Citrus Sinensis ID: 000410

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------1000------1010------1020------1030------1040------1050------1060------1070------1080------1090------1100------1110------1120------1130------1140------1150------1160------1170------1180------1190------1200------1210------1220------1230------1240------1250------1260------1270------1280------1290------1300------1310------1320------1330------1340------1350------1360------1370------1380------1390------1400------1410------1420------1430------1440------1450------1460------1470------1480------1490------1500------1510------1520------1530------1540------1550---

MGNKIAKTTQASATEYYLHDLPSSYNLVLKEVLGGSRFFKSILCKHDEGLVLVKVYFKRGDYIDLREYERRLFHIRETFRSIDHPHVWAFQFWQETDKAAYLLRQYFFNSLRDRLSTPPFLSLVEKKWLAFQLLLAVKQCHEKGICHGDIKCENVLVTSWNWLYLSDFASFKPTYIPYDDPSDFSFFFDTGGKRLCYLAPERFYEHGGEMQVAQDAPLKPSMDIFAVGCVIAELFLEVPFFELSHLLAYRRGQYDPSQHLEKIPDSGIRKMILHMIQLEPELRFSAESYLQNYAAVVFPTYFSPFLHNFYCCWNPLHSDMRVAMCRSVFPEILKQMMGNKSSEDIGSGVGTPSTAMSVKESQERVTKQNLNLAKALLEKREEMEKGRVQNRFRLLGDISTLIGDGKESNQCSNVKPMPEDVPNSTFSQDLRNSSVESSGELLQSISDAFRKNGHPFLKKITMNNLSSLMSEYDSQSDTFGMPFLPLPEDSMKCEGIVLIASLLCSCVRNVKLPHYRRAAILLLKSSSLFIDDEDRLQRVLPHVIAMLSDPAAIVRCAALETLCDILPLVRNFPPSDAKIFPEYILPMLSMLPDDPEESVRICYASNIAKLALTAYGFLVHSIRLSEAGVLDKLSAPHKSPSSSNETSVQLQRLNADVQLSQLRKSIAEVVQELVMGPKQTPSIRRALLQDIGNLCSFFGQRQSNDFLLPILPAFLNDRDEQLRAVFYGQIVYVCFFVGERSVEEYLLPYIEQALSDATEAVIVNALDCLAILCKSGYLRKRILLEMIERAFPLLCYPSQWVRRSVVTFIAASSESLGAVDSYVFLAPVIRPFLRRQPASLASVKALLSCLKPPVSREVFYQVLENARSSDMLERQRKIWYNTSSQSKQQETADLLKRGAEDLSSIKCWPDKQQSSEGHRPAGDTSKQPEFAQSDDNDGAKLRTLGSLVYNASSMADIRDPLCPEKLLFSGFMSQQVSGVNSLRCDKSSEGIPLYSFSMDKRAMGNLPVASDSVLQVNSLGIGSSTMPWMDTTNQSFSLASSVPPPNLVSGSFSISNGSKQFYRVVHEPEGRENDQMASVNCKFPEMGTSGTAKGSSINVEDASSPADLTGLPSFVRTSSIPDSGWRPRGILVAHLQEHCSAVNEIAISHDHSFFVSASDDSTVKVWDSRKLEKDISFRSRLTYHLEGSRALCTMMLRHSAQVVVGACDGIIHMFSVDHISRGLGNVEKYSGISDIKKKDTKEGAIVTLVNYNTDNCASHMFMYSTQNCGIHLWDTRSNSNTWTLKAIPEEGYVSSLVTGPCGNWFVSGSSRGVLTLWDLRFLVPVNSWQYSQVCPIEKMCLFVPPPNAAVSTTARPLIYVAAGCNEVSLWNAENGSCHQVLRTANYDGDTEMSDLPWAFARPSSRSNPKTDLRRNVNQKYRVDELNEPPPRLLGIRSLLPLPGGDLLTGGTDLKIRRWDHCSPGRSYCICGPNLKGVGNDEFYETRSSSGVQVVQERKRQPLTSKLTAKAVLAAAATDSAGCHRDSILSLGSVKLNQRLLISSSRDGAIKVWK

ccccccccccccccccccccccccccEEEEEEEEcccEEEEEEEEEcccEEEEEEEEEccccccHHHHHHHHHHHHHHHcccccccEEcEEEEEEEccEEEEEEEcccccccHHHcccccccHHHHHHHHHHHHHHHHHHHHccccccccccccEEEcccccEEEEEccccccccccccccccccccEEcccccccccccccccccccccccccccccccccEEEcHHHHHHHHHcccccccccHHHHHHcccccccccccccccHHHHHHHHHHHHccccccccHHHHHHHHHHcccccccccccHHcccccccccccHHHHHccccHHHHHHHHccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEHHHHHcccccccHHHHHHHHHHHHHHccccccHHHHHcccHHHHHccccccHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccHHHHHcccHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHcHHHHHHHccccccccccccccccccccccHHHHHHHHHcccEEEEEEccccHHHcHHHHHHHHcccccHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHcccccccEEEEEEcccHHHcccccccccHHHHHHcccccccHHHHHHHHHHHcccHHHHHHHHHHHccccccHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEcccccccccEEEEcccccEEEEEcccccEEEEcccccccccccccccEEccccccEEEEEEEEcccEEEEEEccccEEEEEEEEccccccccccccccccccccccccccEEEEEEEccccccccEEEEEEcccEEEEEEccccccccccccccccccEEEEEEcccccEEEEEEcccEEEEEEccccccccEEEEcccccEEEEEEcccccccccccccccEEEEEccccEEEEEEcccccEEEEEEccccccccccccccccccccccccccccHHHHccccccccccccccccccccEEEEcccccccEEEcccccEEEEEEcccccccEEEEcccccccccccEEEEEEccccEEEEEEEcccccccccHHHHHHHHHccccccccccccEEEEEEccccEEEEEEcccEEEEcc

cccccccccccccHHHHHHccccHccEEEEEEcccccEEEEEEEEcccccEEEEEEEEccccccHHHHHHHHHHHHHHHHHccccccccHEEEEcccHHHHHHHHHHHHcHHHHHccccccHHHHHHHHHHHHHHHHHHHHHcccEcccccccEEEEEcccEEEEEccccccccEcccccccccccEEccccccccEcccHEEccccccccccccccccccccHHHHHHHHHHHHcccccccHHHHHHHHcccccccccccccccHHHHHHHHHHHHccHHHcccHHHHHHHHHccccHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccHHHcccHHHHHHHHHHHccccccHHHHHHHHHHHHHHHccHHcHccccccccccccccccccHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHcHHHHHHHHccccccHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHcccHHcHHHEEHHcccHHcccccccHcHHHHHHHHccccccHHHHHHHHHcccccHHHHHHHccccccccccccccHHHccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEcccccccccccccccccccccccccHHHHHHHccccccccHHHHcccccccccccccccccccEEEEEEccccccEEEEEEcccccEEEEEccccEEEEEEcHHHccccccccccEEcccccEEEEEEEEcccEEEEEEEcccEEEEEEEEEcccccccccccccEEEEEccccccccEEEEEEEccccccccEEEEEEcccEEEEEEccccccEEEEccccccccEEEEEEcccccEEEEEccccEEEEEEEEEEEEEccccccccccEEEEEEccccccEEEEccccEEEEEEccccEEEEEEcccccEEEEEEEcccccccccccccccccccccccccccccccccccHccHcccccccccEEEEEEEccccccEEEEcccccEEEEEEcccccccEEEEccccccccccccEccccccccEEEEEEccccccccccccccccccccccccccccHHHHHHHEcccccEEEEEccccEEEEEc

MGNKIAKTTQASAteyylhdlpssyNLVLKEVLGGSRFFKSILCKHDEGLVLVKVYFKRGDYIDLREYERRLFHIRETfrsidhphvwafQFWQETDKAAYLLRQYFFNSlrdrlstppflSLVEKKWLAFQLLLAVKQCHekgichgdikcenVLVTSWNwlylsdfasfkptyipyddpsdfsfffdtggkrlcylaperfyehggemqvaqdaplkpsmdIFAVGCVIAELFLEVPFFELSHLLAyrrgqydpsqhlekipdsGIRKMILHMIQLEPELRFSAESYLQNYAAVvfptyfspflhnfyccwnplhsDMRVAMCRSVFPEILKQMmgnkssedigsgvgtpstamsVKESQERVTKQNLNLAKALLEKREEMEKGRVQNRFRLLGDIStligdgkesnqcsnvkpmpedvpnstfsqdlrnssveSSGELLQSISDAFRKNGHPFLKKITMNNLSSLMSeydsqsdtfgmpflplpedsmkcEGIVLIASLLCSCvrnvklphYRRAAILLLKssslfiddedRLQRVLPHVIAMLSDPAAIVRCAALETLCdilplvrnfppsdakifpeyilpmlsmlpddpeesvRICYASNIAKLALTAYGFLVHSIRLseagvldklsaphkspsssnetSVQLQRLNADVQLSQLRKSIAEVVQELvmgpkqtpSIRRALLQDIGNLCSffgqrqsndfllpilpaflnDRDEQLRAVFYGQIVYVCFFVGERSVEEYLLPYIEQALSDATEAVIVNALDCLAILCKSGYLRKRILLEMIERAfpllcypsqwvRRSVVTFIAASSeslgavdsyvflapvirpflrrqpASLASVKALLsclkppvsrEVFYQVLENARSSDMLERQRKIWYNTSSQSKQQETADLLKRGaedlssikcwpdkqqsseghrpagdtskqpefaqsddndgakLRTLGSLVynassmadirdplcpekllfsgfmsqqvsgvnslrcdkssegiplysfsmdkramgnlpvasdSVLQVNslgigsstmpwmdttnqsfslassvpppnlvsgsfsisngsKQFYRVvhepegrendqmasvnckfpemgtsgtakgssinvedasspadltglpsfvrtssipdsgwrprGILVAHLQEHCSAVNEIaishdhsffvsasddstvkvwdsrklekdiSFRSRLTYHLEGSRALCTMMLRHSAQVVVGACDGIIHMFSVDHIsrglgnvekysgisdikkkdtkegAIVTLVNyntdncashMFMYStqncgihlwdtrsnsntwtlkaipeegyvsslvtgpcgnwfvsgssrgvltlwdlrflvpvnswqysqvcpiekmclfvpppnaavsttarPLIYVAAGCNEvslwnaengschQVLRTanydgdtemsdlpwafarpssrsnpktdlrrnvnqkyrvdelneppprllgirsllplpggdlltggtdlkirrwdhcspgrsycicgpnlkgvgndefyetrsssgvqvvqerkrqpltsKLTAKAVLAAAAtdsagchrdsilsLGSVKLNQRLLISSSRDGAIKVWK

MGNKIAKTTQASATEYYLHDLPSSYNLVLKEVLGGSRFFKSILCkhdeglvlvkvyfkrgdyidlrEYERRLFHIRETFRSIDHPHVWAFQFWQETDKAAYLLRQYFFNSLRDRLSTPPFLSLVEKKWLAFQLLLAVKQCHEKGICHGDIKCENVLVTSWNWLYLSDFASFKPTYIPYDDPSDFSFFFDTGGKRLCYLAPERFYEHGGEMQVAQDAPLKPSMDIFAVGCVIAELFLEVPFFELSHLLAYRRGQYDPSQHLEKIPDSGIRKMILHMIQLEPELRFSAESYLQNYAAVVFPTYFSPFLHNFYCCWNPLHSDMRVAMCRSVFPEILKQMMGNKSSEDIGSGVGTPSTAMSVKESQERVTKQNLNLAKALlekreemekgrvqnrfrLLGDISTLIGDGKESNQCSNVKPMPEDVPNSTFSQDLRNSSVESSGELLQSISDAFRKNGHPFLKKITMNNLSSLMSEYDSQSDTFGMPFLPLPEDSMKCEGIVLIASLLCSCVRNVKLPHYRRAAILLLKSSSLFIDDEDRLQRVLPHVIAMLSDPAAIVRCAALETLCDILPLVRNFPPSDAKIFPEYILPMLSMLPDDPEESVRICYASNIAKLALTAYGFLVHSIRLSEAGVLDKLsaphkspsssnetsVQLQRLNADVQLSQLRKSIAEVVQELVMGPKQTPSIRRALLQDIGNLCSFFGQRQSNDFLLPILPAFLNDRDEQLRAVFYGQIVYVCFFVGERSVEEYLLPYIEQALSDATEAVIVNALDCLAILCKSGYLRKRILLEMIERAFPLLCYPSQWVRRSVVTFIAASseslgavdSYVFLAPVIRPFLRRQPASLASVKALLSCLKPPVSREVFYQVLENarssdmleRQRKIWyntssqskqqETADLLKRGAEDLSSIKCWPDKQQSSEGHRPAGDTSKQPEFAQSDDNDGAKLRTLGSLVYNASSMADIRDPLCPEKLLFSGFMSQQVSGVNSLRCDKSSEGIPLYSFSMDKRAMGNLPVASDSVLQVNSLGIGSSTMPWMDTTNQSFSLASSVPPPNLVSGSFSISNGSKQFYRVVHEPEGRENDQMASVNCKFPEMGTSGTAKGSSINVEDASSPADLTGLPSFVRTSSIPDSGWRPRGILVAHLQEHCSAVNEIAISHDHSFfvsasddstvkvwdsrklekdisfrsrltYHLEGSRALCTMMLRHSAQVVVGACDGIIHMFSVDHISRGLGNVEKYsgisdikkkdtkegAIVTLVNYNTDNCASHMFMYSTQNCGIHLWDTRSNSNTWTLKAIPEEGYVSSLVTGPCGNWFVSGSSRGVLTLWDLRFLVPVNSWQYSQVCPIEKMCLFVPPPNAAVSTTARPLIYVAAGCNEVSLWNAENGSCHQVLRTANYDGDTEMSDLPWafarpssrsnpktdlrrnvnqkyrvdelneppprLLGIRSLLPLPGGDLLTGGTDLKIRRWDHCSPGRSYCICGPNLKGVGNDEFYETrsssgvqvvqerkrqpltskLTAKAVLAAAATDSAGCHRDSILslgsvklnqrllisssrdgaikvwk

MGNKIAKTTQASATEYYLHDLPSSYNLVLKEVLGGSRFFKSILCKHDEGLVLVKVYFKRGDYIDLREYERRLFHIRETFRSIDHPHVWAFQFWQETDKAAYLLRQYFFNSLRDRLSTPPFLSLVEKKWLAFQLLLAVKQCHEKGICHGDIKCENVLVTSWNWLYLSDFASFKPTYIPYddpsdfsfffdTGGKRLCYLAPERFYEHGGEMQVAQDAPLKPSMDIFAVGCVIAELFLEVPFFELSHLLAYRRGQYDPSQHLEKIPDSGIRKMILHMIQLEPELRFSAESYLQNYAAVVFPTYFSPFLHNFYCCWNPLHSDMRVAMCRSVFPEILKQMMGNKSSEDIGSGVGTPSTAMSVKESQERVTKQNLNLAKALLEKREEMEKGRVQNRFRLLGDISTLIGDGKESNQCSNVKPMPEDVPNSTFSQDLRNSSVESSGELLQSISDAFRKNGHPFLKKITMNNLSSLMSEYDSQSDTFGMPFLPLPEDSMKCEGIVLIASLLCSCVRNVKLPHYRRAAILLLKSSSLFIDDEDRLQRVLPHVIAMLSDPAAIVRCAALETLCDILPLVRNFPPSDAKIFPEYILPMLSMLPDDPEESVRICYASNIAKLALTAYGFLVHSIRLSEAGVLDKLSAPHKSPSSSNETSVQLQRLNADVQLSQLRKSIAEVVQELVMGPKQTPSIRRALLQDIGNLCSFFGQRQSNDFLLPILPAFLNDRDEQLRAVFYGQIVYVCFFVGERSVEEYLLPYIEQALSDATEAVIVNALDCLAILCKSGYLRKRILLEMIERAFPLLCYPSQWVRRSVVTFIAASSESLGAVDSYVFLAPVIRPFLRRQPASLASVKALLSCLKPPVSREVFYQVLENARSSDMLERQRKIWYNTSSQSKQQETADLLKRGAEDLSSIKCWPDKQQSSEGHRPAGDTSKQPEFAQSDDNDGAKLRTLGSLVYNASSMADIRDPLCPEKLLFSGFMSQQVSGVNSLRCDKSSEGIPLYSFSMDKRAMGNLPVASDSVLQVNSLGIGSSTMPWMDTTNQSFSLASSVPPPNLVSGSFSISNGSKQFYRVVHEPEGRENDQMASVNCKFPEMGTSGTAKGSSINVEDASSPADLTGLPSFVRTSSIPDSGWRPRGILVAHLQEHCSAVNEIAISHDHSFFVSASDDSTVKVWDSRKLEKDISFRSRLTYHLEGSRALCTMMLRHSAQVVVGACDGIIHMFSVDHISRGLGNVEKYSGISDIKKKDTKEGAIVTLVNYNTDNCASHMFMYSTQNCGIHLWDTRSNSNTWTLKAIPEEGYVSSLVTGPCGNWFVSGSSRGVLTLWDLRFLVPVNSWQYSQVCPIEKMCLFVPPPNAAVSTTARPLIYVAAGCNEVSLWNAENGSCHQVLRTANYDGDTEMSDLPWAFARPSSRSNPKTDLRRNVNQKYRVDELNEPPPRLLGIRSllplpggdlltggtdlKIRRWDHCSPGRSYCICGPNLKGVGNDEFYETRSSSGVQVVQERKRQPltskltakavlaaaatdsaGCHRDSILSLGSVKLNQRLLISSSRDGAIKVWK

*************TEYYLHDLPSSYNLVLKEVLGGSRFFKSILCKHDEGLVLVKVYFKRGDYIDLREYERRLFHIRETFRSIDHPHVWAFQFWQETDKAAYLLRQYFFNSLRDRLSTPPFLSLVEKKWLAFQLLLAVKQCHEKGICHGDIKCENVLVTSWNWLYLSDFASFKPTYIPYDDPSDFSFFFDTGGKRLCYLAPERFYEHGGEMQVAQDAPLKPSMDIFAVGCVIAELFLEVPFFELSHLLAYRRGQYDPSQHLEKIPDSGIRKMILHMIQLEPELRFSAESYLQNYAAVVFPTYFSPFLHNFYCCWNPLHSDMRVAMCRSVFPEILK********************************************************RFRLLGDISTLI****************************************************************************FGMPFLPLPEDSMKCEGIVLIASLLCSCVRNVKLPHYRRAAILLLKSSSLFIDDEDRLQRVLPHVIAMLSDPAAIVRCAALETLCDILPLVRNFPPSDAKIFPEYILPMLSMLPDDPEESVRICYASNIAKLALTAYGFLVHSIRLSEAGVL*********************************KSIAEVVQELVMGPKQTPSIRRALLQDIGNLCSFFGQRQSNDFLLPILPAFLNDRDEQLRAVFYGQIVYVCFFVGERSVEEYLLPYIEQALSDATEAVIVNALDCLAILCKSGYLRKRILLEMIERAFPLLCYPSQWVRRSVVTFIAASSESLGAVDSYVFLAPVIRPFLRRQPASLASVKALLSCLKPPVSREVFYQVLENA***********IWY**************************************************************TLGSLVYNASSMADIRDPLCPEKLLFSGFMSQQVSGVNSLRC******IPLYSFS***************VLQVNSLGI****************************************************************************************************DSGWRPRGILVAHLQEHCSAVNEIAISHDHSFFVSASDDSTVKVWDSRKLEKDISFRSRLTYHLEGSRALCTMMLRHSAQVVVGACDGIIHMFSVDHISRGLGNVEKYSGISDIKKKDTKEGAIVTLVNYNTDNCASHMFMYSTQNCGIHLWDTRSNSNTWTLKAIPEEGYVSSLVTGPCGNWFVSGSSRGVLTLWDLRFLVPVNSWQYSQVCPIEKMCLFVPPPNAAVSTTARPLIYVAAGCNEVSLWNAENGSCHQVLRTANYDGDT****LPWA*********************************LLGIRSLLPLPGGDLLTGGTDLKIRRWDHCSPGRSYCICGPNLKGVGNDEFY************************AKAVLAAAATDSAGCHRDSILSLGSVKLNQRLLI************

********************LPSSYNLVLKEVLGGSRFFKSILCKHDEGLVLVKVYFKRGD**********LFHIRETFRSIDHPHVWAFQFWQETDKAAYLLRQYFFNSLRDRLSTPPFLSLVEKKWLAFQLLLAVKQCHEKGICHGDIKCENVLVTSWNWLYLSDFASFKPTYIPYDDPSDFSFFFDTGGKRLCYLAPERFYEH**********PLKPSMDIFAVGCVIAELFLEVPFFELSHLLAYRRGQYDPSQHLEKIPDSGIRKMILHMIQLEPELRFSAESYLQNYAAVVFPTYFSPFLHNFYCCWNPLHSDMRVAMCRSVFPEIL*****************************************************************************************************************************************************FLPLPEDSMKCEGIVLIASLLCSCVRNVKLPHYRRAAILLLKSSSLFIDDEDRLQRVLPHVIAMLSDPAAIVRCAALETLCDILPLVRNFPPSDAKIFPEYILPMLSMLPDDPEESVRICYASNIAKLALTAYGFLVHSIRLS****************************NADVQLSQLRKSIAEVVQELVMGPKQTPSIRRALLQDIGNLCSFFGQRQSNDFLLPILPAFLNDRDEQLRAVFYGQIVYVCFFVGERSVEEYLLPYIEQALSDATEAVIVNALDCLAILCKSGYLRKRILLEMIERAFPLLCYPSQWVRRSVVTFIAASSESLGAVDSYVFLAPVIRPFLRRQPASLASVKALLSCLKPPVSREVFYQVLENARSSD*************************************************************************L*****************************************************************************************************************************************************************************************************V**IAISHDHSFFVSASDDSTVKVWD********************SRALCTMMLRHSAQVVVGACDGIIHMFSVD*********************DTKEGAIVTLVNYNTDNCASHMFMYSTQNCGIHLWDTRSNSNTWTLKAIPEEGYVSSLVTGPCGNWFVSGSSRGVLTLWDLRFLVPVNSWQYSQVCPIEKMCLFVPPPNAAVSTTARPLIYVAAGCNEVSLWNAENGSCHQVLRTANYD**************************RNVNQ***************GIRSLLPLPGGDLLTGGTDLKIRRWDHCSPGRSYCI****************RSSSGVQV********************************SILSLGSVKLNQRLLISSSRDGAIKVWK

*********QASATEYYLHDLPSSYNLVLKEVLGGSRFFKSILCKHDEGLVLVKVYFKRGDYIDLREYERRLFHIRETFRSIDHPHVWAFQFWQETDKAAYLLRQYFFNSLRDRLSTPPFLSLVEKKWLAFQLLLAVKQCHEKGICHGDIKCENVLVTSWNWLYLSDFASFKPTYIPYDDPSDFSFFFDTGGKRLCYLAPERFYEHGGEMQVAQDAPLKPSMDIFAVGCVIAELFLEVPFFELSHLLAYRRGQYDPSQHLEKIPDSGIRKMILHMIQLEPELRFSAESYLQNYAAVVFPTYFSPFLHNFYCCWNPLHSDMRVAMCRSVFPEILKQMMGN**************************TKQNLNLAKALLEKREEMEKGRVQNRFRLLGDISTLIGDGKESNQCSNVKPMPEDVPNSTFSQ************LLQSISDAFRKNGHPFLKKITMNNLSSLMSEYDSQSDTFGMPFLPLPEDSMKCEGIVLIASLLCSCVRNVKLPHYRRAAILLLKSSSLFIDDEDRLQRVLPHVIAMLSDPAAIVRCAALETLCDILPLVRNFPPSDAKIFPEYILPMLSMLPDDPEESVRICYASNIAKLALTAYGFLVHSIRLSEAGVLDK*****************LQRLNADVQLSQLRKSIAEVVQELVMGPKQTPSIRRALLQDIGNLCSFFGQRQSNDFLLPILPAFLNDRDEQLRAVFYGQIVYVCFFVGERSVEEYLLPYIEQALSDATEAVIVNALDCLAILCKSGYLRKRILLEMIERAFPLLCYPSQWVRRSVVTFIAASSESLGAVDSYVFLAPVIRPFLRRQPASLASVKALLSCLKPPVSREVFYQVLENARSSDMLERQRKIWYNTS*********DLLKRGAEDLSSIKCWP**********************QSDDNDGAKLRTLGSLVYNASSMADIRDPLCPEKLLFSGFMSQQVSGVNSLRCDKSSEGIPLYSFSMDKRAMGNLPVASDSVLQVNSLGIGSSTMPWMDTTNQSFSLASSVPPPNLVSGSFSISNGSKQFYRVVHEPEGRENDQMASVNCKFPEMGTSGTAKGSSINVEDASSPADLTGLPSFVRTSSIPDSGWRPRGILVAHLQEHCSAVNEIAISHDHSFFVSASDDSTVKVWDSRKLEKDISFRSRLTYHLEGSRALCTMMLRHSAQVVVGACDGIIHMFSVDHISRGLGNVEKYSGISDIKKKDTKEGAIVTLVNYNTDNCASHMFMYSTQNCGIHLWDTRSNSNTWTLKAIPEEGYVSSLVTGPCGNWFVSGSSRGVLTLWDLRFLVPVNSWQYSQVCPIEKMCLFVPPPNAAVSTTARPLIYVAAGCNEVSLWNAENGSCHQVLRTANYDGDTEMSDLPWAFAR*********DLRRNVNQKYRVDELNEPPPRLLGIRSLLPLPGGDLLTGGTDLKIRRWDHCSPGRSYCICGPNLKGVGNDEFYE**************RQPLTSKLTAKAVLAAAATDSAGCHRDSILSLGSVKLNQRLLISSSRDGAIKVWK

******KTTQASATEYYLHDLPSSYNLVLKEVLGGSRFFKSILCKHDEGLVLVKVYFKRGDYIDLREYERRLFHIRETFRSIDHPHVWAFQFWQETDKAAYLLRQYFFNSLRDRLSTPPFLSLVEKKWLAFQLLLAVKQCHEKGICHGDIKCENVLVTSWNWLYLSDFASFKPTYIPYDDPSDFSFFFDTGGKRLCYLAPERFYEHGG******DAPLKPSMDIFAVGCVIAELFLEVPFFELSHLLAYRRGQYDPSQHLEKIPDSGIRKMILHMIQLEPELRFSAESYLQNYAAVVFPTYFSPFLHNFYCCWNPLHSDMRVAMCRSVFPEILKQMMGNKSSEDIGSGVGTPSTAMSVKESQERVTKQNLNLAKALLEKREEMEKGRVQNRFRLLGDISTLIGDGKESNQCSNVKPMPEDVPNSTFSQDLRNSSVESSGELLQSISDAFRKNGHPFLKKITMNNLSSLMSEYDSQSDTFGMPFLPLPEDSMKCEGIVLIASLLCSCVRNVKLPHYRRAAILLLKSSSLFIDDEDRLQRVLPHVIAMLSDPAAIVRCAALETLCDILPLVRNFPPSDAKIFPEYILPMLSMLPDDPEESVRICYASNIAKLALTAYGFLVHSIRLSEAGVLDKLSAPHKSPSSSNETSVQLQRLNADVQLSQLRKSIAEVVQELVMGPKQTPSIRRALLQDIGNLCSFFGQRQSNDFLLPILPAFLNDRDEQLRAVFYGQIVYVCFFVGERSVEEYLLPYIEQALSDATEAVIVNALDCLAILCKSGYLRKRILLEMIERAFPLLCYPSQWVRRSVVTFIAASSESLGAVDSYVFLAPVIRPFLRRQPASLASVKALLSCLKPPVSREVFYQVLENARSSDMLERQRKIWYNTSSQSKQQETADLLK********************************EFAQSDDNDGAKLRTLGSLVYNASSMADIRDPLCPEKLLFS*********************************************************************************************R***EPEGRENDQMASVNCKFPEMGTSGTAKGSSINVEDASSPADLTGLPSFVRTSSIPDSGWRPRGILVAHLQEHCSAVNEIAISHDHSFFVSASDDSTVKVWDSRKLEKDISFRSRLTYHLEGSRALCTMMLRHSAQVVVGACDGIIHMFSVDHISRGLGNVEKYSGISDIKKKDTKEGAIVTLVNYNTDNCASHMFMYSTQNCGIHLWDTRSNSNTWTLKAIPEEGYVSSLVTGPCGNWFVSGSSRGVLTLWDLRFLVPVNSWQYSQVCPIEKMCLFVPPPNAAVSTTARPLIYVAAGCNEVSLWNAENGSCHQVLRTANYDGDTEMSDLPWAFA**********DLRRNVNQKYRVDELNEPPPRLLGIRSLLPLPGGDLLTGGTDLKIRRWDHCSPGRSYCICGPNLKGVGNDEFYETRSSSGVQVVQERKR**********************CHRDSILSLGSVKLNQRLLISSSRDGAIKVWK

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		1553	2.2.26 [Sep-21-2011]
Q54S77		1966	Probable serine/threonine	yes	no	0.211	0.167	0.467	3e-81
Q99570		1358	Phosphoinositide 3-kinase	yes	no	0.218	0.250	0.416	2e-74
Q5R9I3		1358	Phosphoinositide 3-kinase	yes	no	0.216	0.247	0.415	1e-73
Q8VD65		1358	Phosphoinositide 3-kinase	yes	no	0.218	0.250	0.419	1e-72
P0C0R5		1358	Phosphoinositide 3-kinase	yes	no	0.218	0.250	0.416	5e-72
O42900		1706	Serine/threonine-protein	yes	no	0.194	0.177	0.436	3e-66
Q9UVG6		1340	Putative serine/threonine	yes	no	0.191	0.222	0.428	8e-65
P22219		1454	Serine/threonine-protein	yes	no	0.194	0.207	0.412	2e-62
Q63450		374	Calcium/calmodulin-depend	no	no	0.154	0.641	0.278	4e-10
Q91YS8		374	Calcium/calmodulin-depend	no	no	0.154	0.641	0.278	4e-10

>sp\|Q54S77\|VPS15_DICDI Probable serine/threonine-protein kinase vps15 OS=Dictyostelium discoideum GN=vps15 PE=3 SV=1	Back alignment and function desciption

 Score =  304 bits (779), Expect = 3e-81,   Method: Compositional matrix adjust.
 Identities = 160/342 (46%), Positives = 218/342 (63%), Gaps = 13/342 (3%)

Query: 1   MGNKIAKTTQASATEYYLHDLPSSYNLVLKEVLGGSRFFKSILCKH-DEGLVLVKVYFKR 59
           MGN +     A     YL D      +V K+ LG +RF K++   H +EG V+VK+Y KR
Sbjct: 1   MGNTVG----APIVSEYLEDEIGP--IVFKKSLGNARFLKTVKAYHSEEGYVVVKIYKKR 54

Query: 60  GDYIDLREYERRLFHIRETFRSIDHPHVWAFQFWQETDKAAYLLRQYFFNSLRDRLSTPP 119
                L +Y+  L  I++ F      ++  +Q + ETD++ YL+RQYF N+L DRLST P
Sbjct: 55  NTKESLEKYKIMLKEIKDNFNITPSFNIMPYQHFIETDRSGYLIRQYFHNNLYDRLSTRP 114

Query: 120 FLSLVEKKWLAFQLLLAVKQCHEKGICHGDIKCENVLVTSWNWLYLSDFASFKPTYIPYD 179
           FLS++EKK++AFQLL A++Q   KG+ HGDIK ENVLVT+ NW+YLSDFA +KPT+IP D
Sbjct: 115 FLSMIEKKFIAFQLLKALEQSSFKGVFHGDIKSENVLVTTSNWVYLSDFACYKPTFIPED 174

Query: 180 DPSDFSFFFDTGGKRLCYLAPERFYEHGGEMQVAQDAPLKPSMDIFAVGCVIAELFLE-V 238
           +P+DFSF+FDT G+R CY+APERFYE         +  L P MDIF++GCVIAELFL+  
Sbjct: 175 NPADFSFYFDTSGRRTCYIAPERFYETN--RGAPSNNELTPKMDIFSLGCVIAELFLDGF 232

Query: 239 PFFELSHLLAYRRGQYDPSQHL-EKIPDSGIRKMILHMIQLEPELRFSAESYLQNYAAVV 297
           P F+ S LL+YR+G+Y P   + ++I D  I+ +ILHMIQ +P+ R++ E Y+  +   V
Sbjct: 233 PIFDFSQLLSYRKGEYSPEPIIRQRIQDPNIQTLILHMIQKDPDQRYTPEKYISKWNT-V 291

Query: 298 FPTYFSPFLHNFYCCWNPLHSDMRVAMCRSVFPEILKQMMGN 339
           FP YFS F H F      L +D RV      F EI+     N
Sbjct: 292 FPQYFS-FAHQFIPELMRLENDDRVMCISDKFDEIVDIFKNN 332

Dictyostelium discoideum (taxid: 44689)
EC: 2EC: .EC: 7EC: .EC: 1EC: 1EC: .EC: 1

>sp\|Q99570\|PI3R4_HUMAN Phosphoinositide 3-kinase regulatory subunit 4 OS=Homo sapiens GN=PIK3R4 PE=1 SV=3	Back alignment and function description

>sp\|Q5R9I3\|PI3R4_PONAB Phosphoinositide 3-kinase regulatory subunit 4 OS=Pongo abelii GN=PIK3R4 PE=2 SV=3	Back alignment and function description

>sp\|Q8VD65\|PI3R4_MOUSE Phosphoinositide 3-kinase regulatory subunit 4 OS=Mus musculus GN=Pik3r4 PE=1 SV=3	Back alignment and function description

>sp\|P0C0R5\|PI3R4_RAT Phosphoinositide 3-kinase regulatory subunit 4 OS=Rattus norvegicus GN=Pik3r4 PE=2 SV=2	Back alignment and function description

>sp\|O42900\|PPK19_SCHPO Serine/threonine-protein kinase ppk19 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppk19 PE=1 SV=1	Back alignment and function description

>sp\|Q9UVG6\|VPS15_PICPA Putative serine/threonine-protein kinase VPS15 OS=Komagataella pastoris GN=VPS15 PE=3 SV=3	Back alignment and function description

>sp\|P22219\|VPS15_YEAST Serine/threonine-protein kinase VPS15 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VPS15 PE=1 SV=4	Back alignment and function description

>sp\|Q63450\|KCC1A_RAT Calcium/calmodulin-dependent protein kinase type 1 OS=Rattus norvegicus GN=Camk1 PE=1 SV=2	Back alignment and function description

>sp\|Q91YS8\|KCC1A_MOUSE Calcium/calmodulin-dependent protein kinase type 1 OS=Mus musculus GN=Camk1 PE=1 SV=1	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		1553
359484532		1455	PREDICTED: phosphoinositide 3-kinase reg	0.935	0.998	0.764	0.0
255546297		1455	ATP binding protein, putative [Ricinus c	0.935	0.998	0.756	0.0
356497575		1521	PREDICTED: phosphoinositide 3-kinase reg	0.976	0.997	0.753	0.0
356520822		1488	PREDICTED: phosphoinositide 3-kinase reg	0.956	0.998	0.746	0.0
449435788		1445	PREDICTED: phosphoinositide 3-kinase reg	0.929	0.998	0.721	0.0
449489804		1445	PREDICTED: LOW QUALITY PROTEIN: phosphoi	0.929	0.998	0.720	0.0
297803098		1494	kinase family protein [Arabidopsis lyrat	0.960	0.998	0.705	0.0
15233564		1494	phosphoinositide-3-kinase, regulatory su	0.960	0.998	0.709	0.0
224088049		1209	predicted protein [Populus trichocarpa]	0.777	0.999	0.755	0.0
357137425		1450	PREDICTED: phosphoinositide 3-kinase reg	0.925	0.991	0.540	0.0

>gi\|359484532\|ref\|XP_002280317.2\| PREDICTED: phosphoinositide 3-kinase regulatory subunit 4-like [Vitis vinifera]	Back alignment and taxonomy information

 Score = 2381 bits (6170), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1189/1555 (76%), Positives = 1300/1555 (83%), Gaps = 102/1555 (6%)

Query: 1    MGNKIAKTTQASATEYYLHDLPSSYNLVLKEVLGGSRFFKSILCKHDEGLVLVKVYFKRG 60
            MGNKIA+TTQASA+EYYLHDLPSSYNLVLKEVLG  RFFKSI CKHDEGLVLVKVYFKRG
Sbjct: 1    MGNKIARTTQASASEYYLHDLPSSYNLVLKEVLGRGRFFKSIQCKHDEGLVLVKVYFKRG 60

Query: 61   DYIDLREYERRLFHIRETFRSIDHPHVWAFQFWQETDKAAYLLRQYFFNSLRDRLSTPPF 120
            D IDLREYERRLF I+  FR++DHPHVW FQFW ETDKAAYLLRQYFFN+L DRLST PF
Sbjct: 61   DSIDLREYERRLFQIQGIFRALDHPHVWPFQFWIETDKAAYLLRQYFFNNLHDRLSTRPF 120

Query: 121  LSLVEKKWLAFQLLLAVKQCHEKGICHGDIKCENVLVTSWNWLYLSDFASFKPTYIPYDD 180
            LSL+EKKWLAFQLL AVKQ HE G+CHGDIKCENVLVTSWNWLYL+DFASFKPTYIP DD
Sbjct: 121  LSLIEKKWLAFQLLCAVKQSHENGVCHGDIKCENVLVTSWNWLYLADFASFKPTYIPDDD 180

Query: 181  PSDFSFFFDTGGKRLCYLAPERFYEHGGEMQVAQDAPLKPSMDIFAVGCVIAELFLE-VP 239
            PSDFSFFFDTGG+RLCYLAPERFYE GGEMQVAQ APL+PSMDIFAVGCV+AELFLE  P
Sbjct: 181  PSDFSFFFDTGGRRLCYLAPERFYEPGGEMQVAQGAPLRPSMDIFAVGCVVAELFLEGQP 240

Query: 240  FFELSHLLAYRRGQYDPSQHLEKIPDSGIRKMILHMIQLEPELRFSAESYLQNYAAVVFP 299
             FELS LLAYRRGQYDPSQHLEKIPDSGIRKMILHMIQL+PE RFSAESYLQNYA+++FP
Sbjct: 241  LFELSQLLAYRRGQYDPSQHLEKIPDSGIRKMILHMIQLDPESRFSAESYLQNYASILFP 300

Query: 300  TYFSPFLHNFYCCWNPLHSDMRVAMCRSVFPEILKQMMGNKSSEDIGSGVGTPSTAMSVK 359
            +YFSPFLHNFY C NPL SD RVA+C+S+F EI KQMM N S+E   + + TP  A   K
Sbjct: 301  SYFSPFLHNFYSCLNPLDSDTRVAVCQSLFHEIHKQMMSNASAEVTSAELSTPLNATGCK 360

Query: 360  ESQERVTKQNLNLAKALLEKREEMEKGRVQNRFRLLGDISTLIGDGKESNQCSNVKPMPE 419
             S++ V KQ LNL K    +++E EKG + N+F LLGDI++L+ D K+SN  S VK + E
Sbjct: 361  PSKQVVAKQKLNLTKNS-SRKQENEKGLIHNQFELLGDINSLLKDVKQSNNYSGVKSVVE 419

Query: 420  DVPNSTFSQDLRNSSVESSGELLQSISDAFRKNGHPFLKKITMNNLSSLMSEYDSQSDTF 479
            D PNS+     +NS  +S G L+++IS+ F+KN +P LKKITM++L++LMSEYDSQSDTF
Sbjct: 420  DAPNSSH----QNSGKDSPGRLVETISNVFKKNDYPLLKKITMDDLNTLMSEYDSQSDTF 475

Query: 480  GMPFLPLPEDSMKCEGIVLIASLLCSCVRNVKLPHYRRAAILLLKSSSLFIDDEDRLQRV 539
            GMPFLPLP+D M CEG+VLIASLLCSC+RNVKLPH RR AILLLKS SL+IDDEDRLQRV
Sbjct: 476  GMPFLPLPQDCMSCEGMVLIASLLCSCIRNVKLPHLRRGAILLLKSCSLYIDDEDRLQRV 535

Query: 540  LPHVIAMLSDPAAIVRCAALETLCDILPLVRNFPPSDAKIFPEYILPMLSMLPDDPEESV 599
            LP+VIAMLSDP AIVRCAALETLCDILPLVR+FPPSDAKIFPEYILPMLSMLPDDPEESV
Sbjct: 536  LPYVIAMLSDPVAIVRCAALETLCDILPLVRDFPPSDAKIFPEYILPMLSMLPDDPEESV 595

Query: 600  RICYASNIAKLALTAYGFLVHSIRLSEAGVLDKLSAPHKSPSSSNETSVQLQRLNADVQL 659
            RICYA +I++LALTAYGFL+HS+ LSEAGVLD+L++  KS + S ETS +LQ+     QL
Sbjct: 596  RICYARSISRLALTAYGFLIHSLSLSEAGVLDELNSQQKSLAPSTETSGRLQK----TQL 651

Query: 660  SQLRKSIAEVVQELVMGPKQTPSIRRALLQDIGNLCSFFGQRQSNDFLLPILPAFLNDRD 719
            +QLRKSIAEVVQELVMGPKQTP+IRRALLQDIGNLC FFGQRQSNDFLLPILPAFLNDRD
Sbjct: 652  AQLRKSIAEVVQELVMGPKQTPNIRRALLQDIGNLCCFFGQRQSNDFLLPILPAFLNDRD 711

Query: 720  EQLRAVFYGQIVYVCFFVGERSVEEYLLPYIEQALSDATEAVIVNALDCLAILCKSGYLR 779
            EQLRAVFYGQIVYVCFFVG+RSVEEYLLPYIEQALSDATEAVIVNALDCLA+LCKSG+LR
Sbjct: 712  EQLRAVFYGQIVYVCFFVGQRSVEEYLLPYIEQALSDATEAVIVNALDCLAVLCKSGFLR 771

Query: 780  KRILLEMIERAFPLLCYPSQWVRRSVVTFIAASSESLGAVDSYVFLAPVIRPFLRRQPAS 839
            KRILLEMI  AFPLLCYPSQWVRRS VTFIAASSE+LGAVDSYVFLAPVIRPFLRRQPAS
Sbjct: 772  KRILLEMIAHAFPLLCYPSQWVRRSAVTFIAASSENLGAVDSYVFLAPVIRPFLRRQPAS 831

Query: 840  LASVKALLSCLKPPVSREVFYQVLENARSSDMLERQRKIWYNTSSQSKQQETADLLKRGA 899
            LAS KALLSCLKPPVSR+VFY+VLENARSSDMLERQRKIWYN+S Q KQ ET DL +RGA
Sbjct: 832  LASEKALLSCLKPPVSRQVFYEVLENARSSDMLERQRKIWYNSSVQPKQWETVDLHRRGA 891

Query: 900  EDLSSIKCWPDKQQSSEGHRPAGDTSKQPEFAQSDDNDGAKLRTLGSLVYNASSMADIRD 959
            E+L+ +K  PD Q++ E                                           
Sbjct: 892  EELNLMKSLPDGQRALE------------------------------------------- 908

Query: 960  PLCPEKLLFSGFMSQQVSGVNSLRCDKSSEGIPLYSFSMDKRAMGNLPVASDSVLQVNSL 1019
                  L FSGFM+ Q+ GVNS  CDKSSEGIPLYSFSMDKRA G  P ASDS LQ+NSL
Sbjct: 909  ------LQFSGFMTPQIGGVNSFICDKSSEGIPLYSFSMDKRAAGVPPAASDSSLQLNSL 962

Query: 1020 GIGSSTMPWMDTTNQSFSLASSVPPPNLVSGSFSISNGSKQFYRVVHEPEGRENDQMASV 1079
            G                                           VVHEPE RENDQ A V
Sbjct: 963  GT------------------------------------------VVHEPESRENDQTAYV 980

Query: 1080 NCKFPEMGTSGTAKGSSINVEDASSPADLTGLPSFVRTSSIPDSGWRPRGILVAHLQEHC 1139
            N KF +MG SGT+KGSSI VED+SS  D+TGLPSF RTSSIPD GWRPRG+LVAHLQEH 
Sbjct: 981  NSKFQDMGISGTSKGSSITVEDSSSSTDITGLPSFARTSSIPDMGWRPRGVLVAHLQEHR 1040

Query: 1140 SAVNEIAISHDHSFFVSASDDSTVKVWDSRKLEKDISFRSRLTYHLEGSRALCTMMLRHS 1199
            SAVN+IAIS DHSFFVSASDDSTVKVWDSRKLEKDISFRSRLTY LEGSRALCT MLR+S
Sbjct: 1041 SAVNDIAISTDHSFFVSASDDSTVKVWDSRKLEKDISFRSRLTYPLEGSRALCTAMLRNS 1100

Query: 1200 AQVVVGACDGIIHMFSVDHISRGLGN-VEKYSGISDIKKKDTKEGAIVTLVNYNTDNCAS 1258
            AQV+VGACDGIIHMFSVD+ISRGLGN VEKYSGI+DIKKKD  EGAI++L+NY  D   S
Sbjct: 1101 AQVIVGACDGIIHMFSVDYISRGLGNVVEKYSGIADIKKKDVGEGAILSLLNYCADGSPS 1160

Query: 1259 HMFMYSTQNCGIHLWDTRSNSNTWTLKAIPEEGYVSSLVTGPCGNWFVSGSSRGVLTLWD 1318
             M MYSTQNCGIHLWDTR+NSN WTLKAIPEEGYVSSLVTGPCGNWFVSGSSRGVLTLWD
Sbjct: 1161 QMVMYSTQNCGIHLWDTRTNSNAWTLKAIPEEGYVSSLVTGPCGNWFVSGSSRGVLTLWD 1220

Query: 1319 LRFLVPVNSWQYSQVCPIEKMCLFVPPPNAAVSTTARPLIYVAAGCNEVSLWNAENGSCH 1378
            LRFLVPVNSWQYS VCPIE++CLFVPPPNA+VST ARPLIYVAAGCNEVSLWNAENGSCH
Sbjct: 1221 LRFLVPVNSWQYSLVCPIEEICLFVPPPNASVSTMARPLIYVAAGCNEVSLWNAENGSCH 1280

Query: 1379 QVLRTANYDGDTEMSDLPWAFARPSSRSNPKTDLRRNVNQKYRVDELNEPPPRLLGIRSL 1438
            QVLR AN + D EMSDLPWA ARPSS+SN K D+RRNVN KYRVDELNEP  RL GIRSL
Sbjct: 1281 QVLRVANNESDAEMSDLPWALARPSSKSNSKPDIRRNVNPKYRVDELNEPASRLPGIRSL 1340

Query: 1439 LPLPGGDLLTGGTDLKIRRWDHCSPGRSYCICGPNLKGVGNDEFYETRSSSGVQVVQERK 1498
            LPLPGGDLLTGGTDLKIRRWDH SP RSYCICGP +KGVGND+F+ET+SS GVQVVQE K
Sbjct: 1341 LPLPGGDLLTGGTDLKIRRWDHYSPDRSYCICGPTIKGVGNDDFFETKSSFGVQVVQETK 1400

Query: 1499 RQPLTSKLTAKAVLAAAATDSAGCHRDSILSLGSVKLNQRLLISSSRDGAIKVWK 1553
            R+PL +KLT+KAVLAAAATDSAGCHRDS+LSL SVKLNQRLLISSSRDGAIKVWK
Sbjct: 1401 RRPLATKLTSKAVLAAAATDSAGCHRDSVLSLASVKLNQRLLISSSRDGAIKVWK 1455

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|255546297\|ref\|XP_002514208.1\| ATP binding protein, putative [Ricinus communis] gi\|223546664\|gb\|EEF48162.1\| ATP binding protein, putative [Ricinus communis]	Back alignment and taxonomy information

>gi\|356497575\|ref\|XP_003517635.1\| PREDICTED: phosphoinositide 3-kinase regulatory subunit 4-like [Glycine max]	Back alignment and taxonomy information

>gi\|356520822\|ref\|XP_003529059.1\| PREDICTED: phosphoinositide 3-kinase regulatory subunit 4-like [Glycine max]	Back alignment and taxonomy information

>gi\|449435788\|ref\|XP_004135676.1\| PREDICTED: phosphoinositide 3-kinase regulatory subunit 4-like [Cucumis sativus]	Back alignment and taxonomy information

>gi\|449489804\|ref\|XP_004158421.1\| PREDICTED: LOW QUALITY PROTEIN: phosphoinositide 3-kinase regulatory subunit 4-like [Cucumis sativus]	Back alignment and taxonomy information

>gi\|297803098\|ref\|XP_002869433.1\| kinase family protein [Arabidopsis lyrata subsp. lyrata] gi\|297315269\|gb\|EFH45692.1\| kinase family protein [Arabidopsis lyrata subsp. lyrata]	Back alignment and taxonomy information

>gi\|15233564\|ref\|NP_194667.1\| phosphoinositide-3-kinase, regulatory subunit 4, p150 [Arabidopsis thaliana] gi\|7269836\|emb\|CAB79696.1\| putative protein [Arabidopsis thaliana] gi\|332660224\|gb\|AEE85624.1\| phosphoinositide-3-kinase, regulatory subunit 4, p150 [Arabidopsis thaliana]	Back alignment and taxonomy information

>gi\|224088049\|ref\|XP_002308305.1\| predicted protein [Populus trichocarpa] gi\|222854281\|gb\|EEE91828.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|357137425\|ref\|XP_003570301.1\| PREDICTED: phosphoinositide 3-kinase regulatory subunit 4-like [Brachypodium distachyon]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		1553
TAIR\|locus:2118234		1494	VPS15 "vacuolar protein sortin	0.735	0.764	0.671	0.0
DICTYBASE\|DDB_G0282627		1966	vps15 "VPS15 family protein ki	0.231	0.183	0.431	1.3e-152
UNIPROTKB\|E2QZF5		1358	PIK3R4 "Uncharacterized protei	0.238	0.272	0.339	1.9e-145
ZFIN\|ZDB-GENE-050309-84		1386	pik3r4 "phosphoinositide-3-kin	0.194	0.217	0.437	1.5e-144
MGI\|MGI:1922919		1358	Pik3r4 "phosphatidylinositol 3	0.236	0.270	0.340	2.4e-144
RGD\|1311809		1358	Pik3r4 "phosphoinositide-3-kin	0.238	0.272	0.336	1.1e-143
UNIPROTKB\|Q99570		1358	PIK3R4 "Phosphoinositide 3-kin	0.238	0.272	0.336	2.2e-143
UNIPROTKB\|A6QLW1		1358	PIK3R4 "PIK3R4 protein" [Bos t	0.243	0.278	0.335	3.1e-143
UNIPROTKB\|Q5R9I3		1358	PIK3R4 "Phosphoinositide 3-kin	0.238	0.272	0.334	1.6e-141
UNIPROTKB\|I3LEJ8		1354	PIK3R4 "Uncharacterized protei	0.245	0.281	0.326	9.3e-139

TAIR\|locus:2118234 VPS15 "vacuolar protein sorting 15" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 4015 (1418.4 bits), Expect = 0., Sum P(2) = 0.
 Identities = 780/1161 (67%), Positives = 923/1161 (79%)

Query:   403 GD--GKESNQCSNVKPMPEDVPNSTF-------SQDLRNSSVESSGELLQSISDAFRKNG 453
             GD  G +S   SN  PM       TF       S+DL  ++V S  E+  SISDA +KN 
Sbjct:   343 GDEIGVDSPVTSN--PMNASTVQETFANHKLNSSKDLIRNTVNSKDEIFYSISDALKKNR 400

Query:   454 HPFLKKITMNNLSSLMSEYDSQSDTFGMPFLPLPEDSMKCEGIVLIASLLCSCVRNVKLP 513
             HPFLKKITM++L +LMS YDS+SDT+G PFLP+ E +M+CEG+VLIAS+LCSC+RN+KLP
Sbjct:   401 HPFLKKITMDDLGTLMSLYDSRSDTYGTPFLPV-EGNMRCEGMVLIASMLCSCIRNIKLP 459

Query:   514 HYRRAAILLLKSSSLFIDDEDRLQRVLPHVIAMLSDPAAIVRCAALETLCDILPLVRNFP 573
             H RR AILLL+S SL+IDD+DRLQRVLP+V+A+LSDP AIVRCAA+ETLCDILPLVR+FP
Sbjct:   460 HLRREAILLLRSCSLYIDDDDRLQRVLPYVVALLSDPTAIVRCAAMETLCDILPLVRDFP 519

Query:   574 PSDAKIFPEYILPMLSMLPDDPEESVRICYASNIAKLALTAYGFLVHSIRLSEAGVLDKL 633
             PSDAKIFPEYI PMLSMLP+D EESVRICYASNIAKLALTAYGFL+HS +LS+ GVL++L
Sbjct:   520 PSDAKIFPEYIFPMLSMLPEDTEESVRICYASNIAKLALTAYGFLIHSFQLSDVGVLNEL 579

Query:   634 SAPHKSPSSSNETSVQLQRLNADVQLSQLRKSIAEVVQELVMGPKQTPSIRRALLQDIGN 693
             ++   S + ++ET   LQ+ N + QL QLRK+IAEVVQELVMGPKQTP++RRALLQDIG 
Sbjct:   580 NSQQISTTPASETPSHLQKANGNAQLQQLRKTIAEVVQELVMGPKQTPNVRRALLQDIGE 639

Query:   694 LCSFFGQRQSNDFLLPILPAFLNDRDEQLRAVFYGQIVYVCFFVGERSVEEYLLPYIEQA 753
             LC FFGQRQSNDFLLPILPAFLNDRDEQLR+VF+ +IVYVCFFVG+RSVEEYLLPYI+QA
Sbjct:   640 LCFFFGQRQSNDFLLPILPAFLNDRDEQLRSVFFEKIVYVCFFVGQRSVEEYLLPYIDQA 699

Query:   754 LSDATEAVIVNALDCLAILCKSGYLRKRILLEMIERAFPLLCYPSQWVRRSVVTFIAASS 813
             LSD TEAVIVNAL+CL+ LCKS +LRKR LL+MIE  +PLLCYPSQWVRR+VVTFIAASS
Sbjct:   700 LSDQTEAVIVNALECLSTLCKSSFLRKRALLQMIECVYPLLCYPSQWVRRAVVTFIAASS 759

Query:   814 ESLGAVDSYVFLAPVIRPFLRRQPASLASVKALLSCLKPPVSREVFYQVLENARSSDMLE 873
             E LGAVDSY F+APVIR +L R PAS+AS + LLSCLKPPV+REV Y++ E  R+ + + 
Sbjct:   760 ECLGAVDSYAFIAPVIRSYLSRLPASIASEEGLLSCLKPPVTREVVYRIFEKTRNPEFMA 819

Query:   874 RQRKIWYNTSSQSKQQETADLLKRGAEDLSSIKCWPDKQQSSEGHRPAGDTSKQPEFAQS 933
             +QRK+WY++S QSK  E+ DL  + A +L+S++C  +++QS EG +     SKQPE    
Sbjct:   820 KQRKMWYSSSPQSKDWESVDLFDKDAGELNSVECRAEQKQSVEGKKQIKSASKQPEVQGK 879

Query:   934 DDNDGAKLRTLGSLVYNASSMADIRDPLCPEKLLFSGFMSQQVSGVNSLRCDKSSEGIPL 993
                  AKLR   +   NAS+  ++RDP+ PEKL FSGFM+  VSG NS       E IPL
Sbjct:   880 YAEKDAKLRIPRNPRPNASNTVELRDPVYPEKLQFSGFMAPYVSGANSFI---EPENIPL 936

Query:   994 YSFSMDKRAMGNLPVASDSVLQVNSLGIGSSTMPWMDTTNQSFSLASSVPPPNLVSGSFS 1053
             YSFSMDKRA  N PVAS+S LQ+NSLG+GS ++PWMD+ ++SF+LASSVP P L+SGSF 
Sbjct:   937 YSFSMDKRAATNPPVASESSLQMNSLGMGSLSVPWMDSMSKSFNLASSVPVPKLISGSFH 996

Query:  1054 ISNGSKQFYRVVHEPEGRENDQMASVNCKFPEMGTSGTAKGSSINVEDASSPADLTGLPS 1113
             +    KQFYRVVHEPE RENDQ++S   KF ++G S ++K +S+  EDASSPADL G PS
Sbjct:   997 VGTNPKQFYRVVHEPESRENDQISSAISKFQDLGVSSSSKSASVTSEDASSPADLVGEPS 1056

Query:  1114 FVRTSSIPDSGWRPRGILVAHLQEHCSAVNEIAISHDHSFFVSASDDSTVKVWDSRKLEK 1173
               RTS +PDSGW+PRG+LVAHLQEH SAVN+IA S DHSFFVSASDDSTVKVWDSRKLEK
Sbjct:  1057 LSRTS-VPDSGWKPRGVLVAHLQEHRSAVNDIATSSDHSFFVSASDDSTVKVWDSRKLEK 1115

Query:  1174 DISFRSRLTYHLEGSRALCTMMLRHSAQVVVGACDGIIHMFSVDHISRGLGNV-EKYSGI 1232
             DISFRSRLTYHLEGSR +CT MLR+S QVVVGA DG+IHMFS+DHISRGLGNV EKYSGI
Sbjct:  1116 DISFRSRLTYHLEGSRGMCTTMLRNSTQVVVGASDGVIHMFSIDHISRGLGNVVEKYSGI 1175

Query:  1233 SDIKKKDTKEGAIVTLVNYNTDNCASHMFMYSTQNCGIHLWDTRSNSNTWTLKAIPEEGY 1292
              DIKKKD KEGA+V+L+NY  D+ +  M MYSTQNCGIHLWDTRS+ + WTLKA PEEGY
Sbjct:  1176 VDIKKKDVKEGALVSLLNYTADSLSGPMVMYSTQNCGIHLWDTRSDLDAWTLKANPEEGY 1235

Query:  1293 VSSLVTGPCGNWFVSGSSRGVLTLWDLRFLVPVNSWQYSQVCPIEKMCLFVPPPNAAVST 1352
             VSSLVT PCGNWFVSGSSRGVLTLWDLRF VPVNSWQY  +CPIEKMCL   PP+ +VST
Sbjct:  1236 VSSLVTSPCGNWFVSGSSRGVLTLWDLRFRVPVNSWQYPIICPIEKMCLCFLPPSVSVST 1295

Query:  1353 TARPLIYVAAGCNEVSLWNAENGSCHQVLRTANYDGDTEMSDLPWAFARPSSRSNPKTDL 1412
             T +PLIYVAAGCNEVSLWNAE GSCHQVLR ANY+ +T++S+  W    PS++ NPK + 
Sbjct:  1296 TMKPLIYVAAGCNEVSLWNAEGGSCHQVLRVANYENETDVSEFQWKL--PSNKVNPKPNH 1353

Query:  1413 RRNVNQKYRVDELNEPPPRLLGIRSXXXXXXXXXXXXXXXXKIRRWDHCSPGRSYCICGP 1472
             R+N++ KYR++ELNEPPPRL GIRS                KIRRWD+ SP RSYCICGP
Sbjct:  1354 RQNMSSKYRIEELNEPPPRLPGIRSLLPLPGGDLLTGGTDLKIRRWDYSSPERSYCICGP 1413

Query:  1473 NLKGVGNDEFYETRSSSGVQVVQERKRQPXXXXXXXXXXXXXXXXXXXGCHRDSILSLGS 1532
             +LKGVGND+FYE ++++GVQ VQE KR+P                   GCHRDS+ SL S
Sbjct:  1414 SLKGVGNDDFYELKTNTGVQFVQETKRRPLATKLTAKAVLAAAATDTAGCHRDSVQSLAS 1473

Query:  1533 VKLNQRLLISSSRDGAIKVWK 1553
             VKLNQRLLISSSRDGAIKVWK
Sbjct:  1474 VKLNQRLLISSSRDGAIKVWK 1494

GO:0004672 "protein kinase activity" evidence=IEA;ISS

GO:0004674 "protein serine/threonine kinase activity" evidence=IEA

GO:0005524 "ATP binding" evidence=IEA;ISS

GO:0005794 "Golgi apparatus" evidence=ISM

GO:0006468 "protein phosphorylation" evidence=IEA;ISS

GO:0016772 "transferase activity, transferring phosphorus-containing groups" evidence=IEA

GO:0080008 "Cul4-RING ubiquitin ligase complex" evidence=ISS

GO:0005737 "cytoplasm" evidence=IDA

GO:0009555 "pollen development" evidence=IMP

GO:0009846 "pollen germination" evidence=IMP

GO:0000303 "response to superoxide" evidence=RCA

GO:0006635 "fatty acid beta-oxidation" evidence=RCA

GO:0006869 "lipid transport" evidence=RCA

GO:0006891 "intra-Golgi vesicle-mediated transport" evidence=RCA

GO:0007165 "signal transduction" evidence=RCA

GO:0008219 "cell death" evidence=RCA

GO:0009630 "gravitropism" evidence=RCA

GO:0009755 "hormone-mediated signaling pathway" evidence=RCA

GO:0009863 "salicylic acid mediated signaling pathway" evidence=RCA

GO:0009873 "ethylene mediated signaling pathway" evidence=RCA

GO:0010351 "lithium ion transport" evidence=RCA

GO:0016558 "protein import into peroxisome matrix" evidence=RCA

GO:0044265 "cellular macromolecule catabolic process" evidence=RCA

GO:0048573 "photoperiodism, flowering" evidence=RCA

DICTYBASE\|DDB_G0282627 vps15 "VPS15 family protein kinase Vps15" [Dictyostelium discoideum (taxid:44689)]	Back alignment and assigned GO terms

UNIPROTKB\|E2QZF5 PIK3R4 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)]	Back alignment and assigned GO terms

ZFIN\|ZDB-GENE-050309-84 pik3r4 "phosphoinositide-3-kinase, regulatory subunit 4" [Danio rerio (taxid:7955)]	Back alignment and assigned GO terms

MGI\|MGI:1922919 Pik3r4 "phosphatidylinositol 3 kinase, regulatory subunit, polypeptide 4, p150" [Mus musculus (taxid:10090)]	Back alignment and assigned GO terms

RGD\|1311809 Pik3r4 "phosphoinositide-3-kinase, regulatory subunit 4" [Rattus norvegicus (taxid:10116)]	Back alignment and assigned GO terms

UNIPROTKB\|Q99570 PIK3R4 "Phosphoinositide 3-kinase regulatory subunit 4" [Homo sapiens (taxid:9606)]	Back alignment and assigned GO terms

UNIPROTKB\|A6QLW1 PIK3R4 "PIK3R4 protein" [Bos taurus (taxid:9913)]	Back alignment and assigned GO terms

UNIPROTKB\|Q5R9I3 PIK3R4 "Phosphoinositide 3-kinase regulatory subunit 4" [Pongo abelii (taxid:9601)]	Back alignment and assigned GO terms

UNIPROTKB\|I3LEJ8 PIK3R4 "Uncharacterized protein" [Sus scrofa (taxid:9823)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

Prediction Level	EC number	Confidence of Prediction
4th Layer	2.7.11.1	0.824
3rd Layer	2.7.11	0.766

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		1553
cd00180		215	cd00180, PKc, Catalytic domain of Protein Kinases	4e-24
smart00220		254	smart00220, S_TKc, Serine/Threonine protein kinase	8e-24
pfam00069		260	pfam00069, Pkinase, Protein kinase domain	7e-19
COG0515		384	COG0515, SPS1, Serine/threonine protein kinase [Ge	2e-17
cd00200		289	cd00200, WD40, WD40 domain, found in a number of e	3e-13
cd08215		258	cd08215, STKc_Nek, Catalytic domain of the Protein	7e-13
cd07829		282	cd07829, STKc_CDK_like, Catalytic domain of Cyclin	2e-12
cd07833		288	cd07833, STKc_CDKL, Catalytic domain of Cyclin-Dep	2e-11
cd06606		260	cd06606, STKc_MAPKKK, Catalytic domain of the Prot	2e-10
cd08217		265	cd08217, STKc_Nek2, Catalytic domain of the Protei	5e-10
cd05118		283	cd05118, STKc_CMGC, Catalytic domain of CMGC famil	6e-10
cd07840		287	cd07840, STKc_CDK9_like, Catalytic domain of Cycli	8e-10
cd06626		264	cd06626, STKc_MEKK4, Catalytic domain of the Prote	1e-09
cd07836		284	cd07836, STKc_Pho85, Catalytic domain of the Serin	2e-09
cd07847		286	cd07847, STKc_CDKL1_4, Catalytic domain of the Ser	2e-09
cd07864		302	cd07864, STKc_CDK12, Catalytic domain of the Serin	3e-09
cd05581		280	cd05581, STKc_PDK1, Catalytic domain of the Protei	4e-09
cd07830		283	cd07830, STKc_MAK_like, Catalytic domain of Male g	1e-08
cd07838		287	cd07838, STKc_CDK4_6_like, Catalytic domain of Cyc	1e-08
cd07832		286	cd07832, STKc_CCRK, Catalytic domain of the Serine	2e-08
cd07831		282	cd07831, STKc_MOK, Catalytic domain of the Serine/	2e-08
cd07845		309	cd07845, STKc_CDK10, Catalytic domain of the Serin	4e-08
cd06627		254	cd06627, STKc_Cdc7_like, Catalytic domain of Cell	4e-08
COG2319		466	COG2319, COG2319, FOG: WD40 repeat [General functi	9e-08
pfam00400		39	pfam00400, WD40, WD domain, G-beta repeat	1e-07
cd05122		253	cd05122, PKc_STE, Catalytic domain of STE family P	2e-07
smart00320		40	smart00320, WD40, WD40 repeats	2e-07
cd07846		286	cd07846, STKc_CDKL2_3, Catalytic domain of the Ser	2e-07
cd05611		260	cd05611, STKc_Rim15_like, Catalytic domain of fung	2e-07
cd08221		256	cd08221, STKc_Nek9, Catalytic domain of the Protei	2e-07
cd05123		250	cd05123, STKc_AGC, Catalytic domain of AGC family	4e-07
cd06632		258	cd06632, STKc_MEKK1_plant, Catalytic domain of the	6e-07
cd08530		256	cd08530, STKc_CNK2-like, Catalytic domain of the P	6e-07
COG2319		466	COG2319, COG2319, FOG: WD40 repeat [General functi	8e-07
cd07841		298	cd07841, STKc_CDK7, Catalytic domain of the Serine	9e-07
cd05580		290	cd05580, STKc_PKA, Catalytic domain of the Protein	9e-07
cd05602		325	cd05602, STKc_SGK1, Catalytic domain of the Protei	1e-06
cd06624		268	cd06624, STKc_ASK, Catalytic domain of the Protein	1e-06
cd00200		289	cd00200, WD40, WD40 domain, found in a number of e	3e-06
cd08220		256	cd08220, STKc_Nek8, Catalytic domain of the Protei	3e-06
cd07866		311	cd07866, STKc_BUR1, Catalytic domain of the Serine	5e-06
cd07848		287	cd07848, STKc_CDKL5, Catalytic domain of the Serin	6e-06
cd07852		337	cd07852, STKc_MAPK15, Catalytic domain of the Seri	1e-05
cd08219		255	cd08219, STKc_Nek3, Catalytic domain of the Protei	2e-05
PTZ00036		440	PTZ00036, PTZ00036, glycogen synthase kinase; Prov	2e-05
cd07843		293	cd07843, STKc_CDC2L1, Catalytic domain of the Seri	3e-05
cd05603		321	cd05603, STKc_SGK2, Catalytic domain of the Protei	3e-05
cd05579		265	cd05579, STKc_MAST_like, Catalytic domain of Micro	4e-05
cd07860		284	cd07860, STKc_CDK2_3, Catalytic domain of the Seri	5e-05
PTZ00283		496	PTZ00283, PTZ00283, serine/threonine protein kinas	6e-05
cd07842		316	cd07842, STKc_CDK8_like, Catalytic domain of Cycli	6e-05
cd08529		256	cd08529, STKc_FA2-like, Catalytic domain of the Pr	7e-05
cd07859		338	cd07859, STKc_TDY_MAPK_plant, Catalytic domain of	1e-04
cd07871		288	cd07871, STKc_PCTAIRE3, Catalytic domain of the Se	1e-04
cd08218		256	cd08218, STKc_Nek1, Catalytic domain of the Protei	1e-04
cd07837		295	cd07837, STKc_CdkB_plant, Catalytic domain of the	2e-04
cd07865		310	cd07865, STKc_CDK9, Catalytic domain of the Serine	2e-04
cd07835		283	cd07835, STKc_CDK1_like, Catalytic domain of Cycli	2e-04
cd08225		257	cd08225, STKc_Nek5, Catalytic domain of the Protei	2e-04
cd07863		288	cd07863, STKc_CDK4, Catalytic domain of the Serine	3e-04
cd07872		309	cd07872, STKc_PCTAIRE2, Catalytic domain of the Se	3e-04
PLN00009		294	PLN00009, PLN00009, cyclin-dependent kinase A; Pro	4e-04
cd05604		325	cd05604, STKc_SGK3, Catalytic domain of the Protei	4e-04
cd07834		330	cd07834, STKc_MAPK, Catalytic domain of the Serine	5e-04
cd07862		290	cd07862, STKc_CDK6, Catalytic domain of the Serine	7e-04
PHA03211		461	PHA03211, PHA03211, serine/threonine kinase US3; P	0.001
PTZ00263		329	PTZ00263, PTZ00263, protein kinase A catalytic sub	0.001
cd08528		269	cd08528, STKc_Nek10, Catalytic domain of the Prote	0.001
cd05609		305	cd05609, STKc_MAST, Catalytic domain of the Protei	0.001
cd05575		323	cd05575, STKc_SGK, Catalytic domain of the Protein	0.001
cd06659		297	cd06659, STKc_PAK6, Catalytic domain of the Protei	0.002
cd05046		275	cd05046, PTK_CCK4, Pseudokinase domain of the Prot	0.002
cd08224		267	cd08224, STKc_Nek6_Nek7, Catalytic domain of the P	0.002
cd07873		301	cd07873, STKc_PCTAIRE1, Catalytic domain of the Se	0.002
cd05600		333	cd05600, STKc_Sid2p_Dbf2p, Catalytic domain of Fun	0.002
cd05614		332	cd05614, STKc_MSK2_N, N-terminal catalytic domain	0.002
cd05589		324	cd05589, STKc_PKN, Catalytic domain of the Protein	0.002
cd07839		284	cd07839, STKc_CDK5, Catalytic domain of the Serine	0.002
cd05571		323	cd05571, STKc_PKB, Catalytic domain of the Protein	0.003
cd07867		317	cd07867, STKc_CDC2L6, Catalytic domain of Serine/T	0.003
pfam02985		31	pfam02985, HEAT, HEAT repeat	0.003
cd07874		355	cd07874, STKc_JNK3, Catalytic domain of the Serine	0.004
cd06629		272	cd06629, STKc_MAPKKK_Bck1_like, Catalytic domain o	0.004
cd06628		267	cd06628, STKc_MAPKKK_Byr2_like, Catalytic domain o	0.004

>gnl\|CDD\|173623 cd00180, PKc, Catalytic domain of Protein Kinases	Back alignment and domain information

 Score =  101 bits (255), Expect = 4e-24
 Identities = 60/265 (22%), Positives = 98/265 (36%), Gaps = 56/265 (21%)

Query: 33  LGGSRFFKSILCKHDEG--LVLVKVYFKRGDYIDLREYERRLFHIRETFRSIDHPHVWAF 90
           LG   F    L +  +    V +K+  K      L E  R +    E  + ++HP++   
Sbjct: 1   LGEGGFGTVYLARDKKTGKKVAIKIIKKEDSSSLLEELLREI----EILKKLNHPNIVKL 56

Query: 91  QFWQETDKAAYLLRQYFFN-SLRDRLST-PPFLSLVEKKWLAFQLLLAVKQCHEKGICHG 148
               E +   YL+ +Y    SL+D L      LS  E   +  Q+L  ++  H  GI H 
Sbjct: 57  YGVFEDENHLYLVMEYCEGGSLKDLLKENEGKLSEDEILRILLQILEGLEYLHSNGIIHR 116

Query: 149 DIKCENVLVTSWNW-LYLSDFASFKPTYIPYDDPSDFSFFFDTGGKRLCYLAPERFYEHG 207
           D+K EN+L+ S N  + L+DF   K         +       T      Y+APE      
Sbjct: 117 DLKPENILLDSDNGKVKLADFGLSKLL-------TSDKSLLKTIVGTPAYMAPEVLL--- 166

Query: 208 GEMQVAQDAPLKPSMDIFAVGCVIAELFLEVPFFELSHLLAYRRGQYDPSQHLEKIPDSG 267
                          DI+++G ++ EL                                 
Sbjct: 167 ------GKGYYSEKSDIWSLGVILYEL-------------------------------PE 189

Query: 268 IRKMILHMIQLEPELRFSAESYLQN 292
           ++ +I  M+Q +PE R SA+  L++
Sbjct: 190 LKDLIRKMLQKDPEKRPSAKEILEH 214

Protein Kinases (PKs), catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The PK family is part of a larger superfamily that includes the catalytic domains of RIO kinases, aminoglycoside phosphotransferase, choline kinase, phosphoinositide 3-kinase (PI3K), and actin-fragmin kinase. PKs make up a large family of serine/threonine kinases, protein tyrosine kinases (PTKs), and dual-specificity PKs that phosphorylate both serine/threonine and tyrosine residues of target proteins. Majority of protein phosphorylation, about 95%, occurs on serine residues while only 1% occurs on tyrosine residues. Protein phosphorylation is a mechanism by which a wide variety of cellular proteins, such as enzymes and membrane channels, are reversibly regulated in response to certain stimuli. PKs often function as components of signal transduction pathways in which one kinase activates a second kinase, which in turn, may act on other kinases; this sequential action transmits a signal from the cell surface to target proteins, which results in cellular responses. The PK family is one of the largest known protein families with more than 100 homologous yeast enzymes and 550 human proteins. A fraction of PK family members are pseudokinases that lack crucial residues for catalytic activity. The mutiplicity of kinases allows for specific regulation according to substrate, tissue distribution, and cellular localization. PKs regulate many cellular processes including proliferation, division, differentiation, motility, survival, metabolism, cell-cycle progression, cytoskeletal rearrangement, immunity, and neuronal functions. Many kinases are implicated in the development of various human diseases including different types of cancer. Length = 215

>gnl\|CDD\|214567 smart00220, S_TKc, Serine/Threonine protein kinases, catalytic domain	Back alignment and domain information

>gnl\|CDD\|215690 pfam00069, Pkinase, Protein kinase domain	Back alignment and domain information

>gnl\|CDD\|223589 COG0515, SPS1, Serine/threonine protein kinase [General function prediction only / Signal transduction mechanisms / Transcription / DNA replication, recombination, and repair]	Back alignment and domain information

>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment

Back alignment and domain information

>gnl\|CDD\|173755 cd08215, STKc_Nek, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase	Back alignment and domain information

>gnl\|CDD\|173733 cd07829, STKc_CDK_like, Catalytic domain of Cyclin-Dependent protein Kinase-like Serine/Threonine Kinases	Back alignment and domain information

>gnl\|CDD\|143338 cd07833, STKc_CDKL, Catalytic domain of Cyclin-Dependent protein Kinase Like Serine/Threonine Kinases	Back alignment and domain information

>gnl\|CDD\|173724 cd06606, STKc_MAPKKK, Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Kinase Kinase	Back alignment and domain information

>gnl\|CDD\|173757 cd08217, STKc_Nek2, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 2	Back alignment and domain information

>gnl\|CDD\|143333 cd05118, STKc_CMGC, Catalytic domain of CMGC family Serine/Threonine Kinases	Back alignment and domain information

>gnl\|CDD\|143345 cd07840, STKc_CDK9_like, Catalytic domain of Cyclin-Dependent protein Kinase 9-like Serine/Threonine Kinases	Back alignment and domain information

>gnl\|CDD\|132957 cd06626, STKc_MEKK4, Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 4	Back alignment and domain information

>gnl\|CDD\|143341 cd07836, STKc_Pho85, Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Pho85	Back alignment and domain information

>gnl\|CDD\|173744 cd07847, STKc_CDKL1_4, Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 1 and 4	Back alignment and domain information

>gnl\|CDD\|173753 cd07864, STKc_CDK12, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 12	Back alignment and domain information

>gnl\|CDD\|173672 cd05581, STKc_PDK1, Catalytic domain of the Protein Serine/Threonine Kinase, Phosphoinositide-dependent kinase 1	Back alignment and domain information

>gnl\|CDD\|173734 cd07830, STKc_MAK_like, Catalytic domain of Male germ cell-Associated Kinase-like Serine/Threonine Kinases	Back alignment and domain information

>gnl\|CDD\|173739 cd07838, STKc_CDK4_6_like, Catalytic domain of Cyclin-Dependent protein Kinase 4 and 6-like Serine/Threonine Kinases	Back alignment and domain information

>gnl\|CDD\|173736 cd07832, STKc_CCRK, Catalytic domain of the Serine/Threonine Kinase, Cell Cycle-Related Kinase	Back alignment and domain information

>gnl\|CDD\|173735 cd07831, STKc_MOK, Catalytic domain of the Serine/Threonine Kinase, MAPK/MAK/MRK Overlapping Kinase	Back alignment and domain information

>gnl\|CDD\|173742 cd07845, STKc_CDK10, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 10	Back alignment and domain information

>gnl\|CDD\|173731 cd06627, STKc_Cdc7_like, Catalytic domain of Cell division control protein 7-like Protein Serine/Threonine Kinases	Back alignment and domain information

>gnl\|CDD\|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only]	Back alignment and domain information

>gnl\|CDD\|201208 pfam00400, WD40, WD domain, G-beta repeat	Back alignment and domain information

>gnl\|CDD\|173659 cd05122, PKc_STE, Catalytic domain of STE family Protein Kinases	Back alignment and domain information

>gnl\|CDD\|197651 smart00320, WD40, WD40 repeats	Back alignment and domain information

>gnl\|CDD\|173743 cd07846, STKc_CDKL2_3, Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 2 and 3	Back alignment and domain information

>gnl\|CDD\|173702 cd05611, STKc_Rim15_like, Catalytic domain of fungal Rim15-like Protein Serine/Threonine Kinases	Back alignment and domain information

>gnl\|CDD\|173761 cd08221, STKc_Nek9, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 9	Back alignment and domain information

>gnl\|CDD\|173660 cd05123, STKc_AGC, Catalytic domain of AGC family Protein Serine/Threonine Kinases	Back alignment and domain information

>gnl\|CDD\|132963 cd06632, STKc_MEKK1_plant, Catalytic domain of the Protein Serine/Threonine Kinase, Plant MAP/ERK kinase kinase 1	Back alignment and domain information

>gnl\|CDD\|173772 cd08530, STKc_CNK2-like, Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii CNK2, and similar domains	Back alignment and domain information

>gnl\|CDD\|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only]	Back alignment and domain information

>gnl\|CDD\|143346 cd07841, STKc_CDK7, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 7	Back alignment and domain information

>gnl\|CDD\|173671 cd05580, STKc_PKA, Catalytic domain of the Protein Serine/Threonine Kinase, cAMP-dependent protein kinase	Back alignment and domain information

>gnl\|CDD\|173693 cd05602, STKc_SGK1, Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 1	Back alignment and domain information

>gnl\|CDD\|173730 cd06624, STKc_ASK, Catalytic domain of the Protein Serine/Threonine Kinase, Apoptosis signal-regulating kinase	Back alignment and domain information

Back alignment and domain information

>gnl\|CDD\|173760 cd08220, STKc_Nek8, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 8	Back alignment and domain information

>gnl\|CDD\|143371 cd07866, STKc_BUR1, Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Bypass UAS Requirement 1 and similar proteins	Back alignment and domain information

>gnl\|CDD\|173745 cd07848, STKc_CDKL5, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase Like 5	Back alignment and domain information

>gnl\|CDD\|173747 cd07852, STKc_MAPK15, Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase 15	Back alignment and domain information

>gnl\|CDD\|173759 cd08219, STKc_Nek3, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 3	Back alignment and domain information

>gnl\|CDD\|173333 PTZ00036, PTZ00036, glycogen synthase kinase; Provisional	Back alignment and domain information

>gnl\|CDD\|173741 cd07843, STKc_CDC2L1, Catalytic domain of the Serine/Threonine Kinase, Cell Division Cycle 2-like 1	Back alignment and domain information

>gnl\|CDD\|173694 cd05603, STKc_SGK2, Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 2	Back alignment and domain information

>gnl\|CDD\|173670 cd05579, STKc_MAST_like, Catalytic domain of Microtubule-associated serine/threonine kinase-like proteins	Back alignment and domain information

>gnl\|CDD\|173751 cd07860, STKc_CDK2_3, Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase 2 and 3	Back alignment and domain information

>gnl\|CDD\|240344 PTZ00283, PTZ00283, serine/threonine protein kinase; Provisional	Back alignment and domain information

>gnl\|CDD\|173740 cd07842, STKc_CDK8_like, Catalytic domain of Cyclin-Dependent protein Kinase 8-like Serine/Threonine Kinases	Back alignment and domain information

>gnl\|CDD\|173771 cd08529, STKc_FA2-like, Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii FA2 and similar domains	Back alignment and domain information

>gnl\|CDD\|143364 cd07859, STKc_TDY_MAPK_plant, Catalytic domain of the Serine/Threonine Kinases, TDY Mitogen-Activated Protein Kinases from Plants	Back alignment and domain information

>gnl\|CDD\|143376 cd07871, STKc_PCTAIRE3, Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-3 kinase	Back alignment and domain information

>gnl\|CDD\|173758 cd08218, STKc_Nek1, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 1	Back alignment and domain information

>gnl\|CDD\|143342 cd07837, STKc_CdkB_plant, Catalytic domain of the Serine/Threonine Kinase, Plant B-type Cyclin-Dependent protein Kinase	Back alignment and domain information

>gnl\|CDD\|173754 cd07865, STKc_CDK9, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 9	Back alignment and domain information

>gnl\|CDD\|173738 cd07835, STKc_CDK1_like, Catalytic domain of Cyclin-Dependent protein Kinase 1-like Serine/Threonine Kinases	Back alignment and domain information

>gnl\|CDD\|173765 cd08225, STKc_Nek5, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 5	Back alignment and domain information

>gnl\|CDD\|143368 cd07863, STKc_CDK4, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 4	Back alignment and domain information

>gnl\|CDD\|143377 cd07872, STKc_PCTAIRE2, Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-2 kinase	Back alignment and domain information

>gnl\|CDD\|177649 PLN00009, PLN00009, cyclin-dependent kinase A; Provisional	Back alignment and domain information

>gnl\|CDD\|173695 cd05604, STKc_SGK3, Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 3	Back alignment and domain information

>gnl\|CDD\|173737 cd07834, STKc_MAPK, Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase	Back alignment and domain information

>gnl\|CDD\|143367 cd07862, STKc_CDK6, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 6	Back alignment and domain information

>gnl\|CDD\|223009 PHA03211, PHA03211, serine/threonine kinase US3; Provisional	Back alignment and domain information

>gnl\|CDD\|140289 PTZ00263, PTZ00263, protein kinase A catalytic subunit; Provisional	Back alignment and domain information

>gnl\|CDD\|173770 cd08528, STKc_Nek10, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 10	Back alignment and domain information

>gnl\|CDD\|173700 cd05609, STKc_MAST, Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine kinase	Back alignment and domain information

>gnl\|CDD\|173666 cd05575, STKc_SGK, Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase	Back alignment and domain information

>gnl\|CDD\|132990 cd06659, STKc_PAK6, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 6	Back alignment and domain information

>gnl\|CDD\|133178 cd05046, PTK_CCK4, Pseudokinase domain of the Protein Tyrosine Kinase, Colon Carcinoma Kinase 4	Back alignment and domain information

>gnl\|CDD\|173764 cd08224, STKc_Nek6_Nek7, Catalytic domain of the Protein Serine/Threonine Kinases, Never In Mitosis gene A-related kinase 6 and 7	Back alignment and domain information

>gnl\|CDD\|143378 cd07873, STKc_PCTAIRE1, Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-1 kinase	Back alignment and domain information

>gnl\|CDD\|173691 cd05600, STKc_Sid2p_Dbf2p, Catalytic domain of Fungal Sid2p- and Dbf2p-like Protein Serine/Threonine Kinases	Back alignment and domain information

>gnl\|CDD\|173705 cd05614, STKc_MSK2_N, N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 2	Back alignment and domain information

>gnl\|CDD\|173680 cd05589, STKc_PKN, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase N	Back alignment and domain information

>gnl\|CDD\|143344 cd07839, STKc_CDK5, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 5	Back alignment and domain information

>gnl\|CDD\|173662 cd05571, STKc_PKB, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B	Back alignment and domain information

>gnl\|CDD\|143372 cd07867, STKc_CDC2L6, Catalytic domain of Serine/Threonine Kinase, Cell Division Cycle 2-like 6	Back alignment and domain information

>gnl\|CDD\|202500 pfam02985, HEAT, HEAT repeat	Back alignment and domain information

>gnl\|CDD\|143379 cd07874, STKc_JNK3, Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 3	Back alignment and domain information

>gnl\|CDD\|132960 cd06629, STKc_MAPKKK_Bck1_like, Catalytic domain of fungal Bck1-like MAP Kinase Kinase Kinases	Back alignment and domain information

>gnl\|CDD\|173732 cd06628, STKc_MAPKKK_Byr2_like, Catalytic domain of fungal Byr2-like MAP Kinase Kinase Kinases	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		1553
KOG1240		1431	consensus Protein kinase containing WD40 repeats [	100.0
PLN00181		793	protein SPA1-RELATED; Provisional	100.0
KOG0615		475	consensus Serine/threonine protein kinase Chk2 and	100.0
KOG0575		592	consensus Polo-like serine/threonine protein kinas	100.0
KOG0581		364	consensus Mitogen-activated protein kinase kinase	100.0
KOG0592		604	consensus 3-phosphoinositide-dependent protein kin	100.0
KOG0598		357	consensus Ribosomal protein S6 kinase and related	100.0
KOG0595		429	consensus Serine/threonine-protein kinase involved	100.0
KOG0593		396	consensus Predicted protein kinase KKIAMRE [Genera	100.0
KOG0591		375	consensus NIMA (never in mitosis)-related G2-speci	100.0
KOG0588		786	consensus Serine/threonine protein kinase [Cell cy	100.0
KOG0661		538	consensus MAPK related serine/threonine protein ki	100.0
KOG0597		808	consensus Serine-threonine protein kinase FUSED [G	100.0
KOG0600		560	consensus Cdc2-related protein kinase [Cell cycle	100.0
KOG0659		318	consensus Cdk activating kinase (CAK)/RNA polymera	100.0
KOG0583		370	consensus Serine/threonine protein kinase [Signal	100.0
KOG0611		668	consensus Predicted serine/threonine protein kinas	100.0
KOG0605		550	consensus NDR and related serine/threonine kinases	100.0
KOG0616		355	consensus cAMP-dependent protein kinase catalytic	100.0
KOG0582		516	consensus Ste20-like serine/threonine protein kina	100.0
KOG0660		359	consensus Mitogen-activated protein kinase [Signal	100.0
KOG0599		411	consensus Phosphorylase kinase gamma subunit [Carb	100.0
KOG0585		576	consensus Ca2+/calmodulin-dependent protein kinase	100.0
KOG0198		313	consensus MEKK and related serine/threonine protei	100.0
KOG0663		419	consensus Protein kinase PITSLRE and related kinas	100.0
KOG4717		864	consensus Serine/threonine protein kinase [Signal	100.0
KOG0192		362	consensus Tyrosine kinase specific for activated (	100.0
KOG0658		364	consensus Glycogen synthase kinase-3 [Carbohydrate	100.0
KOG0580		281	consensus Serine/threonine protein kinase [Cell cy	100.0
KOG0694		694	consensus Serine/threonine protein kinase [Signal	100.0
KOG0271		480	consensus Notchless-like WD40 repeat-containing pr	100.0
cd05612		291	STKc_PRKX_like Catalytic domain of PRKX-like Prote	100.0
PTZ00263		329	protein kinase A catalytic subunit; Provisional	100.0
KOG0033		355	consensus Ca2+/calmodulin-dependent protein kinase	100.0
KOG0594		323	consensus Protein kinase PCTAIRE and related kinas	100.0
cd05571		323	STKc_PKB Catalytic domain of the Protein Serine/Th	100.0
PTZ00426		340	cAMP-dependent protein kinase catalytic subunit; P	100.0
cd07871		288	STKc_PCTAIRE3 Catalytic domain of the Serine/Threo	100.0
KOG0201		467	consensus Serine/threonine protein kinase [Signal	100.0
KOG0667		586	consensus Dual-specificity tyrosine-phosphorylatio	100.0
KOG0578		550	consensus p21-activated serine/threonine protein k	100.0
cd05585		312	STKc_YPK1_like Catalytic domain of Yeast Protein K	100.0
cd05593		328	STKc_PKB_gamma Catalytic domain of the Protein Ser	100.0
KOG0596		677	consensus Dual specificity; serine/threonine and t	100.0
KOG0272		459	consensus U4/U6 small nuclear ribonucleoprotein Pr	100.0
cd07869		303	STKc_PFTAIRE1 Catalytic domain of the Serine/Threo	100.0
cd05595		323	STKc_PKB_beta Catalytic domain of the Protein Seri	100.0
cd05614		332	STKc_MSK2_N N-terminal catalytic domain of the Pro	100.0
KOG0032		382	consensus Ca2+/calmodulin-dependent protein kinase	100.0
KOG1989		738	consensus ARK protein kinase family [Signal transd	100.0
cd05584		323	STKc_p70S6K Catalytic domain of the Protein Serine	100.0
cd07859		338	STKc_TDY_MAPK_plant Catalytic domain of the Serine	100.0
KOG2345		302	consensus Serine/threonine protein kinase/TGF-beta	100.0
KOG0193		678	consensus Serine/threonine protein kinase RAF [Sig	100.0
KOG0586		596	consensus Serine/threonine protein kinase [General	100.0
KOG0589		426	consensus Serine/threonine protein kinase [General	100.0
cd05631		285	STKc_GRK4 Catalytic domain of the Protein Serine/T	100.0
cd05599		364	STKc_NDR_like Catalytic domain of Nuclear Dbf2-Rel	100.0
cd05600		333	STKc_Sid2p_Dbf2p Catalytic domain of Fungal Sid2p-	100.0
KOG0610		459	consensus Putative serine/threonine protein kinase	100.0
cd05573		350	STKc_ROCK_NDR_like Catalytic domain of ROCK- and N	100.0
cd05587		324	STKc_cPKC Catalytic domain of the Protein Serine/T	100.0
cd05590		320	STKc_nPKC_eta Catalytic domain of the Protein Seri	100.0
cd05575		323	STKc_SGK Catalytic domain of the Protein Serine/Th	100.0
cd07862		290	STKc_CDK6 Catalytic domain of the Serine/Threonine	100.0
cd07848		287	STKc_CDKL5 Catalytic domain of the Serine/Threonin	100.0
cd05594		325	STKc_PKB_alpha Catalytic domain of the Protein Ser	100.0
cd05102		338	PTKc_VEGFR3 Catalytic domain of the Protein Tyrosi	100.0
PHA03212		391	serine/threonine kinase US3; Provisional	100.0
cd05628		363	STKc_NDR1 Catalytic domain of the Protein Serine/T	100.0
cd05589		324	STKc_PKN Catalytic domain of the Protein Serine/Th	100.0
cd05616		323	STKc_cPKC_beta Catalytic domain of the Protein Ser	100.0
cd05620		316	STKc_nPKC_delta Catalytic domain of the Protein Se	100.0
cd05591		321	STKc_nPKC_epsilon Catalytic domain of the Protein	100.0
cd05592		316	STKc_nPKC_theta_delta Catalytic domain of the Prot	100.0
cd05596		370	STKc_ROCK Catalytic domain of the Protein Serine/T	100.0
cd05588		329	STKc_aPKC Catalytic domain of the Protein Serine/T	100.0
KOG4279		1226	consensus Serine/threonine protein kinase [Signal	100.0
cd05626		381	STKc_LATS2 Catalytic domain of the Protein Serine/	100.0
cd06649		331	PKc_MEK2 Catalytic domain of the dual-specificity	100.0
cd05629		377	STKc_NDR_like_fungal Catalytic domain of Fungal Nu	100.0
cd05598		376	STKc_LATS Catalytic domain of the Protein Serine/T	100.0
cd05625		382	STKc_LATS1 Catalytic domain of the Protein Serine/	100.0
cd05619		316	STKc_nPKC_theta Catalytic domain of the Protein Se	100.0
cd05618		329	STKc_aPKC_iota Catalytic domain of the Protein Ser	100.0
cd07874		355	STKc_JNK3 Catalytic domain of the Serine/Threonine	100.0
cd05621		370	STKc_ROCK2 Catalytic domain of the Protein Serine/	100.0
cd05570		318	STKc_PKC Catalytic domain of the Protein Serine/Th	100.0
cd05582		318	STKc_RSK_N N-terminal catalytic domain of the Prot	100.0
PTZ00267		478	NIMA-related protein kinase; Provisional	100.0
cd05603		321	STKc_SGK2 Catalytic domain of the Protein Serine/T	100.0
PLN00034		353	mitogen-activated protein kinase kinase; Provision	100.0
PHA02988		283	hypothetical protein; Provisional	100.0
cd05601		330	STKc_CRIK Catalytic domain of the Protein Serine/T	100.0
cd05602		325	STKc_SGK1 Catalytic domain of the Protein Serine/T	100.0
cd07876		359	STKc_JNK2 Catalytic domain of the Serine/Threonine	100.0
KOG0197		468	consensus Tyrosine kinases [Signal transduction me	100.0
cd07872		309	STKc_PCTAIRE2 Catalytic domain of the Serine/Threo	100.0
cd05604		325	STKc_SGK3 Catalytic domain of the Protein Serine/T	100.0
cd07875		364	STKc_JNK1 Catalytic domain of the Serine/Threonine	100.0
cd05615		323	STKc_cPKC_alpha Catalytic domain of the Protein Se	100.0
KOG4721		904	consensus Serine/threonine protein kinase, contain	100.0
cd05096		304	PTKc_DDR1 Catalytic domain of the Protein Tyrosine	100.0
cd07863		288	STKc_CDK4 Catalytic domain of the Serine/Threonine	100.0
cd05617		327	STKc_aPKC_zeta Catalytic domain of the Protein Ser	100.0
PTZ00036		440	glycogen synthase kinase; Provisional	100.0
cd07853		372	STKc_NLK Catalytic domain of the Serine/Threonine	100.0
cd05622		371	STKc_ROCK1 Catalytic domain of the Protein Serine/	100.0
cd05048		283	PTKc_Ror Catalytic Domain of the Protein Tyrosine	100.0
PTZ00284		467	protein kinase; Provisional	100.0
PHA03207		392	serine/threonine kinase US3; Provisional	100.0
cd06625		263	STKc_MEKK3_like Catalytic domain of MAP/ERK kinase	100.0
cd05608		280	STKc_GRK1 Catalytic domain of the Protein Serine/T	100.0
cd05627		360	STKc_NDR2 Catalytic domain of the Protein Serine/T	100.0
PTZ00283		496	serine/threonine protein kinase; Provisional	100.0
cd07868		317	STKc_CDK8 Catalytic domain of the Serine/Threonine	100.0
cd06650		333	PKc_MEK1 Catalytic domain of the dual-specificity	100.0
cd05605		285	STKc_GRK4_like Catalytic domain of G protein-coupl	100.0
cd05104		375	PTKc_Kit Catalytic domain of the Protein Tyrosine	100.0
KOG0666		438	consensus Cyclin C-dependent kinase CDK8 [Transcri	100.0
cd05106		374	PTKc_CSF-1R Catalytic domain of the Protein Tyrosi	100.0
cd07873		301	STKc_PCTAIRE1 Catalytic domain of the Serine/Threo	100.0
cd05597		331	STKc_DMPK_like Catalytic domain of Myotonic Dystro	100.0
cd05586		330	STKc_Sck1_like Catalytic domain of Suppressor of l	100.0
PHA03211		461	serine/threonine kinase US3; Provisional	100.0
cd05090		283	PTKc_Ror1 Catalytic domain of the Protein Tyrosine	100.0
KOG0604		400	consensus MAP kinase-activated protein kinase 2 [S	100.0
KOG0286		343	consensus G-protein beta subunit [General function	100.0
cd07861		285	STKc_CDK1_euk Catalytic domain of the Serine/Threo	100.0
KOG0577		948	consensus Serine/threonine protein kinase [Signal	100.0
cd05064		266	PTKc_EphR_A10 Catalytic domain of the Protein Tyro	100.0
KOG0690		516	consensus Serine/threonine protein kinase [Signal	100.0
KOG0607		463	consensus MAP kinase-interacting kinase and relate	100.0
cd05094		291	PTKc_TrkC Catalytic domain of the Protein Tyrosine	100.0
PF00069		260	Pkinase: Protein kinase domain Protein kinase; unc	100.0
cd05623		332	STKc_MRCK_alpha Catalytic domain of the Protein Se	100.0
cd07878		343	STKc_p38beta_MAPK11 Catalytic domain of the Serine	100.0
KOG0272		459	consensus U4/U6 small nuclear ribonucleoprotein Pr	100.0
cd05580		290	STKc_PKA Catalytic domain of the Protein Serine/Th	100.0
PHA03209		357	serine/threonine kinase US3; Provisional	100.0
cd05049		280	PTKc_Trk Catalytic domain of the Protein Tyrosine	100.0
cd05093		288	PTKc_TrkB Catalytic domain of the Protein Tyrosine	100.0
cd05108		316	PTKc_EGFR Catalytic domain of the Protein Tyrosine	100.0
PTZ00266		1021	NIMA-related protein kinase; Provisional	100.0
cd06628		267	STKc_MAPKKK_Byr2_like Catalytic domain of fungal B	100.0
KOG0662		292	consensus Cyclin-dependent kinase CDK5 [Intracellu	100.0
cd08219		255	STKc_Nek3 Catalytic domain of the Protein Serine/T	100.0
cd07867		317	STKc_CDC2L6 Catalytic domain of Serine/Threonine K	100.0
cd08529		256	STKc_FA2-like Catalytic domain of the Protein Seri	100.0
cd06646		267	STKc_MAP4K5 Catalytic domain of the Protein Serine	100.0
cd05624		331	STKc_MRCK_beta Catalytic domain of the Protein Ser	100.0
cd05062		277	PTKc_IGF-1R Catalytic domain of the Protein Tyrosi	100.0
cd05607		277	STKc_GRK7 Catalytic domain of the Protein Serine/T	100.0
cd05114		256	PTKc_Tec_Rlk Catalytic domain of the Protein Tyros	100.0
cd05033		266	PTKc_EphR Catalytic domain of Ephrin Receptor Prot	100.0
cd08227		327	PK_STRAD_alpha Pseudokinase domain of STE20-relate	100.0
KOG4645		1509	consensus MAPKKK (MAP kinase kinase kinase) SSK2 a	100.0
cd06631		265	STKc_YSK4 Catalytic domain of the Protein Serine/T	100.0
cd05091		283	PTKc_Ror2 Catalytic domain of the Protein Tyrosine	100.0
cd05082		256	PTKc_Csk Catalytic domain of the Protein Tyrosine	100.0
cd05084		252	PTKc_Fes Catalytic domain of the Protein Tyrosine	100.0
cd05089		297	PTKc_Tie1 Catalytic domain of the Protein Tyrosine	100.0
cd06651		266	STKc_MEKK3 Catalytic domain of the Protein Serine/	100.0
cd05061		288	PTKc_InsR Catalytic domain of the Protein Tyrosine	100.0
cd05052		263	PTKc_Abl Catalytic domain of the Protein Tyrosine	100.0
cd05053		293	PTKc_FGFR Catalytic domain of the Protein Tyrosine	100.0
cd07839		284	STKc_CDK5 Catalytic domain of the Serine/Threonine	100.0
cd05109		279	PTKc_HER2 Catalytic domain of the Protein Tyrosine	100.0
cd05039		256	PTKc_Csk_like Catalytic domain of C-terminal Src k	100.0
cd05113		256	PTKc_Btk_Bmx Catalytic domain of the Protein Tyros	99.98
cd05032		277	PTKc_InsR_like Catalytic domain of Insulin Recepto	99.98
cd05630		285	STKc_GRK6 Catalytic domain of the Protein Serine/T	99.98
cd06645		267	STKc_MAP4K3 Catalytic domain of the Protein Serine	99.98
cd05105		400	PTKc_PDGFR_alpha Catalytic domain of the Protein T	99.98
PF07714		259	Pkinase_Tyr: Protein tyrosine kinase Protein kinas	99.98
cd00192		262	PTKc Catalytic domain of Protein Tyrosine Kinases.	99.98
cd08223		257	STKc_Nek4 Catalytic domain of the Protein Serine/T	99.98
KOG0579		1187	consensus Ste20-like serine/threonine protein kina	99.98
cd05036		277	PTKc_ALK_LTK Catalytic domain of the Protein Tyros	99.98
cd05098		307	PTKc_FGFR1 Catalytic domain of the Protein Tyrosin	99.98
cd08228		267	STKc_Nek6 Catalytic domain of the Protein Serine/T	99.98
KOG0612		1317	consensus Rho-associated, coiled-coil containing p	99.98
cd05068		261	PTKc_Frk_like Catalytic domain of Fyn-related kina	99.98
cd05092		280	PTKc_TrkA Catalytic domain of the Protein Tyrosine	99.98
cd05609		305	STKc_MAST Catalytic domain of the Protein Serine/T	99.98
cd05054		337	PTKc_VEGFR Catalytic domain of the Protein Tyrosin	99.98
cd06615		308	PKc_MEK Catalytic domain of the dual-specificity P	99.98
cd05088		303	PTKc_Tie2 Catalytic domain of the Protein Tyrosine	99.98
cd05059		256	PTKc_Tec_like Catalytic domain of Tec-like Protein	99.98
cd05051		296	PTKc_DDR Catalytic domain of the Protein Tyrosine	99.98
cd05116		257	PTKc_Syk Catalytic domain of the Protein Tyrosine	99.98
cd05072		261	PTKc_Lyn Catalytic domain of the Protein Tyrosine	99.98
cd07841		298	STKc_CDK7 Catalytic domain of the Serine/Threonine	99.98
KOG4236		888	consensus Serine/threonine protein kinase PKC mu/P	99.98
cd06652		265	STKc_MEKK2 Catalytic domain of the Protein Serine/	99.98
PRK13184		932	pknD serine/threonine-protein kinase; Reviewed	99.98
cd05101		304	PTKc_FGFR2 Catalytic domain of the Protein Tyrosin	99.98
cd05111		279	PTK_HER3 Pseudokinase domain of the Protein Tyrosi	99.98
cd05574		316	STKc_phototropin_like Catalytic domain of Phototro	99.98
cd06619		279	PKc_MKK5 Catalytic domain of the dual-specificity	99.98
cd05632		285	STKc_GRK5 Catalytic domain of the Protein Serine/T	99.98
cd05578		258	STKc_Yank1 Catalytic domain of the Protein Serine/	99.98
KOG1026		774	consensus Nerve growth factor receptor TRKA and re	99.98
cd05099		314	PTKc_FGFR4 Catalytic domain of the Protein Tyrosin	99.98
KOG0295		406	consensus WD40 repeat-containing protein [Function	99.98
cd07832		286	STKc_CCRK Catalytic domain of the Serine/Threonine	99.98
cd05572		262	STKc_cGK_PKG Catalytic domain of the Protein Serin	99.98
cd06630		268	STKc_MEKK1 Catalytic domain of the Protein Serine/	99.98
cd06644		292	STKc_STK10_LOK Catalytic domain of the Protein Ser	99.98
cd06632		258	STKc_MEKK1_plant Catalytic domain of the Protein S	99.98
cd05035		273	PTKc_Axl_like Catalytic Domain of Axl-like Protein	99.97
cd07855		334	STKc_ERK5 Catalytic domain of the Serine/Threonine	99.97
cd05045		290	PTKc_RET Catalytic domain of the Protein Tyrosine	99.97
cd06626		264	STKc_MEKK4 Catalytic domain of the Protein Serine/	99.97
cd05060		257	PTKc_Syk_like Catalytic domain of Spleen Tyrosine	99.97
KOG0574		502	consensus STE20-like serine/threonine kinase MST [	99.97
cd05097		295	PTKc_DDR_like Catalytic domain of Discoidin Domain	99.97
cd05055		302	PTKc_PDGFR Catalytic domain of the Protein Tyrosin	99.97
cd05080		283	PTKc_Tyk2_rpt2 Catalytic (repeat 2) domain of the	99.97
cd06638		286	STKc_myosinIIIA Catalytic domain of the Protein Se	99.97
cd07850		353	STKc_JNK Catalytic domain of the Serine/Threonine	99.97
cd05075		272	PTKc_Axl Catalytic domain of the Protein Tyrosine	99.97
cd07844		291	STKc_PCTAIRE_like Catalytic domain of PCTAIRE-like	99.97
cd06654		296	STKc_PAK1 Catalytic domain of the Protein Serine/T	99.97
cd06643		282	STKc_SLK Catalytic domain of the Protein Serine/Th	99.97
cd08221		256	STKc_Nek9 Catalytic domain of the Protein Serine/T	99.97
cd06613		262	STKc_MAP4K3_like Catalytic domain of Mitogen-activ	99.97
cd05633		279	STKc_GRK3 Catalytic domain of the Protein Serine/T	99.97
cd05066		267	PTKc_EphR_A Catalytic domain of the Protein Tyrosi	99.97
cd07843		293	STKc_CDC2L1 Catalytic domain of the Serine/Threoni	99.97
cd07865		310	STKc_CDK9 Catalytic domain of the Serine/Threonine	99.97
cd05148		261	PTKc_Srm_Brk Catalytic domain of the Protein Tyros	99.97
cd07870		291	STKc_PFTAIRE2 Catalytic domain of the Serine/Threo	99.97
KOG0669		376	consensus Cyclin T-dependent kinase CDK9 [Cell cyc	99.97
KOG0584		632	consensus Serine/threonine protein kinase [General	99.97
cd05043		280	PTK_Ryk Pseudokinase domain of Ryk (Receptor relat	99.97
cd05115		257	PTKc_Zap-70 Catalytic domain of the Protein Tyrosi	99.97
cd06609		274	STKc_MST3_like Catalytic domain of Mammalian Ste20	99.97
KOG0983		391	consensus Mitogen-activated protein kinase (MAPK)	99.97
cd07849		336	STKc_ERK1_2_like Catalytic domain of Extracellular	99.97
cd07847		286	STKc_CDKL1_4 Catalytic domain of the Serine/Threon	99.97
cd06611		280	STKc_SLK_like Catalytic domain of Ste20-like kinas	99.97
cd05100		334	PTKc_FGFR3 Catalytic domain of the Protein Tyrosin	99.97
cd05606		278	STKc_beta_ARK Catalytic domain of the Protein Seri	99.97
cd07831		282	STKc_MOK Catalytic domain of the Serine/Threonine	99.97
cd05079		284	PTKc_Jak1_rpt2 Catalytic (repeat 2) domain of the	99.97
cd06629		272	STKc_MAPKKK_Bck1_like Catalytic domain of fungal B	99.97
cd05095		296	PTKc_DDR2 Catalytic domain of the Protein Tyrosine	99.97
cd06637		272	STKc_TNIK Catalytic domain of the Protein Serine/T	99.97
cd06656		297	STKc_PAK3 Catalytic domain of the Protein Serine/T	99.97
cd06622		286	PKc_MAPKK_PBS2_like Catalytic domain of fungal PBS	99.97
cd05050		288	PTKc_Musk Catalytic domain of the Protein Tyrosine	99.97
cd05034		261	PTKc_Src_like Catalytic domain of Src kinase-like	99.97
cd05046		275	PTK_CCK4 Pseudokinase domain of the Protein Tyrosi	99.97
cd06640		277	STKc_MST4 Catalytic domain of the Protein Serine/T	99.97
cd06617		283	PKc_MKK3_6 Catalytic domain of the dual-specificit	99.97
KOG1187		361	consensus Serine/threonine protein kinase [Signal	99.97
cd06610		267	STKc_OSR1_SPAK Catalytic domain of the Protein Ser	99.97
cd06612		256	STKc_MST1_2 Catalytic domain of the Protein Serine	99.97
cd05581		280	STKc_PDK1 Catalytic domain of the Protein Serine/T	99.97
cd06655		296	STKc_PAK2 Catalytic domain of the Protein Serine/T	99.97
PHA03210		501	serine/threonine kinase US3; Provisional	99.97
cd05063		268	PTKc_EphR_A2 Catalytic domain of the Protein Tyros	99.97
cd05057		279	PTKc_EGFR_like Catalytic domain of Epidermal Growt	99.97
cd05083		254	PTKc_Chk Catalytic domain of the Protein Tyrosine	99.97
cd05070		260	PTKc_Fyn_Yrk Catalytic domain of the Protein Tyros	99.97
cd07842		316	STKc_CDK8_like Catalytic domain of Cyclin-Dependen	99.97
cd05107		401	PTKc_PDGFR_beta Catalytic domain of the Protein Ty	99.97
cd05085		250	PTKc_Fer Catalytic domain of the Protein Tyrosine	99.97
cd05042		269	PTKc_Aatyk Catalytic domain of the Protein Tyrosin	99.97
KOG0285		460	consensus Pleiotropic regulator 1 [RNA processing	99.97
cd07860		284	STKc_CDK2_3 Catalytic domain of the Serine/Threoni	99.97
cd05071		262	PTKc_Src Catalytic domain of the Protein Tyrosine	99.97
cd06608		275	STKc_myosinIII_like Catalytic domain of Class III	99.97
cd07845		309	STKc_CDK10 Catalytic domain of the Serine/Threonin	99.97
cd05065		269	PTKc_EphR_B Catalytic domain of the Protein Tyrosi	99.97
cd05056		270	PTKc_FAK Catalytic domain of the Protein Tyrosine	99.97
cd05067		260	PTKc_Lck_Blk Catalytic domain of the Protein Tyros	99.97
cd08218		256	STKc_Nek1 Catalytic domain of the Protein Serine/T	99.97
cd06605		265	PKc_MAPKK Catalytic domain of the dual-specificity	99.97
cd06623		264	PKc_MAPKK_plant_like Catalytic domain of Plant dua	99.97
cd06620		284	PKc_MAPKK_Byr1_like Catalytic domain of fungal Byr	99.97
cd08217		265	STKc_Nek2 Catalytic domain of the Protein Serine/T	99.97
cd07846		286	STKc_CDKL2_3 Catalytic domain of the Serine/Threon	99.97
cd05041		251	PTKc_Fes_like Catalytic domain of Fes-like Protein	99.97
cd08224		267	STKc_Nek6_Nek7 Catalytic domain of the Protein Ser	99.97
smart00219		258	TyrKc Tyrosine kinase, catalytic domain. Phosphotr	99.97
cd05613		290	STKc_MSK1_N N-terminal catalytic domain of the Pro	99.97
cd05077		262	PTK_Jak1_rpt1 Pseudokinase (repeat 1) domain of th	99.97
cd05040		257	PTKc_Ack_like Catalytic domain of the Protein Tyro	99.97
cd05112		256	PTKc_Itk Catalytic domain of the Protein Tyrosine	99.97
cd05577		277	STKc_GRK Catalytic domain of the Protein Serine/Th	99.97
cd06636		282	STKc_MAP4K4_6 Catalytic domain of the Protein Seri	99.97
KOG1035		1351	consensus eIF-2alpha kinase GCN2 [Translation, rib	99.97
cd08220		256	STKc_Nek8 Catalytic domain of the Protein Serine/T	99.97
cd05047		270	PTKc_Tie Catalytic domain of Tie Protein Tyrosine	99.97
cd06607		307	STKc_TAO Catalytic domain of the Protein Serine/Th	99.97
cd06642		277	STKc_STK25-YSK1 Catalytic domain of the Protein Se	99.97
cd08229		267	STKc_Nek7 Catalytic domain of the Protein Serine/T	99.97
cd05103		343	PTKc_VEGFR2 Catalytic domain of the Protein Tyrosi	99.97
cd06641		277	STKc_MST3 Catalytic domain of the Protein Serine/T	99.97
cd07836		284	STKc_Pho85 Catalytic domain of the Serine/Threonin	99.97
cd05044		269	PTKc_c-ros Catalytic domain of the Protein Tyrosin	99.97
cd06606		260	STKc_MAPKKK Catalytic domain of the Protein Serine	99.97
cd05078		258	PTK_Jak2_Jak3_rpt1 Pseudokinase (repeat 1) domain	99.97
cd07858		337	STKc_TEY_MAPK_plant Catalytic domain of the Serine	99.97
cd05087		269	PTKc_Aatyk1_Aatyk3 Catalytic domain of the Protein	99.97
cd05081		284	PTKc_Jak2_Jak3_rpt2 Catalytic (repeat 2) domain of	99.97
cd07835		283	STKc_CDK1_like Catalytic domain of Cyclin-Dependen	99.97
cd05076		274	PTK_Tyk2_rpt1 Pseudokinase (repeat 1) domain of th	99.97
cd07837		295	STKc_CdkB_plant Catalytic domain of the Serine/Thr	99.97
cd06639		291	STKc_myosinIIIB Catalytic domain of the Protein Se	99.97
cd06627		254	STKc_Cdc7_like Catalytic domain of Cell division c	99.97
KOG0194		474	consensus Protein tyrosine kinase [Signal transduc	99.97
cd05069		260	PTKc_Yes Catalytic domain of the Protein Tyrosine	99.97
cd05058		262	PTKc_Met_Ron Catalytic domain of the Protein Tyros	99.97
cd06658		292	STKc_PAK5 Catalytic domain of the Protein Serine/T	99.97
cd06917		277	STKc_NAK1_like Catalytic domain of Fungal Nak1-lik	99.97
KOG0696		683	consensus Serine/threonine protein kinase [Signal	99.97
cd05073		260	PTKc_Hck Catalytic domain of the Protein Tyrosine	99.97
PHA02882		294	putative serine/threonine kinase; Provisional	99.97
cd07833		288	STKc_CDKL Catalytic domain of Cyclin-Dependent pro	99.97
cd05122		253	PKc_STE Catalytic domain of STE family Protein Kin	99.97
PLN00009		294	cyclin-dependent kinase A; Provisional	99.97
cd06624		268	STKc_ASK Catalytic domain of the Protein Serine/Th	99.97
KOG0986		591	consensus G protein-coupled receptor kinase [Signa	99.97
cd08215		258	STKc_Nek Catalytic domain of the Protein Serine/Th	99.97
cd07840		287	STKc_CDK9_like Catalytic domain of Cyclin-Dependen	99.97
KOG0614		732	consensus cGMP-dependent protein kinase [Signal tr	99.97
cd06635		317	STKc_TAO1 Catalytic domain of the Protein Serine/T	99.97
cd05086		268	PTKc_Aatyk2 Catalytic domain of the Protein Tyrosi	99.97
cd06653		264	STKc_MEKK3_like_1 Catalytic domain of MAP/ERK kina	99.97
KOG0279		315	consensus G protein beta subunit-like protein [Sig	99.97
cd08226		328	PK_STRAD_beta Pseudokinase domain of STE20-related	99.97
cd05038		284	PTKc_Jak_rpt2 Catalytic (repeat 2) domain of the P	99.97
cd05037		259	PTK_Jak_rpt1 Pseudokinase (repeat 1) domain of the	99.97
cd07854		342	STKc_MAPK4_6 Catalytic domain of the Serine/Threon	99.97
cd08216		314	PK_STRAD Pseudokinase domain of STE20-related kina	99.97
cd06633		313	STKc_TAO3 Catalytic domain of the Protein Serine/T	99.97
cd07834		330	STKc_MAPK Catalytic domain of the Serine/Threonine	99.97
cd05110		303	PTKc_HER4 Catalytic domain of the Protein Tyrosine	99.97
cd05579		265	STKc_MAST_like Catalytic domain of Microtubule-ass	99.97
cd08225		257	STKc_Nek5 Catalytic domain of the Protein Serine/T	99.97
cd07866		311	STKc_BUR1 Catalytic domain of the Serine/Threonine	99.97
PTZ00024		335	cyclin-dependent protein kinase; Provisional	99.97
cd05611		260	STKc_Rim15_like Catalytic domain of fungal Rim15-l	99.97
cd06621		287	PKc_MAPKK_Pek1_like Catalytic domain of fungal Pek	99.97
cd06616		288	PKc_MKK4 Catalytic domain of the dual-specificity	99.97
cd07852		337	STKc_MAPK15 Catalytic domain of the Serine/Threoni	99.97
cd07857		332	STKc_MPK1 Catalytic domain of the Serine/Threonine	99.97
cd06618		296	PKc_MKK7 Catalytic domain of the dual-specificity	99.97
cd08530		256	STKc_CNK2-like Catalytic domain of the Protein Ser	99.97
cd06659		297	STKc_PAK6 Catalytic domain of the Protein Serine/T	99.97
cd07880		343	STKc_p38gamma_MAPK12 Catalytic domain of the Serin	99.97
cd07879		342	STKc_p38delta_MAPK13 Catalytic domain of the Serin	99.97
cd07838		287	STKc_CDK4_6_like Catalytic domain of Cyclin-Depend	99.97
PHA03390		267	pk1 serine/threonine-protein kinase 1; Provisional	99.97
cd06614		286	STKc_PAK Catalytic domain of the Protein Serine/Th	99.97
cd06647		293	STKc_PAK_I Catalytic domain of the Protein Serine/	99.97
cd07851		343	STKc_p38 Catalytic domain of the Serine/Threonine	99.97
cd05074		273	PTKc_Tyro3 Catalytic domain of the Protein Tyrosin	99.97
cd07877		345	STKc_p38alpha_MAPK14 Catalytic domain of the Serin	99.97
cd07856		328	STKc_Sty1_Hog1 Catalytic domain of the Serine/Thre	99.97
cd05583		288	STKc_MSK_N N-terminal catalytic domain of the Prot	99.97
cd06634		308	STKc_TAO2 Catalytic domain of the Protein Serine/T	99.97
cd05123		250	STKc_AGC Catalytic domain of AGC family Protein Se	99.97
cd07864		302	STKc_CDK12 Catalytic domain of the Serine/Threonin	99.97
cd08222		260	STKc_Nek11 Catalytic domain of the Protein Serine/	99.97
cd07830		283	STKc_MAK_like Catalytic domain of Male germ cell-A	99.97
KOG0281		499	consensus Beta-TrCP (transducin repeats containing	99.97
cd06648		285	STKc_PAK_II Catalytic domain of the Protein Serine	99.97
cd08528		269	STKc_Nek10 Catalytic domain of the Protein Serine/	99.97
KOG1095		1025	consensus Protein tyrosine kinase [Signal transduc	99.97
cd07829		282	STKc_CDK_like Catalytic domain of Cyclin-Dependent	99.96
cd05610		669	STKc_MASTL Catalytic domain of the Protein Serine/	99.96
KOG0271		480	consensus Notchless-like WD40 repeat-containing pr	99.96
KOG0603		612	consensus Ribosomal protein S6 kinase [Signal tran	99.96
cd05118		283	STKc_CMGC Catalytic domain of CMGC family Serine/T	99.96
cd06657		292	STKc_PAK4 Catalytic domain of the Protein Serine/T	99.96
KOG0279		315	consensus G protein beta subunit-like protein [Sig	99.96
KOG1151		775	consensus Tousled-like protein kinase [Signal tran	99.96
KOG1094		807	consensus Discoidin domain receptor DDR1 [Signal t	99.96
KOG0296		399	consensus Angio-associated migratory cell protein	99.96
KOG0608		1034	consensus Warts/lats-like serine threonine kinases	99.96
cd05576		237	STKc_RPK118_like Catalytic domain of the Protein S	99.96
KOG0284		464	consensus Polyadenylation factor I complex, subuni	99.96
KOG1027		903	consensus Serine/threonine protein kinase and endo	99.96
KOG0284		464	consensus Polyadenylation factor I complex, subuni	99.96
KOG0671		415	consensus LAMMER dual specificity kinases [Signal	99.96
KOG0315		311	consensus G-protein beta subunit-like protein (con	99.96
KOG0282		503	consensus mRNA splicing factor [Function unknown]	99.96
cd00200		289	WD40 WD40 domain, found in a number of eukaryotic	99.96
KOG0315		311	consensus G-protein beta subunit-like protein (con	99.96
KOG0665		369	consensus Jun-N-terminal kinase (JNK) [Signal tran	99.96
KOG4257		974	consensus Focal adhesion tyrosine kinase FAK, cont	99.96
KOG4250		732	consensus TANK binding protein kinase TBK1 [Signal	99.96
KOG0293		519	consensus WD40 repeat-containing protein [Function	99.96
KOG0265		338	consensus U5 snRNP-specific protein-like factor an	99.96
KOG0199		1039	consensus ACK and related non-receptor tyrosine ki	99.96
KOG0266		456	consensus WD40 repeat-containing protein [General	99.95
KOG0695		593	consensus Serine/threonine protein kinase [Signal	99.95
KOG1006		361	consensus Mitogen-activated protein kinase (MAPK)	99.95
KOG0196		996	consensus Tyrosine kinase, EPH (ephrin) receptor f	99.95
PLN03225		566	Serine/threonine-protein kinase SNT7; Provisional	99.95
KOG0587		953	consensus Traf2- and Nck-interacting kinase and re	99.95
KOG4278		1157	consensus Protein tyrosine kinase [Signal transduc	99.95
KOG0273		524	consensus Beta-transducin family (WD-40 repeat) pr	99.95
KOG0668		338	consensus Casein kinase II, alpha subunit [Signal	99.95
KOG0263		707	consensus Transcription initiation factor TFIID, s	99.95
KOG1152		772	consensus Signal transduction serine/threonine kin	99.95
KOG0670		752	consensus U4/U6-associated splicing factor PRP4 [R	99.95
KOG3653		534	consensus Transforming growth factor beta/activin	99.95
KOG2052		513	consensus Activin A type IB receptor, serine/threo	99.94
KOG0664		449	consensus Nemo-like MAPK-related serine/threonine	99.94
KOG0645		312	consensus WD40 repeat protein [General function pr	99.94
smart00220		244	S_TKc Serine/Threonine protein kinases, catalytic	99.94
KOG0291		893	consensus WD40-repeat-containing subunit of the 18	99.94
KOG0275		508	consensus Conserved WD40 repeat-containing protein	99.94
KOG0273		524	consensus Beta-transducin family (WD-40 repeat) pr	99.94
KOG0319		775	consensus WD40-repeat-containing subunit of the 18	99.94
KOG0640		430	consensus mRNA cleavage stimulating factor complex	99.94
KOG1025		1177	consensus Epidermal growth factor receptor EGFR an	99.94
PLN00113		968	leucine-rich repeat receptor-like protein kinase;	99.94
KOG0263		707	consensus Transcription initiation factor TFIID, s	99.94
PLN03224		507	probable serine/threonine protein kinase; Provisio	99.94
KOG0286		343	consensus G-protein beta subunit [General function	99.94
KOG1290		590	consensus Serine/threonine protein kinase [Signal	99.93
KOG1345		378	consensus Serine/threonine kinase [Signal transduc	99.93
KOG0984		282	consensus Mitogen-activated protein kinase (MAPK)	99.93
KOG0291		893	consensus WD40-repeat-containing subunit of the 18	99.93
KOG0285		460	consensus Pleiotropic regulator 1 [RNA processing	99.93
KOG0318		603	consensus WD40 repeat stress protein/actin interac	99.93
KOG0200		609	consensus Fibroblast/platelet-derived growth facto	99.93
KOG0316		307	consensus Conserved WD40 repeat-containing protein	99.93
KOG0645		312	consensus WD40 repeat protein [General function pr	99.92
KOG0295		406	consensus WD40 repeat-containing protein [Function	99.92
KOG0313		423	consensus Microtubule binding protein YTM1 (contai	99.92
KOG0281		499	consensus Beta-TrCP (transducin repeats containing	99.92
KOG0643		327	consensus Translation initiation factor 3, subunit	99.92
KOG0276		794	consensus Vesicle coat complex COPI, beta' subunit	99.92
KOG0268		433	consensus Sof1-like rRNA processing protein (conta	99.92
KOG0319		775	consensus WD40-repeat-containing subunit of the 18	99.92
KOG0266		456	consensus WD40 repeat-containing protein [General	99.92
cd00180		215	PKc Catalytic domain of Protein Kinases. Protein K	99.92
KOG0576		829	consensus Mitogen-activated protein kinase kinase	99.91
KOG0306		888	consensus WD40-repeat-containing subunit of the 18	99.91
KOG0293		519	consensus WD40 repeat-containing protein [Function	99.91
KOG0265		338	consensus U5 snRNP-specific protein-like factor an	99.91
KOG0318		603	consensus WD40 repeat stress protein/actin interac	99.91
KOG0278		334	consensus Serine/threonine kinase receptor-associa	99.9
KOG0274		537	consensus Cdc4 and related F-box and WD-40 protein	99.9
KOG0292		1202	consensus Vesicle coat complex COPI, alpha subunit	99.9
KOG1407		313	consensus WD40 repeat protein [Function unknown]	99.9
KOG0274		537	consensus Cdc4 and related F-box and WD-40 protein	99.9
KOG1167		418	consensus Serine/threonine protein kinase of the C	99.9
KOG0292		1202	consensus Vesicle coat complex COPI, alpha subunit	99.9
KOG0288		459	consensus WD40 repeat protein TipD [General functi	99.9
KOG0277		311	consensus Peroxisomal targeting signal type 2 rece	99.9
KOG0278		334	consensus Serine/threonine kinase receptor-associa	99.9
KOG0316		307	consensus Conserved WD40 repeat-containing protein	99.89
cd00200		289	WD40 WD40 domain, found in a number of eukaryotic	99.89
KOG0313		423	consensus Microtubule binding protein YTM1 (contai	99.89
KOG0296		399	consensus Angio-associated migratory cell protein	99.89
PLN00181		793	protein SPA1-RELATED; Provisional	99.89
smart00221		225	STYKc Protein kinase; unclassified specificity. Ph	99.89
KOG0643		327	consensus Translation initiation factor 3, subunit	99.89
KOG1446		311	consensus Histone H3 (Lys4) methyltransferase comp	99.89
KOG0973		942	consensus Histone transcription regulator HIRA, WD	99.88
KOG0282		503	consensus mRNA splicing factor [Function unknown]	99.88
KOG0277		311	consensus Peroxisomal targeting signal type 2 rece	99.88
KOG0300		481	consensus WD40 repeat-containing protein [Function	99.88
KOG1024		563	consensus Receptor-like protein tyrosine kinase RY	99.88
KOG0276		794	consensus Vesicle coat complex COPI, beta' subunit	99.88
KOG0289		506	consensus mRNA splicing factor [General function p	99.88
KOG0310		487	consensus Conserved WD40 repeat-containing protein	99.88
KOG0305		484	consensus Anaphase promoting complex, Cdc20, Cdh1,	99.88
KOG0640		430	consensus mRNA cleavage stimulating factor complex	99.88
KOG2096		420	consensus WD40 repeat protein [General function pr	99.87
PTZ00421		493	coronin; Provisional	99.87
KOG0308		735	consensus Conserved WD40 repeat-containing protein	99.87
KOG0647		347	consensus mRNA export protein (contains WD40 repea	99.87
KOG0772		641	consensus Uncharacterized conserved protein, conta	99.87
PTZ00420		568	coronin; Provisional	99.87
PTZ00421		493	coronin; Provisional	99.87
KOG0283		712	consensus WD40 repeat-containing protein [Function	99.87
KOG1036		323	consensus Mitotic spindle checkpoint protein BUB3,	99.87
KOG0288		459	consensus WD40 repeat protein TipD [General functi	99.87
PTZ00420		568	coronin; Provisional	99.86
KOG0300		481	consensus WD40 repeat-containing protein [Function	99.86
KOG4283		397	consensus Transcription-coupled repair protein CSA	99.86
KOG0305		484	consensus Anaphase promoting complex, Cdc20, Cdh1,	99.86
KOG0289		506	consensus mRNA splicing factor [General function p	99.85
KOG0641		350	consensus WD40 repeat protein [General function pr	99.85
KOG0639		705	consensus Transducin-like enhancer of split protei	99.85
KOG0294		362	consensus WD40 repeat-containing protein [Function	99.85
KOG0306		888	consensus WD40-repeat-containing subunit of the 18	99.85
KOG0301		745	consensus Phospholipase A2-activating protein (con	99.85
smart00750		176	KIND kinase non-catalytic C-lobe domain. It is an	99.85
KOG0641		350	consensus WD40 repeat protein [General function pr	99.85
KOG0264		422	consensus Nucleosome remodeling factor, subunit CA	99.84

>KOG1240 consensus Protein kinase containing WD40 repeats [Signal transduction mechanisms]	Back alignment and domain information

Probab=100.00  E-value=5.3e-220  Score=1973.51  Aligned_cols=1405  Identities=40%  Similarity=0.614  Sum_probs=1034.7

Q ss_pred             CCCccccCccccccccccccCCCccceEEEEEeeccCcEEEEEEEECCceEEEEEEeccCCCcCHHHHHHHHHHHHHHHh
Q 000410            1 MGNKIAKTTQASATEYYLHDLPSSYNLVLKEVLGGSRFFKSILCKHDEGLVLVKVYFKRGDYIDLREYERRLFHIRETFR   80 (1553)
Q Consensus         1 Mgn~~s~~~~~~~~~~~~~~l~~~~~y~~~~~LG~G~fg~V~~a~~~~~~vavKv~~~~~~~~~~~~~~~~l~~e~~~l~   80 (1553)
                      ||||++.|+|+.+++.|+.++..  +|.+.+.||+++|.+|++|++++|.|+||||.++++..+++.+.++++++.  ..
T Consensus         1 MGnqls~~sQi~~~e~yfsd~~~--e~~~~~~LGstRFlKv~r~k~~eG~vVvKVFvk~~p~~sL~~~~qrL~~ik--~~   76 (1431)
T KOG1240|consen    1 MGNQLSLPSQISPVEVYFSDLSV--ECHYVENLGSTRFLKVARAKDREGLVVVKVFVKQDPTISLRPFKQRLEEIK--FA   76 (1431)
T ss_pred             CCcccccccccchHHHHhhcCcc--ceeeecccCchhhhhhhhccCCCceEEEEEEeccCCCCCchHHHHHHHHHH--HH
Confidence            99999999999999999999987  788999999999999999999999999999999998999999999998876  56


Q ss_pred             cCCCCCeeEEEEEEEeCCEEEEEeccccCCHHHHhcCCCCCCHHHHHHHHHHHHHHHHHHHHCCCeecCCCCCcEEEecC
Q 000410           81 SIDHPHVWAFQFWQETDKAAYLLRQYFFNSLRDRLSTPPFLSLVEKKWLAFQLLLAVKQCHEKGICHGDIKCENVLVTSW  160 (1553)
Q Consensus        81 ~l~hpnIv~~~~~~~~~~~~~lV~E~~~gsL~d~l~~~~~l~~~~~~~i~~Qll~aL~~LH~~gIvHrDIKp~NILv~~~  160 (1553)
                      .++|||+++|..+.+++++.|||++|+..+|+|+++.||+|...|++||++||+.||..||..||+|||||.|||||++|
T Consensus        77 l~~~pn~lPfqk~~~t~kAAylvRqyvkhnLyDRlSTRPFL~~iEKkWiaFQLL~al~qcH~~gVcHGDIKsENILiTSW  156 (1431)
T KOG1240|consen   77 LMKAPNCLPFQKVLVTDKAAYLVRQYVKHNLYDRLSTRPFLVLIEKKWIAFQLLKALSQCHKLGVCHGDIKSENILITSW  156 (1431)
T ss_pred             hhcCCcccchHHHHHhhHHHHHHHHHHhhhhhhhhccchHHHHHHHHHHHHHHHHHHHHHHHcCccccccccceEEEeee
Confidence            67899999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CcEEEeecCccccccCCCCCCCCcceeeecCCCCccccCcchhcccCCccccccCCC-CCCcccHHHHHHHHHHHHcC-C
Q 000410          161 NWLYLSDFASFKPTYIPYDDPSDFSFFFDTGGKRLCYLAPERFYEHGGEMQVAQDAP-LKPSMDIFAVGCVIAELFLE-V  238 (1553)
Q Consensus       161 ~~vkL~DFG~a~~~~~~~~~~~~~~~~~~~~~gt~~Y~APE~~~~~~~~~~~~~~~~-~t~~~DIwSlG~il~eLltg-~  238 (1553)
                      +|+.|+||..+||+++|+++|++|.++|+|..++.||+|||+|....+..+..+... ++++|||||+||+++||++. +
T Consensus       157 NW~~LtDFAsFKPtYLPeDNPadf~fFFDTSrRRtCYiAPERFv~~~~~~~~~q~~~~L~paMDIFS~GCViaELf~Eg~  236 (1431)
T KOG1240|consen  157 NWLYLTDFASFKPTYLPEDNPADFTFFFDTSRRRTCYIAPERFVSALGKTSVGQDAPLLTPAMDIFSAGCVIAELFLEGR  236 (1431)
T ss_pred             chhhhhcccccCCccCCCCCcccceEEEecCCceeeecChHhhhccccccccCCcccccChhhhhhhhhHHHHHHHhcCC
Confidence            999999999999999999999999999999999999999999987665444455555 89999999999999999986 9


Q ss_pred             CCCCchHHHHHHhc-CCCCCCCCCCCCCHHHHHHHHHhcccCcCCCCCHHHHHHhhhcccCCCCCCchhhhhhccCCCCC
Q 000410          239 PFFELSHLLAYRRG-QYDPSQHLEKIPDSGIRKMILHMIQLEPELRFSAESYLQNYAAVVFPTYFSPFLHNFYCCWNPLH  317 (1553)
Q Consensus       239 ~pf~~~~~~~~~~~-~~~~~~~~~~~~~~~l~~LI~~mL~~dP~~Rpsa~elL~~~~~~~fP~~f~~fl~~~~~~~~~~~  317 (1553)
                      |+|+++++.+|+.+ .+.+...++++.+..+++||..|++.||.+|.+|+++|+++++.+||+|||+|||+|+..+.++.
T Consensus       237 PlF~LSQL~aYr~~~~~~~e~~Le~Ied~~~Rnlil~Mi~rdPs~RlSAedyL~~yrG~~FP~yFy~FL~~Y~~~~~~~~  316 (1431)
T KOG1240|consen  237 PLFTLSQLLAYRSGNADDPEQLLEKIEDVSLRNLILSMIQRDPSKRLSAEDYLQKYRGLVFPEYFYSFLYDYLDRFVPLT  316 (1431)
T ss_pred             CcccHHHHHhHhccCccCHHHHHHhCcCccHHHHHHHHHccCchhccCHHHHHHhhhccccHHHHHHHHHHHHHhcCCcc
Confidence            99999999999998 55666788999999999999999999999999999999999999999999999999999998877


Q ss_pred             CcchhhhhccchHHHHHhhcCCCCCCCCCCCCCCCCcCCchhhHHHHHHHHhHHHHHHHhhHHHHHhhhccccchhcccc
Q 000410          318 SDMRVAMCRSVFPEILKQMMGNKSSEDIGSGVGTPSTAMSVKESQERVTKQNLNLAKALLEKREEMEKGRVQNRFRLLGD  397 (1553)
Q Consensus       318 ~~~r~~~~~~~~~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  397 (1553)
                      ....+..          .-+.+...++.            ++..++-.++                          ...|
T Consensus       317 ~~~p~~~----------~~~~gs~i~d~------------~~~~~~p~n~--------------------------~~~~  348 (1431)
T KOG1240|consen  317 TSTPISD----------NTCTGSTIEDN------------VKLLDGPTNK--------------------------IYRD  348 (1431)
T ss_pred             ccCcccc----------ccccCcccccc------------cccccCcccc--------------------------hhhh
Confidence            3322221          11111111111            0000000011                          1234


Q ss_pred             ccccccCCCCCCccCCCCCCCCCCCCCcccccccCccccccchhhhhhhhhhhcCCCCcccccccccccccccccCCCCC
Q 000410          398 ISTLIGDGKESNQCSNVKPMPEDVPNSTFSQDLRNSSVESSGELLQSISDAFRKNGHPFLKKITMNNLSSLMSEYDSQSD  477 (1553)
Q Consensus       398 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  477 (1553)
                      +..+|+.......+.                 .+.  ..+.++.+..+.+....+.+++.......++-.....|++.++
T Consensus       349 ~~~~~h~ln~~~~~~-----------------~~~--~~S~De~~~~~~~al~~~r~~~~~l~~~~dl~~~~q~~~~~~~  409 (1431)
T KOG1240|consen  349 FSQICHCLNFPLIKD-----------------GGT--ITSSDEIIDSISKALEFSRHLIENLDVIQDLKPEKQLWTARSS  409 (1431)
T ss_pred             hhccccccccccccc-----------------ccc--ccCCcHHHHHHHHHHhhhhhhcccchhhhccchHHhcccccCC
Confidence            444555444221110                 000  0122333333333332222233322222222122224444332


Q ss_pred             CCCCCCCCCCCCCccccceehhhHHHHhhhcccCCchhHHHHHHHHHHHhccCCcccccccccceeeecccCCCchhHHH
Q 000410          478 TFGMPFLPLPEDSMKCEGIVLIASLLCSCVRNVKLPHYRRAAILLLKSSSLFIDDEDRLQRVLPHVIAMLSDPAAIVRCA  557 (1553)
Q Consensus       478 ~~~~~~~~~~~~~~~~~~~~i~l~~i~s~~R~~~~~~sk~~al~ll~~~s~~~~de~~ldrilPy~~~ll~d~~~~Vr~~  557 (1553)
                      .+        ....+++|++||+++||||||+++.+++|++||+||..||+|++||.||||||||+|+|+.|+.+.|||+
T Consensus       410 ~~--------~~~~~~~ga~l~vs~lts~IR~lk~~~tK~~ALeLl~~lS~~i~de~~LDRVlPY~v~l~~Ds~a~Vra~  481 (1431)
T KOG1240|consen  410 PN--------IKDPKEEGAVLFVSVLTSCIRALKTIQTKLAALELLQELSTYIDDEVKLDRVLPYFVHLLMDSEADVRAT  481 (1431)
T ss_pred             cc--------cCCccccceeeeHHHHHHHHHhhhcchhHHHHHHHHHHHhhhcchHHHHhhhHHHHHHHhcCchHHHHHH
Confidence            21        1246789999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHhcccccccCCCCCCccccccccccCCCCCC-CCchhhHHHHhhHHHHHHHHHHHHHHHHHhhhcccccccCCC
Q 000410          558 ALETLCDILPLVRNFPPSDAKIFPEYILPMLSMLPDD-PEESVRICYASNIAKLALTAYGFLVHSIRLSEAGVLDKLSAP  636 (1553)
Q Consensus       558 al~~l~~~l~~v~~~~~~~~~iF~eYilP~l~~l~~d-~~~~vr~~~A~~l~~LA~~a~rfl~~~~~~~~~~~~~~~~~~  636 (1553)
                      ||+|||++|.+|+.+||+|+|||||||||.|++|+.| ...+||+|||+||+.||.||.||||.+|.++..|.++..+++
T Consensus       482 Al~Tlt~~L~~Vr~~~~~daniF~eYlfP~L~~l~~d~~~~~vRiayAsnla~LA~tA~rFle~~q~~~~~g~~n~~nse  561 (1431)
T KOG1240|consen  482 ALETLTELLALVRDIPPSDANIFPEYLFPHLNHLLNDSSAQIVRIAYASNLAQLAKTAYRFLELTQELRQAGMLNDPNSE  561 (1431)
T ss_pred             HHHHHHHHHhhccCCCcccchhhHhhhhhhhHhhhccCccceehhhHHhhHHHHHHHHHHHHHHHHHHHhcccccCcccc
Confidence            9999999999999999999999999999999999999 789999999999999999999999999999988877654321


Q ss_pred             CCCCCCCCccchhhhccchHHHHHHHHHHHHHHHHHHhcCCCCChHHHHHHHhcccchhcccCccccccccccccccccc
Q 000410          637 HKSPSSSNETSVQLQRLNADVQLSQLRKSIAEVVQELVMGPKQTPSIRRALLQDIGNLCSFFGQRQSNDFLLPILPAFLN  716 (1553)
Q Consensus       637 ~~~~~~~~~~~~~~~~~~~~~~l~~l~~~~~~~~~~ll~~~~~~~~vk~all~~i~~Lc~FfG~~ktnd~iL~hlit~LN  716 (1553)
                               + ..+.  ++++++++|++.+++.|++||+  |+++.||||||++|.+||+||||+|+||+||||||||||
T Consensus       562 ---------t-~~~~--~~~~~~~~L~~~V~~~v~sLls--d~~~~Vkr~Lle~i~~LC~FFGk~ksND~iLshLiTfLN  627 (1431)
T KOG1240|consen  562 ---------T-APEQ--NYNTELQALHHTVEQMVSSLLS--DSPPIVKRALLESIIPLCVFFGKEKSNDVILSHLITFLN  627 (1431)
T ss_pred             ---------c-cccc--ccchHHHHHHHHHHHHHHHHHc--CCchHHHHHHHHHHHHHHHHhhhcccccchHHHHHHHhc
Confidence                     0 1222  3467999999999999999999  467999999999999999999999999999999999999


Q ss_pred             CCChhHHHHHHhccceeeeeeccchhhHhHHHHHHhhcCCCchHHHHHHHHHHHHHHHcCCCchHHHHHHHHhhcccccC
Q 000410          717 DRDEQLRAVFYGQIVYVCFFVGERSVEEYLLPYIEQALSDATEAVIVNALDCLAILCKSGYLRKRILLEMIERAFPLLCY  796 (1553)
Q Consensus       717 d~d~~LR~aff~~i~~v~~~vG~~s~e~~ilPll~q~l~D~ee~Vv~~~l~~l~~l~~~gl~~k~~~~~~~~~~~~ll~H  796 (1553)
                      ||||+||+||||+|+|||.||||+|+|+||||||+|||+|+||+||++||+||+.|||+|||+|+++.|++..|+|||||
T Consensus       628 DkDw~LR~aFfdsI~gvsi~VG~rs~seyllPLl~Q~ltD~EE~Viv~aL~~ls~Lik~~ll~K~~v~~i~~~v~PlL~h  707 (1431)
T KOG1240|consen  628 DKDWRLRGAFFDSIVGVSIFVGWRSVSEYLLPLLQQGLTDGEEAVIVSALGSLSILIKLGLLRKPAVKDILQDVLPLLCH  707 (1431)
T ss_pred             CccHHHHHHHHhhccceEEEEeeeeHHHHHHHHHHHhccCcchhhHHHHHHHHHHHHHhcccchHHHHHHHHhhhhheeC
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CcHHHHHHHHHHHHHHhhcCCccceeEEEeeccccccccCCCccCCHHHHHhccCCCCcHHHHHHHHHHhh-hchHHHHH
Q 000410          797 PSQWVRRSVVTFIAASSESLGAVDSYVFLAPVIRPFLRRQPASLASVKALLSCLKPPVSREVFYQVLENAR-SSDMLERQ  875 (1553)
Q Consensus       797 Pn~wiR~~~~~~i~~~~~~l~~ad~~c~l~P~~~p~l~~~~~~~~~~~~ll~~l~~p~sr~v~~~~~~~~~-~~~~~~~~  875 (1553)
                      ||.|||+++++||++++++|+.|||||+|||+|||||+.++.++.+++.|++||||||||+||+++++|.. ...-..-+
T Consensus       708 PN~WIR~~~~~iI~~~~~~ls~advyc~l~P~irpfl~~~v~~i~s~~~LlsclkpPVsRsv~~~l~r~~~ens~f~k~l  787 (1431)
T KOG1240|consen  708 PNLWIRRAVLGIIAAIARQLSAADVYCKLMPLIRPFLERPVIQIESKEVLLSCLKPPVSRSVFNQLLRWSDENSSFWKKL  787 (1431)
T ss_pred             chHHHHHHHHHHHHHHHhhhhhhhheEEeehhhHHhhhccHhhhcchHHHHHHhcCCCcHHHHHHHHHHhhcchHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999986 22222333


Q ss_pred             hhhhcccCCCChhhhhHHhhhcCCCcccccccCCcccCCcCCCCCCCCCCCCCcccCCCcC--------hhhhHhhcccc
Q 000410          876 RKIWYNTSSQSKQQETADLLKRGAEDLSSIKCWPDKQQSSEGHRPAGDTSKQPEFAQSDDN--------DGAKLRTLGSL  947 (1553)
Q Consensus       876 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~--------~~~kl~~~~~~  947 (1553)
                      +..|+..+.+++.|..++...+..+...+-.....+       .+..+....-+-.++.++        +.|+..+++.+
T Consensus       788 ~~~~~~s~~~s~d~~~~~~~~k~~g~l~~~e~~~~~-------~~~~~~~~~i~S~~~~e~~e~~l~~k~~~~~~~r~~~  860 (1431)
T KOG1240|consen  788 LERHYSSSGNSRDEFIKNYSSKRYGFLPFEEGAGSS-------KWSNTGFKKIKSEGKTELVEDKLLEKDIFLIRSRKPK  860 (1431)
T ss_pred             HHHhhhccCccchhhhhcchhhhcccCCccccccch-------hhhhhhcceeeccccccccccccchhchhhhcccCCc
Confidence            445555555555554322211111111111111100       011000000011133333        33444444332


Q ss_pred             hhccCccccCCCCCCC-ccccccccccccccccCccccCCCCCCCCcccccccccccCCCCCcCcccccccccccCCCCC
Q 000410          948 VYNASSMADIRDPLCP-EKLLFSGFMSQQVSGVNSLRCDKSSEGIPLYSFSMDKRAMGNLPVASDSVLQVNSLGIGSSTM 1026 (1553)
Q Consensus       948 ~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 1026 (1553)
                      ........ ..+...+ +.....++...++...+...   .+..++..++..+....++.+.........+.+.+++.+.
T Consensus       861 ~~~s~~~~-l~d~~~~~~~~~~~~v~~~~~n~~~t~~---~P~~~~~~~~~~d~n~~~~~~~~~~~~n~~~~l~~~~~~~  936 (1431)
T KOG1240|consen  861 SNISNRVL-LDDPAYPRNTNGREGVLTRQVNLVGTII---EPSNIHARVRRKDSNREGNESNMESPQNSKHLLPIGSPNK  936 (1431)
T ss_pred             cchhhhhh-hcCcccccccCCceeeeccccccccccc---ccccchhhhhhhhccccCCCccccCCCcchhhccCCCCCc
Confidence            11111110 0111111 11111222222221111111   1222333333333222111111000111111122222111


Q ss_pred             CCCccccCCCCC-CCCCCCCC-cccCCcccCCCCCccceeeccCCCCCcccc-ccccccCCCCCCCCccccccccccCCC
Q 000410         1027 PWMDTTNQSFSL-ASSVPPPN-LVSGSFSISNGSKQFYRVVHEPEGRENDQM-ASVNCKFPEMGTSGTAKGSSINVEDAS 1103 (1553)
Q Consensus      1027 ~~~~~~~~~~~~-~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~ 1103 (1553)
                      .|.+  |..... .......+ +.++++.........+.+.+.+.++.+... ..+.+.....+.............+..
T Consensus       937 ~~~~--~~~~~t~~~~~~~vp~~ts~~~~~~t~~~~~~~~~p~~ns~~~~~~~r~~~~~~dL~~~~~~~~~~~ss~~~s~ 1014 (1431)
T KOG1240|consen  937 LNHT--GSPRSTLLLDGNSVPTLTSSSVRVVTNLKPTKPVMPVPNSTANNQVERSLTCLNDLEMLTVSIPKRPSSESISH 1014 (1431)
T ss_pred             cccc--CCCcccccccCCccceeeccceeeeeccCCcccccccCCCCcccchhHHHHHHHhhhhhhhhcccccchhhccc
Confidence            1111  110000 00000001 111122111111111122222322222111 111111111111111111111111110


Q ss_pred             CCCCCCCCCCcccccCCCCCCcccCccEeeeccccccCeeEEEEcCCC-CEEEEEeCCCcEEEEeCCCCccc-cccccce
Q 000410         1104 SPADLTGLPSFVRTSSIPDSGWRPRGILVAHLQEHCSAVNEIAISHDH-SFFVSASDDSTVKVWDSRKLEKD-ISFRSRL 1181 (1553)
Q Consensus      1104 ~~~~~~g~~~~~~~~~~~~~~W~p~G~lv~~l~~H~~~V~~l~~spd~-~~laSgS~DGtVkIWD~~~~~~~-~~~~~~~ 1181 (1553)
                       +....+-|.... .+.++.+|+|+|.+|+||+||+.+|+.++.++++ .+|+|||+||||||||+++.++. .+.++++
T Consensus      1015 -p~~~~~ep~~~~-~~~p~~gW~p~G~lVAhL~Ehs~~v~k~a~s~~~~s~FvsgS~DGtVKvW~~~k~~~~~~s~rS~l 1092 (1431)
T KOG1240|consen 1015 -PCLLNSEPSAWS-VGSPPPGWNPRGILVAHLHEHSSAVIKLAVSSEHTSLFVSGSDDGTVKVWNLRKLEGEGGSARSEL 1092 (1431)
T ss_pred             -hhhhccCCchhh-cCCCCCCCCccceEeehhhhccccccceeecCCCCceEEEecCCceEEEeeehhhhcCcceeeeeE
Confidence             000111111111 1355778999999999999999999999998766 89999999999999999998866 7889999


Q ss_pred             eeecCCCceEEEEEecCCcEEEEEeCCCcEEEEEeeecccCCCccccccccccceec-ccCCCcEEEEEEecCCCCcceE
Q 000410         1182 TYHLEGSRALCTMMLRHSAQVVVGACDGIIHMFSVDHISRGLGNVEKYSGISDIKKK-DTKEGAIVTLVNYNTDNCASHM 1260 (1553)
Q Consensus      1182 ~~~~h~~~I~~l~f~~~~~~las~s~DG~I~vwdi~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~v~~~~~~~~~~s~~~ 1260 (1553)
                      +|...++++.++.++++++.+|+|+.||.|++.+++...     ..++... ..+.. ....|..|.+.+|.....+ ..
T Consensus      1093 tys~~~sr~~~vt~~~~~~~~Av~t~DG~v~~~~id~~~-----~~~~~~~-~~ri~n~~~~g~vv~m~a~~~~~~S-~~ 1165 (1431)
T KOG1240|consen 1093 TYSPEGSRVEKVTMCGNGDQFAVSTKDGSVRVLRIDHYN-----VSKRVAT-QVRIPNLKKDGVVVSMHAFTAIVQS-HV 1165 (1431)
T ss_pred             EEeccCCceEEEEeccCCCeEEEEcCCCeEEEEEccccc-----cccceee-eeecccccCCCceEEeecccccccc-ee
Confidence            999888899999999999999999999999999998421     1222222 22332 3345678888888877543 59


Q ss_pred             EEEEeCCceEEEEeCCCCcccceeccCCCCcceEEEEEcCCCCEEEEEeCCCcEEEEeCCCCcccceeeccccCCcceEE
Q 000410         1261 FMYSTQNCGIHLWDTRSNSNTWTLKAIPEEGYVSSLVTGPCGNWFVSGSSRGVLTLWDLRFLVPVNSWQYSQVCPIEKMC 1340 (1553)
Q Consensus      1261 l~~~s~dg~I~iwDlrt~~~~~~l~~~~h~g~Itsl~~sp~g~~LvsGs~dG~l~lWDlr~~~~l~s~~~~~~~~I~~l~ 1340 (1553)
                      ++++|..+.|..||+|+...+|+++++..+|.|++++.||.++|++.||+.|.+.+||+||+.++.+|.+++..+|+++.
T Consensus      1166 lvy~T~~~~iv~~D~r~~~~~w~lk~~~~hG~vTSi~idp~~~WlviGts~G~l~lWDLRF~~~i~sw~~P~~~~i~~v~ 1245 (1431)
T KOG1240|consen 1166 LVYATDLSRIVSWDTRMRHDAWRLKNQLRHGLVTSIVIDPWCNWLVIGTSRGQLVLWDLRFRVPILSWEHPARAPIRHVW 1245 (1431)
T ss_pred             EEEEEeccceEEecchhhhhHHhhhcCccccceeEEEecCCceEEEEecCCceEEEEEeecCceeecccCcccCCcceEE
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999998


Q ss_pred             eecCCCCCccccCCCCEEEEEE-cCCeEEEEEcCCCcEEEEEecccCCCCCccCCCcccccCCCCCCCCCcccccccccc
Q 000410         1341 LFVPPPNAAVSTTARPLIYVAA-GCNEVSLWNAENGSCHQVLRTANYDGDTEMSDLPWAFARPSSRSNPKTDLRRNVNQK 1419 (1553)
Q Consensus      1341 ~~~p~~~~~~~s~~~~~l~s~s-~dg~V~vWDl~tg~~~~~l~~~~~~~~~~~~~~~~~~~~p~~~~~~~~~~~~~~~~~ 1419 (1553)
                      . +|....     ....+.+++ +.++|.+|++++|.|..+++.++.  .+   .+.+.  .|...              
T Consensus      1246 ~-~~~~~~-----~S~~vs~~~~~~nevs~wn~~~g~~~~vl~~s~~--~p---~ls~~--~Ps~~-------------- 1298 (1431)
T KOG1240|consen 1246 L-CPTYPQ-----ESVSVSAGSSSNNEVSTWNMETGLRQTVLWASDG--AP---ILSYA--LPSND-------------- 1298 (1431)
T ss_pred             e-eccCCC-----CceEEEecccCCCceeeeecccCcceEEEEcCCC--Cc---chhhh--ccccc--------------
Confidence            8 554320     122344444 688999999999999999997733  11   11111  11110              


Q ss_pred             ccccccCCCCCCccCcEEeccCCCCeEEEccCCCeEEEEeCCCCCCc-eEEeCCCCCCCCCCccEEEeecCCeEEEEeee
Q 000410         1420 YRVDELNEPPPRLLGIRSLLPLPGGDLLTGGTDLKIRRWDHCSPGRS-YCICGPNLKGVGNDEFYETRSSSGVQVVQERK 1498 (1553)
Q Consensus      1420 ~~~~~l~~~~~~~~~V~sl~~sp~g~llTgg~Dg~IrlWDl~~~~~s-~~~~g~~~~~~~~~~~~~~~~~~~~~~~~e~~ 1498 (1553)
                            ...++...++.|....+++.++|||+|++||.||...++.+ +.+.|+.........+|..+...|.++++|..
T Consensus      1299 ------~~kp~~~~~~~~~~~~~~~~~ltggsd~kIR~wD~~~p~~ss~~~~~~s~~~~~~~~s~~~~~i~~~~~i~e~i 1372 (1431)
T KOG1240|consen 1299 ------ARKPDSLAGISCGVCEKNGFLLTGGSDMKIRKWDPTRPEISSYAVPGPSTSYSTNSESYDLSTIPGSQFIDEFI 1372 (1431)
T ss_pred             ------CCCCCcccceeeecccCCceeeecCCccceeeccCCCcccccccccCccccccccchhccccccCCCccchhhh
Confidence                  00123344677777778889999999999999999999998 77777766555667789999999999999865


Q ss_pred             cCCcchhhh----HHHHHhhhhcCccCCCccceeEEeeeecCCcEEEEEcCCceEEEcC
Q 000410         1499 RQPLTSKLT----AKAVLAAAATDSAGCHRDSILSLGSVKLNQRLLISSSRDGAIKVWK 1553 (1553)
Q Consensus      1499 ~~~~~~~~~----~~~~~~~~~~~~~~~H~d~I~~va~~~~~~~~LvSas~DG~IkVWk 1553 (1553)
                      ..+.+...+    .....+........+|+|.|+|++.+..++.+||++|+||+|||||
T Consensus      1373 ~~~~tv~~t~~~~~~~~~~~~~~~ps~~H~d~Itdma~~~~~q~llvs~s~dG~IkiWk 1431 (1431)
T KOG1240|consen 1373 IYQQTVGLTEALRENQKLRPGPSDPSTYHHDPITDMATLKSEQPLLVSSSRDGVIKIWK 1431 (1431)
T ss_pred             hhhhhcCchhhcccccccccCCCCCcccccchhhhhhhhccCccEEEEecCCCeeeecC
Confidence            444322222    1112222234456789999999988888899999999999999997

>PLN00181 protein SPA1-RELATED; Provisional	Back alignment and domain information

>KOG0615 consensus Serine/threonine protein kinase Chk2 and related proteins [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>KOG0575 consensus Polo-like serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>KOG0581 consensus Mitogen-activated protein kinase kinase (MAP2K) [Signal transduction mechanisms]	Back alignment and domain information

>KOG0592 consensus 3-phosphoinositide-dependent protein kinase (PDK1) [Signal transduction mechanisms]	Back alignment and domain information

>KOG0598 consensus Ribosomal protein S6 kinase and related proteins [General function prediction only; Signal transduction mechanisms]	Back alignment and domain information

>KOG0595 consensus Serine/threonine-protein kinase involved in autophagy [Posttranslational modification, protein turnover, chaperones; Intracellular trafficking, secretion, and vesicular transport; Signal transduction mechanisms]	Back alignment and domain information

>KOG0593 consensus Predicted protein kinase KKIAMRE [General function prediction only]	Back alignment and domain information

>KOG0591 consensus NIMA (never in mitosis)-related G2-specific serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>KOG0588 consensus Serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>KOG0661 consensus MAPK related serine/threonine protein kinase [Signal transduction mechanisms]	Back alignment and domain information

>KOG0597 consensus Serine-threonine protein kinase FUSED [General function prediction only]	Back alignment and domain information

>KOG0600 consensus Cdc2-related protein kinase [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>KOG0659 consensus Cdk activating kinase (CAK)/RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH/TFIIK, kinase subunit CDK7 [Cell cycle control, cell division, chromosome partitioning; Transcription; Replication, recombination and repair]	Back alignment and domain information

>KOG0583 consensus Serine/threonine protein kinase [Signal transduction mechanisms]	Back alignment and domain information

>KOG0611 consensus Predicted serine/threonine protein kinase [General function prediction only]	Back alignment and domain information

>KOG0605 consensus NDR and related serine/threonine kinases [General function prediction only]	Back alignment and domain information

>KOG0616 consensus cAMP-dependent protein kinase catalytic subunit (PKA) [Signal transduction mechanisms]	Back alignment and domain information

>KOG0582 consensus Ste20-like serine/threonine protein kinase [Signal transduction mechanisms]	Back alignment and domain information

>KOG0660 consensus Mitogen-activated protein kinase [Signal transduction mechanisms]	Back alignment and domain information

>KOG0599 consensus Phosphorylase kinase gamma subunit [Carbohydrate transport and metabolism]	Back alignment and domain information

>KOG0585 consensus Ca2+/calmodulin-dependent protein kinase kinase beta and related serine/threonine protein kinases [Signal transduction mechanisms]	Back alignment and domain information

>KOG0198 consensus MEKK and related serine/threonine protein kinases [Signal transduction mechanisms]	Back alignment and domain information

>KOG0663 consensus Protein kinase PITSLRE and related kinases [General function prediction only]	Back alignment and domain information

>KOG4717 consensus Serine/threonine protein kinase [Signal transduction mechanisms]	Back alignment and domain information

>KOG0192 consensus Tyrosine kinase specific for activated (GTP-bound) p21cdc42Hs [Signal transduction mechanisms]	Back alignment and domain information

>KOG0658 consensus Glycogen synthase kinase-3 [Carbohydrate transport and metabolism]	Back alignment and domain information

>KOG0580 consensus Serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>KOG0694 consensus Serine/threonine protein kinase [Signal transduction mechanisms]	Back alignment and domain information

>KOG0271 consensus Notchless-like WD40 repeat-containing protein [Function unknown]	Back alignment and domain information

>cd05612 STKc_PRKX_like Catalytic domain of PRKX-like Protein Serine/Threonine Kinases	Back alignment and domain information

>PTZ00263 protein kinase A catalytic subunit; Provisional	Back alignment and domain information

>KOG0033 consensus Ca2+/calmodulin-dependent protein kinase, EF-Hand protein superfamily [Signal transduction mechanisms]	Back alignment and domain information

>KOG0594 consensus Protein kinase PCTAIRE and related kinases [General function prediction only]	Back alignment and domain information

>cd05571 STKc_PKB Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B	Back alignment and domain information

>PTZ00426 cAMP-dependent protein kinase catalytic subunit; Provisional	Back alignment and domain information

>cd07871 STKc_PCTAIRE3 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-3 kinase	Back alignment and domain information

>KOG0201 consensus Serine/threonine protein kinase [Signal transduction mechanisms]	Back alignment and domain information

>KOG0667 consensus Dual-specificity tyrosine-phosphorylation regulated kinase [General function prediction only]	Back alignment and domain information

>KOG0578 consensus p21-activated serine/threonine protein kinase [Signal transduction mechanisms]	Back alignment and domain information

>cd05585 STKc_YPK1_like Catalytic domain of Yeast Protein Kinase 1-like Protein Serine/Threonine Kinases	Back alignment and domain information

>cd05593 STKc_PKB_gamma Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B gamma	Back alignment and domain information

>KOG0596 consensus Dual specificity; serine/threonine and tyrosine kinase [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>KOG0272 consensus U4/U6 small nuclear ribonucleoprotein Prp4 (contains WD40 repeats) [RNA processing and modification]	Back alignment and domain information

>cd07869 STKc_PFTAIRE1 Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-1 kinase	Back alignment and domain information

>cd05595 STKc_PKB_beta Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B beta	Back alignment and domain information

>cd05614 STKc_MSK2_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 2	Back alignment and domain information

>KOG0032 consensus Ca2+/calmodulin-dependent protein kinase, EF-Hand protein superfamily [Signal transduction mechanisms]	Back alignment and domain information

>KOG1989 consensus ARK protein kinase family [Signal transduction mechanisms]	Back alignment and domain information

>cd05584 STKc_p70S6K Catalytic domain of the Protein Serine/Threonine Kinase, 70 kDa ribosomal protein S6 kinase	Back alignment and domain information

>cd07859 STKc_TDY_MAPK_plant Catalytic domain of the Serine/Threonine Kinases, TDY Mitogen-Activated Protein Kinases from Plants	Back alignment and domain information

>KOG2345 consensus Serine/threonine protein kinase/TGF-beta stimulated factor [Transcription; Lipid transport and metabolism; Signal transduction mechanisms]	Back alignment and domain information

>KOG0193 consensus Serine/threonine protein kinase RAF [Signal transduction mechanisms]	Back alignment and domain information

>KOG0586 consensus Serine/threonine protein kinase [General function prediction only]	Back alignment and domain information

>KOG0589 consensus Serine/threonine protein kinase [General function prediction only]	Back alignment and domain information

>cd05631 STKc_GRK4 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 4	Back alignment and domain information

>cd05599 STKc_NDR_like Catalytic domain of Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases	Back alignment and domain information

>cd05600 STKc_Sid2p_Dbf2p Catalytic domain of Fungal Sid2p- and Dbf2p-like Protein Serine/Threonine Kinases	Back alignment and domain information

>KOG0610 consensus Putative serine/threonine protein kinase [General function prediction only]	Back alignment and domain information

>cd05573 STKc_ROCK_NDR_like Catalytic domain of ROCK- and NDR kinase-like Protein Serine/Threonine Kinases	Back alignment and domain information

>cd05587 STKc_cPKC Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C	Back alignment and domain information

>cd05590 STKc_nPKC_eta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C eta	Back alignment and domain information

>cd05575 STKc_SGK Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase	Back alignment and domain information

>cd07862 STKc_CDK6 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 6	Back alignment and domain information

>cd07848 STKc_CDKL5 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase Like 5	Back alignment and domain information

>cd05594 STKc_PKB_alpha Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B alpha	Back alignment and domain information

>cd05102 PTKc_VEGFR3 Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 3	Back alignment and domain information

>PHA03212 serine/threonine kinase US3; Provisional	Back alignment and domain information

>cd05628 STKc_NDR1 Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 1	Back alignment and domain information

>cd05589 STKc_PKN Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase N	Back alignment and domain information

>cd05616 STKc_cPKC_beta Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C beta	Back alignment and domain information

>cd05620 STKc_nPKC_delta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C delta	Back alignment and domain information

>cd05591 STKc_nPKC_epsilon Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C epsilon	Back alignment and domain information

>cd05592 STKc_nPKC_theta_delta Catalytic domain of the Protein Serine/Threonine Kinases, Novel Protein Kinase C theta and delta	Back alignment and domain information

>cd05596 STKc_ROCK Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase	Back alignment and domain information

>cd05588 STKc_aPKC Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C	Back alignment and domain information

>KOG4279 consensus Serine/threonine protein kinase [Signal transduction mechanisms]	Back alignment and domain information

>cd05626 STKc_LATS2 Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 2	Back alignment and domain information

>cd06649 PKc_MEK2 Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 2	Back alignment and domain information

>cd05629 STKc_NDR_like_fungal Catalytic domain of Fungal Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases	Back alignment and domain information

>cd05598 STKc_LATS Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor	Back alignment and domain information

>cd05625 STKc_LATS1 Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 1	Back alignment and domain information

>cd05619 STKc_nPKC_theta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C theta	Back alignment and domain information

>cd05618 STKc_aPKC_iota Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C iota	Back alignment and domain information

>cd07874 STKc_JNK3 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 3	Back alignment and domain information

>cd05621 STKc_ROCK2 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 2	Back alignment and domain information

>cd05570 STKc_PKC Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase C	Back alignment and domain information

>cd05582 STKc_RSK_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, 90 kDa ribosomal protein S6 kinase	Back alignment and domain information

>PTZ00267 NIMA-related protein kinase; Provisional	Back alignment and domain information

>cd05603 STKc_SGK2 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 2	Back alignment and domain information

>PLN00034 mitogen-activated protein kinase kinase; Provisional	Back alignment and domain information

>PHA02988 hypothetical protein; Provisional	Back alignment and domain information

>cd05601 STKc_CRIK Catalytic domain of the Protein Serine/Threonine Kinase, Citron Rho-interacting kinase	Back alignment and domain information

>cd05602 STKc_SGK1 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 1	Back alignment and domain information

>cd07876 STKc_JNK2 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 2	Back alignment and domain information

>KOG0197 consensus Tyrosine kinases [Signal transduction mechanisms]	Back alignment and domain information

>cd07872 STKc_PCTAIRE2 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-2 kinase	Back alignment and domain information

>cd05604 STKc_SGK3 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 3	Back alignment and domain information

>cd07875 STKc_JNK1 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 1	Back alignment and domain information

>cd05615 STKc_cPKC_alpha Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C alpha	Back alignment and domain information

>KOG4721 consensus Serine/threonine protein kinase, contains leucine zipper domain [Signal transduction mechanisms]	Back alignment and domain information

>cd05096 PTKc_DDR1 Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 1	Back alignment and domain information

>cd07863 STKc_CDK4 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 4	Back alignment and domain information

>cd05617 STKc_aPKC_zeta Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C zeta	Back alignment and domain information

>PTZ00036 glycogen synthase kinase; Provisional	Back alignment and domain information

>cd07853 STKc_NLK Catalytic domain of the Serine/Threonine Kinase, Nemo-Like Kinase	Back alignment and domain information

>cd05622 STKc_ROCK1 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 1	Back alignment and domain information

>cd05048 PTKc_Ror Catalytic Domain of the Protein Tyrosine Kinases, Receptor tyrosine kinase-like Orphan Receptors	Back alignment and domain information

>PTZ00284 protein kinase; Provisional	Back alignment and domain information

>PHA03207 serine/threonine kinase US3; Provisional	Back alignment and domain information

>cd06625 STKc_MEKK3_like Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases	Back alignment and domain information

>cd05608 STKc_GRK1 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 1	Back alignment and domain information

>cd05627 STKc_NDR2 Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 2	Back alignment and domain information

>PTZ00283 serine/threonine protein kinase; Provisional	Back alignment and domain information

>cd07868 STKc_CDK8 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 8	Back alignment and domain information

>cd06650 PKc_MEK1 Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 1	Back alignment and domain information

>cd05605 STKc_GRK4_like Catalytic domain of G protein-coupled Receptor Kinase 4-like Protein Serine/Threonine Kinases	Back alignment and domain information

>cd05104 PTKc_Kit Catalytic domain of the Protein Tyrosine Kinase, Kit	Back alignment and domain information

>KOG0666 consensus Cyclin C-dependent kinase CDK8 [Transcription]	Back alignment and domain information

>cd05106 PTKc_CSF-1R Catalytic domain of the Protein Tyrosine Kinase, Colony-Stimulating Factor-1 Receptor	Back alignment and domain information

>cd07873 STKc_PCTAIRE1 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-1 kinase	Back alignment and domain information

>cd05597 STKc_DMPK_like Catalytic domain of Myotonic Dystrophy protein kinase-like Protein Serine/Threonine Kinases	Back alignment and domain information

>cd05586 STKc_Sck1_like Catalytic domain of Suppressor of loss of cAMP-dependent protein kinase-like Protein Serine/Threonine Kinases	Back alignment and domain information

>PHA03211 serine/threonine kinase US3; Provisional	Back alignment and domain information

>cd05090 PTKc_Ror1 Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 1	Back alignment and domain information

>KOG0604 consensus MAP kinase-activated protein kinase 2 [Signal transduction mechanisms]	Back alignment and domain information

>KOG0286 consensus G-protein beta subunit [General function prediction only]	Back alignment and domain information

>cd07861 STKc_CDK1_euk Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 1 from higher eukaryotes-like	Back alignment and domain information

>KOG0577 consensus Serine/threonine protein kinase [Signal transduction mechanisms]	Back alignment and domain information

>cd05064 PTKc_EphR_A10 Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A10	Back alignment and domain information

>KOG0690 consensus Serine/threonine protein kinase [Signal transduction mechanisms]	Back alignment and domain information

>KOG0607 consensus MAP kinase-interacting kinase and related serine/threonine protein kinases [Signal transduction mechanisms]	Back alignment and domain information

>cd05094 PTKc_TrkC Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase C	Back alignment and domain information

>PF00069 Pkinase: Protein kinase domain Protein kinase; unclassified specificity	Back alignment and domain information

>cd05623 STKc_MRCK_alpha Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase alpha	Back alignment and domain information

>cd07878 STKc_p38beta_MAPK11 Catalytic domain of the Serine/Threonine Kinase, p38beta Mitogen-Activated Protein Kinase	Back alignment and domain information

>KOG0272 consensus U4/U6 small nuclear ribonucleoprotein Prp4 (contains WD40 repeats) [RNA processing and modification]	Back alignment and domain information

>cd05580 STKc_PKA Catalytic domain of the Protein Serine/Threonine Kinase, cAMP-dependent protein kinase	Back alignment and domain information

>PHA03209 serine/threonine kinase US3; Provisional	Back alignment and domain information

>cd05049 PTKc_Trk Catalytic domain of the Protein Tyrosine Kinases, Tropomyosin Related Kinases	Back alignment and domain information

>cd05093 PTKc_TrkB Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase B	Back alignment and domain information

>cd05108 PTKc_EGFR Catalytic domain of the Protein Tyrosine Kinase, Epidermal Growth Factor Receptor	Back alignment and domain information

>PTZ00266 NIMA-related protein kinase; Provisional	Back alignment and domain information

>cd06628 STKc_MAPKKK_Byr2_like Catalytic domain of fungal Byr2-like MAP Kinase Kinase Kinases	Back alignment and domain information

>KOG0662 consensus Cyclin-dependent kinase CDK5 [Intracellular trafficking, secretion, and vesicular transport; Signal transduction mechanisms]	Back alignment and domain information

>cd08219 STKc_Nek3 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 3	Back alignment and domain information

>cd07867 STKc_CDC2L6 Catalytic domain of Serine/Threonine Kinase, Cell Division Cycle 2-like 6	Back alignment and domain information

>cd08529 STKc_FA2-like Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii FA2 and similar domains	Back alignment and domain information

>cd06646 STKc_MAP4K5 Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 5	Back alignment and domain information

>cd05624 STKc_MRCK_beta Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase beta	Back alignment and domain information

>cd05062 PTKc_IGF-1R Catalytic domain of the Protein Tyrosine Kinase, Insulin-like Growth Factor-1 Receptor	Back alignment and domain information

>cd05607 STKc_GRK7 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 7	Back alignment and domain information

>cd05114 PTKc_Tec_Rlk Catalytic domain of the Protein Tyrosine Kinases, Tyrosine kinase expressed in hepatocellular carcinoma and Resting lymphocyte kinase	Back alignment and domain information

>cd05033 PTKc_EphR Catalytic domain of Ephrin Receptor Protein Tyrosine Kinases	Back alignment and domain information

>cd08227 PK_STRAD_alpha Pseudokinase domain of STE20-related kinase adapter protein alpha	Back alignment and domain information

>KOG4645 consensus MAPKKK (MAP kinase kinase kinase) SSK2 and related serine/threonine protein kinases [Signal transduction mechanisms]	Back alignment and domain information

>cd06631 STKc_YSK4 Catalytic domain of the Protein Serine/Threonine Kinase, Yeast Sps1/Ste20-related kinase 4	Back alignment and domain information

>cd05091 PTKc_Ror2 Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 2	Back alignment and domain information

>cd05082 PTKc_Csk Catalytic domain of the Protein Tyrosine Kinase, C-terminal Src kinase	Back alignment and domain information

>cd05084 PTKc_Fes Catalytic domain of the Protein Tyrosine Kinase, Fes	Back alignment and domain information

>cd05089 PTKc_Tie1 Catalytic domain of the Protein Tyrosine Kinase, Tie1	Back alignment and domain information

>cd06651 STKc_MEKK3 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 3	Back alignment and domain information

>cd05061 PTKc_InsR Catalytic domain of the Protein Tyrosine Kinase, Insulin Receptor	Back alignment and domain information

>cd05052 PTKc_Abl Catalytic domain of the Protein Tyrosine Kinase, Abelson kinase	Back alignment and domain information

>cd05053 PTKc_FGFR Catalytic domain of the Protein Tyrosine Kinases, Fibroblast Growth Factor Receptors	Back alignment and domain information

>cd07839 STKc_CDK5 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 5	Back alignment and domain information

>cd05109 PTKc_HER2 Catalytic domain of the Protein Tyrosine Kinase, HER2	Back alignment and domain information

>cd05039 PTKc_Csk_like Catalytic domain of C-terminal Src kinase-like Protein Tyrosine Kinases	Back alignment and domain information

>cd05113 PTKc_Btk_Bmx Catalytic domain of the Protein Tyrosine Kinases, Bruton's tyrosine kinase and Bone marrow kinase on the X chromosome	Back alignment and domain information

>cd05032 PTKc_InsR_like Catalytic domain of Insulin Receptor-like Protein Tyrosine Kinases	Back alignment and domain information

>cd05630 STKc_GRK6 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 6	Back alignment and domain information

>cd06645 STKc_MAP4K3 Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 3	Back alignment and domain information

>cd05105 PTKc_PDGFR_alpha Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor alpha	Back alignment and domain information

>PF07714 Pkinase_Tyr: Protein tyrosine kinase Protein kinase; unclassified specificity	Back alignment and domain information

>cd00192 PTKc Catalytic domain of Protein Tyrosine Kinases	Back alignment and domain information

>cd08223 STKc_Nek4 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 4	Back alignment and domain information

>KOG0579 consensus Ste20-like serine/threonine protein kinase [Signal transduction mechanisms]	Back alignment and domain information

>cd05036 PTKc_ALK_LTK Catalytic domain of the Protein Tyrosine Kinases, Anaplastic Lymphoma Kinase and Leukocyte Tyrosine Kinase	Back alignment and domain information

>cd05098 PTKc_FGFR1 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 1	Back alignment and domain information

>cd08228 STKc_Nek6 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 6	Back alignment and domain information

>KOG0612 consensus Rho-associated, coiled-coil containing protein kinase [Signal transduction mechanisms]	Back alignment and domain information

>cd05068 PTKc_Frk_like Catalytic domain of Fyn-related kinase-like Protein Tyrosine Kinases	Back alignment and domain information

>cd05092 PTKc_TrkA Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase A	Back alignment and domain information

>cd05609 STKc_MAST Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine kinase	Back alignment and domain information

>cd05054 PTKc_VEGFR Catalytic domain of the Protein Tyrosine Kinases, Vascular Endothelial Growth Factor Receptors	Back alignment and domain information

>cd06615 PKc_MEK Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase	Back alignment and domain information

>cd05088 PTKc_Tie2 Catalytic domain of the Protein Tyrosine Kinase, Tie2	Back alignment and domain information

>cd05059 PTKc_Tec_like Catalytic domain of Tec-like Protein Tyrosine Kinases	Back alignment and domain information

>cd05051 PTKc_DDR Catalytic domain of the Protein Tyrosine Kinases, Discoidin Domain Receptors	Back alignment and domain information

>cd05116 PTKc_Syk Catalytic domain of the Protein Tyrosine Kinase, Spleen tyrosine kinase	Back alignment and domain information

>cd05072 PTKc_Lyn Catalytic domain of the Protein Tyrosine Kinase, Lyn	Back alignment and domain information

>cd07841 STKc_CDK7 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 7	Back alignment and domain information

>KOG4236 consensus Serine/threonine protein kinase PKC mu/PKD and related proteins [Signal transduction mechanisms]	Back alignment and domain information

>cd06652 STKc_MEKK2 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 2	Back alignment and domain information

>PRK13184 pknD serine/threonine-protein kinase; Reviewed	Back alignment and domain information

>cd05101 PTKc_FGFR2 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 2	Back alignment and domain information

>cd05111 PTK_HER3 Pseudokinase domain of the Protein Tyrosine Kinase, HER3	Back alignment and domain information

>cd05574 STKc_phototropin_like Catalytic domain of Phototropin-like Protein Serine/Threonine Kinases	Back alignment and domain information

>cd06619 PKc_MKK5 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 5	Back alignment and domain information

>cd05632 STKc_GRK5 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 5	Back alignment and domain information

>cd05578 STKc_Yank1 Catalytic domain of the Protein Serine/Threonine Kinase, Yank1	Back alignment and domain information

>KOG1026 consensus Nerve growth factor receptor TRKA and related tyrosine kinases [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>cd05099 PTKc_FGFR4 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 4	Back alignment and domain information

>KOG0295 consensus WD40 repeat-containing protein [Function unknown]	Back alignment and domain information

>cd07832 STKc_CCRK Catalytic domain of the Serine/Threonine Kinase, Cell Cycle-Related Kinase	Back alignment and domain information

>cd05572 STKc_cGK_PKG Catalytic domain of the Protein Serine/Threonine Kinase, cGMP-dependent protein kinase	Back alignment and domain information

>cd06630 STKc_MEKK1 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 1	Back alignment and domain information

>cd06644 STKc_STK10_LOK Catalytic domain of the Protein Serine/Threonine Kinase, STK10 or Lymphocyte-oriented kinase	Back alignment and domain information

>cd06632 STKc_MEKK1_plant Catalytic domain of the Protein Serine/Threonine Kinase, Plant MAP/ERK kinase kinase 1	Back alignment and domain information

>cd05035 PTKc_Axl_like Catalytic Domain of Axl-like Protein Tyrosine Kinases	Back alignment and domain information

>cd07855 STKc_ERK5 Catalytic domain of the Serine/Threonine Kinase, Extracellular signal-Regulated Kinase 5	Back alignment and domain information

>cd05045 PTKc_RET Catalytic domain of the Protein Tyrosine Kinase, REarranged during Transfection protein	Back alignment and domain information

>cd06626 STKc_MEKK4 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 4	Back alignment and domain information

>cd05060 PTKc_Syk_like Catalytic domain of Spleen Tyrosine Kinase-like Protein Tyrosine Kinases	Back alignment and domain information

>KOG0574 consensus STE20-like serine/threonine kinase MST [Signal transduction mechanisms]	Back alignment and domain information

>cd05097 PTKc_DDR_like Catalytic domain of Discoidin Domain Receptor-like Protein Tyrosine Kinases	Back alignment and domain information

>cd05055 PTKc_PDGFR Catalytic domain of the Protein Tyrosine Kinases, Platelet Derived Growth Factor Receptors	Back alignment and domain information

>cd05080 PTKc_Tyk2_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2	Back alignment and domain information

>cd06638 STKc_myosinIIIA Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIA myosin	Back alignment and domain information

>cd07850 STKc_JNK Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase	Back alignment and domain information

>cd05075 PTKc_Axl Catalytic domain of the Protein Tyrosine Kinase, Axl	Back alignment and domain information

>cd07844 STKc_PCTAIRE_like Catalytic domain of PCTAIRE-like Serine/Threonine Kinases	Back alignment and domain information

>cd06654 STKc_PAK1 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 1	Back alignment and domain information

>cd06643 STKc_SLK Catalytic domain of the Protein Serine/Threonine Kinase, Ste20-like kinase	Back alignment and domain information

>cd08221 STKc_Nek9 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 9	Back alignment and domain information

>cd06613 STKc_MAP4K3_like Catalytic domain of Mitogen-activated protein kinase kinase kinase kinase-like Protein Serine/Threonine Kinases	Back alignment and domain information

>cd05633 STKc_GRK3 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 3	Back alignment and domain information

>cd05066 PTKc_EphR_A Catalytic domain of the Protein Tyrosine Kinases, Class EphA Ephrin Receptors	Back alignment and domain information

>cd07843 STKc_CDC2L1 Catalytic domain of the Serine/Threonine Kinase, Cell Division Cycle 2-like 1	Back alignment and domain information

>cd07865 STKc_CDK9 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 9	Back alignment and domain information

>cd05148 PTKc_Srm_Brk Catalytic domain of the Protein Tyrosine Kinases, Srm and Brk	Back alignment and domain information

>cd07870 STKc_PFTAIRE2 Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-2 kinase	Back alignment and domain information

>KOG0669 consensus Cyclin T-dependent kinase CDK9 [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>KOG0584 consensus Serine/threonine protein kinase [General function prediction only]	Back alignment and domain information

>cd05043 PTK_Ryk Pseudokinase domain of Ryk (Receptor related to tyrosine kinase)	Back alignment and domain information

>cd05115 PTKc_Zap-70 Catalytic domain of the Protein Tyrosine Kinase, Zeta-chain-associated protein of 70kDa	Back alignment and domain information

>cd06609 STKc_MST3_like Catalytic domain of Mammalian Ste20-like protein kinase 3-like Protein Serine/Threonine Kinases	Back alignment and domain information

>KOG0983 consensus Mitogen-activated protein kinase (MAPK) kinase MKK7/JNKK2 [Signal transduction mechanisms]	Back alignment and domain information

>cd07849 STKc_ERK1_2_like Catalytic domain of Extracellular signal-Regulated Kinase 1 and 2-like Serine/Threonine Kinases	Back alignment and domain information

>cd07847 STKc_CDKL1_4 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 1 and 4	Back alignment and domain information

>cd06611 STKc_SLK_like Catalytic domain of Ste20-like kinase-like Protein Serine/Threonine Kinases	Back alignment and domain information

>cd05100 PTKc_FGFR3 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 3	Back alignment and domain information

>cd05606 STKc_beta_ARK Catalytic domain of the Protein Serine/Threonine Kinase, beta-adrenergic receptor kinase	Back alignment and domain information

>cd07831 STKc_MOK Catalytic domain of the Serine/Threonine Kinase, MAPK/MAK/MRK Overlapping Kinase	Back alignment and domain information

>cd05079 PTKc_Jak1_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Janus kinase 1	Back alignment and domain information

>cd06629 STKc_MAPKKK_Bck1_like Catalytic domain of fungal Bck1-like MAP Kinase Kinase Kinases	Back alignment and domain information

>cd05095 PTKc_DDR2 Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 2	Back alignment and domain information

>cd06637 STKc_TNIK Catalytic domain of the Protein Serine/Threonine Kinase, Traf2- and Nck-interacting kinase	Back alignment and domain information

>cd06656 STKc_PAK3 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 3	Back alignment and domain information

>cd06622 PKc_MAPKK_PBS2_like Catalytic domain of fungal PBS2-like dual-specificity MAP kinase kinases	Back alignment and domain information

>cd05050 PTKc_Musk Catalytic domain of the Protein Tyrosine Kinase, Muscle-specific kinase	Back alignment and domain information

>cd05034 PTKc_Src_like Catalytic domain of Src kinase-like Protein Tyrosine Kinases	Back alignment and domain information

>cd05046 PTK_CCK4 Pseudokinase domain of the Protein Tyrosine Kinase, Colon Carcinoma Kinase 4	Back alignment and domain information

>cd06640 STKc_MST4 Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 4	Back alignment and domain information

>cd06617 PKc_MKK3_6 Catalytic domain of the dual-specificity Protein Kinases, MAP kinase kinases 3 and 6	Back alignment and domain information

>KOG1187 consensus Serine/threonine protein kinase [Signal transduction mechanisms]	Back alignment and domain information

>cd06610 STKc_OSR1_SPAK Catalytic domain of the Protein Serine/Threonine Kinases, Oxidative stress response kinase and Ste20-related proline alanine-rich kinase	Back alignment and domain information

>cd06612 STKc_MST1_2 Catalytic domain of the Protein Serine/Threonine Kinases, Mammalian Ste20-like protein kinase 1 and 2	Back alignment and domain information

>cd05581 STKc_PDK1 Catalytic domain of the Protein Serine/Threonine Kinase, Phosphoinositide-dependent kinase 1	Back alignment and domain information

>cd06655 STKc_PAK2 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 2	Back alignment and domain information

>PHA03210 serine/threonine kinase US3; Provisional	Back alignment and domain information

>cd05063 PTKc_EphR_A2 Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A2	Back alignment and domain information

>cd05057 PTKc_EGFR_like Catalytic domain of Epidermal Growth Factor Receptor-like Protein Tyrosine Kinases	Back alignment and domain information

>cd05083 PTKc_Chk Catalytic domain of the Protein Tyrosine Kinase, Csk homologous kinase	Back alignment and domain information

>cd05070 PTKc_Fyn_Yrk Catalytic domain of the Protein Tyrosine Kinases, Fyn and Yrk	Back alignment and domain information

>cd07842 STKc_CDK8_like Catalytic domain of Cyclin-Dependent protein Kinase 8-like Serine/Threonine Kinases	Back alignment and domain information

>cd05107 PTKc_PDGFR_beta Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor beta	Back alignment and domain information

>cd05085 PTKc_Fer Catalytic domain of the Protein Tyrosine Kinase, Fer	Back alignment and domain information

>cd05042 PTKc_Aatyk Catalytic domain of the Protein Tyrosine Kinases, Apoptosis-associated tyrosine kinases	Back alignment and domain information

>KOG0285 consensus Pleiotropic regulator 1 [RNA processing and modification]	Back alignment and domain information

>cd07860 STKc_CDK2_3 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase 2 and 3	Back alignment and domain information

>cd05071 PTKc_Src Catalytic domain of the Protein Tyrosine Kinase, Src	Back alignment and domain information

>cd06608 STKc_myosinIII_like Catalytic domain of Class III myosin-like Protein Serine/Threonine Kinases	Back alignment and domain information

>cd07845 STKc_CDK10 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 10	Back alignment and domain information

>cd05065 PTKc_EphR_B Catalytic domain of the Protein Tyrosine Kinases, Class EphB Ephrin Receptors	Back alignment and domain information

>cd05056 PTKc_FAK Catalytic domain of the Protein Tyrosine Kinase, Focal Adhesion Kinase	Back alignment and domain information

>cd05067 PTKc_Lck_Blk Catalytic domain of the Protein Tyrosine Kinases, Lymphocyte-specific kinase and Blk	Back alignment and domain information

>cd08218 STKc_Nek1 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 1	Back alignment and domain information

>cd06605 PKc_MAPKK Catalytic domain of the dual-specificity Protein Kinase, Mitogen-Activated Protein Kinase Kinase	Back alignment and domain information

>cd06623 PKc_MAPKK_plant_like Catalytic domain of Plant dual-specificity MAP kinase kinases and similar proteins	Back alignment and domain information

>cd06620 PKc_MAPKK_Byr1_like Catalytic domain of fungal Byr1-like dual-specificity MAP kinase kinases	Back alignment and domain information

>cd08217 STKc_Nek2 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 2	Back alignment and domain information

>cd07846 STKc_CDKL2_3 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 2 and 3	Back alignment and domain information

>cd05041 PTKc_Fes_like Catalytic domain of Fes-like Protein Tyrosine Kinases	Back alignment and domain information

>cd08224 STKc_Nek6_Nek7 Catalytic domain of the Protein Serine/Threonine Kinases, Never In Mitosis gene A-related kinase 6 and 7	Back alignment and domain information

>smart00219 TyrKc Tyrosine kinase, catalytic domain	Back alignment and domain information

>cd05613 STKc_MSK1_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 1	Back alignment and domain information

>cd05077 PTK_Jak1_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinase, Janus kinase 1	Back alignment and domain information

>cd05040 PTKc_Ack_like Catalytic domain of the Protein Tyrosine Kinase, Activated Cdc42-associated kinase	Back alignment and domain information

>cd05112 PTKc_Itk Catalytic domain of the Protein Tyrosine Kinase, Interleukin-2-inducible T-cell Kinase	Back alignment and domain information

>cd05577 STKc_GRK Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase	Back alignment and domain information

>cd06636 STKc_MAP4K4_6 Catalytic domain of the Protein Serine/Threonine Kinases, Mitogen-Activated Protein Kinase Kinase Kinase Kinase 4 and 6	Back alignment and domain information

>KOG1035 consensus eIF-2alpha kinase GCN2 [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>cd08220 STKc_Nek8 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 8	Back alignment and domain information

>cd05047 PTKc_Tie Catalytic domain of Tie Protein Tyrosine Kinases	Back alignment and domain information

>cd06607 STKc_TAO Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids proteins	Back alignment and domain information

>cd06642 STKc_STK25-YSK1 Catalytic domain of the Protein Serine/Threonine Kinase, STK25 or Yeast Sps1/Ste20-related kinase 1	Back alignment and domain information

>cd08229 STKc_Nek7 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 7	Back alignment and domain information

>cd05103 PTKc_VEGFR2 Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 2	Back alignment and domain information

>cd06641 STKc_MST3 Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 3	Back alignment and domain information

>cd07836 STKc_Pho85 Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Pho85	Back alignment and domain information

>cd05044 PTKc_c-ros Catalytic domain of the Protein Tyrosine Kinase, C-ros	Back alignment and domain information

>cd06606 STKc_MAPKKK Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Kinase Kinase	Back alignment and domain information

>cd05078 PTK_Jak2_Jak3_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3	Back alignment and domain information

>cd07858 STKc_TEY_MAPK_plant Catalytic domain of the Serine/Threonine Kinases, TEY Mitogen-Activated Protein Kinases from Plants	Back alignment and domain information

>cd05087 PTKc_Aatyk1_Aatyk3 Catalytic domain of the Protein Tyrosine Kinases, Apoptosis-associated tyrosine kinases 1 and 3	Back alignment and domain information

>cd05081 PTKc_Jak2_Jak3_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3	Back alignment and domain information

>cd07835 STKc_CDK1_like Catalytic domain of Cyclin-Dependent protein Kinase 1-like Serine/Threonine Kinases	Back alignment and domain information

>cd05076 PTK_Tyk2_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2	Back alignment and domain information

>cd07837 STKc_CdkB_plant Catalytic domain of the Serine/Threonine Kinase, Plant B-type Cyclin-Dependent protein Kinase	Back alignment and domain information

>cd06639 STKc_myosinIIIB Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIB myosin	Back alignment and domain information

>cd06627 STKc_Cdc7_like Catalytic domain of Cell division control protein 7-like Protein Serine/Threonine Kinases	Back alignment and domain information

>KOG0194 consensus Protein tyrosine kinase [Signal transduction mechanisms]	Back alignment and domain information

>cd05069 PTKc_Yes Catalytic domain of the Protein Tyrosine Kinase, Yes	Back alignment and domain information

>cd05058 PTKc_Met_Ron Catalytic domain of the Protein Tyrosine Kinases, Met and Ron	Back alignment and domain information

>cd06658 STKc_PAK5 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 5	Back alignment and domain information

>cd06917 STKc_NAK1_like Catalytic domain of Fungal Nak1-like Protein Serine/Threonine Kinases	Back alignment and domain information

>KOG0696 consensus Serine/threonine protein kinase [Signal transduction mechanisms]	Back alignment and domain information

>cd05073 PTKc_Hck Catalytic domain of the Protein Tyrosine Kinase, Hematopoietic cell kinase	Back alignment and domain information

>PHA02882 putative serine/threonine kinase; Provisional	Back alignment and domain information

>cd07833 STKc_CDKL Catalytic domain of Cyclin-Dependent protein Kinase Like Serine/Threonine Kinases	Back alignment and domain information

>cd05122 PKc_STE Catalytic domain of STE family Protein Kinases	Back alignment and domain information

>PLN00009 cyclin-dependent kinase A; Provisional	Back alignment and domain information

>cd06624 STKc_ASK Catalytic domain of the Protein Serine/Threonine Kinase, Apoptosis signal-regulating kinase	Back alignment and domain information

>KOG0986 consensus G protein-coupled receptor kinase [Signal transduction mechanisms]	Back alignment and domain information

>cd08215 STKc_Nek Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase	Back alignment and domain information

>cd07840 STKc_CDK9_like Catalytic domain of Cyclin-Dependent protein Kinase 9-like Serine/Threonine Kinases	Back alignment and domain information

>KOG0614 consensus cGMP-dependent protein kinase [Signal transduction mechanisms]	Back alignment and domain information

>cd06635 STKc_TAO1 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 1	Back alignment and domain information

>cd05086 PTKc_Aatyk2 Catalytic domain of the Protein Tyrosine Kinase, Apoptosis-associated tyrosine kinase 2	Back alignment and domain information

>cd06653 STKc_MEKK3_like_1 Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases	Back alignment and domain information

>KOG0279 consensus G protein beta subunit-like protein [Signal transduction mechanisms]	Back alignment and domain information

>cd08226 PK_STRAD_beta Pseudokinase domain of STE20-related kinase adapter protein beta	Back alignment and domain information

>cd05038 PTKc_Jak_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases	Back alignment and domain information

>cd05037 PTK_Jak_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinases, Janus kinases	Back alignment and domain information

>cd07854 STKc_MAPK4_6 Catalytic domain of the Serine/Threonine Kinases, Mitogen-Activated Protein Kinases 4 and 6	Back alignment and domain information

>cd08216 PK_STRAD Pseudokinase domain of STE20-related kinase adapter protein	Back alignment and domain information

>cd06633 STKc_TAO3 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 3	Back alignment and domain information

>cd07834 STKc_MAPK Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase	Back alignment and domain information

>cd05110 PTKc_HER4 Catalytic domain of the Protein Tyrosine Kinase, HER4	Back alignment and domain information

>cd05579 STKc_MAST_like Catalytic domain of Microtubule-associated serine/threonine kinase-like proteins	Back alignment and domain information

>cd08225 STKc_Nek5 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 5	Back alignment and domain information

>cd07866 STKc_BUR1 Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Bypass UAS Requirement 1 and similar proteins	Back alignment and domain information

>PTZ00024 cyclin-dependent protein kinase; Provisional	Back alignment and domain information

>cd05611 STKc_Rim15_like Catalytic domain of fungal Rim15-like Protein Serine/Threonine Kinases	Back alignment and domain information

>cd06621 PKc_MAPKK_Pek1_like Catalytic domain of fungal Pek1-like dual-specificity MAP kinase kinases	Back alignment and domain information

>cd06616 PKc_MKK4 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 4	Back alignment and domain information

>cd07852 STKc_MAPK15 Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase 15	Back alignment and domain information

>cd07857 STKc_MPK1 Catalytic domain of the Serine/Threonine Kinase, Fungal Mitogen-Activated Protein Kinase MPK1	Back alignment and domain information

>cd06618 PKc_MKK7 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 7	Back alignment and domain information

>cd08530 STKc_CNK2-like Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii CNK2, and similar domains	Back alignment and domain information

>cd06659 STKc_PAK6 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 6	Back alignment and domain information

>cd07880 STKc_p38gamma_MAPK12 Catalytic domain of the Serine/Threonine Kinase, p38gamma Mitogen-Activated Protein Kinase	Back alignment and domain information

>cd07879 STKc_p38delta_MAPK13 Catalytic domain of the Serine/Threonine Kinase, p38delta Mitogen-Activated Protein Kinase	Back alignment and domain information

>cd07838 STKc_CDK4_6_like Catalytic domain of Cyclin-Dependent protein Kinase 4 and 6-like Serine/Threonine Kinases	Back alignment and domain information

>PHA03390 pk1 serine/threonine-protein kinase 1; Provisional	Back alignment and domain information

>cd06614 STKc_PAK Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase	Back alignment and domain information

>cd06647 STKc_PAK_I Catalytic domain of the Protein Serine/Threonine Kinase, Group I p21-activated kinase	Back alignment and domain information

>cd07851 STKc_p38 Catalytic domain of the Serine/Threonine Kinase, p38 Mitogen-Activated Protein Kinase	Back alignment and domain information

>cd05074 PTKc_Tyro3 Catalytic domain of the Protein Tyrosine Kinase, Tyro3	Back alignment and domain information

>cd07877 STKc_p38alpha_MAPK14 Catalytic domain of the Serine/Threonine Kinase, p38alpha Mitogen-Activated Protein Kinase	Back alignment and domain information

>cd07856 STKc_Sty1_Hog1 Catalytic domain of the Serine/Threonine Kinases, Fungal Mitogen-Activated Protein Kinases Sty1 and Hog1	Back alignment and domain information

>cd05583 STKc_MSK_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase	Back alignment and domain information

>cd06634 STKc_TAO2 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 2	Back alignment and domain information

>cd05123 STKc_AGC Catalytic domain of AGC family Protein Serine/Threonine Kinases	Back alignment and domain information

>cd07864 STKc_CDK12 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 12	Back alignment and domain information

>cd08222 STKc_Nek11 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 11	Back alignment and domain information

>cd07830 STKc_MAK_like Catalytic domain of Male germ cell-Associated Kinase-like Serine/Threonine Kinases	Back alignment and domain information

>KOG0281 consensus Beta-TrCP (transducin repeats containing)/Slimb proteins [Function unknown]	Back alignment and domain information

>cd06648 STKc_PAK_II Catalytic domain of the Protein Serine/Threonine Kinase, Group II p21-activated kinase	Back alignment and domain information

>cd08528 STKc_Nek10 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 10	Back alignment and domain information

>KOG1095 consensus Protein tyrosine kinase [Signal transduction mechanisms]	Back alignment and domain information

>cd07829 STKc_CDK_like Catalytic domain of Cyclin-Dependent protein Kinase-like Serine/Threonine Kinases	Back alignment and domain information

>cd05610 STKc_MASTL Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine-like kinase	Back alignment and domain information

>KOG0271 consensus Notchless-like WD40 repeat-containing protein [Function unknown]	Back alignment and domain information

>KOG0603 consensus Ribosomal protein S6 kinase [Signal transduction mechanisms]	Back alignment and domain information

>cd05118 STKc_CMGC Catalytic domain of CMGC family Serine/Threonine Kinases	Back alignment and domain information

>cd06657 STKc_PAK4 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 4	Back alignment and domain information

>KOG0279 consensus G protein beta subunit-like protein [Signal transduction mechanisms]	Back alignment and domain information

>KOG1151 consensus Tousled-like protein kinase [Signal transduction mechanisms]	Back alignment and domain information

>KOG1094 consensus Discoidin domain receptor DDR1 [Signal transduction mechanisms]	Back alignment and domain information

>KOG0296 consensus Angio-associated migratory cell protein (contains WD40 repeats) [Function unknown]	Back alignment and domain information

>KOG0608 consensus Warts/lats-like serine threonine kinases [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>cd05576 STKc_RPK118_like Catalytic domain of the Protein Serine/Threonine Kinases, RPK118 and similar proteins	Back alignment and domain information

>KOG0284 consensus Polyadenylation factor I complex, subunit PFS2 [RNA processing and modification]	Back alignment and domain information

>KOG1027 consensus Serine/threonine protein kinase and endoribonuclease ERN1/IRE1, sensor of the unfolded protein response pathway [Signal transduction mechanisms]	Back alignment and domain information

>KOG0284 consensus Polyadenylation factor I complex, subunit PFS2 [RNA processing and modification]	Back alignment and domain information

>KOG0671 consensus LAMMER dual specificity kinases [Signal transduction mechanisms]	Back alignment and domain information

>KOG0315 consensus G-protein beta subunit-like protein (contains WD40 repeats) [General function prediction only]	Back alignment and domain information

>KOG0282 consensus mRNA splicing factor [Function unknown]	Back alignment and domain information

>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto

Back alignment and domain information

>KOG0315 consensus G-protein beta subunit-like protein (contains WD40 repeats) [General function prediction only]	Back alignment and domain information

>KOG0665 consensus Jun-N-terminal kinase (JNK) [Signal transduction mechanisms]	Back alignment and domain information

>KOG4257 consensus Focal adhesion tyrosine kinase FAK, contains FERM domain [Signal transduction mechanisms]	Back alignment and domain information

>KOG4250 consensus TANK binding protein kinase TBK1 [Signal transduction mechanisms]	Back alignment and domain information

>KOG0293 consensus WD40 repeat-containing protein [Function unknown]	Back alignment and domain information

>KOG0265 consensus U5 snRNP-specific protein-like factor and related proteins [RNA processing and modification]	Back alignment and domain information

>KOG0199 consensus ACK and related non-receptor tyrosine kinases [Signal transduction mechanisms]	Back alignment and domain information

>KOG0266 consensus WD40 repeat-containing protein [General function prediction only]	Back alignment and domain information

>KOG0695 consensus Serine/threonine protein kinase [Signal transduction mechanisms]	Back alignment and domain information

>KOG1006 consensus Mitogen-activated protein kinase (MAPK) kinase MKK4 [Signal transduction mechanisms]	Back alignment and domain information

>KOG0196 consensus Tyrosine kinase, EPH (ephrin) receptor family [Signal transduction mechanisms]	Back alignment and domain information

>PLN03225 Serine/threonine-protein kinase SNT7; Provisional	Back alignment and domain information

>KOG0587 consensus Traf2- and Nck-interacting kinase and related germinal center kinase (GCK) family protein kinases [Signal transduction mechanisms]	Back alignment and domain information

>KOG4278 consensus Protein tyrosine kinase [Signal transduction mechanisms]	Back alignment and domain information

>KOG0273 consensus Beta-transducin family (WD-40 repeat) protein [Chromatin structure and dynamics]	Back alignment and domain information

>KOG0668 consensus Casein kinase II, alpha subunit [Signal transduction mechanisms; Cell cycle control, cell division, chromosome partitioning; Transcription]	Back alignment and domain information

>KOG0263 consensus Transcription initiation factor TFIID, subunit TAF5 (also component of histone acetyltransferase SAGA) [Transcription]	Back alignment and domain information

>KOG1152 consensus Signal transduction serine/threonine kinase with PAS/PAC sensor domain [Signal transduction mechanisms]	Back alignment and domain information

>KOG0670 consensus U4/U6-associated splicing factor PRP4 [RNA processing and modification]	Back alignment and domain information

>KOG3653 consensus Transforming growth factor beta/activin receptor subfamily of serine/threonine kinases [Signal transduction mechanisms]	Back alignment and domain information

>KOG2052 consensus Activin A type IB receptor, serine/threonine protein kinase [Signal transduction mechanisms]	Back alignment and domain information

>KOG0664 consensus Nemo-like MAPK-related serine/threonine protein kinase [Signal transduction mechanisms]	Back alignment and domain information

>KOG0645 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>smart00220 S_TKc Serine/Threonine protein kinases, catalytic domain	Back alignment and domain information

>KOG0291 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification]	Back alignment and domain information

>KOG0275 consensus Conserved WD40 repeat-containing protein [General function prediction only]	Back alignment and domain information

>KOG0273 consensus Beta-transducin family (WD-40 repeat) protein [Chromatin structure and dynamics]	Back alignment and domain information

>KOG0319 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification]	Back alignment and domain information

>KOG0640 consensus mRNA cleavage stimulating factor complex; subunit 1 [RNA processing and modification]	Back alignment and domain information

>KOG1025 consensus Epidermal growth factor receptor EGFR and related tyrosine kinases [Signal transduction mechanisms]	Back alignment and domain information

>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional	Back alignment and domain information

>KOG0263 consensus Transcription initiation factor TFIID, subunit TAF5 (also component of histone acetyltransferase SAGA) [Transcription]	Back alignment and domain information

>PLN03224 probable serine/threonine protein kinase; Provisional	Back alignment and domain information

>KOG0286 consensus G-protein beta subunit [General function prediction only]	Back alignment and domain information

>KOG1290 consensus Serine/threonine protein kinase [Signal transduction mechanisms]	Back alignment and domain information

>KOG1345 consensus Serine/threonine kinase [Signal transduction mechanisms]	Back alignment and domain information

>KOG0984 consensus Mitogen-activated protein kinase (MAPK) kinase MKK3/MKK6 [Signal transduction mechanisms]	Back alignment and domain information

>KOG0291 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification]	Back alignment and domain information

>KOG0285 consensus Pleiotropic regulator 1 [RNA processing and modification]	Back alignment and domain information

>KOG0318 consensus WD40 repeat stress protein/actin interacting protein [Cytoskeleton]	Back alignment and domain information

>KOG0200 consensus Fibroblast/platelet-derived growth factor receptor and related receptor tyrosine kinases [Signal transduction mechanisms]	Back alignment and domain information

>KOG0316 consensus Conserved WD40 repeat-containing protein [Function unknown]	Back alignment and domain information

>KOG0645 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>KOG0295 consensus WD40 repeat-containing protein [Function unknown]	Back alignment and domain information

>KOG0313 consensus Microtubule binding protein YTM1 (contains WD40 repeats) [Cytoskeleton]	Back alignment and domain information

>KOG0281 consensus Beta-TrCP (transducin repeats containing)/Slimb proteins [Function unknown]	Back alignment and domain information

>KOG0643 consensus Translation initiation factor 3, subunit i (eIF-3i)/TGF-beta receptor-interacting protein (TRIP-1) [Translation, ribosomal structure and biogenesis; Signal transduction mechanisms]	Back alignment and domain information

>KOG0276 consensus Vesicle coat complex COPI, beta' subunit [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG0268 consensus Sof1-like rRNA processing protein (contains WD40 repeats) [RNA processing and modification]	Back alignment and domain information

>KOG0319 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification]	Back alignment and domain information

>KOG0266 consensus WD40 repeat-containing protein [General function prediction only]	Back alignment and domain information

>cd00180 PKc Catalytic domain of Protein Kinases	Back alignment and domain information

>KOG0576 consensus Mitogen-activated protein kinase kinase kinase kinase (MAP4K), germinal center kinase family [Signal transduction mechanisms]	Back alignment and domain information

>KOG0306 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification]	Back alignment and domain information

>KOG0293 consensus WD40 repeat-containing protein [Function unknown]	Back alignment and domain information

>KOG0265 consensus U5 snRNP-specific protein-like factor and related proteins [RNA processing and modification]	Back alignment and domain information

>KOG0318 consensus WD40 repeat stress protein/actin interacting protein [Cytoskeleton]	Back alignment and domain information

>KOG0278 consensus Serine/threonine kinase receptor-associated protein [Lipid transport and metabolism]	Back alignment and domain information

>KOG0274 consensus Cdc4 and related F-box and WD-40 proteins [General function prediction only]	Back alignment and domain information

>KOG0292 consensus Vesicle coat complex COPI, alpha subunit [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG1407 consensus WD40 repeat protein [Function unknown]	Back alignment and domain information

>KOG0274 consensus Cdc4 and related F-box and WD-40 proteins [General function prediction only]	Back alignment and domain information

>KOG1167 consensus Serine/threonine protein kinase of the CDC7 subfamily involved in DNA synthesis, repair and recombination [Replication, recombination and repair]	Back alignment and domain information

>KOG0292 consensus Vesicle coat complex COPI, alpha subunit [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG0288 consensus WD40 repeat protein TipD [General function prediction only]	Back alignment and domain information

>KOG0277 consensus Peroxisomal targeting signal type 2 receptor [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG0278 consensus Serine/threonine kinase receptor-associated protein [Lipid transport and metabolism]	Back alignment and domain information

>KOG0316 consensus Conserved WD40 repeat-containing protein [Function unknown]	Back alignment and domain information

Back alignment and domain information

>KOG0313 consensus Microtubule binding protein YTM1 (contains WD40 repeats) [Cytoskeleton]	Back alignment and domain information

>KOG0296 consensus Angio-associated migratory cell protein (contains WD40 repeats) [Function unknown]	Back alignment and domain information

>PLN00181 protein SPA1-RELATED; Provisional	Back alignment and domain information

>smart00221 STYKc Protein kinase; unclassified specificity	Back alignment and domain information

>KOG0643 consensus Translation initiation factor 3, subunit i (eIF-3i)/TGF-beta receptor-interacting protein (TRIP-1) [Translation, ribosomal structure and biogenesis; Signal transduction mechanisms]	Back alignment and domain information

>KOG1446 consensus Histone H3 (Lys4) methyltransferase complex and RNA cleavage factor II complex, subunit SWD2 [RNA processing and modification; Chromatin structure and dynamics; Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0973 consensus Histone transcription regulator HIRA, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning; Transcription]	Back alignment and domain information

>KOG0282 consensus mRNA splicing factor [Function unknown]	Back alignment and domain information

>KOG0277 consensus Peroxisomal targeting signal type 2 receptor [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG0300 consensus WD40 repeat-containing protein [Function unknown]	Back alignment and domain information

>KOG1024 consensus Receptor-like protein tyrosine kinase RYK/derailed [Signal transduction mechanisms]	Back alignment and domain information

>KOG0276 consensus Vesicle coat complex COPI, beta' subunit [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG0289 consensus mRNA splicing factor [General function prediction only]	Back alignment and domain information

>KOG0310 consensus Conserved WD40 repeat-containing protein [Function unknown]	Back alignment and domain information

>KOG0305 consensus Anaphase promoting complex, Cdc20, Cdh1, and Ama1 subunits [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0640 consensus mRNA cleavage stimulating factor complex; subunit 1 [RNA processing and modification]	Back alignment and domain information

>KOG2096 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>PTZ00421 coronin; Provisional	Back alignment and domain information

>KOG0308 consensus Conserved WD40 repeat-containing protein [Function unknown]	Back alignment and domain information

>KOG0647 consensus mRNA export protein (contains WD40 repeats) [RNA processing and modification]	Back alignment and domain information

>KOG0772 consensus Uncharacterized conserved protein, contains WD40 repeat [Function unknown]	Back alignment and domain information

>PTZ00420 coronin; Provisional	Back alignment and domain information

>PTZ00421 coronin; Provisional	Back alignment and domain information

>KOG0283 consensus WD40 repeat-containing protein [Function unknown]	Back alignment and domain information

>KOG1036 consensus Mitotic spindle checkpoint protein BUB3, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>KOG0288 consensus WD40 repeat protein TipD [General function prediction only]	Back alignment and domain information

>PTZ00420 coronin; Provisional	Back alignment and domain information

>KOG0300 consensus WD40 repeat-containing protein [Function unknown]	Back alignment and domain information

>KOG4283 consensus Transcription-coupled repair protein CSA, contains WD40 domain [Transcription; Replication, recombination and repair]	Back alignment and domain information

>KOG0305 consensus Anaphase promoting complex, Cdc20, Cdh1, and Ama1 subunits [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0289 consensus mRNA splicing factor [General function prediction only]	Back alignment and domain information

>KOG0641 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>KOG0639 consensus Transducin-like enhancer of split protein (contains WD40 repeats) [Chromatin structure and dynamics]	Back alignment and domain information

>KOG0294 consensus WD40 repeat-containing protein [Function unknown]	Back alignment and domain information

>KOG0306 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification]	Back alignment and domain information

>KOG0301 consensus Phospholipase A2-activating protein (contains WD40 repeats) [Lipid transport and metabolism]	Back alignment and domain information

>smart00750 KIND kinase non-catalytic C-lobe domain	Back alignment and domain information

>KOG0641 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>KOG0264 consensus Nucleosome remodeling factor, subunit CAF1/NURF55/MSI1 [Chromatin structure and dynamics]	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

ID	Alignment Graph	Length	Definition	E-value
Query		1553
3gre_A		437	Crystal Structure Of Saccharomyces Cerevisiae Vps15		3e-10
1a06_A		332	Calmodulin-Dependent Protein Kinase From Rat Length		1e-09
4fg7_A		293	Crystal Structure Of Human Calcium/calmodulin-depen		2e-09
4fg8_A		315	Crystal Structure Of Human Calcium/calmodulin-depen		3e-09
4fg9_A		320	Crystal Structure Of Human Calcium/calmodulin-depen		4e-09
3d5w_A		317	Crystal Structure Of A Phosphorylated Polo-Like Kin		8e-08
3d5u_A		317	Crystal Structure Of A Wildtype Polo-Like Kinase 1		8e-08
3d5v_A		317	Crystal Structure Of An Activated (Thr->asp) Polo-L		1e-07
3db6_A		301	Crystal Structure Of An Activated (Thr->asp) Polo-L		1e-07
3eb0_A		383	Crystal Structure Of Cgd4_240 From Cryptosporidium		7e-07
2y7j_A		365	Structure Of Human Phosphorylase Kinase, Gamma 2 Le		2e-06
1q3d_A		424	Gsk-3 Beta Complexed With Staurosporine Length = 42		2e-06
1pyx_A		422	Gsk-3 Beta Complexed With Amp-Pnp Length = 422		2e-06
4acc_A		465	Gsk3b In Complex With Inhibitor Length = 465		2e-06
3kb7_A		311	Crystal Structure Of Polo-Like Kinase 1 In Complex		2e-06
2v5q_A		315	Crystal Structure Of Wild-type Plk-1 Kinase Domain		2e-06
2yac_A		311	Crystal Structure Of Polo-Like Kinase 1 In Complex		2e-06
1r0e_A		391	Glycogen Synthase Kinase-3 Beta In Complex With 3-I		2e-06
1i09_A		420	Structure Of Glycogen Synthase Kinase-3 (Gsk3b) Len		2e-06
1q5k_A		414	Crystal Structure Of Glycogen Synthase Kinase 3 In		2e-06
2ou7_A		335	Structure Of The Catalytic Domain Of Human Polo-Lik		2e-06
3thb_A		333	Structure Of Plk1 Kinase Domain In Complex With A B		2e-06
2pk9_A		317	Structure Of The Pho85-pho80 Cdk-cyclin Complex Of		4e-06
2rku_A		294	Structure Of Plk1 In Complex With Bi2536 Length = 2		4e-06
2o5k_A		372	Crystal Structure Of Gsk3beta In Complex With A Ben		5e-06
3sd0_A		350	Identification Of A Glycogen Synthase Kinase-3b Inh		9e-06
1h8f_A		352	Glycogen Synthase Kinase 3 Beta. Length = 352		9e-06
1uv5_A		350	Glycogen Synthase Kinase 3 Beta Complexed With 6-Br		9e-06
3say_A		430	Crystal Structure Of Human Glycogen Synthase Kinase		1e-05
4aaa_A		331	Crystal Structure Of The Human Cdkl2 Kinase Domain		1e-05
2r5t_A		373	Crystal Structure Of Inactive Serum And Glucocortic		2e-05
2qkr_A		313	Cryptosporidium Parvum Cyclin-Dependent Kinase Cgd5		2e-05
3niz_A		311	Cryptosporidium Parvum Cyclin-Dependent Kinase Cgd5		2e-05
3zgw_A		347	Crystal Structure Of Maternal Embryonic Leucine Zip		3e-05
4dit_A		382	Crystal Structure Of Gsk3beta In Complex With A Imi		3e-05
4apc_A		350	Crystal Structure Of Human Nima-Related Kinase 1 (N		3e-05
1gng_A		378	Glycogen Synthase Kinase-3 Beta (Gsk3) Complex With		3e-05
4afj_A		367	5-Aryl-4-Carboxamide-1,3-Oxazoles: Potent And Selec		3e-05
3zrk_A		371	Identification Of 2-(4-Pyridyl)thienopyridinones As		4e-05
3gb2_A		353	Gsk3beta Inhibitor Complex Length = 353		4e-05
3f7z_A		350	X-ray Co-crystal Structure Of Glycogen Synthase Kin		4e-05
4eoi_A		299	Thr 160 Phosphorylated Cdk2 K89d, Q131e - Human Cyc		5e-05
3f88_A		349	Glycogen Synthase Kinase 3beta Inhibitor Complex Le		5e-05
2ow3_A		352	Glycogen Synthase Kinase-3 Beta In Complex With Bis		7e-05
3zdi_A		350	Glycogen Synthase Kinase 3 Beta Complexed With Axin		7e-05
1v0o_A		288	Structure Of P. Falciparum Pfpk5-Indirubin-5-Sulpho		7e-05
3uc3_A		361	The Crystal Structure Of Snf1-Related Kinase 2.3 Le		8e-05
1ob3_A		288	Structure Of P. Falciparum Pfpk5 Length = 288		8e-05
2hak_A		328	Catalytic And Ubiqutin-Associated Domains Of Mark1P		8e-05
1v0b_A		288	Crystal Structure Of The T198a Mutant Of Pfpk5 Leng		8e-05
1bi8_A		326	Mechanism Of G1 Cyclin Dependent Kinase Inhibition		1e-04
3nup_A		307	Cdk6 (Monomeric) In Complex With Inhibitor Length =		1e-04
1o9u_A		350	Glycogen Synthase Kinase 3 Beta Complexed With Axin		1e-04
3fe3_A		328	Crystal Structure Of The Kinase Mark3PAR-1: T211a-S		1e-04
2qnj_A		328	Kinase And Ubiquitin-Associated Domains Of Mark3PAR		1e-04
1jow_B		308	Crystal Structure Of A Complex Of Human Cdk6 And A		1e-04
2w9f_B		306	Crystal Structure Of Cdk4 In Complex With A D-Type		1e-04
4agu_A		311	Crystal Structure Of The Human Cdkl1 Kinase Domain		1e-04
3g33_A		308	Crystal Structure Of Cdk4CYCLIN D3 Length = 308		2e-04
2b9h_A		353	Crystal Structure Of Fus3 With A Docking Motif From		2e-04
2w99_B		306	Crystal Structure Of Cdk4 In Complex With A D-Type		2e-04
2r0i_A		327	Crystal Structure Of A Kinase Mark2PAR-1 Mutant Len		2e-04
1zmw_A		327	Catalytic And Ubiqutin-Associated Domains Of Mark2P		2e-04
1zmu_A		327	Catalytic And Ubiqutin-Associated Domains Of Mark2P		2e-04
3iec_A		319	Helicobacter Pylori Caga Inhibits Par1MARK FAMILY K		2e-04
2w96_B		306	Crystal Structure Of Cdk4 In Complex With A D-Type		2e-04
4el9_A		305	Structure Of N-Terminal Kinase Domain Of Rsk2 With		2e-04
2f9g_A		353	Crystal Structure Of Fus3 Phosphorylated On Tyr182		2e-04
3ubd_A		304	Structure Of N-Terminal Domain Of Rsk2 Kinase In Co		2e-04
2b9f_A		353	Crystal Structure Of Non-Phosphorylated Fus3 Length		2e-04
4eoo_A		299	Thr 160 Phosphorylated Cdk2 Q131e - Human Cyclin A3		2e-04
4eok_A		300	Thr 160 Phosphorylated Cdk2 H84s, Q85m, K89d - Huma		2e-04
1zmv_A		327	Catalytic And Ubiqutin-Associated Domains Of Mark2P		3e-04
2wzj_A		327	Catalytic And Uba Domain Of Kinase Mark2(PAR-1) K82		3e-04
4eop_A		300	Thr 160 Phosphorylated Cdk2 Q131e - Human Cyclin A3		3e-04
4eoj_A		302	Thr 160 Phosphorylated Cdk2 H84s, Q85m, K89d - Huma		3e-04
3mtl_A		324	Crystal Structure Of The Pctaire1 Kinase In Complex		4e-04
3g51_A		325	Structural Diversity Of The Active Conformation Of		4e-04
3mxx_A		315	Crystal Structure Of Wdr5 Mutant (S62a) Length = 31		4e-04
2jc6_A		334	Crystal Structure Of Human Calmodulin-Dependent Pro		4e-04
3n0d_A		315	Crystal Structure Of Wdr5 Mutant (W330f) Length = 3		4e-04
3n0e_A		315	Crystal Structure Of Wdr5 Mutant (W330y) Length = 3		5e-04
2z7q_A		321	Crystal Structure Of The N-Terminal Kinase Domain O		5e-04
4erw_A		306	Cdk2 In Complex With Staurosporine Length = 306		5e-04
3ezr_A		300	Cdk-2 With Indazole Inhibitor 17 Bound At Its Activ		5e-04
1vyw_A		309	Structure Of Cdk2CYCLIN A WITH PNU-292137 Length =		5e-04
3pj8_A		299	Structure Of Cdk2 In Complex With A Pyrazolo[4,3-D]		5e-04
1oit_A		299	Imidazopyridines: A Potent And Selective Class Of C		6e-04
1gz8_A		299	Human Cyclin Dependent Kinase 2 Complexed With The		6e-04
2g9a_A		311	Structural Basis For The Specific Recognition Of Me		6e-04
1h1p_A		303	Structure Of Human Thr160-Phospho Cdk2CYCLIN A COMP		6e-04
3zut_A		362	The Structure Of Ost1 (D160a) Kinase Length = 362		6e-04
3zuu_A		362	The Structure Of Ost1 (D160a, S175d) Kinase In Comp		6e-04
1oir_A		299	Imidazopyridines: A Potent And Selective Class Of C		6e-04
1h01_A		298	Cdk2 In Complex With A Disubstituted 2, 4-Bis Anili		6e-04
2w17_A		299	Cdk2 In Complex With The Imidazole Pyrimidine Amide		6e-04
1fin_A		298	Cyclin A-Cyclin-Dependent Kinase 2 Complex Length =		6e-04
1pf8_A		298	Crystal Structure Of Human Cyclin-dependent Kinase		6e-04
3pxf_A		306	Cdk2 In Complex With Two Molecules Of 8-Anilino-1-N		6e-04
3bht_A		300	Structure Of Phosphorylated Thr160 Cdk2CYCLIN A IN		6e-04
3vuk_A		370	Crystal Structure Of A Cysteine-deficient Mutant M5		6e-04
4eos_A		300	Thr 160 Phosphorylated Cdk2 Wt - Human Cyclin A3 Co		6e-04
1ogu_A		302	Structure Of Human Thr160-phospho Cdk2/cyclin A Com		6e-04
3ujg_A		361	Crystal Structure Of Snrk2.6 In Complex With Hab1 L		6e-04
1y8g_A		327	Catalytic And Ubiqutin-Associated Domains Of Mark2P		6e-04
4eon_A		300	Thr 160 Phosphorylated Cdk2 H84s, Q85m, Q131e - Hum		7e-04
3emh_A		318	Structural Basis Of Wdr5-Mll Interaction Length = 3		7e-04
1qmz_A		299	Phosphorylated Cdk2-Cyclyin A-Substrate Peptide Com		7e-04
4a7j_A		318	Symmetric Dimethylation Of H3 Arginine 2 Is A Novel		7e-04
1w98_A		298	The Structural Basis Of Cdk2 Activation By Cyclin E		7e-04
4eoq_A		301	Thr 160 Phosphorylated Cdk2 Wt - Human Cyclin A3 Co		7e-04
4bcq_A		301	Structure Of Cdk2 In Complex With Cyclin A And A 2-		7e-04
2jgz_A		289	Crystal Structure Of Phospho-Cdk2 In Complex With C		7e-04
2iw6_A		302	Structure Of Human Thr160-Phospho Cdk2-Cyclin A Com		7e-04
2g99_A		308	Structural Basis For The Specific Recognition Of Me		7e-04
2h13_A		317	Crystal Structure Of Wdr5HISTONE H3 COMPLEX Length		7e-04
4eom_A		301	Thr 160 Phosphorylated Cdk2 H84s, Q85m, Q131e - Hum		7e-04
3smr_A		312	Crystal Structure Of Human Wd Repeat Domain 5 With		7e-04
2h9l_A		329	Wdr5delta23 Length = 329		7e-04
2h9m_A		313	Wdr5 In Complex With Unmodified H3k4 Peptide Length		7e-04
3qhr_A		298	Structure Of A Pcdk2CYCLINA TRANSITION-State Mimic		7e-04
3psl_A		318	Fine-Tuning The Stimulation Of Mll1 Methyltransfera		7e-04
2h68_A		312	Histone H3 Recognition And Presentation By The Wdr5		7e-04
1jst_A		298	Phosphorylated Cyclin-Dependent Kinase-2 Bound To C		7e-04
1e9h_A		297	Thr 160 Phosphorylated Cdk2-Human Cyclin A3 Complex		7e-04
2cn5_A		329	Crystal Structure Of Human Chk2 In Complex With Adp		8e-04
4i3z_A		296	Structure Of Pcdk2CYCLINA BOUND TO ADP AND 2 MAGNES		8e-04
2nyl_A		582	Crystal Structure Of Protein Phosphatase 2a (Pp2a)		9e-04
3fga_A		588	Structural Basis Of Pp2a And Sgo Interaction Length		9e-04

>pdb|3GRE|A Chain A, Crystal Structure Of Saccharomyces Cerevisiae Vps15 Wd Repeat Domain Length = 437