Saccharomyces cerevisiae} Length = 1219 | Back alignment and structure |
|---|
| >3psi_A Transcription elongation factor SPT6; nucleus; 3.30A {Saccharomyces cerevisiae} Length = 1219 | Back alignment and structure |
|---|
| >3psi_A Transcription elongation factor SPT6; nucleus; 3.30A {Saccharomyces cerevisiae} Length = 1219 | Back alignment and structure |
|---|
| >3psi_A Transcription elongation factor SPT6; nucleus; 3.30A {Saccharomyces cerevisiae} Length = 1219 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Length = 530 | Back alignment and structure |
|---|
| >2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Length = 530 | Back alignment and structure |
|---|
| >2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Length = 530 | Back alignment and structure |
|---|
| >2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Length = 530 | Back alignment and structure |
|---|
| >2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Length = 530 | Back alignment and structure |
|---|
| >2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Length = 530 | Back alignment and structure |
|---|
| >2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Length = 530 | Back alignment and structure |
|---|
| >2eqs_A ATP-dependent RNA helicase DHX8; S1 domain, OB-fold, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 103 | Back alignment and structure |
|---|
| >2eqs_A ATP-dependent RNA helicase DHX8; S1 domain, OB-fold, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 103 | Back alignment and structure |
|---|
| >2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Length = 308 | Back alignment and structure |
|---|
| >2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Length = 308 | Back alignment and structure |
|---|
| >2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Length = 308 | Back alignment and structure |
|---|
| >2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Length = 308 | Back alignment and structure |
|---|
| >2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Length = 308 | Back alignment and structure |
|---|
| >2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Length = 493 | Back alignment and structure |
|---|
| >2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Length = 493 | Back alignment and structure |
|---|
| >2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Length = 493 | Back alignment and structure |
|---|
| >3bzc_A TEX; helix-turn-helix, helix-hairpin-helix, S1 domain, YQGF domain, transcription, RNA binding protein; 2.27A {Pseudomonas aeruginosa} SCOP: a.60.2.6 a.60.2.6 a.294.1.1 b.40.4.5 c.55.3.13 PDB: 3bzk_A 2oce_A Length = 785 | Back alignment and structure |
|---|
| >3bzc_A TEX; helix-turn-helix, helix-hairpin-helix, S1 domain, YQGF domain, transcription, RNA binding protein; 2.27A {Pseudomonas aeruginosa} SCOP: a.60.2.6 a.60.2.6 a.294.1.1 b.40.4.5 c.55.3.13 PDB: 3bzk_A 2oce_A Length = 785 | Back alignment and structure |
|---|
| >3cdi_A Polynucleotide phosphorylase; mRNA turnover, RNAse, RNA degradation, kinase, transferase; 2.60A {Escherichia coli} PDB: 1sro_A Length = 723 | Back alignment and structure |
|---|
| >4aid_A Polyribonucleotide nucleotidyltransferase; transferase-peptide complex; 2.60A {Caulobacter vibrioides} PDB: 4aim_A 4am3_A Length = 726 | Back alignment and structure |
|---|
| >4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Length = 679 | Back alignment and structure |
|---|
| >4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Length = 679 | Back alignment and structure |
|---|
| >4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Length = 679 | Back alignment and structure |
|---|
| >1e3p_A Guanosine pentaphosphate synthetase; polyribonucleotide transferase, ATP-GTP diphosphotransferase RNA processing, RNA degradation; 2.5A {Streptomyces antibioticus} SCOP: a.4.9.1 b.40.4.5 d.14.1.4 d.14.1.4 d.52.3.1 d.101.1.1 d.101.1.1 PDB: 1e3h_A Length = 757 | Back alignment and structure |
|---|
| >3go5_A Multidomain protein with S1 RNA-binding domains; structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.40A {Streptococcus pneumoniae} Length = 285 | Back alignment and structure |
|---|
| >3go5_A Multidomain protein with S1 RNA-binding domains; structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.40A {Streptococcus pneumoniae} Length = 285 | Back alignment and structure |
|---|
| >3go5_A Multidomain protein with S1 RNA-binding domains; structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.40A {Streptococcus pneumoniae} Length = 285 | Back alignment and structure |
|---|
| >4ayb_E DNA-directed RNA polymerase; transferase, multi-subunit, transcription; 3.20A {Sulfolobus shibatae} PDB: 2y0s_E 4b1o_E 4b1p_T 2waq_E 2wb1_E 2pmz_E 3hkz_E Length = 180 | Back alignment and structure |
|---|
| >2id0_A Exoribonuclease 2; RNAse, exonuclease, hydrolyase, mRNA decay, RNR family, hydrolase; 2.35A {Escherichia coli} SCOP: b.40.4.5 b.40.4.5 b.40.4.5 b.40.4.16 PDB: 2ix0_A* 2ix1_A Length = 644 | Back alignment and structure |
|---|
| >2r7d_A Ribonuclease II family protein; structural genomics, PSI-2, structure initiative, northeast structural genomics consort NESG; 1.80A {Deinococcus radiodurans R1} SCOP: b.40.4.5 b.40.4.16 PDB: 2r7f_A Length = 469 | Back alignment and structure |
|---|
| >3m7n_A Putative uncharacterized protein AF_0206; exosome, RNA, exonuclease, hydrolase, nuclease, hydrolase-RN; 2.40A {Archaeoglobus fulgidus} PDB: 2ba1_A 3m85_A Length = 179 | Back alignment and structure |
|---|
| >2wp8_J Exosome complex exonuclease DIS3; nucleus, hydrolase, RNA-binding, exonucle binding, mitochondrion, rRNA processing; 3.00A {Saccharomyces cerevisiae} Length = 977 | Back alignment and structure |
|---|
| >3h0g_G DNA-directed RNA polymerase II subunit RPB7; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 172 | Back alignment and structure |
|---|
| >2vnu_D Exosome complex exonuclease RRP44; hydrolase-RNA complex, RNA degradation, RNA-binding, RNA Pro; HET: 1PE; 2.30A {Saccharomyces cerevisiae} SCOP: b.40.4.5 b.40.4.5 b.40.4.5 b.40.4.16 Length = 760 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
No hit with probability above 80.00
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 1826 | ||||
| d3bzka4 | 94 | b.40.4.5 (A:637-730) Tex S1-domain {Pseudomonas ae | 1e-17 | |
| d3bzka4 | 94 | b.40.4.5 (A:637-730) Tex S1-domain {Pseudomonas ae | 1e-13 | |
| d3bzka4 | 94 | b.40.4.5 (A:637-730) Tex S1-domain {Pseudomonas ae | 3e-11 | |
| d3bzka4 | 94 | b.40.4.5 (A:637-730) Tex S1-domain {Pseudomonas ae | 4e-11 | |
| d3bzka4 | 94 | b.40.4.5 (A:637-730) Tex S1-domain {Pseudomonas ae | 2e-08 | |
| d3bzka4 | 94 | b.40.4.5 (A:637-730) Tex S1-domain {Pseudomonas ae | 2e-04 | |
| d3bzka4 | 94 | b.40.4.5 (A:637-730) Tex S1-domain {Pseudomonas ae | 5e-04 | |
| d3bzka4 | 94 | b.40.4.5 (A:637-730) Tex S1-domain {Pseudomonas ae | 0.002 | |
| d3bzka4 | 94 | b.40.4.5 (A:637-730) Tex S1-domain {Pseudomonas ae | 0.002 | |
| d1sroa_ | 76 | b.40.4.5 (A:) S1 RNA-binding domain of polyribonuc | 1e-16 | |
| d1sroa_ | 76 | b.40.4.5 (A:) S1 RNA-binding domain of polyribonuc | 5e-14 | |
| d1sroa_ | 76 | b.40.4.5 (A:) S1 RNA-binding domain of polyribonuc | 7e-10 | |
| d1sroa_ | 76 | b.40.4.5 (A:) S1 RNA-binding domain of polyribonuc | 6e-09 | |
| d1sroa_ | 76 | b.40.4.5 (A:) S1 RNA-binding domain of polyribonuc | 2e-07 | |
| d1sroa_ | 76 | b.40.4.5 (A:) S1 RNA-binding domain of polyribonuc | 0.001 | |
| d1sroa_ | 76 | b.40.4.5 (A:) S1 RNA-binding domain of polyribonuc | 0.002 | |
| d1kl9a2 | 86 | b.40.4.5 (A:3-88) Eukaryotic initiation factor 2al | 1e-14 | |
| d1kl9a2 | 86 | b.40.4.5 (A:3-88) Eukaryotic initiation factor 2al | 1e-08 | |
| d1kl9a2 | 86 | b.40.4.5 (A:3-88) Eukaryotic initiation factor 2al | 8e-07 | |
| d1kl9a2 | 86 | b.40.4.5 (A:3-88) Eukaryotic initiation factor 2al | 3e-06 | |
| d1kl9a2 | 86 | b.40.4.5 (A:3-88) Eukaryotic initiation factor 2al | 7e-06 | |
| d1kl9a2 | 86 | b.40.4.5 (A:3-88) Eukaryotic initiation factor 2al | 2e-05 | |
| d2ahob2 | 84 | b.40.4.5 (B:1-84) Eukaryotic initiation factor 2al | 3e-14 | |
| d2ahob2 | 84 | b.40.4.5 (B:1-84) Eukaryotic initiation factor 2al | 2e-07 | |
| d2ahob2 | 84 | b.40.4.5 (B:1-84) Eukaryotic initiation factor 2al | 9e-07 | |
| d2ahob2 | 84 | b.40.4.5 (B:1-84) Eukaryotic initiation factor 2al | 1e-06 | |
| d2ahob2 | 84 | b.40.4.5 (B:1-84) Eukaryotic initiation factor 2al | 9e-06 | |
| d2ahob2 | 84 | b.40.4.5 (B:1-84) Eukaryotic initiation factor 2al | 1e-04 | |
| d2z0sa1 | 88 | b.40.4.5 (A:60-147) S1-domain of exosome complex R | 4e-13 | |
| d2z0sa1 | 88 | b.40.4.5 (A:60-147) S1-domain of exosome complex R | 1e-07 | |
| d2z0sa1 | 88 | b.40.4.5 (A:60-147) S1-domain of exosome complex R | 1e-05 | |
| d2z0sa1 | 88 | b.40.4.5 (A:60-147) S1-domain of exosome complex R | 2e-04 | |
| d2z0sa1 | 88 | b.40.4.5 (A:60-147) S1-domain of exosome complex R | 3e-04 | |
| d1wi5a_ | 119 | b.40.4.5 (A:) S1-domain of RRP5 protein homolog (P | 6e-13 | |
| d1wi5a_ | 119 | b.40.4.5 (A:) S1-domain of RRP5 protein homolog (P | 2e-09 | |
| d1wi5a_ | 119 | b.40.4.5 (A:) S1-domain of RRP5 protein homolog (P | 2e-06 | |
| d1wi5a_ | 119 | b.40.4.5 (A:) S1-domain of RRP5 protein homolog (P | 2e-04 | |
| d1wi5a_ | 119 | b.40.4.5 (A:) S1-domain of RRP5 protein homolog (P | 6e-04 | |
| d1wi5a_ | 119 | b.40.4.5 (A:) S1-domain of RRP5 protein homolog (P | 8e-04 | |
| d1e3pa2 | 62 | b.40.4.5 (A:656-717) S1 RNA-binding domain of poly | 1e-12 | |
| d1e3pa2 | 62 | b.40.4.5 (A:656-717) S1 RNA-binding domain of poly | 3e-07 | |
| d1e3pa2 | 62 | b.40.4.5 (A:656-717) S1 RNA-binding domain of poly | 1e-06 | |
| d1e3pa2 | 62 | b.40.4.5 (A:656-717) S1 RNA-binding domain of poly | 3e-04 | |
| d2je6i1 | 87 | b.40.4.5 (I:66-152) S1-domain of exosome complex R | 1e-11 | |
| d2je6i1 | 87 | b.40.4.5 (I:66-152) S1-domain of exosome complex R | 5e-07 | |
| d2je6i1 | 87 | b.40.4.5 (I:66-152) S1-domain of exosome complex R | 3e-05 | |
| d2je6i1 | 87 | b.40.4.5 (I:66-152) S1-domain of exosome complex R | 9e-05 | |
| d2je6i1 | 87 | b.40.4.5 (I:66-152) S1-domain of exosome complex R | 2e-04 | |
| d2ba0a1 | 83 | b.40.4.5 (A:53-135) S1-domain of exosome complex R | 3e-11 | |
| d2ba0a1 | 83 | b.40.4.5 (A:53-135) S1-domain of exosome complex R | 8e-08 | |
| d2ba0a1 | 83 | b.40.4.5 (A:53-135) S1-domain of exosome complex R | 2e-05 | |
| d2ba0a1 | 83 | b.40.4.5 (A:53-135) S1-domain of exosome complex R | 4e-05 | |
| d2ba0a1 | 83 | b.40.4.5 (A:53-135) S1-domain of exosome complex R | 6e-04 | |
| d1go3e1 | 106 | b.40.4.5 (E:79-184) C-terminal domain of RNA polym | 7e-11 | |
| d1y14b1 | 91 | b.40.4.5 (B:81-171) C-terminal domain of RNA polym | 5e-10 | |
| d1y14b1 | 91 | b.40.4.5 (B:81-171) C-terminal domain of RNA polym | 0.002 | |
| d2ix0a3 | 87 | b.40.4.5 (A:558-644) Exoribonuclease 2, RNB {Esche | 7e-10 | |
| d2ix0a3 | 87 | b.40.4.5 (A:558-644) Exoribonuclease 2, RNB {Esche | 0.002 | |
| d2nn6h1 | 95 | b.40.4.5 (H:73-167) S1-domain of Ribosomal RNA-pro | 3e-09 | |
| d2onda1 | 308 | a.118.8.7 (A:242-549) Cleavage stimulation factor | 7e-08 | |
| d2onda1 | 308 | a.118.8.7 (A:242-549) Cleavage stimulation factor | 4e-07 | |
| d2c35b1 | 94 | b.40.4.5 (B:78-171) C-terminal domain of RNA polym | 4e-07 | |
| d2nn6g1 | 88 | b.40.4.5 (G:107-194) S1-domain of exosome componen | 4e-07 | |
| d2ja9a1 | 90 | b.40.4.5 (A:62-151) S1-domain of exosome component | 2e-05 | |
| d1hh2p1 | 72 | b.40.4.5 (P:127-198) S1 domain of NusA {Thermotoga | 6e-05 | |
| d2nn6i1 | 125 | b.40.4.5 (I:61-185) Exosome component 1, EXOSC1 {H | 0.004 |
| >d3bzka4 b.40.4.5 (A:637-730) Tex S1-domain {Pseudomonas aeruginosa [TaxId: 287]} Length = 94 | Back information, alignment and structure |
|---|
class: All beta proteins fold: OB-fold superfamily: Nucleic acid-binding proteins family: Cold shock DNA-binding domain-like domain: Tex S1-domain species: Pseudomonas aeruginosa [TaxId: 287]
Score = 77.2 bits (190), Expect = 1e-17
Identities = 31/90 (34%), Positives = 53/90 (58%), Gaps = 2/90 (2%)
Query: 1453 RTASQSE-INNLSNLHVGDIVIGQIKRVESYGLFITIENTNLVGLCHVSELSEDHVDNIE 1511
+TA E + +L +L G ++ G + V ++G F+ I + GL H+S LSE V +
Sbjct: 2 KTAEFQEGVESLKDLKPGMVLEGVVTNVTNFGAFVDIGV-HQDGLVHISALSEKFVKDPY 60
Query: 1512 TIYRAGEKVKVKILKVDKEKRRISLGMKSS 1541
+ +AG+ VKVK+++VD + R+ L M+ S
Sbjct: 61 EVVKAGDIVKVKVMEVDIPRNRVGLSMRMS 90
|
| >d3bzka4 b.40.4.5 (A:637-730) Tex S1-domain {Pseudomonas aeruginosa [TaxId: 287]} Length = 94 | Back information, alignment and structure |
|---|
| >d3bzka4 b.40.4.5 (A:637-730) Tex S1-domain {Pseudomonas aeruginosa [TaxId: 287]} Length = 94 | Back information, alignment and structure |
|---|
| >d3bzka4 b.40.4.5 (A:637-730) Tex S1-domain {Pseudomonas aeruginosa [TaxId: 287]} Length = 94 | Back information, alignment and structure |
|---|
| >d3bzka4 b.40.4.5 (A:637-730) Tex S1-domain {Pseudomonas aeruginosa [TaxId: 287]} Length = 94 | Back information, alignment and structure |
|---|
| >d3bzka4 b.40.4.5 (A:637-730) Tex S1-domain {Pseudomonas aeruginosa [TaxId: 287]} Length = 94 | Back information, alignment and structure |
|---|
| >d3bzka4 b.40.4.5 (A:637-730) Tex S1-domain {Pseudomonas aeruginosa [TaxId: 287]} Length = 94 | Back information, alignment and structure |
|---|
| >d3bzka4 b.40.4.5 (A:637-730) Tex S1-domain {Pseudomonas aeruginosa [TaxId: 287]} Length = 94 | Back information, alignment and structure |
|---|
| >d3bzka4 b.40.4.5 (A:637-730) Tex S1-domain {Pseudomonas aeruginosa [TaxId: 287]} Length = 94 | Back information, alignment and structure |
|---|
| >d1sroa_ b.40.4.5 (A:) S1 RNA-binding domain of polyribonucleotide phosphorylase, PNPase {Escherichia coli [TaxId: 562]} Length = 76 | Back information, alignment and structure |
|---|
| >d1sroa_ b.40.4.5 (A:) S1 RNA-binding domain of polyribonucleotide phosphorylase, PNPase {Escherichia coli [TaxId: 562]} Length = 76 | Back information, alignment and structure |
|---|
| >d1sroa_ b.40.4.5 (A:) S1 RNA-binding domain of polyribonucleotide phosphorylase, PNPase {Escherichia coli [TaxId: 562]} Length = 76 | Back information, alignment and structure |
|---|
| >d1sroa_ b.40.4.5 (A:) S1 RNA-binding domain of polyribonucleotide phosphorylase, PNPase {Escherichia coli [TaxId: 562]} Length = 76 | Back information, alignment and structure |
|---|
| >d1sroa_ b.40.4.5 (A:) S1 RNA-binding domain of polyribonucleotide phosphorylase, PNPase {Escherichia coli [TaxId: 562]} Length = 76 | Back information, alignment and structure |
|---|
| >d1sroa_ b.40.4.5 (A:) S1 RNA-binding domain of polyribonucleotide phosphorylase, PNPase {Escherichia coli [TaxId: 562]} Length = 76 | Back information, alignment and structure |
|---|
| >d1sroa_ b.40.4.5 (A:) S1 RNA-binding domain of polyribonucleotide phosphorylase, PNPase {Escherichia coli [TaxId: 562]} Length = 76 | Back information, alignment and structure |
|---|
| >d1kl9a2 b.40.4.5 (A:3-88) Eukaryotic initiation factor 2alpha, eIF2alpha, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 86 | Back information, alignment and structure |
|---|
| >d1kl9a2 b.40.4.5 (A:3-88) Eukaryotic initiation factor 2alpha, eIF2alpha, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 86 | Back information, alignment and structure |
|---|
| >d1kl9a2 b.40.4.5 (A:3-88) Eukaryotic initiation factor 2alpha, eIF2alpha, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 86 | Back information, alignment and structure |
|---|
| >d1kl9a2 b.40.4.5 (A:3-88) Eukaryotic initiation factor 2alpha, eIF2alpha, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 86 | Back information, alignment and structure |
|---|
| >d1kl9a2 b.40.4.5 (A:3-88) Eukaryotic initiation factor 2alpha, eIF2alpha, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 86 | Back information, alignment and structure |
|---|
| >d1kl9a2 b.40.4.5 (A:3-88) Eukaryotic initiation factor 2alpha, eIF2alpha, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 86 | Back information, alignment and structure |
|---|
| >d2ahob2 b.40.4.5 (B:1-84) Eukaryotic initiation factor 2alpha, eIF2alpha, N-terminal domain {Sulfolobus solfataricus [TaxId: 2287]} Length = 84 | Back information, alignment and structure |
|---|
| >d2ahob2 b.40.4.5 (B:1-84) Eukaryotic initiation factor 2alpha, eIF2alpha, N-terminal domain {Sulfolobus solfataricus [TaxId: 2287]} Length = 84 | Back information, alignment and structure |
|---|
| >d2ahob2 b.40.4.5 (B:1-84) Eukaryotic initiation factor 2alpha, eIF2alpha, N-terminal domain {Sulfolobus solfataricus [TaxId: 2287]} Length = 84 | Back information, alignment and structure |
|---|
| >d2ahob2 b.40.4.5 (B:1-84) Eukaryotic initiation factor 2alpha, eIF2alpha, N-terminal domain {Sulfolobus solfataricus [TaxId: 2287]} Length = 84 | Back information, alignment and structure |
|---|
| >d2ahob2 b.40.4.5 (B:1-84) Eukaryotic initiation factor 2alpha, eIF2alpha, N-terminal domain {Sulfolobus solfataricus [TaxId: 2287]} Length = 84 | Back information, alignment and structure |
|---|
| >d2ahob2 b.40.4.5 (B:1-84) Eukaryotic initiation factor 2alpha, eIF2alpha, N-terminal domain {Sulfolobus solfataricus [TaxId: 2287]} Length = 84 | Back information, alignment and structure |
|---|
| >d2z0sa1 b.40.4.5 (A:60-147) S1-domain of exosome complex RNA-binding protein 1, ECR1 {Aeropyrum pernix [TaxId: 56636]} Length = 88 | Back information, alignment and structure |
|---|
| >d2z0sa1 b.40.4.5 (A:60-147) S1-domain of exosome complex RNA-binding protein 1, ECR1 {Aeropyrum pernix [TaxId: 56636]} Length = 88 | Back information, alignment and structure |
|---|
| >d2z0sa1 b.40.4.5 (A:60-147) S1-domain of exosome complex RNA-binding protein 1, ECR1 {Aeropyrum pernix [TaxId: 56636]} Length = 88 | Back information, alignment and structure |
|---|
| >d2z0sa1 b.40.4.5 (A:60-147) S1-domain of exosome complex RNA-binding protein 1, ECR1 {Aeropyrum pernix [TaxId: 56636]} Length = 88 | Back information, alignment and structure |
|---|
| >d2z0sa1 b.40.4.5 (A:60-147) S1-domain of exosome complex RNA-binding protein 1, ECR1 {Aeropyrum pernix [TaxId: 56636]} Length = 88 | Back information, alignment and structure |
|---|
| >d1wi5a_ b.40.4.5 (A:) S1-domain of RRP5 protein homolog (PDCD11, KIAA0185) {Human (Homo sapiens) [TaxId: 9606]} Length = 119 | Back information, alignment and structure |
|---|
| >d1wi5a_ b.40.4.5 (A:) S1-domain of RRP5 protein homolog (PDCD11, KIAA0185) {Human (Homo sapiens) [TaxId: 9606]} Length = 119 | Back information, alignment and structure |
|---|
| >d1wi5a_ b.40.4.5 (A:) S1-domain of RRP5 protein homolog (PDCD11, KIAA0185) {Human (Homo sapiens) [TaxId: 9606]} Length = 119 | Back information, alignment and structure |
|---|
| >d1wi5a_ b.40.4.5 (A:) S1-domain of RRP5 protein homolog (PDCD11, KIAA0185) {Human (Homo sapiens) [TaxId: 9606]} Length = 119 | Back information, alignment and structure |
|---|
| >d1wi5a_ b.40.4.5 (A:) S1-domain of RRP5 protein homolog (PDCD11, KIAA0185) {Human (Homo sapiens) [TaxId: 9606]} Length = 119 | Back information, alignment and structure |
|---|
| >d1wi5a_ b.40.4.5 (A:) S1-domain of RRP5 protein homolog (PDCD11, KIAA0185) {Human (Homo sapiens) [TaxId: 9606]} Length = 119 | Back information, alignment and structure |
|---|
| >d1e3pa2 b.40.4.5 (A:656-717) S1 RNA-binding domain of polyribonucleotide phosphorylase, PNPase {Streptomyces antibioticus [TaxId: 1890]} Length = 62 | Back information, alignment and structure |
|---|
| >d1e3pa2 b.40.4.5 (A:656-717) S1 RNA-binding domain of polyribonucleotide phosphorylase, PNPase {Streptomyces antibioticus [TaxId: 1890]} Length = 62 | Back information, alignment and structure |
|---|
| >d1e3pa2 b.40.4.5 (A:656-717) S1 RNA-binding domain of polyribonucleotide phosphorylase, PNPase {Streptomyces antibioticus [TaxId: 1890]} Length = 62 | Back information, alignment and structure |
|---|
| >d1e3pa2 b.40.4.5 (A:656-717) S1 RNA-binding domain of polyribonucleotide phosphorylase, PNPase {Streptomyces antibioticus [TaxId: 1890]} Length = 62 | Back information, alignment and structure |
|---|
| >d2je6i1 b.40.4.5 (I:66-152) S1-domain of exosome complex RNA-binding protein 1, ECR1 {Sulfolobus solfataricus [TaxId: 2287]} Length = 87 | Back information, alignment and structure |
|---|
| >d2je6i1 b.40.4.5 (I:66-152) S1-domain of exosome complex RNA-binding protein 1, ECR1 {Sulfolobus solfataricus [TaxId: 2287]} Length = 87 | Back information, alignment and structure |
|---|
| >d2je6i1 b.40.4.5 (I:66-152) S1-domain of exosome complex RNA-binding protein 1, ECR1 {Sulfolobus solfataricus [TaxId: 2287]} Length = 87 | Back information, alignment and structure |
|---|
| >d2je6i1 b.40.4.5 (I:66-152) S1-domain of exosome complex RNA-binding protein 1, ECR1 {Sulfolobus solfataricus [TaxId: 2287]} Length = 87 | Back information, alignment and structure |
|---|
| >d2je6i1 b.40.4.5 (I:66-152) S1-domain of exosome complex RNA-binding protein 1, ECR1 {Sulfolobus solfataricus [TaxId: 2287]} Length = 87 | Back information, alignment and structure |
|---|
| >d2ba0a1 b.40.4.5 (A:53-135) S1-domain of exosome complex RNA-binding protein 1, ECR1 {Archaeoglobus fulgidus [TaxId: 2234]} Length = 83 | Back information, alignment and structure |
|---|
| >d2ba0a1 b.40.4.5 (A:53-135) S1-domain of exosome complex RNA-binding protein 1, ECR1 {Archaeoglobus fulgidus [TaxId: 2234]} Length = 83 | Back information, alignment and structure |
|---|
| >d2ba0a1 b.40.4.5 (A:53-135) S1-domain of exosome complex RNA-binding protein 1, ECR1 {Archaeoglobus fulgidus [TaxId: 2234]} Length = 83 | Back information, alignment and structure |
|---|
| >d2ba0a1 b.40.4.5 (A:53-135) S1-domain of exosome complex RNA-binding protein 1, ECR1 {Archaeoglobus fulgidus [TaxId: 2234]} Length = 83 | Back information, alignment and structure |
|---|
| >d2ba0a1 b.40.4.5 (A:53-135) S1-domain of exosome complex RNA-binding protein 1, ECR1 {Archaeoglobus fulgidus [TaxId: 2234]} Length = 83 | Back information, alignment and structure |
|---|
| >d1go3e1 b.40.4.5 (E:79-184) C-terminal domain of RNA polymerase II subunit RBP7 (RpoE) {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 106 | Back information, alignment and structure |
|---|
| >d1y14b1 b.40.4.5 (B:81-171) C-terminal domain of RNA polymerase II subunit RBP7 (RpoE) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 91 | Back information, alignment and structure |
|---|
| >d1y14b1 b.40.4.5 (B:81-171) C-terminal domain of RNA polymerase II subunit RBP7 (RpoE) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 91 | Back information, alignment and structure |
|---|
| >d2ix0a3 b.40.4.5 (A:558-644) Exoribonuclease 2, RNB {Escherichia coli [TaxId: 562]} Length = 87 | Back information, alignment and structure |
|---|
| >d2ix0a3 b.40.4.5 (A:558-644) Exoribonuclease 2, RNB {Escherichia coli [TaxId: 562]} Length = 87 | Back information, alignment and structure |
|---|
| >d2nn6h1 b.40.4.5 (H:73-167) S1-domain of Ribosomal RNA-processing protein 4, RRP4 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 | Back information, alignment and structure |
|---|
| >d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Length = 308 | Back information, alignment and structure |
|---|
| >d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Length = 308 | Back information, alignment and structure |
|---|
| >d2c35b1 b.40.4.5 (B:78-171) C-terminal domain of RNA polymerase II subunit RBP7 (RpoE) {Human (Homo sapiens) [TaxId: 9606]} Length = 94 | Back information, alignment and structure |
|---|
| >d2nn6g1 b.40.4.5 (G:107-194) S1-domain of exosome component 3 (RRP40) {Human (Homo sapiens) [TaxId: 9606]} Length = 88 | Back information, alignment and structure |
|---|
| >d2ja9a1 b.40.4.5 (A:62-151) S1-domain of exosome component 3 (RRP40) {Saccharomyces cerevisiae [TaxId: 4932]} Length = 90 | Back information, alignment and structure |
|---|
| >d1hh2p1 b.40.4.5 (P:127-198) S1 domain of NusA {Thermotoga maritima [TaxId: 2336]} Length = 72 | Back information, alignment and structure |
|---|
| >d2nn6i1 b.40.4.5 (I:61-185) Exosome component 1, EXOSC1 {Human (Homo sapiens) [TaxId: 9606]} Length = 125 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 1826 | |||
| d2onda1 | 308 | Cleavage stimulation factor 77 kDa subunit CSTF3 { | 99.63 | |
| d2onda1 | 308 | Cleavage stimulation factor 77 kDa subunit CSTF3 { | 99.61 | |
| d1wi5a_ | 119 | S1-domain of RRP5 protein homolog (PDCD11, KIAA018 | 99.56 | |
| d3bzka4 | 94 | Tex S1-domain {Pseudomonas aeruginosa [TaxId: 287] | 99.55 | |
| d1sroa_ | 76 | S1 RNA-binding domain of polyribonucleotide phosph | 99.54 | |
| d3bzka4 | 94 | Tex S1-domain {Pseudomonas aeruginosa [TaxId: 287] | 99.53 | |
| d1kl9a2 | 86 | Eukaryotic initiation factor 2alpha, eIF2alpha, N- | 99.52 | |
| d2ahob2 | 84 | Eukaryotic initiation factor 2alpha, eIF2alpha, N- | 99.49 | |
| d1sroa_ | 76 | S1 RNA-binding domain of polyribonucleotide phosph | 99.49 | |
| d1kl9a2 | 86 | Eukaryotic initiation factor 2alpha, eIF2alpha, N- | 99.45 | |
| d1wi5a_ | 119 | S1-domain of RRP5 protein homolog (PDCD11, KIAA018 | 99.44 | |
| d2ahob2 | 84 | Eukaryotic initiation factor 2alpha, eIF2alpha, N- | 99.4 | |
| d1go3e1 | 106 | C-terminal domain of RNA polymerase II subunit RBP | 99.34 | |
| d2ba0a1 | 83 | S1-domain of exosome complex RNA-binding protein 1 | 99.33 | |
| d1go3e1 | 106 | C-terminal domain of RNA polymerase II subunit RBP | 99.27 | |
| d2ba0a1 | 83 | S1-domain of exosome complex RNA-binding protein 1 | 99.27 | |
| d2je6i1 | 87 | S1-domain of exosome complex RNA-binding protein 1 | 99.25 | |
| d2z0sa1 | 88 | S1-domain of exosome complex RNA-binding protein 1 | 99.22 | |
| d2je6i1 | 87 | S1-domain of exosome complex RNA-binding protein 1 | 99.17 | |
| d2z0sa1 | 88 | S1-domain of exosome complex RNA-binding protein 1 | 99.17 | |
| d1w3ba_ | 388 | O-GlcNAc transferase p110 subunit, OGT {Human (Hom | 99.06 | |
| d2nn6h1 | 95 | S1-domain of Ribosomal RNA-processing protein 4, R | 98.92 | |
| d1w3ba_ | 388 | O-GlcNAc transferase p110 subunit, OGT {Human (Hom | 98.9 | |
| d2ix0a3 | 87 | Exoribonuclease 2, RNB {Escherichia coli [TaxId: 5 | 98.89 | |
| d1fcha_ | 323 | Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 | 98.86 | |
| d1fcha_ | 323 | Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 | 98.84 | |
| d1e3pa2 | 62 | S1 RNA-binding domain of polyribonucleotide phosph | 98.81 | |
| d1y14b1 | 91 | C-terminal domain of RNA polymerase II subunit RBP | 98.79 | |
| d2nn6h1 | 95 | S1-domain of Ribosomal RNA-processing protein 4, R | 98.76 | |
| d1e3pa2 | 62 | S1 RNA-binding domain of polyribonucleotide phosph | 98.71 | |
| d2c35b1 | 94 | C-terminal domain of RNA polymerase II subunit RBP | 98.69 | |
| d1y14b1 | 91 | C-terminal domain of RNA polymerase II subunit RBP | 98.61 | |
| d2ix0a3 | 87 | Exoribonuclease 2, RNB {Escherichia coli [TaxId: 5 | 98.58 | |
| d2c35b1 | 94 | C-terminal domain of RNA polymerase II subunit RBP | 98.5 | |
| d2h6fa1 | 315 | Protein farnesyltransferase alpha-subunit {Human ( | 98.38 | |
| d2h6fa1 | 315 | Protein farnesyltransferase alpha-subunit {Human ( | 98.34 | |
| d1xnfa_ | 259 | Lipoprotein NlpI {Escherichia coli [TaxId: 562]} | 98.32 | |
| d1a17a_ | 159 | Protein phosphatase 5 {Human (Homo sapiens) [TaxId | 98.24 | |
| d2nn6g1 | 88 | S1-domain of exosome component 3 (RRP40) {Human (H | 98.22 | |
| d2nn6g1 | 88 | S1-domain of exosome component 3 (RRP40) {Human (H | 98.22 | |
| d1xnfa_ | 259 | Lipoprotein NlpI {Escherichia coli [TaxId: 562]} | 98.19 | |
| d1elwa_ | 117 | Hop {Human (Homo sapiens) [TaxId: 9606]} | 98.11 | |
| d2ja9a1 | 90 | S1-domain of exosome component 3 (RRP40) {Saccharo | 98.06 | |
| d1dcea1 | 334 | Rab geranylgeranyltransferase alpha-subunit, N-ter | 97.98 | |
| d1hh2p1 | 72 | S1 domain of NusA {Thermotoga maritima [TaxId: 233 | 97.98 | |
| d2ja9a1 | 90 | S1-domain of exosome component 3 (RRP40) {Saccharo | 97.97 | |
| d2nn6i1 | 125 | Exosome component 1, EXOSC1 {Human (Homo sapiens) | 97.94 | |
| d2nn6i1 | 125 | Exosome component 1, EXOSC1 {Human (Homo sapiens) | 97.81 | |
| d2c2la1 | 201 | STIP1 homology and U box-containing protein 1, STU | 97.81 | |
| d1hh2p1 | 72 | S1 domain of NusA {Thermotoga maritima [TaxId: 233 | 97.76 | |
| d1qqea_ | 290 | Vesicular transport protein sec17 {Baker's yeast ( | 97.65 | |
| d1a17a_ | 159 | Protein phosphatase 5 {Human (Homo sapiens) [TaxId | 97.6 | |
| d1zbpa1 | 264 | Hypothetical protein VPA1032 {Vibrio parahaemolyti | 97.59 | |
| d1hxia_ | 112 | Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 | 97.47 | |
| d1elwa_ | 117 | Hop {Human (Homo sapiens) [TaxId: 9606]} | 97.47 | |
| d1hh8a_ | 192 | Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H | 97.44 | |
| d2asba1 | 76 | S1 domain of NusA {Mycobacterium tuberculosis [Tax | 97.41 | |
| d1hxia_ | 112 | Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 | 97.4 | |
| d1nzna_ | 122 | Mitochondria fission protein Fis1 {Human (Homo sap | 97.33 | |
| d1p5qa1 | 170 | FKBP52 (FKBP4), C-terminal domain {Human (Homo sap | 97.29 | |
| d1ihga1 | 169 | Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} | 97.28 | |
| d2c2la1 | 201 | STIP1 homology and U box-containing protein 1, STU | 97.21 | |
| d2asba1 | 76 | S1 domain of NusA {Mycobacterium tuberculosis [Tax | 97.2 | |
| d1dcea1 | 334 | Rab geranylgeranyltransferase alpha-subunit, N-ter | 97.2 | |
| d2fbna1 | 153 | Putative 70 kda peptidylprolyl isomerase PFL2275c | 97.18 | |
| d1nzna_ | 122 | Mitochondria fission protein Fis1 {Human (Homo sap | 97.09 | |
| d1hh8a_ | 192 | Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H | 96.7 | |
| d1ya0a1 | 497 | SMG-7 {Human (Homo sapiens) [TaxId: 9606]} | 96.68 | |
| d1smxa_ | 87 | S1-domain of Ribonuclease E {Escherichia coli [Tax | 96.5 | |
| d1zu2a1 | 145 | Mitochondrial import receptor subunit tom20-3 {Tha | 96.42 | |
| d1kt1a1 | 168 | FKBP51, C-terminal domain {Monkey (Saimiri bolivie | 96.25 | |
| d1hz4a_ | 366 | Transcription factor MalT domain III {Escherichia | 96.21 | |
| d1hz4a_ | 366 | Transcription factor MalT domain III {Escherichia | 96.12 | |
| d1smxa_ | 87 | S1-domain of Ribonuclease E {Escherichia coli [Tax | 96.1 | |
| d1zbpa1 | 264 | Hypothetical protein VPA1032 {Vibrio parahaemolyti | 96.03 | |
| d1elra_ | 128 | Hop {Human (Homo sapiens) [TaxId: 9606]} | 95.98 | |
| d1ya0a1 | 497 | SMG-7 {Human (Homo sapiens) [TaxId: 9606]} | 95.36 | |
| d1p5qa1 | 170 | FKBP52 (FKBP4), C-terminal domain {Human (Homo sap | 95.17 | |
| d1elra_ | 128 | Hop {Human (Homo sapiens) [TaxId: 9606]} | 94.93 | |
| d1qqea_ | 290 | Vesicular transport protein sec17 {Baker's yeast ( | 94.8 | |
| d2ff4a2 | 179 | Probable regulatory protein EmbR, middle domain {M | 94.64 | |
| d2fbna1 | 153 | Putative 70 kda peptidylprolyl isomerase PFL2275c | 93.95 | |
| d1ihga1 | 169 | Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} | 93.23 | |
| d1kt1a1 | 168 | FKBP51, C-terminal domain {Monkey (Saimiri bolivie | 92.06 | |
| d1zu2a1 | 145 | Mitochondrial import receptor subunit tom20-3 {Tha | 91.92 | |
| d1tjca_ | 95 | Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human | 91.34 | |
| d2ff4a2 | 179 | Probable regulatory protein EmbR, middle domain {M | 86.03 | |
| d2hr2a1 | 156 | Hypothetical protein CT2138 {Chlorobium tepidum [T | 84.3 |
| >d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
class: All alpha proteins fold: alpha-alpha superhelix superfamily: TPR-like family: HAT/Suf repeat domain: Cleavage stimulation factor 77 kDa subunit CSTF3 species: Mouse (Mus musculus) [TaxId: 10090]
Probab=99.63 E-value=8.1e-15 Score=114.42 Aligned_cols=139 Identities=17% Similarity=0.246 Sum_probs=112.0
Q ss_pred CCCCCCCHHHHHHHHHHCCCC-HHHHHHHHHHHHHCCCHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHH-CCCCC
Q ss_conf 258999978999998819996-3689999999992289999999999998622651034589999999999997-09999
Q 000227 1665 EKDAPRTPDEFERLVRSSPNS-SFVWIKYMAFMLSMADVEKARSIAERALQTINIREENEKLNIWVAYFNLENE-YGNPP 1742 (1826)
Q Consensus 1665 ~~~~p~s~~~fer~l~~~p~s-s~lWi~y~~f~l~~~ei~~AR~i~erAl~~i~~re~~e~~niW~a~l~LE~~-~g~~~ 1742 (1826)
.++..+++..|++++...|.. ..+|+.|+.|..+.+++++||++++||++..+... .+|+.++.+|.. .| +
T Consensus 112 ~~~~~~a~~i~~~~l~~~~~~~~~~w~~~~~~~~~~~~~~~ar~i~~~al~~~~~~~-----~~~~~~a~~e~~~~~--~ 184 (308)
T d2onda1 112 RMKYEKVHSIYNRLLAIEDIDPTLVYIQYMKFARRAEGIKSGRMIFKKAREDARTRH-----HVYVTAALMEYYCSK--D 184 (308)
T ss_dssp TTCHHHHHHHHHHHHTSSSSCTHHHHHHHHHHHHHHHCHHHHHHHHHHHHTSTTCCT-----HHHHHHHHHHHHTSC--C
T ss_pred CCCHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHCCCCH-----HHHHHHHHHHHHHCC--C
T ss_conf 133899999999999871578699999999999982786889999999998088867-----999999999987655--7
Q ss_pred HHHHHHHHHHHH-HCCCCHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHCCCC----HHHHHHHHHHHHHCCCC
Q ss_conf 789999999999-319949999999999998099589999999999981799----79999999988723433
Q 000227 1743 EEAVVKVFQRAL-QYCDPKKVHLALLGLYERTEQNKLADELLYKMIKKFKHS----CKVIIELLSFHFTSILS 1810 (1826)
Q Consensus 1743 ~e~~~~vf~~a~-~~~~~~~v~~~~~~i~~~~~~~~~a~e~~~~~~kk~~~~----~~~W~~~~~~~~~~~~~ 1810 (1826)
.+.++.+|++++ .+++...+|+.|++++...|++++||.+|++++++++.+ ..+|..|++|+..+|+-
T Consensus 185 ~~~a~~i~e~~l~~~p~~~~~w~~y~~~~~~~g~~~~aR~~fe~ai~~~~~~~~~~~~iw~~~~~fE~~~G~~ 257 (308)
T d2onda1 185 KSVAFKIFELGLKKYGDIPEYVLAYIDYLSHLNEDNNTRVLFERVLTSGSLPPEKSGEIWARFLAFESNIGDL 257 (308)
T ss_dssp HHHHHHHHHHHHHHHTTCHHHHHHHHHHHHTTCCHHHHHHHHHHHHHSSSSCGGGCHHHHHHHHHHHHHHSCH
T ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHCCCH
T ss_conf 7899999999998610038899999999998698689999999999827898689999999999999984999
|
| >d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wi5a_ b.40.4.5 (A:) S1-domain of RRP5 protein homolog (PDCD11, KIAA0185) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3bzka4 b.40.4.5 (A:637-730) Tex S1-domain {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1sroa_ b.40.4.5 (A:) S1 RNA-binding domain of polyribonucleotide phosphorylase, PNPase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d3bzka4 b.40.4.5 (A:637-730) Tex S1-domain {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1kl9a2 b.40.4.5 (A:3-88) Eukaryotic initiation factor 2alpha, eIF2alpha, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ahob2 b.40.4.5 (B:1-84) Eukaryotic initiation factor 2alpha, eIF2alpha, N-terminal domain {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1sroa_ b.40.4.5 (A:) S1 RNA-binding domain of polyribonucleotide phosphorylase, PNPase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1kl9a2 b.40.4.5 (A:3-88) Eukaryotic initiation factor 2alpha, eIF2alpha, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wi5a_ b.40.4.5 (A:) S1-domain of RRP5 protein homolog (PDCD11, KIAA0185) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ahob2 b.40.4.5 (B:1-84) Eukaryotic initiation factor 2alpha, eIF2alpha, N-terminal domain {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1go3e1 b.40.4.5 (E:79-184) C-terminal domain of RNA polymerase II subunit RBP7 (RpoE) {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d2ba0a1 b.40.4.5 (A:53-135) S1-domain of exosome complex RNA-binding protein 1, ECR1 {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1go3e1 b.40.4.5 (E:79-184) C-terminal domain of RNA polymerase II subunit RBP7 (RpoE) {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d2ba0a1 b.40.4.5 (A:53-135) S1-domain of exosome complex RNA-binding protein 1, ECR1 {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d2je6i1 b.40.4.5 (I:66-152) S1-domain of exosome complex RNA-binding protein 1, ECR1 {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d2z0sa1 b.40.4.5 (A:60-147) S1-domain of exosome complex RNA-binding protein 1, ECR1 {Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d2je6i1 b.40.4.5 (I:66-152) S1-domain of exosome complex RNA-binding protein 1, ECR1 {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d2z0sa1 b.40.4.5 (A:60-147) S1-domain of exosome complex RNA-binding protein 1, ECR1 {Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2nn6h1 b.40.4.5 (H:73-167) S1-domain of Ribosomal RNA-processing protein 4, RRP4 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ix0a3 b.40.4.5 (A:558-644) Exoribonuclease 2, RNB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1e3pa2 b.40.4.5 (A:656-717) S1 RNA-binding domain of polyribonucleotide phosphorylase, PNPase {Streptomyces antibioticus [TaxId: 1890]} | Back information, alignment and structure |
|---|
| >d1y14b1 b.40.4.5 (B:81-171) C-terminal domain of RNA polymerase II subunit RBP7 (RpoE) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2nn6h1 b.40.4.5 (H:73-167) S1-domain of Ribosomal RNA-processing protein 4, RRP4 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1e3pa2 b.40.4.5 (A:656-717) S1 RNA-binding domain of polyribonucleotide phosphorylase, PNPase {Streptomyces antibioticus [TaxId: 1890]} | Back information, alignment and structure |
|---|
| >d2c35b1 b.40.4.5 (B:78-171) C-terminal domain of RNA polymerase II subunit RBP7 (RpoE) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1y14b1 b.40.4.5 (B:81-171) C-terminal domain of RNA polymerase II subunit RBP7 (RpoE) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2ix0a3 b.40.4.5 (A:558-644) Exoribonuclease 2, RNB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2c35b1 b.40.4.5 (B:78-171) C-terminal domain of RNA polymerase II subunit RBP7 (RpoE) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2nn6g1 b.40.4.5 (G:107-194) S1-domain of exosome component 3 (RRP40) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2nn6g1 b.40.4.5 (G:107-194) S1-domain of exosome component 3 (RRP40) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ja9a1 b.40.4.5 (A:62-151) S1-domain of exosome component 3 (RRP40) {Saccharomyces cerevisiae [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1hh2p1 b.40.4.5 (P:127-198) S1 domain of NusA {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2ja9a1 b.40.4.5 (A:62-151) S1-domain of exosome component 3 (RRP40) {Saccharomyces cerevisiae [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2nn6i1 b.40.4.5 (I:61-185) Exosome component 1, EXOSC1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2nn6i1 b.40.4.5 (I:61-185) Exosome component 1, EXOSC1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1hh2p1 b.40.4.5 (P:127-198) S1 domain of NusA {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} | Back information, alignment and structure |
|---|
| >d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} | Back information, alignment and structure |
|---|
| >d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2asba1 b.40.4.5 (A:108-183) S1 domain of NusA {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} | Back information, alignment and structure |
|---|
| >d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2asba1 b.40.4.5 (A:108-183) S1 domain of NusA {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1smxa_ b.40.4.5 (A:) S1-domain of Ribonuclease E {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} | Back information, alignment and structure |
|---|
| >d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1smxa_ b.40.4.5 (A:) S1-domain of Ribonuclease E {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} | Back information, alignment and structure |
|---|
| >d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} | Back information, alignment and structure |
|---|
| >d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} | Back information, alignment and structure |
|---|