Citrus Sinensis ID: 000447
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
|
|
Close Homologs for Annotation Transfer
Close Homologs in SWISS-PROT Database Detected by BLAST 
Original result of BLAST against SWISS-PROT Database
| ID | Alignment graph | Length |
Definition |
RBH(Q2H) |
RBH(H2Q) |
Q cover |
H cover |
Identity |
E-value |
| Query | 1497 | 2.2.26 [Sep-21-2011] | |||||||
| O81825 | 919 | Probable disease resistan | yes | no | 0.488 | 0.796 | 0.309 | 3e-82 | |
| Q9T048 | 985 | Disease resistance protei | no | no | 0.546 | 0.830 | 0.270 | 1e-68 | |
| Q42484 | 909 | Disease resistance protei | no | no | 0.494 | 0.814 | 0.267 | 4e-58 | |
| P60838 | 894 | Probable disease resistan | no | no | 0.381 | 0.638 | 0.290 | 6e-48 | |
| Q9FLB4 | 874 | Putative disease resistan | no | no | 0.499 | 0.855 | 0.266 | 3e-44 | |
| Q8RXS5 | 888 | Probable disease resistan | no | no | 0.388 | 0.654 | 0.267 | 4e-44 | |
| O64973 | 889 | Disease resistance protei | no | no | 0.428 | 0.722 | 0.269 | 3e-43 | |
| Q8L3R3 | 885 | Disease resistance protei | no | no | 0.394 | 0.667 | 0.265 | 2e-41 | |
| Q940K0 | 889 | Probable disease resistan | no | no | 0.382 | 0.644 | 0.268 | 1e-39 | |
| O64789 | 925 | Probable disease resistan | no | no | 0.382 | 0.618 | 0.273 | 3e-39 |
| >sp|O81825|DRL28_ARATH Probable disease resistance protein At4g27220 OS=Arabidopsis thaliana GN=At4g27220 PE=2 SV=1 | Back alignment and function desciption |
|---|
Score = 307 bits (787), Expect = 3e-82, Method: Compositional matrix adjust.
Identities = 242/781 (30%), Positives = 397/781 (50%), Gaps = 49/781 (6%)
Query: 160 VYMIGVYGMAGIGKTTLVK----EVARLAKEGRIFDEVVFAEVSQTPDLKRIRREIADQL 215
V IGV+GM G+GKTTLV+ ++ + A + F V++ VS+ DLKR++ +IA +L
Sbjct: 134 VQKIGVWGMGGVGKTTLVRTLNNDLLKYAATQQ-FALVIWVTVSKDFDLKRVQMDIAKRL 192
Query: 216 GLNFCEESDSERIMMLCNRLKREKKILVILDDIWTSLDLERTGIPFG-DVHRGCKILVTS 274
G F E ++ + +C RL K L+ILDD+W +DL++ GIP + + K+++TS
Sbjct: 193 GKRFTREQMNQLGLTICERLIDLKNFLLILDDVWHPIDLDQLGIPLALERSKDSKVVLTS 252
Query: 275 RRRDVLVSEMHCQNNYCVSVLNKEEAWSLFSKVVGNCVEDPDLQTVAIQVANECGGLPIA 334
RR +V +M N V+ L ++EAW LF VG +++ +A V++EC GLP+A
Sbjct: 253 RRLEV-CQQMMTNENIKVACLQEKEAWELFCHNVGEVANSDNVKPIAKDVSHECCGLPLA 311
Query: 335 ILTVARTLRNKP-LFVWKKALQELRFSARNFTGLEALLGSTIELIYNYLEGEELKLTFLL 393
I+T+ RTLR KP + VWK L L+ SA + E + G T++L Y++L+ + +K FL
Sbjct: 312 IITIGRTLRGKPQVEVWKHTLNLLKRSAPSIDTEEKIFG-TLKLSYDFLQ-DNMKSCFLF 369
Query: 394 CSLMKHPCDAPIMDLLKYGTGLGLFEDIYTMQERRDRVYALVRGLKDTCLLHDDDTADWF 453
C+L + +L+ Y GL + + ++ + LV LKD+CLL D D+ D
Sbjct: 370 CALFPEDYSIKVSELIMYWVAEGLLDGQHHYEDMMNEGVTLVERLKDSCLLEDGDSCDTV 429
Query: 454 SMLGFVRNVAISIASI------NLMVRNDALIEWPNKDMLKNCIAIFLHDINTGELPEG- 506
M VR+ AI S +L++ LIE+P + + + L LP
Sbjct: 430 KMHDVVRDFAIWFMSSQGEGFHSLVMAGRGLIEFPQDKFVSSVQRVSLMANKLERLPNNV 489
Query: 507 LEYPHLTSLCMNPKDPFLHIPDNFFAGMPKLRVLVLTRMKLLTLPSSFCHLPNLESLCLD 566
+E L + +P+ F P LR+L L+ +++ TLP SF +L +L SL L
Sbjct: 490 IEGVETLVLLLQGNSHVKEVPNGFLQAFPNLRILDLSGVRIRTLPDSFSNLHSLRSLVLR 549
Query: 567 QC-ILGDIAIIGNLKNLEILSLCCSDIEQLPREIGELTQLKLLDLSNCSKLKVIPPNVIS 625
C L ++ + +L L+ L L S I +LPR + L+ L+ + +SN +L+ IP I
Sbjct: 550 NCKKLRNLPSLESLVKLQFLDLHESAIRELPRGLEALSSLRYICVSNTYQLQSIPAGTIL 609
Query: 626 SLSQLEELYLGNTSVEWEFEGLNLERNNASLQELSILSHLTTLEIHIRDAVILPKGL--F 683
LS LE L + ++ W +G E A+L E++ L HL L I + D +
Sbjct: 610 QLSSLEVLDMAGSAYSWGIKGEERE-GQATLDEVTCLPHLQFLAIKLLDVLSFSYEFDSL 668
Query: 684 SQKLARYKILVGDVWDW--PGKSENRRTLKLKLPTNIYLDEIIMNLKEIEELYLDEVPGI 741
+++L +++ L + PG E + +N + ++ ++ ++ Y + + G+
Sbjct: 669 TKRLTKFQFLFSPIRSVSPPGTGEGCLAISDVNVSNASIGWLLQHVTSLDLNYCEGLNGM 728
Query: 742 ENVLYELDRKGLPALKHLRAQNNPFILCIVDSMAQVRCNAFPVLESMFLHNLIHLEKI-- 799
L + A+K L P + + S + + + FP LE + L N ++LE I
Sbjct: 729 FENLVTKSKSSFVAMKALSIHYFPSL--SLASGCESQLDLFPNLEELSLDN-VNLESIGE 785
Query: 800 CDGLLTAEFFSKLRIIKVRNCDKLKNIFSFSIVRG-LPQLQILKVIKCNNMEEIFSFGGE 858
+G L KL++++V C +LK +FS I+ G LP LQ +KV+ C +EE+F+F
Sbjct: 786 LNGFLGMR-LQKLKLLQVSGCRQLKRLFSDQILAGTLPNLQEIKVVSCLRLEELFNFSS- 843
Query: 859 DDVGYNEVDKIEFGQLRSLILKFLPQLTSFYAQLKSSDELDTPKPLFNERVVFPNLETLE 918
V + + +L + LK+LPQL S L N+RVV +LE LE
Sbjct: 844 --VPVDFCAESLLPKLTVIKLKYLPQLRS----------------LCNDRVVLESLEHLE 885
Query: 919 L 919
+
Sbjct: 886 V 886
|
Probable disease resistance protein. Arabidopsis thaliana (taxid: 3702) |
| >sp|Q9T048|DRL27_ARATH Disease resistance protein At4g27190 OS=Arabidopsis thaliana GN=At4g27190 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q42484|RPS2_ARATH Disease resistance protein RPS2 OS=Arabidopsis thaliana GN=RPS2 PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|P60838|DRL1_ARATH Probable disease resistance protein At1g12280 OS=Arabidopsis thaliana GN=At1g12280 PE=3 SV=1 | Back alignment and function description |
|---|
| >sp|Q9FLB4|DRL31_ARATH Putative disease resistance protein At5g05400 OS=Arabidopsis thaliana GN=At5g05400 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q8RXS5|DRL40_ARATH Probable disease resistance protein At5g63020 OS=Arabidopsis thaliana GN=At5g63020 PE=2 SV=2 | Back alignment and function description |
|---|
| >sp|O64973|RPS5_ARATH Disease resistance protein RPS5 OS=Arabidopsis thaliana GN=RPS5 PE=1 SV=2 | Back alignment and function description |
|---|
| >sp|Q8L3R3|RFL1_ARATH Disease resistance protein RFL1 OS=Arabidopsis thaliana GN=RFL1 PE=3 SV=2 | Back alignment and function description |
|---|
| >sp|Q940K0|DRL15_ARATH Probable disease resistance protein At1g61180 OS=Arabidopsis thaliana GN=At1g61180 PE=2 SV=2 | Back alignment and function description |
|---|
| >sp|O64789|DRL18_ARATH Probable disease resistance protein At1g61310 OS=Arabidopsis thaliana GN=At1g61310 PE=2 SV=1 | Back alignment and function description |
|---|
Close Homologs in the Non-Redundant Database Detected by BLAST
Original result of BLAST against Nonredundant Database
| GI | Alignment Graph | Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 1497 | ||||||
| 359488108 | 1436 | PREDICTED: disease resistance protein At | 0.873 | 0.910 | 0.400 | 0.0 | |
| 224111296 | 1315 | cc-nbs-lrr resistance protein [Populus t | 0.828 | 0.942 | 0.416 | 0.0 | |
| 359488288 | 1340 | PREDICTED: LOW QUALITY PROTEIN: probable | 0.824 | 0.921 | 0.401 | 0.0 | |
| 224143316 | 1337 | cc-nbs-lrr resistance protein [Populus t | 0.835 | 0.934 | 0.418 | 0.0 | |
| 224111284 | 1340 | cc-nbs-lrr resistance protein [Populus t | 0.849 | 0.948 | 0.415 | 0.0 | |
| 255563252 | 1603 | Disease resistance protein RPS5, putativ | 0.818 | 0.764 | 0.425 | 0.0 | |
| 224083434 | 1144 | cc-nbs-lrr resistance protein [Populus t | 0.684 | 0.895 | 0.450 | 0.0 | |
| 296087872 | 1152 | unnamed protein product [Vitis vinifera] | 0.711 | 0.924 | 0.427 | 0.0 | |
| 255574526 | 1232 | Disease resistance protein RFL1, putativ | 0.676 | 0.821 | 0.443 | 0.0 | |
| 147787802 | 1517 | hypothetical protein VITISV_005047 [Viti | 0.845 | 0.833 | 0.363 | 0.0 |
| >gi|359488108|ref|XP_003633701.1| PREDICTED: disease resistance protein At4g27190-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 868 bits (2243), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 561/1402 (40%), Positives = 802/1402 (57%), Gaps = 95/1402 (6%)
Query: 5 KQFGYFCCYKSNFDHLTKEVEKLRERRESVQHRVDFAKENGEEIEQSVENWLISVDKIVE 64
+Q Y Y++N + L+++V+ LR+ R QH VD A NG IE V W+ D ++
Sbjct: 22 RQLDYLFNYRTNIEDLSQKVDNLRDARARQQHSVDEAIGNGHIIEDDVCKWMKRADGFIQ 81
Query: 65 E-----AGKFVEDDEEANNPCFKVLCPNLKNRHHLSKKAAKEVKAIVELQDEGNFDRVSV 119
A KF+ED++EA CF LCPNLK+R+ LS++A K VE+ G F+RVS
Sbjct: 82 NGFIQNACKFLEDEKEARKSCFNRLCPNLKSRYQLSREARKRAGVAVEILGAGQFERVSY 141
Query: 120 RGISRDRLVAYTESYNEGHEFIESRESILNDILDALRGPYVYMIGVYGMAGIGKTTLVKE 179
R ++ A +E+ +ESR LN+++ ALR + IGV+G+ G+GKTTLVK+
Sbjct: 142 RAPLQEIRSAPSEA-------LESRMLTLNEVMVALRDAKINKIGVWGLGGVGKTTLVKQ 194
Query: 180 VARLAKEGRIFDEVVFAEVSQTPDLKRIRREIADQLGLNFCEESDSERIMMLCNRLKREK 239
VA A + ++FD+VV A V +TPDLK+I+ E+AD LG+ F EES+ R L R+ EK
Sbjct: 195 VAEQAAQEKLFDKVVTAAVLETPDLKKIQGELADLLGMKFEEESEQGRAARLYQRMNEEK 254
Query: 240 KILVILDDIWTSLDLERTGIPFGDVHRGCKILVTSRRRDVLVSEMHCQNNYCVSVLNKEE 299
IL+ILDDIW LDLE+ GIP D H+GCK+++TSR +L +EM Q ++ V L ++E
Sbjct: 255 TILIILDDIWAKLDLEKIGIPSPDHHKGCKLVLTSRNEHILSNEMDTQKDFRVQPLQEDE 314
Query: 300 AWSLFSKVVGNCVEDPDLQTVAIQVANECGGLPIAILTVARTLRNKPLFVWKKALQELRF 359
W LF G+ +E+P+LQ +A+ VA EC GLP+AI+TVA+ L+NK + +WK ALQ+L+
Sbjct: 315 TWILFKNTAGS-IENPELQPIAVDVAKECAGLPLAIVTVAKALKNKNVSIWKDALQQLKS 373
Query: 360 SA-RNFTGLEALLGSTIELIYNYLEGEELKLTFLLCSLMKHPCDAPIMDLLKYGTGLGLF 418
N TGL + S+++L Y +L+G E+K FLLC L+ D I DLLKYG GL LF
Sbjct: 374 QTLTNVTGLTTNVYSSLKLSYEHLKGVEVKSFFLLCGLISQN-DISIRDLLKYGVGLRLF 432
Query: 419 EDIYTMQERRDRVYALVRGLKDTCLLHDDDTADWFSMLGFVRNVAISIAS--------IN 470
+ T++E ++R+ ALV LK + L + + M VR+ A IAS N
Sbjct: 433 QGTNTLEEAKNRIDALVDNLKSSNFLLETGHNAFVRMHDLVRSTARKIASDQHHVFTLQN 492
Query: 471 LMVRNDALIEWPNKDMLKNCIAIFLHDINTGELPEGLEYPHLTSL-CMNPK-DPFLHIPD 528
VR + WP D L+ + LHD + ELPEGL P L C + + + IP+
Sbjct: 493 TTVRVEG---WPRIDELQKVTWVSLHDCDIRELPEGLACPKLELFGCYDVNTNSAVQIPN 549
Query: 529 NFFAGMPKLRVLVLTRMKLLTLPSSFCHL-PNLESLCLDQCILGDIAIIGNLKNLEILSL 587
NFF M +L+VL L+RM+L +LP S CH NL +LCLD C LG+I II LK LEILSL
Sbjct: 550 NFFEEMKQLKVLDLSRMQLPSLPLS-CHCRTNLRTLCLDGCNLGEIVIIAELKKLEILSL 608
Query: 588 CCSDIEQLPREIGELTQLKLLDLSNCSKLKVIPPNVISSLSQLEELYLGNTSVEWEFEGL 647
SDIE+LPREI +LT L+L DL KLKVIPP+VISSLSQLE+L + N+ +WE EG
Sbjct: 609 TYSDIEKLPREIAQLTHLRLFDLKGSYKLKVIPPDVISSLSQLEDLCMENSFTQWEGEG- 667
Query: 648 NLERNNASLQELSILSHLTTLEIHIRDAVILPKGLFSQKLARYKILVGDVWDWPGKSENR 707
++NA L EL LSHLT+L+I I DA +LPK + L RY+I VGDVW W G SE
Sbjct: 668 ---KSNACLAELKHLSHLTSLDIQIPDAKLLPKDIVFDTLVRYRIFVGDVWSWGGISEAN 724
Query: 708 RTLKL-KLPTNIYL-DEIIMNLKEIEELYLDEVPGIENVLYELDRKGLPALKHLRAQNNP 765
+TL+L K T+++L D II LK E+L+L E+ G NVL +LD +G LKHL +++P
Sbjct: 725 KTLQLNKFDTSLHLVDGIIKLLKRTEDLHLRELCGGTNVLSKLDGEGFLKLKHLNVESSP 784
Query: 766 FILCIVDSMAQVRCN-AFPVLESMFLHNLIHLEKICDGLLTAEFFSKLRIIKVRNCDKLK 824
I IV+SM + AFPV+E++ L+ LI+L+++C G A F LR ++V +CD LK
Sbjct: 785 EIQYIVNSMDLTPSHGAFPVMETLSLNQLINLQEVCRGQFPAGSFGCLRKVEVEDCDGLK 844
Query: 825 NIFSFSIVRGLPQLQILKVIKCNNMEEIFSFGGEDDVGYNEVDKIEFGQLRSLILKFLPQ 884
+FS S+ RGL +L+ KV +C +M E+ S G ++ + V+ F +LRSL L+ LP+
Sbjct: 845 FLFSLSVARGLSRLEETKVTRCKSMVEMVS-QGRKEIKEDAVNVPLFPELRSLTLEDLPK 903
Query: 885 LTSFYAQ-----LKSSDELDTPK-PLFNERVVFPN--LETL--ELYAINTERIWHNQPVA 934
L++F + K + + P P N+ + L +L L ++N ++ +
Sbjct: 904 LSNFCFEENPVLSKPASTIVGPSTPPLNQPEIRDGQLLFSLGGNLRSLNLKKCMSLLKLF 963
Query: 935 VSPGIQNLTRLIVHGSEKIKYLF---------------PSSIVRNFVQLQHL-EICHCTV 978
+QNL L V +K++ +F P + L L IC+C
Sbjct: 964 PPSLLQNLQELTVENCDKLEQVFDLEELNVDDGHVGLLPKLGKLRLIDLPKLRHICNCGS 1023
Query: 979 LEEIVSKERGEEATATFVFPKVTYLKLCNLSELITFY-PGIHTLE--------------- 1022
+FPK+ Y+ L L L +F PG H+L+
Sbjct: 1024 SRNHFPSSMASAPVGNIIFPKLFYISLGFLPNLTSFVSPGYHSLQRLHHADLDTPFPVLF 1083
Query: 1023 ---WPLLKRLEVYGCNKVKIFTSEFLSFPKNSEEIQRNIPTQQALFLVEKVGSHLEELKL 1079
WPLL+ L V C K+ +F E +F + E ++P FL +LEEL+L
Sbjct: 1084 DERWPLLEELRVSECYKLDVFAFETPTFQQRHGEGNLDMPL---FFLPHVAFPNLEELRL 1140
Query: 1080 SGKDITMIREGRLPTYLFQNLKILEVVNDKSD---NFPICFLQYFKNLEKLEL-RWSSYK 1135
T I + P F L++L V+D D P LQ NLE L++ SS K
Sbjct: 1141 GDNRDTEIWPEQFPVDSFPRLRVLH-VHDYRDILVVIPSFMLQRLHNLEVLKVGSCSSVK 1199
Query: 1136 QIFSYK--EAEKHAGKLTHIKSLKLWELSDLMYLWNQGFKLDSVVENLEMLEVWWCDNLV 1193
++F + + E A +L ++ ++L +L L LW + + +++LE LEVW C +L+
Sbjct: 1200 EVFQLEGLDEENQAKRLGRLREIELHDLPGLTRLWKENSEPGLDLQSLESLEVWNCGSLI 1259
Query: 1194 NLVPSSPSFRNLITLEVWYCKGLKNLVTSSTAKSLVQLMQLRIDGCKMITEIISNEGDVA 1253
NLVPSS SF+NL TL+V C L++L++ S AKSLV+L L+I M+ E+++NEG A
Sbjct: 1260 NLVPSSVSFQNLATLDVQSCGSLRSLISPSVAKSLVKLKTLKIGRSDMMEEVVANEGGEA 1319
Query: 1254 EDEIVFSKLKWLSLENLESLTSFYSGNYTFKFPCLEDLFVIECPNMKIFSTRESNTPKLQ 1313
DEI F KL+ + L L +LTSF SG Y F FP LE + V ECP MK+FS P+L+
Sbjct: 1320 TDEITFYKLQHMELLYLPNLTSFSSGGYIFSFPSLEQMLVKECPKMKMFSPSLVTPPRLK 1379
Query: 1314 EVRQNWGLDKGCWEGGLNATIQ 1335
++ G ++ W+ LN I
Sbjct: 1380 RIK--VGDEEWPWQDDLNTAIH 1399
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|224111296|ref|XP_002332952.1| cc-nbs-lrr resistance protein [Populus trichocarpa] gi|222834264|gb|EEE72741.1| cc-nbs-lrr resistance protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|359488288|ref|XP_003633735.1| PREDICTED: LOW QUALITY PROTEIN: probable disease resistance protein At1g61310-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|224143316|ref|XP_002336027.1| cc-nbs-lrr resistance protein [Populus trichocarpa] gi|222838884|gb|EEE77235.1| cc-nbs-lrr resistance protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|224111284|ref|XP_002332949.1| cc-nbs-lrr resistance protein [Populus trichocarpa] gi|222834261|gb|EEE72738.1| cc-nbs-lrr resistance protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|255563252|ref|XP_002522629.1| Disease resistance protein RPS5, putative [Ricinus communis] gi|223538105|gb|EEF39716.1| Disease resistance protein RPS5, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|224083434|ref|XP_002307025.1| cc-nbs-lrr resistance protein [Populus trichocarpa] gi|222856474|gb|EEE94021.1| cc-nbs-lrr resistance protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|296087872|emb|CBI35155.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|255574526|ref|XP_002528174.1| Disease resistance protein RFL1, putative [Ricinus communis] gi|223532386|gb|EEF34181.1| Disease resistance protein RFL1, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|147787802|emb|CAN71755.1| hypothetical protein VITISV_005047 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST
Original result of BLAST against Gene Ontology (AMIGO)
| ID |
Alignment graph |
Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 1497 | ||||||
| TAIR|locus:2131689 | 919 | AT4G27220 [Arabidopsis thalian | 0.575 | 0.937 | 0.291 | 7.7e-85 | |
| TAIR|locus:2136447 | 985 | AT4G27190 [Arabidopsis thalian | 0.545 | 0.829 | 0.277 | 2.1e-72 | |
| TAIR|locus:2005517 | 909 | RPS2 "RESISTANT TO P. SYRINGAE | 0.358 | 0.589 | 0.292 | 7.5e-54 | |
| TAIR|locus:2034770 | 894 | SUMM2 "AT1G12280" [Arabidopsis | 0.526 | 0.881 | 0.263 | 9.4e-50 | |
| TAIR|locus:2201996 | 889 | RPS5 "AT1G12220" [Arabidopsis | 0.410 | 0.690 | 0.276 | 2.3e-47 | |
| TAIR|locus:2166320 | 888 | AT5G63020 [Arabidopsis thalian | 0.526 | 0.887 | 0.248 | 6.8e-47 | |
| TAIR|locus:2008510 | 967 | AT1G61190 "AT1G61190" [Arabido | 0.424 | 0.656 | 0.266 | 1.4e-45 | |
| TAIR|locus:2153474 | 874 | AT5G05400 [Arabidopsis thalian | 0.516 | 0.884 | 0.261 | 6.4e-43 | |
| TAIR|locus:2132741 | 892 | AT4G10780 [Arabidopsis thalian | 0.404 | 0.679 | 0.268 | 7.5e-43 | |
| TAIR|locus:2034765 | 884 | AT1G12290 [Arabidopsis thalian | 0.402 | 0.682 | 0.265 | 7.6e-43 |
| TAIR|locus:2131689 AT4G27220 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 858 (307.1 bits), Expect = 7.7e-85, P = 7.7e-85
Identities = 271/930 (29%), Positives = 454/930 (48%)
Query: 13 YKSNFDHLTKEVEKLRERRESVQHRVDFAKENGEEIEQSVENWLISVDKIVEEAGKFVED 72
++SN L + +E+L+ + V + + + +E+ + WL V++ V G+ +
Sbjct: 2 FRSNARALNRALERLKNVQTKVNEALKRSGIQEKSLERKLRIWLRKVEENVP-LGELIL- 59
Query: 73 DEEANNPCFKVLCPNLKNRHHLSXXXXXXXXXXXXLQDEGN--FDRVSVRGISRDRLVAY 130
E + C LS L+++G ++SV SR+ +
Sbjct: 60 --EKRSSC----------AIWLSDKDVEILEKVKRLEEQGQDLIKKISVNKSSREIVERV 107
Query: 131 T-ESYNEGHEFIESRESILNDILDALRGPYVYMIGVYGMAGIGKTTLVKEVAR-LAKEGR 188
S++ +E +L+ + D L+ V IGV+GM G+GKTTLV+ + L K
Sbjct: 108 LGPSFHPQKTALE----MLDKLKDCLKKKNVQKIGVWGMGGVGKTTLVRTLNNDLLKYAA 163
Query: 189 I--FDEVVFAEVSQTPDLKRIRREIADQLGLNFCEESDSERIMMLCNRLKREKKILVILD 246
F V++ VS+ DLKR++ +IA +LG F E ++ + +C RL K L+ILD
Sbjct: 164 TQQFALVIWVTVSKDFDLKRVQMDIAKRLGKRFTREQMNQLGLTICERLIDLKNFLLILD 223
Query: 247 DIWTSLDLERTGIPFG-DVHRGCKILVTSRRRDVLVSEMHCQNNYCVSVLNKEEAWSLFS 305
D+W +DL++ GIP + + K+++TSRR +V +M N V+ L ++EAW LF
Sbjct: 224 DVWHPIDLDQLGIPLALERSKDSKVVLTSRRLEVC-QQMMTNENIKVACLQEKEAWELFC 282
Query: 306 KVVGNCVEDPDLQTVAIQVANECGGLPIAILTVARTLRNKP-LFVWKKALQELRFSARNF 364
VG +++ +A V++EC GLP+AI+T+ RTLR KP + VWK L L+ SA +
Sbjct: 283 HNVGEVANSDNVKPIAKDVSHECCGLPLAIITIGRTLRGKPQVEVWKHTLNLLKRSAPSI 342
Query: 365 TGLEALLGSTIELIYNYLEGEELKLTFLLCSLMKHPCDAPIMDLLKYGTGLGLFEDIYTM 424
E + G T++L Y++L+ + +K FL C+L + +L+ Y GL + +
Sbjct: 343 DTEEKIFG-TLKLSYDFLQ-DNMKSCFLFCALFPEDYSIKVSELIMYWVAEGLLDGQHHY 400
Query: 425 QERRDRVYALVRGLKDTCLLHDDDTADWFSMLGFVRNVAISIASI------NLMVRNDAL 478
++ + LV LKD+CLL D D+ D M VR+ AI S +L++ L
Sbjct: 401 EDMMNEGVTLVERLKDSCLLEDGDSCDTVKMHDVVRDFAIWFMSSQGEGFHSLVMAGRGL 460
Query: 479 IEWPNKDMLKNCIAIFLHDINTGELPEG-LEYPHLTSLCMNPKDPFLHIPDNFFAGMPKL 537
IE+P + + + L LP +E L + +P+ F P L
Sbjct: 461 IEFPQDKFVSSVQRVSLMANKLERLPNNVIEGVETLVLLLQGNSHVKEVPNGFLQAFPNL 520
Query: 538 RVLVLTRMKLLTLPSSFCHLPNLESLCLDQCI-LGDIAIIGNLKNLEILSLCCSDIEQLP 596
R+L L+ +++ TLP SF +L +L SL L C L ++ + +L L+ L L S I +LP
Sbjct: 521 RILDLSGVRIRTLPDSFSNLHSLRSLVLRNCKKLRNLPSLESLVKLQFLDLHESAIRELP 580
Query: 597 REIGELTQLKLLDLSNCSKLKVIPPNVISSLSQLEELYLGNTSVEWEFEGLNLERNNASL 656
R + L+ L+ + +SN +L+ IP I LS LE L + ++ W +G E A+L
Sbjct: 581 RGLEALSSLRYICVSNTYQLQSIPAGTILQLSSLEVLDMAGSAYSWGIKGEERE-GQATL 639
Query: 657 QELSILSHLTTLEIHIRDAVILPKGLFS--QKLARYKILVGDVWDW--PGKSENRRTLKL 712
E++ L HL L I + D + S ++L +++ L + PG E +
Sbjct: 640 DEVTCLPHLQFLAIKLLDVLSFSYEFDSLTKRLTKFQFLFSPIRSVSPPGTGEGCLAISD 699
Query: 713 KLPTNIYLDEIIMNLKEIEELYLDEVPGIENVLYELDRKGLPALKHLRAQNNPFILCIVD 772
+N + ++ ++ ++ Y + + G+ L + A+K L P + +
Sbjct: 700 VNVSNASIGWLLQHVTSLDLNYCEGLNGMFENLVTKSKSSFVAMKALSIHYFPSLS--LA 757
Query: 773 SMAQVRCNAFPVLESMFLHNLIHLEKI--CDGLLTAEFFSKLRIIKVRNCDKLKNIFSFS 830
S + + + FP LE + L N ++LE I +G L KL++++V C +LK +FS
Sbjct: 758 SGCESQLDLFPNLEELSLDN-VNLESIGELNGFLGMRL-QKLKLLQVSGCRQLKRLFSDQ 815
Query: 831 IVRG-LPQLQILKVIKCNNMEEIFSFGGEDDVGYNEVDKIEFGQLRSLILKFLPQLTSFY 889
I+ G LP LQ +KV+ C +EE+F+F V + + +L + LK+LPQL S
Sbjct: 816 ILAGTLPNLQEIKVVSCLRLEELFNFSS---VPVDFCAESLLPKLTVIKLKYLPQLRS-- 870
Query: 890 AQLKSSDELDTPKPLFNERVVFPNLETLEL 919
L N+RVV +LE LE+
Sbjct: 871 --------------LCNDRVVLESLEHLEV 886
|
|
| TAIR|locus:2136447 AT4G27190 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2005517 RPS2 "RESISTANT TO P. SYRINGAE 2" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2034770 SUMM2 "AT1G12280" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2201996 RPS5 "AT1G12220" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2166320 AT5G63020 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2008510 AT1G61190 "AT1G61190" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2153474 AT5G05400 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2132741 AT4G10780 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2034765 AT1G12290 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Annotation Transfer from SWISS-PROT Entries
Original result of BLAST against SWISS-PROT
No confident hit for EC number transfering in SWISSPROT detected by BLAST
EC Number Prediction by Ezypred Server
Original result from Ezypred Server
Fail to connect to Ezypred Server
EC Number Prediction by EFICAz Software
| Prediction Level | EC number | Confidence of Prediction |
| 3rd Layer | 3.6.1 | LOW CONFIDENCE prediction! |
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST
Original result of RPS-BLAST against CDD database part I
| ID | Alignment Graph | Length |
Definition |
E-value |
| Query | 1497 | |||
| pfam00931 | 285 | pfam00931, NB-ARC, NB-ARC domain | 2e-44 | |
| pfam13401 | 124 | pfam13401, AAA_22, AAA domain | 6e-10 | |
| COG4886 | 394 | COG4886, COG4886, Leucine-rich repeat (LRR) protei | 2e-07 | |
| pfam05729 | 165 | pfam05729, NACHT, NACHT domain | 6e-06 | |
| smart00382 | 148 | smart00382, AAA, ATPases associated with a variety | 9e-06 | |
| pfam13855 | 60 | pfam13855, LRR_8, Leucine rich repeat | 1e-05 | |
| pfam13191 | 154 | pfam13191, AAA_16, AAA ATPase domain | 2e-05 | |
| COG1474 | 366 | COG1474, CDC6, Cdc6-related protein, AAA superfami | 2e-05 | |
| PLN03210 | 1153 | PLN03210, PLN03210, Resistant to P | 9e-05 | |
| PLN03210 | 1153 | PLN03210, PLN03210, Resistant to P | 8e-04 | |
| COG4886 | 394 | COG4886, COG4886, Leucine-rich repeat (LRR) protei | 9e-04 | |
| COG4886 | 394 | COG4886, COG4886, Leucine-rich repeat (LRR) protei | 0.001 | |
| pfam13855 | 60 | pfam13855, LRR_8, Leucine rich repeat | 0.002 | |
| PRK13695 | 174 | PRK13695, PRK13695, putative NTPase; Provisional | 0.002 | |
| COG4886 | 394 | COG4886, COG4886, Leucine-rich repeat (LRR) protei | 0.003 | |
| pfam01637 | 223 | pfam01637, Arch_ATPase, Archaeal ATPase | 0.004 |
| >gnl|CDD|216202 pfam00931, NB-ARC, NB-ARC domain | Back alignment and domain information |
|---|
Score = 162 bits (412), Expect = 2e-44
Identities = 85/285 (29%), Positives = 142/285 (49%), Gaps = 13/285 (4%)
Query: 144 RESILNDILDAL--RGPYVYMIGVYGMAGIGKTTLVKEVARLAKEGRIFDEVVFAEVSQT 201
RE ++ +++ L + ++G+ GM G+GKTTL K++ G FD V + VS+T
Sbjct: 1 REDMIEALIEKLLEMSDNLGVVGIVGMGGVGKTTLAKQIYNDDSVGGHFDSVAWVVVSKT 60
Query: 202 PDLKRIRREIADQLGLNFC---EESDSERIMMLCNRLKREKKILVILDDIWTSLDLERTG 258
R++++I +LGL+ E+++SE + + L R K+ L++LDD+W D ++ G
Sbjct: 61 YTEFRLQKDILQELGLDDSDWVEKNESELAVKIKEALLR-KRFLLVLDDVWEKNDWDKIG 119
Query: 259 IPFGDVHRGCKILVTSRRRDVLVSEMHCQNN-YCVSVLNKEEAWSLFSKVVG--NCVEDP 315
+PF D G +++VT+R V M + + V L EE+W LFS V P
Sbjct: 120 VPFPDGENGSRVIVTTRSESVA-GRMGGTSKPHEVESLEPEESWELFSNKVFEKELPPCP 178
Query: 316 DLQTVAIQVANECGGLPIAILTVARTLRNKP-LFVWKKALQELRFSARNFTGLEALLGST 374
+L+ VA ++ +C GLP+A+ + L K + W+ L++L GL +L S
Sbjct: 179 ELEEVAKEIVEKCKGLPLALKVLGGLLAFKSTVQEWEHVLEQLNNELAGRDGLNEVL-SI 237
Query: 375 IELIYNYLEGEELKLTFLLCSLMKHPCDAPIMDLLKYGTGLGLFE 419
+ L Y+ L LK FL +L + L+K G
Sbjct: 238 LSLSYDNLP-MHLKRCFLYLALFPEDYNIRKEQLIKLWIAEGFVI 281
|
Length = 285 |
| >gnl|CDD|222104 pfam13401, AAA_22, AAA domain | Back alignment and domain information |
|---|
| >gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|218719 pfam05729, NACHT, NACHT domain | Back alignment and domain information |
|---|
| >gnl|CDD|214640 smart00382, AAA, ATPases associated with a variety of cellular activities | Back alignment and domain information |
|---|
| >gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat | Back alignment and domain information |
|---|
| >gnl|CDD|221970 pfam13191, AAA_16, AAA ATPase domain | Back alignment and domain information |
|---|
| >gnl|CDD|224391 COG1474, CDC6, Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|215633 PLN03210, PLN03210, Resistant to P | Back alignment and domain information |
|---|
| >gnl|CDD|215633 PLN03210, PLN03210, Resistant to P | Back alignment and domain information |
|---|
| >gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat | Back alignment and domain information |
|---|
| >gnl|CDD|237475 PRK13695, PRK13695, putative NTPase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|216619 pfam01637, Arch_ATPase, Archaeal ATPase | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch
Original result of HHsearch against CDD database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 1497 | |||
| KOG4658 | 889 | consensus Apoptotic ATPase [Signal transduction me | 100.0 | |
| PLN03210 | 1153 | Resistant to P. syringae 6; Provisional | 100.0 | |
| PF00931 | 287 | NB-ARC: NB-ARC domain; InterPro: IPR002182 This is | 100.0 | |
| PLN00113 | 968 | leucine-rich repeat receptor-like protein kinase; | 99.97 | |
| PLN00113 | 968 | leucine-rich repeat receptor-like protein kinase; | 99.97 | |
| KOG0618 | 1081 | consensus Serine/threonine phosphatase 2C containi | 99.81 | |
| PLN03210 | 1153 | Resistant to P. syringae 6; Provisional | 99.81 | |
| KOG4194 | 873 | consensus Membrane glycoprotein LIG-1 [Signal tran | 99.81 | |
| KOG4194 | 873 | consensus Membrane glycoprotein LIG-1 [Signal tran | 99.77 | |
| KOG0618 | 1081 | consensus Serine/threonine phosphatase 2C containi | 99.76 | |
| KOG0472 | 565 | consensus Leucine-rich repeat protein [Function un | 99.76 | |
| KOG0444 | 1255 | consensus Cytoskeletal regulator Flightless-I (con | 99.75 | |
| KOG0472 | 565 | consensus Leucine-rich repeat protein [Function un | 99.75 | |
| KOG0444 | 1255 | consensus Cytoskeletal regulator Flightless-I (con | 99.71 | |
| KOG0617 | 264 | consensus Ras suppressor protein (contains leucine | 99.47 | |
| KOG0617 | 264 | consensus Ras suppressor protein (contains leucine | 99.43 | |
| PRK04841 | 903 | transcriptional regulator MalT; Provisional | 99.28 | |
| PRK15387 | 788 | E3 ubiquitin-protein ligase SspH2; Provisional | 99.25 | |
| PRK15370 | 754 | E3 ubiquitin-protein ligase SlrP; Provisional | 99.24 | |
| KOG4237 | 498 | consensus Extracellular matrix protein slit, conta | 99.23 | |
| COG2909 | 894 | MalT ATP-dependent transcriptional regulator [Tran | 99.22 | |
| KOG4658 | 889 | consensus Apoptotic ATPase [Signal transduction me | 99.2 | |
| KOG4341 | 483 | consensus F-box protein containing LRR [General fu | 99.13 | |
| PRK15370 | 754 | E3 ubiquitin-protein ligase SlrP; Provisional | 99.13 | |
| PRK15387 | 788 | E3 ubiquitin-protein ligase SspH2; Provisional | 99.12 | |
| PRK00411 | 394 | cdc6 cell division control protein 6; Reviewed | 99.05 | |
| TIGR03015 | 269 | pepcterm_ATPase putative secretion ATPase, PEP-CTE | 99.04 | |
| KOG4341 | 483 | consensus F-box protein containing LRR [General fu | 99.02 | |
| KOG4237 | 498 | consensus Extracellular matrix protein slit, conta | 98.94 | |
| PF01637 | 234 | Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 | 98.92 | |
| PF05729 | 166 | NACHT: NACHT domain | 98.92 | |
| KOG0532 | 722 | consensus Leucine-rich repeat (LRR) protein, conta | 98.87 | |
| PF14580 | 175 | LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ | 98.84 | |
| KOG1259 | 490 | consensus Nischarin, modulator of integrin alpha5 | 98.81 | |
| PF14580 | 175 | LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ | 98.79 | |
| TIGR02928 | 365 | orc1/cdc6 family replication initiation protein. M | 98.77 | |
| cd00116 | 319 | LRR_RI Leucine-rich repeats (LRRs), ribonuclease i | 98.66 | |
| PRK00080 | 328 | ruvB Holliday junction DNA helicase RuvB; Reviewed | 98.66 | |
| cd00116 | 319 | LRR_RI Leucine-rich repeats (LRRs), ribonuclease i | 98.64 | |
| KOG0532 | 722 | consensus Leucine-rich repeat (LRR) protein, conta | 98.6 | |
| COG2256 | 436 | MGS1 ATPase related to the helicase subunit of the | 98.58 | |
| PTZ00112 | 1164 | origin recognition complex 1 protein; Provisional | 98.57 | |
| KOG1259 | 490 | consensus Nischarin, modulator of integrin alpha5 | 98.53 | |
| PRK13342 | 413 | recombination factor protein RarA; Reviewed | 98.51 | |
| TIGR00635 | 305 | ruvB Holliday junction DNA helicase, RuvB subunit. | 98.51 | |
| PTZ00202 | 550 | tuzin; Provisional | 98.5 | |
| PRK06893 | 229 | DNA replication initiation factor; Validated | 98.46 | |
| COG4886 | 394 | Leucine-rich repeat (LRR) protein [Function unknow | 98.42 | |
| COG1474 | 366 | CDC6 Cdc6-related protein, AAA superfamily ATPase | 98.36 | |
| PRK07003 | 830 | DNA polymerase III subunits gamma and tau; Validat | 98.36 | |
| PF13173 | 128 | AAA_14: AAA domain | 98.34 | |
| PRK12402 | 337 | replication factor C small subunit 2; Reviewed | 98.33 | |
| PRK14961 | 363 | DNA polymerase III subunits gamma and tau; Provisi | 98.33 | |
| TIGR02903 | 615 | spore_lon_C ATP-dependent protease, Lon family. Me | 98.29 | |
| PRK14949 | 944 | DNA polymerase III subunits gamma and tau; Provisi | 98.29 | |
| PF13401 | 131 | AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S | 98.28 | |
| PRK12323 | 700 | DNA polymerase III subunits gamma and tau; Provisi | 98.27 | |
| COG4886 | 394 | Leucine-rich repeat (LRR) protein [Function unknow | 98.27 | |
| PRK14960 | 702 | DNA polymerase III subunits gamma and tau; Provisi | 98.26 | |
| PRK05564 | 313 | DNA polymerase III subunit delta'; Validated | 98.25 | |
| TIGR03420 | 226 | DnaA_homol_Hda DnaA regulatory inactivator Hda. Me | 98.24 | |
| KOG3207 | 505 | consensus Beta-tubulin folding cofactor E [Posttra | 98.24 | |
| PLN03025 | 319 | replication factor C subunit; Provisional | 98.24 | |
| PRK06645 | 507 | DNA polymerase III subunits gamma and tau; Validat | 98.23 | |
| PRK14963 | 504 | DNA polymerase III subunits gamma and tau; Provisi | 98.23 | |
| KOG2028 | 554 | consensus ATPase related to the helicase subunit o | 98.19 | |
| PRK14956 | 484 | DNA polymerase III subunits gamma and tau; Provisi | 98.17 | |
| cd00009 | 151 | AAA The AAA+ (ATPases Associated with a wide varie | 98.17 | |
| PRK00440 | 319 | rfc replication factor C small subunit; Reviewed | 98.17 | |
| PRK14962 | 472 | DNA polymerase III subunits gamma and tau; Provisi | 98.17 | |
| PRK04195 | 482 | replication factor C large subunit; Provisional | 98.16 | |
| KOG3207 | 505 | consensus Beta-tubulin folding cofactor E [Posttra | 98.12 | |
| PRK14957 | 546 | DNA polymerase III subunits gamma and tau; Provisi | 98.12 | |
| PLN03150 | 623 | hypothetical protein; Provisional | 98.09 | |
| PRK14964 | 491 | DNA polymerase III subunits gamma and tau; Provisi | 98.09 | |
| PRK13341 | 725 | recombination factor protein RarA/unknown domain f | 98.09 | |
| TIGR00678 | 188 | holB DNA polymerase III, delta' subunit. At positi | 98.07 | |
| cd01128 | 249 | rho_factor Transcription termination factor rho is | 98.07 | |
| PF05496 | 233 | RuvB_N: Holliday junction DNA helicase ruvB N-term | 98.07 | |
| PRK14951 | 618 | DNA polymerase III subunits gamma and tau; Provisi | 98.06 | |
| PRK09376 | 416 | rho transcription termination factor Rho; Provisio | 98.06 | |
| PRK08691 | 709 | DNA polymerase III subunits gamma and tau; Validat | 98.05 | |
| PRK14955 | 397 | DNA polymerase III subunits gamma and tau; Provisi | 98.05 | |
| PRK15386 | 426 | type III secretion protein GogB; Provisional | 98.05 | |
| PRK05896 | 605 | DNA polymerase III subunits gamma and tau; Validat | 98.04 | |
| PLN03150 | 623 | hypothetical protein; Provisional | 98.04 | |
| COG3903 | 414 | Predicted ATPase [General function prediction only | 98.02 | |
| PRK09112 | 351 | DNA polymerase III subunit delta'; Validated | 98.02 | |
| PF13855 | 61 | LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF | 98.02 | |
| TIGR02397 | 355 | dnaX_nterm DNA polymerase III, subunit gamma and t | 98.01 | |
| PRK07471 | 365 | DNA polymerase III subunit delta'; Validated | 98.01 | |
| PRK07940 | 394 | DNA polymerase III subunit delta'; Validated | 98.0 | |
| PF13855 | 61 | LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF | 98.0 | |
| PRK08727 | 233 | hypothetical protein; Validated | 97.99 | |
| PRK07994 | 647 | DNA polymerase III subunits gamma and tau; Validat | 97.98 | |
| PRK14958 | 509 | DNA polymerase III subunits gamma and tau; Provisi | 97.98 | |
| PF13191 | 185 | AAA_16: AAA ATPase domain; PDB: 2V1U_A. | 97.96 | |
| TIGR01242 | 364 | 26Sp45 26S proteasome subunit P45 family. Many pro | 97.95 | |
| COG3899 | 849 | Predicted ATPase [General function prediction only | 97.95 | |
| PRK15386 | 426 | type III secretion protein GogB; Provisional | 97.94 | |
| PRK14969 | 527 | DNA polymerase III subunits gamma and tau; Provisi | 97.93 | |
| PRK14959 | 624 | DNA polymerase III subunits gamma and tau; Provisi | 97.92 | |
| PRK07764 | 824 | DNA polymerase III subunits gamma and tau; Validat | 97.9 | |
| KOG2227 | 529 | consensus Pre-initiation complex, subunit CDC6, AA | 97.9 | |
| PRK14971 | 614 | DNA polymerase III subunits gamma and tau; Provisi | 97.89 | |
| PRK08084 | 235 | DNA replication initiation factor; Provisional | 97.89 | |
| PRK09111 | 598 | DNA polymerase III subunits gamma and tau; Validat | 97.89 | |
| PRK14954 | 620 | DNA polymerase III subunits gamma and tau; Provisi | 97.88 | |
| PRK09087 | 226 | hypothetical protein; Validated | 97.88 | |
| KOG2120 | 419 | consensus SCF ubiquitin ligase, Skp2 component [Po | 97.84 | |
| PRK08451 | 535 | DNA polymerase III subunits gamma and tau; Validat | 97.84 | |
| KOG0989 | 346 | consensus Replication factor C, subunit RFC4 [Repl | 97.83 | |
| PRK07133 | 725 | DNA polymerase III subunits gamma and tau; Validat | 97.82 | |
| TIGR00767 | 415 | rho transcription termination factor Rho. Members | 97.81 | |
| PRK14970 | 367 | DNA polymerase III subunits gamma and tau; Provisi | 97.81 | |
| PF14516 | 331 | AAA_35: AAA-like domain | 97.78 | |
| PRK06305 | 451 | DNA polymerase III subunits gamma and tau; Validat | 97.78 | |
| PRK14952 | 584 | DNA polymerase III subunits gamma and tau; Provisi | 97.75 | |
| PF05621 | 302 | TniB: Bacterial TniB protein; InterPro: IPR008868 | 97.74 | |
| TIGR02639 | 731 | ClpA ATP-dependent Clp protease ATP-binding subuni | 97.74 | |
| KOG2120 | 419 | consensus SCF ubiquitin ligase, Skp2 component [Po | 97.74 | |
| KOG1859 | 1096 | consensus Leucine-rich repeat proteins [General fu | 97.73 | |
| PRK14950 | 585 | DNA polymerase III subunits gamma and tau; Provisi | 97.73 | |
| PRK03992 | 389 | proteasome-activating nucleotidase; Provisional | 97.72 | |
| PRK14953 | 486 | DNA polymerase III subunits gamma and tau; Provisi | 97.71 | |
| PHA02544 | 316 | 44 clamp loader, small subunit; Provisional | 97.7 | |
| KOG1859 | 1096 | consensus Leucine-rich repeat proteins [General fu | 97.68 | |
| PRK14948 | 620 | DNA polymerase III subunits gamma and tau; Provisi | 97.68 | |
| KOG0531 | 414 | consensus Protein phosphatase 1, regulatory subuni | 97.66 | |
| KOG0531 | 414 | consensus Protein phosphatase 1, regulatory subuni | 97.64 | |
| PF00308 | 219 | Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013 | 97.64 | |
| PRK11331 | 459 | 5-methylcytosine-specific restriction enzyme subun | 97.63 | |
| TIGR03345 | 852 | VI_ClpV1 type VI secretion ATPase, ClpV1 family. M | 97.63 | |
| PRK08903 | 227 | DnaA regulatory inactivator Hda; Validated | 97.62 | |
| PRK14087 | 450 | dnaA chromosomal replication initiation protein; P | 97.62 | |
| PRK06647 | 563 | DNA polymerase III subunits gamma and tau; Validat | 97.62 | |
| TIGR02881 | 261 | spore_V_K stage V sporulation protein K. Members o | 97.62 | |
| PF12799 | 44 | LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ | 97.62 | |
| TIGR03689 | 512 | pup_AAA proteasome ATPase. In the Actinobacteria, | 97.61 | |
| PRK05563 | 559 | DNA polymerase III subunits gamma and tau; Validat | 97.6 | |
| CHL00095 | 821 | clpC Clp protease ATP binding subunit | 97.58 | |
| PRK05642 | 234 | DNA replication initiation factor; Validated | 97.57 | |
| PF12799 | 44 | LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ | 97.55 | |
| CHL00181 | 287 | cbbX CbbX; Provisional | 97.52 | |
| PRK07399 | 314 | DNA polymerase III subunit delta'; Validated | 97.52 | |
| TIGR02880 | 284 | cbbX_cfxQ probable Rubsico expression protein CbbX | 97.52 | |
| KOG1947 | 482 | consensus Leucine rich repeat proteins, some prote | 97.5 | |
| COG2255 | 332 | RuvB Holliday junction resolvasome, helicase subun | 97.5 | |
| KOG3665 | 699 | consensus ZYG-1-like serine/threonine protein kina | 97.47 | |
| TIGR00362 | 405 | DnaA chromosomal replication initiator protein Dna | 97.47 | |
| PRK14965 | 576 | DNA polymerase III subunits gamma and tau; Provisi | 97.41 | |
| KOG3665 | 699 | consensus ZYG-1-like serine/threonine protein kina | 97.38 | |
| PTZ00454 | 398 | 26S protease regulatory subunit 6B-like protein; P | 97.38 | |
| TIGR00602 | 637 | rad24 checkpoint protein rad24. This family is bas | 97.36 | |
| COG1373 | 398 | Predicted ATPase (AAA+ superfamily) [General funct | 97.35 | |
| PRK05707 | 328 | DNA polymerase III subunit delta'; Validated | 97.34 | |
| KOG2543 | 438 | consensus Origin recognition complex, subunit 5 [R | 97.3 | |
| PRK11034 | 758 | clpA ATP-dependent Clp protease ATP-binding subuni | 97.3 | |
| TIGR03346 | 852 | chaperone_ClpB ATP-dependent chaperone ClpB. Membe | 97.29 | |
| PRK10865 | 857 | protein disaggregation chaperone; Provisional | 97.27 | |
| PRK00149 | 450 | dnaA chromosomal replication initiation protein; R | 97.27 | |
| PRK14088 | 440 | dnaA chromosomal replication initiation protein; P | 97.26 | |
| KOG1947 | 482 | consensus Leucine rich repeat proteins, some prote | 97.25 | |
| PTZ00361 | 438 | 26 proteosome regulatory subunit 4-like protein; P | 97.23 | |
| KOG2982 | 418 | consensus Uncharacterized conserved protein [Funct | 97.22 | |
| PRK10536 | 262 | hypothetical protein; Provisional | 97.21 | |
| PRK14086 | 617 | dnaA chromosomal replication initiation protein; P | 97.2 | |
| KOG2982 | 418 | consensus Uncharacterized conserved protein [Funct | 97.2 | |
| CHL00176 | 638 | ftsH cell division protein; Validated | 97.19 | |
| smart00382 | 148 | AAA ATPases associated with a variety of cellular | 97.19 | |
| PF00004 | 132 | AAA: ATPase family associated with various cellula | 97.18 | |
| PRK06620 | 214 | hypothetical protein; Validated | 97.17 | |
| KOG1909 | 382 | consensus Ran GTPase-activating protein [RNA proce | 97.12 | |
| TIGR00763 | 775 | lon ATP-dependent protease La. This protein is ind | 97.11 | |
| TIGR01241 | 495 | FtsH_fam ATP-dependent metalloprotease FtsH. HflB( | 97.1 | |
| PRK08769 | 319 | DNA polymerase III subunit delta'; Validated | 97.1 | |
| COG1222 | 406 | RPT1 ATP-dependent 26S proteasome regulatory subun | 97.09 | |
| KOG1909 | 382 | consensus Ran GTPase-activating protein [RNA proce | 97.08 | |
| PRK10787 | 784 | DNA-binding ATP-dependent protease La; Provisional | 96.96 | |
| PRK08058 | 329 | DNA polymerase III subunit delta'; Validated | 96.96 | |
| KOG2035 | 351 | consensus Replication factor C, subunit RFC3 [Cell | 96.96 | |
| KOG0741 | 744 | consensus AAA+-type ATPase [Posttranslational modi | 96.96 | |
| KOG0743 | 457 | consensus AAA+-type ATPase [Posttranslational modi | 96.96 | |
| KOG4579 | 177 | consensus Leucine-rich repeat (LRR) protein associ | 96.96 | |
| PRK06090 | 319 | DNA polymerase III subunit delta'; Validated | 96.93 | |
| PF13177 | 162 | DNA_pol3_delta2: DNA polymerase III, delta subunit | 96.91 | |
| PRK12422 | 445 | chromosomal replication initiation protein; Provis | 96.91 | |
| PRK06871 | 325 | DNA polymerase III subunit delta'; Validated | 96.9 | |
| KOG0731 | 774 | consensus AAA+-type ATPase containing the peptidas | 96.9 | |
| KOG0733 | 802 | consensus Nuclear AAA ATPase (VCP subfamily) [Post | 96.88 | |
| COG3267 | 269 | ExeA Type II secretory pathway, component ExeA (pr | 96.84 | |
| CHL00195 | 489 | ycf46 Ycf46; Provisional | 96.83 | |
| KOG0730 | 693 | consensus AAA+-type ATPase [Posttranslational modi | 96.83 | |
| PF05673 | 249 | DUF815: Protein of unknown function (DUF815); Inte | 96.83 | |
| COG0466 | 782 | Lon ATP-dependent Lon protease, bacterial type [Po | 96.81 | |
| PRK08118 | 167 | topology modulation protein; Reviewed | 96.81 | |
| PRK12608 | 380 | transcription termination factor Rho; Provisional | 96.81 | |
| KOG1644 | 233 | consensus U2-associated snRNP A' protein [RNA proc | 96.79 | |
| PRK10865 | 857 | protein disaggregation chaperone; Provisional | 96.76 | |
| PF10443 | 431 | RNA12: RNA12 protein; InterPro: IPR018850 Mitochon | 96.74 | |
| COG0593 | 408 | DnaA ATPase involved in DNA replication initiation | 96.73 | |
| TIGR03345 | 852 | VI_ClpV1 type VI secretion ATPase, ClpV1 family. M | 96.71 | |
| COG1223 | 368 | Predicted ATPase (AAA+ superfamily) [General funct | 96.7 | |
| COG2812 | 515 | DnaX DNA polymerase III, gamma/tau subunits [DNA r | 96.69 | |
| TIGR02639 | 731 | ClpA ATP-dependent Clp protease ATP-binding subuni | 96.64 | |
| PRK08116 | 268 | hypothetical protein; Validated | 96.63 | |
| KOG4579 | 177 | consensus Leucine-rich repeat (LRR) protein associ | 96.59 | |
| PRK12727 | 559 | flagellar biosynthesis regulator FlhF; Provisional | 96.58 | |
| KOG1644 | 233 | consensus U2-associated snRNP A' protein [RNA proc | 96.57 | |
| TIGR01243 | 733 | CDC48 AAA family ATPase, CDC48 subfamily. This sub | 96.55 | |
| PF02562 | 205 | PhoH: PhoH-like protein; InterPro: IPR003714 PhoH | 96.54 | |
| PRK08939 | 306 | primosomal protein DnaI; Reviewed | 96.52 | |
| TIGR02640 | 262 | gas_vesic_GvpN gas vesicle protein GvpN. Members o | 96.5 | |
| KOG0991 | 333 | consensus Replication factor C, subunit RFC2 [Repl | 96.5 | |
| PRK06964 | 342 | DNA polymerase III subunit delta'; Validated | 96.48 | |
| PRK07993 | 334 | DNA polymerase III subunit delta'; Validated | 96.48 | |
| PRK07261 | 171 | topology modulation protein; Provisional | 96.42 | |
| COG0542 | 786 | clpA ATP-binding subunits of Clp protease and DnaK | 96.37 | |
| PF00448 | 196 | SRP54: SRP54-type protein, GTPase domain; InterPro | 96.36 | |
| PHA00729 | 226 | NTP-binding motif containing protein | 96.32 | |
| KOG1514 | 767 | consensus Origin recognition complex, subunit 1, a | 96.32 | |
| PRK08181 | 269 | transposase; Validated | 96.31 | |
| TIGR01243 | 733 | CDC48 AAA family ATPase, CDC48 subfamily. This sub | 96.24 | |
| PF04665 | 241 | Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 | 96.22 | |
| smart00763 | 361 | AAA_PrkA PrkA AAA domain. This is a family of PrkA | 96.17 | |
| PRK06526 | 254 | transposase; Provisional | 96.15 | |
| KOG2004 | 906 | consensus Mitochondrial ATP-dependent protease PIM | 96.13 | |
| TIGR02237 | 209 | recomb_radB DNA repair and recombination protein R | 96.1 | |
| PF01695 | 178 | IstB_IS21: IstB-like ATP binding protein; InterPro | 96.1 | |
| TIGR02902 | 531 | spore_lonB ATP-dependent protease LonB. Members of | 96.02 | |
| COG1875 | 436 | NYN ribonuclease and ATPase of PhoH family domains | 96.01 | |
| PRK12377 | 248 | putative replication protein; Provisional | 96.0 | |
| cd01123 | 235 | Rad51_DMC1_radA Rad51_DMC1_radA,B. This group of r | 95.97 | |
| TIGR01425 | 429 | SRP54_euk signal recognition particle protein SRP5 | 95.97 | |
| PRK04132 | 846 | replication factor C small subunit; Provisional | 95.96 | |
| KOG0734 | 752 | consensus AAA+-type ATPase containing the peptidas | 95.95 | |
| COG0470 | 325 | HolB ATPase involved in DNA replication [DNA repli | 95.94 | |
| TIGR03499 | 282 | FlhF flagellar biosynthetic protein FlhF. | 95.94 | |
| PRK06921 | 266 | hypothetical protein; Provisional | 95.89 | |
| KOG2123 | 388 | consensus Uncharacterized conserved protein [Funct | 95.89 | |
| PRK00771 | 437 | signal recognition particle protein Srp54; Provisi | 95.88 | |
| COG1484 | 254 | DnaC DNA replication protein [DNA replication, rec | 95.82 | |
| TIGR03346 | 852 | chaperone_ClpB ATP-dependent chaperone ClpB. Membe | 95.82 | |
| PF13207 | 121 | AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6 | 95.81 | |
| PRK14722 | 374 | flhF flagellar biosynthesis regulator FlhF; Provis | 95.8 | |
| PRK11034 | 758 | clpA ATP-dependent Clp protease ATP-binding subuni | 95.77 | |
| CHL00095 | 821 | clpC Clp protease ATP binding subunit | 95.76 | |
| KOG0736 | 953 | consensus Peroxisome assembly factor 2 containing | 95.75 | |
| KOG0739 | 439 | consensus AAA+-type ATPase [Posttranslational modi | 95.75 | |
| KOG2739 | 260 | consensus Leucine-rich acidic nuclear protein [Cel | 95.68 | |
| PRK11889 | 436 | flhF flagellar biosynthesis regulator FlhF; Provis | 95.6 | |
| TIGR02012 | 321 | tigrfam_recA protein RecA. This model describes or | 95.59 | |
| PRK08699 | 325 | DNA polymerase III subunit delta'; Validated | 95.59 | |
| PF03215 | 519 | Rad17: Rad17 cell cycle checkpoint protein | 95.58 | |
| PF08423 | 256 | Rad51: Rad51; InterPro: IPR013632 This domain is f | 95.55 | |
| PRK09183 | 259 | transposase/IS protein; Provisional | 95.55 | |
| COG2884 | 223 | FtsE Predicted ATPase involved in cell division [C | 95.54 | |
| KOG1969 | 877 | consensus DNA replication checkpoint protein CHL12 | 95.52 | |
| PRK10867 | 433 | signal recognition particle protein; Provisional | 95.48 | |
| PRK07952 | 244 | DNA replication protein DnaC; Validated | 95.46 | |
| KOG0733 | 802 | consensus Nuclear AAA ATPase (VCP subfamily) [Post | 95.46 | |
| PRK06696 | 223 | uridine kinase; Validated | 95.43 | |
| PRK06835 | 329 | DNA replication protein DnaC; Validated | 95.4 | |
| COG5238 | 388 | RNA1 Ran GTPase-activating protein (RanGAP) involv | 95.37 | |
| KOG2739 | 260 | consensus Leucine-rich acidic nuclear protein [Cel | 95.35 | |
| KOG0727 | 408 | consensus 26S proteasome regulatory complex, ATPas | 95.32 | |
| cd01393 | 226 | recA_like RecA is a bacterial enzyme which has rol | 95.32 | |
| cd00983 | 325 | recA RecA is a bacterial enzyme which has roles in | 95.32 | |
| PF07693 | 325 | KAP_NTPase: KAP family P-loop domain; InterPro: IP | 95.31 | |
| PRK09270 | 229 | nucleoside triphosphate hydrolase domain-containin | 95.26 | |
| TIGR02238 | 313 | recomb_DMC1 meiotic recombinase Dmc1. This model d | 95.25 | |
| PRK09354 | 349 | recA recombinase A; Provisional | 95.22 | |
| COG0464 | 494 | SpoVK ATPases of the AAA+ class [Posttranslational | 95.18 | |
| cd01133 | 274 | F1-ATPase_beta F1 ATP synthase beta subunit, nucle | 95.15 | |
| PRK12723 | 388 | flagellar biosynthesis regulator FlhF; Provisional | 95.15 | |
| PRK09361 | 225 | radB DNA repair and recombination protein RadB; Pr | 95.13 | |
| cd01120 | 165 | RecA-like_NTPases RecA-like NTPases. This family i | 95.12 | |
| PLN03187 | 344 | meiotic recombination protein DMC1 homolog; Provis | 95.07 | |
| PTZ00494 | 664 | tuzin-like protein; Provisional | 95.05 | |
| PRK10733 | 644 | hflB ATP-dependent metalloprotease; Reviewed | 95.01 | |
| KOG0744 | 423 | consensus AAA+-type ATPase [Posttranslational modi | 94.98 | |
| PRK07132 | 299 | DNA polymerase III subunit delta'; Validated | 94.96 | |
| PRK15455 | 644 | PrkA family serine protein kinase; Provisional | 94.95 | |
| PRK04296 | 190 | thymidine kinase; Provisional | 94.95 | |
| KOG0735 | 952 | consensus AAA+-type ATPase [Posttranslational modi | 94.79 | |
| COG0542 | 786 | clpA ATP-binding subunits of Clp protease and DnaK | 94.77 | |
| TIGR02858 | 270 | spore_III_AA stage III sporulation protein AA. Mem | 94.76 | |
| PRK12724 | 432 | flagellar biosynthesis regulator FlhF; Provisional | 94.74 | |
| PRK14974 | 336 | cell division protein FtsY; Provisional | 94.73 | |
| COG1618 | 179 | Predicted nucleotide kinase [Nucleotide transport | 94.7 | |
| COG0541 | 451 | Ffh Signal recognition particle GTPase [Intracellu | 94.69 | |
| PRK05541 | 176 | adenylylsulfate kinase; Provisional | 94.67 | |
| PRK12726 | 407 | flagellar biosynthesis regulator FlhF; Provisional | 94.65 | |
| COG1419 | 407 | FlhF Flagellar GTP-binding protein [Cell motility | 94.6 | |
| TIGR00959 | 428 | ffh signal recognition particle protein. This mode | 94.59 | |
| COG2607 | 287 | Predicted ATPase (AAA+ superfamily) [General funct | 94.58 | |
| PRK08533 | 230 | flagellar accessory protein FlaH; Reviewed | 94.56 | |
| TIGR02236 | 310 | recomb_radA DNA repair and recombination protein R | 94.54 | |
| PRK05703 | 424 | flhF flagellar biosynthesis regulator FlhF; Valida | 94.46 | |
| PLN03186 | 342 | DNA repair protein RAD51 homolog; Provisional | 94.44 | |
| TIGR02239 | 316 | recomb_RAD51 DNA repair protein RAD51. This eukary | 94.42 | |
| cd03115 | 173 | SRP The signal recognition particle (SRP) mediates | 94.42 | |
| KOG0729 | 435 | consensus 26S proteasome regulatory complex, ATPas | 94.41 | |
| PRK04301 | 317 | radA DNA repair and recombination protein RadA; Va | 94.4 | |
| TIGR03877 | 237 | thermo_KaiC_1 KaiC domain protein, Ph0284 family. | 94.4 | |
| TIGR00064 | 272 | ftsY signal recognition particle-docking protein F | 94.23 | |
| COG0468 | 279 | RecA RecA/RadA recombinase [DNA replication, recom | 94.22 | |
| cd01121 | 372 | Sms Sms (bacterial radA) DNA repair protein. This | 94.2 | |
| TIGR00554 | 290 | panK_bact pantothenate kinase, bacterial type. Sho | 94.19 | |
| PRK06547 | 172 | hypothetical protein; Provisional | 94.17 | |
| PTZ00035 | 337 | Rad51 protein; Provisional | 94.15 | |
| KOG2228 | 408 | consensus Origin recognition complex, subunit 4 [R | 94.13 | |
| TIGR01359 | 183 | UMP_CMP_kin_fam UMP-CMP kinase family. This subfam | 94.12 | |
| KOG2123 | 388 | consensus Uncharacterized conserved protein [Funct | 94.11 | |
| PRK14723 | 767 | flhF flagellar biosynthesis regulator FlhF; Provis | 94.07 | |
| cd02025 | 220 | PanK Pantothenate kinase (PanK) catalyzes the phos | 94.06 | |
| PLN00020 | 413 | ribulose bisphosphate carboxylase/oxygenase activa | 94.05 | |
| PF00006 | 215 | ATP-synt_ab: ATP synthase alpha/beta family, nucle | 93.95 | |
| PF13306 | 129 | LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ | 93.9 | |
| ) proteins. It has been suggested that torsins play a role in effectively managing protein folding and that possible breakdown in a neuroprotective mechanism that is, in part, mediated by torsins may be responsible for the neuronal dysfunction associated with dystonia [].; GO: 0005524 ATP binding, 0051085 chaperone mediated protein folding requiring cofactor" target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=PF06309">PF06309 | 127 | Torsin: Torsin; InterPro: IPR010448 This family co | 93.89 | |
| PF13238 | 129 | AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB | 93.85 | |
| cd01394 | 218 | radB RadB. The archaeal protein radB shares simila | 93.83 | |
| PRK07667 | 193 | uridine kinase; Provisional | 93.81 | |
| PRK14721 | 420 | flhF flagellar biosynthesis regulator FlhF; Provis | 93.78 | |
| PRK04328 | 249 | hypothetical protein; Provisional | 93.75 | |
| PRK06995 | 484 | flhF flagellar biosynthesis regulator FlhF; Valida | 93.73 | |
| PF07728 | 139 | AAA_5: AAA domain (dynein-related subfamily); Inte | 93.72 | |
| PRK05917 | 290 | DNA polymerase III subunit delta'; Validated | 93.67 | |
| KOG0728 | 404 | consensus 26S proteasome regulatory complex, ATPas | 93.64 | |
| COG0563 | 178 | Adk Adenylate kinase and related kinases [Nucleoti | 93.64 | |
| PF03308 | 266 | ArgK: ArgK protein; InterPro: IPR005129 Bacterial | 93.64 | |
| PF13306 | 129 | LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ | 93.63 | |
| PF00560 | 22 | LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le | 93.6 | |
| cd03281 | 213 | ABC_MSH5_euk MutS5 homolog in eukaryotes. The MutS | 93.59 | |
| PRK13531 | 498 | regulatory ATPase RavA; Provisional | 93.57 | |
| KOG0738 | 491 | consensus AAA+-type ATPase [Posttranslational modi | 93.55 | |
| PF13481 | 193 | AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C. | 93.54 | |
| cd02019 | 69 | NK Nucleoside/nucleotide kinase (NK) is a protein | 93.54 | |
| COG4088 | 261 | Predicted nucleotide kinase [Nucleotide transport | 93.52 | |
| cd01131 | 198 | PilT Pilus retraction ATPase PilT. PilT is a nucle | 93.49 | |
| PRK05439 | 311 | pantothenate kinase; Provisional | 93.49 | |
| PRK10463 | 290 | hydrogenase nickel incorporation protein HypB; Pro | 93.4 | |
| PRK06851 | 367 | hypothetical protein; Provisional | 93.31 | |
| PF00485 | 194 | PRK: Phosphoribulokinase / Uridine kinase family; | 93.25 | |
| cd03214 | 180 | ABC_Iron-Siderophores_B12_Hemin ABC transporters, | 93.21 | |
| COG1428 | 216 | Deoxynucleoside kinases [Nucleotide transport and | 93.18 | |
| PF13671 | 143 | AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1 | 93.15 | |
| cd03247 | 178 | ABCC_cytochrome_bd The CYD subfamily implicated in | 93.13 | |
| PF01583 | 156 | APS_kinase: Adenylylsulphate kinase; InterPro: IPR | 93.06 | |
| COG0465 | 596 | HflB ATP-dependent Zn proteases [Posttranslational | 93.05 | |
| COG1066 | 456 | Sms Predicted ATP-dependent serine protease [Postt | 93.04 | |
| PF00154 | 322 | RecA: recA bacterial DNA recombination protein; In | 93.04 | |
| COG3640 | 255 | CooC CO dehydrogenase maturation factor [Cell divi | 93.02 | |
| PF10236 | 309 | DAP3: Mitochondrial ribosomal death-associated pro | 93.02 | |
| cd01124 | 187 | KaiC KaiC is a circadian clock protein primarily f | 93.01 | |
| PRK08233 | 182 | hypothetical protein; Provisional | 93.01 | |
| cd01135 | 276 | V_A-ATPase_B V/A-type ATP synthase (non-catalytic) | 93.0 | |
| PRK06762 | 166 | hypothetical protein; Provisional | 92.87 | |
| PRK06067 | 234 | flagellar accessory protein FlaH; Validated | 92.86 | |
| TIGR01360 | 188 | aden_kin_iso1 adenylate kinase, isozyme 1 subfamil | 92.84 | |
| PF14532 | 138 | Sigma54_activ_2: Sigma-54 interaction domain; PDB: | 92.83 | |
| CHL00206 | 2281 | ycf2 Ycf2; Provisional | 92.83 | |
| COG1121 | 254 | ZnuC ABC-type Mn/Zn transport systems, ATPase comp | 92.81 | |
| PRK13765 | 637 | ATP-dependent protease Lon; Provisional | 92.8 | |
| PF03205 | 140 | MobB: Molybdopterin guanine dinucleotide synthesis | 92.79 | |
| PRK05480 | 209 | uridine/cytidine kinase; Provisional | 92.77 | |
| PF08298 | 358 | AAA_PrkA: PrkA AAA domain; InterPro: IPR013153 Thi | 92.76 | |
| PRK09519 | 790 | recA DNA recombination protein RecA; Reviewed | 92.75 | |
| PF08433 | 270 | KTI12: Chromatin associated protein KTI12 ; InterP | 92.75 | |
| PRK03839 | 180 | putative kinase; Provisional | 92.72 | |
| TIGR01069 | 771 | mutS2 MutS2 family protein. Function of MutS2 is u | 92.71 | |
| COG0194 | 191 | Gmk Guanylate kinase [Nucleotide transport and met | 92.71 | |
| PTZ00301 | 210 | uridine kinase; Provisional | 92.7 | |
| cd00561 | 159 | CobA_CobO_BtuR ATP:corrinoid adenosyltransferase B | 92.68 | |
| TIGR00235 | 207 | udk uridine kinase. Model contains a number of lon | 92.61 | |
| cd03216 | 163 | ABC_Carb_Monos_I This family represents the domain | 92.6 | |
| cd03228 | 171 | ABCC_MRP_Like The MRP (Mutidrug Resistance Protein | 92.58 | |
| PF00910 | 107 | RNA_helicase: RNA helicase; InterPro: IPR000605 He | 92.57 | |
| PRK10416 | 318 | signal recognition particle-docking protein FtsY; | 92.56 | |
| cd02027 | 149 | APSK Adenosine 5'-phosphosulfate kinase (APSK) cat | 92.49 | |
| PTZ00088 | 229 | adenylate kinase 1; Provisional | 92.47 | |
| PRK05342 | 412 | clpX ATP-dependent protease ATP-binding subunit Cl | 92.46 | |
| PF00560 | 22 | LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le | 92.44 | |
| COG1703 | 323 | ArgK Putative periplasmic protein kinase ArgK and | 92.41 | |
| PRK12597 | 461 | F0F1 ATP synthase subunit beta; Provisional | 92.41 | |
| PRK00625 | 173 | shikimate kinase; Provisional | 92.38 | |
| KOG3864 | 221 | consensus Uncharacterized conserved protein [Funct | 92.34 | |
| TIGR00390 | 441 | hslU ATP-dependent protease HslVU, ATPase subunit. | 92.29 | |
| TIGR03878 | 259 | thermo_KaiC_2 KaiC domain protein, AF_0795 family. | 92.28 | |
| COG0572 | 218 | Udk Uridine kinase [Nucleotide transport and metab | 92.26 | |
| cd03221 | 144 | ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is | 92.25 | |
| KOG0735 | 952 | consensus AAA+-type ATPase [Posttranslational modi | 92.23 | |
| KOG0652 | 424 | consensus 26S proteasome regulatory complex, ATPas | 92.23 | |
| cd03238 | 176 | ABC_UvrA The excision repair protein UvrA; Nucleot | 92.19 | |
| cd03223 | 166 | ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cass | 92.18 | |
| KOG3347 | 176 | consensus Predicted nucleotide kinase/nuclear prot | 92.18 | |
| PRK04040 | 188 | adenylate kinase; Provisional | 92.17 | |
| TIGR00416 | 454 | sms DNA repair protein RadA. The gene protuct code | 92.15 | |
| PRK11823 | 446 | DNA repair protein RadA; Provisional | 92.13 | |
| PF12775 | 272 | AAA_7: P-loop containing dynein motor region D3; P | 92.11 | |
| TIGR03305 | 449 | alt_F1F0_F1_bet alternate F1F0 ATPase, F1 subunit | 92.09 | |
| COG0488 | 530 | Uup ATPase components of ABC transporters with dup | 92.07 | |
| PRK06217 | 183 | hypothetical protein; Validated | 92.05 | |
| TIGR03575 | 340 | selen_PSTK_euk L-seryl-tRNA(Sec) kinase, eukaryoti | 92.01 | |
| PRK09280 | 463 | F0F1 ATP synthase subunit beta; Validated | 91.97 | |
| TIGR00708 | 173 | cobA cob(I)alamin adenosyltransferase. Alternate n | 91.96 | |
| KOG1051 | 898 | consensus Chaperone HSP104 and related ATP-depende | 91.95 | |
| PRK00409 | 782 | recombination and DNA strand exchange inhibitor pr | 91.93 | |
| PRK08972 | 444 | fliI flagellum-specific ATP synthase; Validated | 91.93 | |
| TIGR02655 | 484 | circ_KaiC circadian clock protein KaiC. Members of | 91.91 | |
| cd01125 | 239 | repA Hexameric Replicative Helicase RepA. RepA is | 91.87 | |
| TIGR01817 | 534 | nifA Nif-specific regulatory protein. This model r | 91.8 | |
| TIGR00750 | 300 | lao LAO/AO transport system ATPase. Mutations have | 91.72 | |
| KOG0737 | 386 | consensus AAA+-type ATPase [Posttranslational modi | 91.7 | |
| PRK06002 | 450 | fliI flagellum-specific ATP synthase; Validated | 91.61 | |
| cd00544 | 169 | CobU Adenosylcobinamide kinase / adenosylcobinamid | 91.54 | |
| PF06745 | 226 | KaiC: KaiC; InterPro: IPR014774 This entry represe | 91.54 | |
| COG0003 | 322 | ArsA Predicted ATPase involved in chromosome parti | 91.48 | |
| KOG2170 | 344 | consensus ATPase of the AAA+ superfamily [General | 91.44 | |
| KOG0927 | 614 | consensus Predicted transporter (ABC superfamily) | 91.37 | |
| PRK09435 | 332 | membrane ATPase/protein kinase; Provisional | 91.36 | |
| PRK00131 | 175 | aroK shikimate kinase; Reviewed | 91.35 | |
| KOG1532 | 366 | consensus GTPase XAB1, interacts with DNA repair p | 91.34 | |
| PF13245 | 76 | AAA_19: Part of AAA domain | 91.31 | |
| cd03283 | 199 | ABC_MutS-like MutS-like homolog in eukaryotes. The | 91.31 | |
| TIGR00382 | 413 | clpX endopeptidase Clp ATP-binding regulatory subu | 91.3 | |
| PF07726 | 131 | AAA_3: ATPase family associated with various cellu | 91.29 | |
| PRK13768 | 253 | GTPase; Provisional | 91.28 | |
| cd01122 | 271 | GP4d_helicase GP4d_helicase is a homohexameric 5'- | 91.22 | |
| COG3854 | 308 | SpoIIIAA ncharacterized protein conserved in bacte | 91.2 | |
| TIGR03881 | 229 | KaiC_arch_4 KaiC domain protein, PAE1156 family. M | 91.18 | |
| COG1224 | 450 | TIP49 DNA helicase TIP49, TBP-interacting protein | 91.18 | |
| PRK10751 | 173 | molybdopterin-guanine dinucleotide biosynthesis pr | 91.16 | |
| TIGR00150 | 133 | HI0065_YjeE ATPase, YjeE family. Members of this f | 91.11 | |
| PRK00889 | 175 | adenylylsulfate kinase; Provisional | 91.09 | |
| cd02020 | 147 | CMPK Cytidine monophosphate kinase (CMPK) catalyze | 91.09 | |
| cd01134 | 369 | V_A-ATPase_A V/A-type ATP synthase catalytic subun | 91.07 | |
| PRK11608 | 326 | pspF phage shock protein operon transcriptional ac | 91.06 | |
| PRK08927 | 442 | fliI flagellum-specific ATP synthase; Validated | 91.03 | |
| COG4608 | 268 | AppF ABC-type oligopeptide transport system, ATPas | 91.03 | |
| PRK12678 | 672 | transcription termination factor Rho; Provisional | 90.98 | |
| COG0529 | 197 | CysC Adenylylsulfate kinase and related kinases [I | 90.97 | |
| PRK15429 | 686 | formate hydrogenlyase transcriptional activator Fh | 90.96 | |
| TIGR02322 | 179 | phosphon_PhnN phosphonate metabolism protein/1,5-b | 90.95 | |
| cd02021 | 150 | GntK Gluconate kinase (GntK) catalyzes the phospho | 90.92 | |
| COG1102 | 179 | Cmk Cytidylate kinase [Nucleotide transport and me | 90.88 | |
| PRK13947 | 171 | shikimate kinase; Provisional | 90.88 | |
| PRK00279 | 215 | adk adenylate kinase; Reviewed | 90.84 | |
| cd00227 | 175 | CPT Chloramphenicol (Cm) phosphotransferase (CPT). | 90.84 | |
| cd02023 | 198 | UMPK Uridine monophosphate kinase (UMPK, EC 2.7.1. | 90.81 | |
| cd01132 | 274 | F1_ATPase_alpha F1 ATP synthase alpha, central dom | 90.81 | |
| TIGR00764 | 608 | lon_rel lon-related putative ATP-dependent proteas | 90.8 | |
| cd02024 | 187 | NRK1 Nicotinamide riboside kinase (NRK) is an enzy | 90.78 | |
| PTZ00185 | 574 | ATPase alpha subunit; Provisional | 90.76 | |
| TIGR02030 | 337 | BchI-ChlI magnesium chelatase ATPase subunit I. Th | 90.73 | |
| PRK13949 | 169 | shikimate kinase; Provisional | 90.68 | |
| PRK13407 | 334 | bchI magnesium chelatase subunit I; Provisional | 90.68 | |
| TIGR01039 | 461 | atpD ATP synthase, F1 beta subunit. The sequences | 90.67 | |
| PF06068 | 398 | TIP49: TIP49 C-terminus; InterPro: IPR010339 This | 90.63 | |
| COG1936 | 180 | Predicted nucleotide kinase (related to CMP and AM | 90.62 | |
| TIGR00073 | 207 | hypB hydrogenase accessory protein HypB. HypB is i | 90.62 | |
| PRK05201 | 443 | hslU ATP-dependent protease ATP-binding subunit Hs | 90.61 | |
| cd00267 | 157 | ABC_ATPase ABC (ATP-binding cassette) transporter | 90.57 | |
| TIGR00176 | 155 | mobB molybdopterin-guanine dinucleotide biosynthes | 90.53 | |
| COG0467 | 260 | RAD55 RecA-superfamily ATPases implicated in signa | 90.51 | |
| PRK14530 | 215 | adenylate kinase; Provisional | 90.38 | |
| PRK08149 | 428 | ATP synthase SpaL; Validated | 90.37 | |
| cd00464 | 154 | SK Shikimate kinase (SK) is the fifth enzyme in th | 90.35 | |
| TIGR01040 | 466 | V-ATPase_V1_B V-type (H+)-ATPase V1, B subunit. Th | 90.26 | |
| KOG0726 | 440 | consensus 26S proteasome regulatory complex, ATPas | 90.25 | |
| PRK14529 | 223 | adenylate kinase; Provisional | 90.18 | |
| PRK13975 | 196 | thymidylate kinase; Provisional | 90.14 | |
| cd02028 | 179 | UMPK_like Uridine monophosphate kinase_like (UMPK_ | 90.14 | |
| KOG3864 | 221 | consensus Uncharacterized conserved protein [Funct | 89.93 | |
| KOG1942 | 456 | consensus DNA helicase, TBP-interacting protein [R | 89.9 | |
| CHL00081 | 350 | chlI Mg-protoporyphyrin IX chelatase | 89.87 | |
| TIGR03263 | 180 | guanyl_kin guanylate kinase. Members of this famil | 89.86 | |
| PRK15453 | 290 | phosphoribulokinase; Provisional | 89.78 | |
| cd03243 | 202 | ABC_MutS_homologs The MutS protein initiates DNA m | 89.75 | |
| cd03287 | 222 | ABC_MSH3_euk MutS3 homolog in eukaryotes. The MutS | 89.69 | |
| PF05970 | 364 | PIF1: PIF1-like helicase; InterPro: IPR010285 This | 89.69 | |
| PRK06731 | 270 | flhF flagellar biosynthesis regulator FlhF; Valida | 89.67 | |
| PHA02774 | 613 | E1; Provisional | 89.66 | |
| PRK12339 | 197 | 2-phosphoglycerate kinase; Provisional | 89.65 | |
| PF13086 | 236 | AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV | 89.64 | |
| TIGR01041 | 458 | ATP_syn_B_arch ATP synthase archaeal, B subunit. A | 89.62 | |
| PRK05057 | 172 | aroK shikimate kinase I; Reviewed | 89.58 | |
| cd03285 | 222 | ABC_MSH2_euk MutS2 homolog in eukaryotes. The MutS | 89.56 | |
| CHL00060 | 494 | atpB ATP synthase CF1 beta subunit | 89.54 | |
| PRK10875 | 615 | recD exonuclease V subunit alpha; Provisional | 89.53 | |
| cd00984 | 242 | DnaB_C DnaB helicase C terminal domain. The hexame | 89.52 | |
| TIGR01313 | 163 | therm_gnt_kin carbohydrate kinase, thermoresistant | 89.52 | |
| COG2019 | 189 | AdkA Archaeal adenylate kinase [Nucleotide transpo | 89.5 | |
| cd01136 | 326 | ATPase_flagellum-secretory_path_III Flagellum-spec | 89.47 | |
| PF03266 | 168 | NTPase_1: NTPase; InterPro: IPR004948 This entry r | 89.4 | |
| PRK13695 | 174 | putative NTPase; Provisional | 89.38 | |
| cd03282 | 204 | ABC_MSH4_euk MutS4 homolog in eukaryotes. The MutS | 89.38 | |
| PRK03846 | 198 | adenylylsulfate kinase; Provisional | 89.36 | |
| TIGR02974 | 329 | phageshock_pspF psp operon transcriptional activat | 89.29 | |
| PRK14527 | 191 | adenylate kinase; Provisional | 89.26 |
| >KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
Probab=100.00 E-value=1.9e-79 Score=777.15 Aligned_cols=627 Identities=28% Similarity=0.433 Sum_probs=493.6
Q ss_pred ccccchhchhhhHHHHHHHHHHHHHHHHHHHHHHHHHHHcCccchHHHHHHHHHHHHHHHHHhhhhhcccccC-------
Q 000447 5 KQFGYFCCYKSNFDHLTKEVEKLRERRESVQHRVDFAKENGEEIEQSVENWLISVDKIVEEAGKFVEDDEEAN------- 77 (1497)
Q Consensus 5 ~~~~~l~~~~~~~~~~~~~~~~L~~~l~~~~~~l~~a~~~~~~~~~~v~~wl~~v~~~~~d~ed~ld~~~~~~------- 77 (1497)
+...++......+.+.++.+..|++.+..++.++++|+++ +.....+..|...++++.|++++.++.+.-..
T Consensus 11 ~~~~~l~~~~~~~~~~~~~i~~Lk~~L~~l~~~l~d~~a~-~~~~~~~~~~~e~~~~~~~~~e~~~~~~~v~~~~~~~~~ 89 (889)
T KOG4658|consen 11 KLDQLLNRESECLDGKDNYILELKENLKALQSALEDLDAK-RDDLERRVNWEEDVGDLVYLAEDIIWLFLVEEIERKAND 89 (889)
T ss_pred hHHHHHHHHHHHHhchHHHHHHHHHHHHHHHHHHHHHHhh-cchHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhH
Confidence 3445777888899999999999999999999999999997 56678999999999999999999876432110
Q ss_pred ----------CCcccccC-CChhhhhHHHHHHHHHHHHHHHHhhcCCCcceeccccccccccccccccCCCcccccchHH
Q 000447 78 ----------NPCFKVLC-PNLKNRHHLSKKAAKEVKAIVELQDEGNFDRVSVRGISRDRLVAYTESYNEGHEFIESRES 146 (1497)
Q Consensus 78 ----------~~~~~~~~-~~~~~r~~~~~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~gR~~ 146 (1497)
.-|+.+.+ .+...-+++++++-++.+.++.+..++.+..++.... + .......+...... +|.+.
T Consensus 90 ~l~~~~~~~~~~c~~~~~~~~~~~~~~~~~rv~~~l~~ve~l~~~~~~~~~~~~~~--~-~~~~e~~~~~~~~~-VG~e~ 165 (889)
T KOG4658|consen 90 LLSTRSVERQRLCLCGFCSKNVSDSYKYGKRVSKVLREVESLGSKGVFEVVGESLD--P-REKVETRPIQSESD-VGLET 165 (889)
T ss_pred HhhhhHHHHHHHhhhhhHhHhhhhhHhHHHHHHHHHHHHHHhccccceeccccccc--c-hhhcccCCCCcccc-ccHHH
Confidence 01111211 2334445566777777777777766655544432111 1 11122222333333 89999
Q ss_pred HHHHHHHHHcCCCeEEEEEEcCCCchHHHHHHHHHHHHh-ccCCcceEEEEEecCCcCHHHHHHHHHHHhCCCCCCCCh-
Q 000447 147 ILNDILDALRGPYVYMIGVYGMAGIGKTTLVKEVARLAK-EGRIFDEVVFAEVSQTPDLKRIRREIADQLGLNFCEESD- 224 (1497)
Q Consensus 147 ~~~~l~~~L~~~~~~vi~I~G~gGiGKTtLa~~v~~~~~-~~~~F~~~~wv~vs~~~~~~~~~~~i~~~l~~~~~~~~~- 224 (1497)
.++++.+.|.+++..+++|+||||+||||||++++|+.. ++++||.++||.||+.++..+++++|+..++........
T Consensus 166 ~~~kl~~~L~~d~~~iv~i~GMGGvGKTTL~~qi~N~~~~v~~~Fd~~iWV~VSk~f~~~~iq~~Il~~l~~~~~~~~~~ 245 (889)
T KOG4658|consen 166 MLEKLWNRLMEDDVGIVGIYGMGGVGKTTLARQIFNKFDEVGNHFDGVIWVVVSKEFTTRKIQQTILERLGLLDEEWEDK 245 (889)
T ss_pred HHHHHHHHhccCCCCEEEEECCCcccHHHHHHHHhcccchhcccCceEEEEEEcccccHHhHHHHHHHHhccCCcccchh
Confidence 999999999987779999999999999999999999998 999999999999999999999999999999875444332
Q ss_pred --HHHHHHHHHHHhcCCeEEEEEcCCCChhhhhhccCCCCCCCCCeEEEEEeCchhhhhhcCcccceEEecCCCHHHHHH
Q 000447 225 --SERIMMLCNRLKREKKILVILDDIWTSLDLERTGIPFGDVHRGCKILVTSRRRDVLVSEMHCQNNYCVSVLNKEEAWS 302 (1497)
Q Consensus 225 --~~~~~~l~~~l~~~k~~LlVlDdv~~~~~~~~l~~~l~~~~~gs~ilvTTR~~~v~~~~~~~~~~~~l~~L~~~e~~~ 302 (1497)
...+..+.+.+. .|||+||+||||+..+|+.++.|+|...+||||++|||++.|+...|++...++++.|+++|||+
T Consensus 246 ~~~~~~~~i~~~L~-~krfllvLDDIW~~~dw~~I~~~~p~~~~g~KvvlTTRs~~V~~~~m~~~~~~~v~~L~~~eaW~ 324 (889)
T KOG4658|consen 246 EEDELASKLLNLLE-GKRFLLVLDDIWEEVDWDKIGVPFPSRENGSKVVLTTRSEEVCGRAMGVDYPIEVECLTPEEAWD 324 (889)
T ss_pred hHHHHHHHHHHHhc-cCceEEEEecccccccHHhcCCCCCCccCCeEEEEEeccHhhhhccccCCccccccccCccccHH
Confidence 345555666664 89999999999999999999999999989999999999999999768988999999999999999
Q ss_pred HHHHHhCCC--CCCchHHHHHHHHHHHhCCChHHHHHHHHHhcCCChHH-HHHHHHHHHhh-ccCccchH-HHHHhHHHH
Q 000447 303 LFSKVVGNC--VEDPDLQTVAIQVANECGGLPIAILTVARTLRNKPLFV-WKKALQELRFS-ARNFTGLE-ALLGSTIEL 377 (1497)
Q Consensus 303 Lf~~~~~~~--~~~~~~~~~~~~i~~~c~glPLai~~~~~~L~~~~~~~-w~~~l~~l~~~-~~~~~~~~-~~~~~~l~l 377 (1497)
||++.+|.. ...+.++++|++++++|+|+|||+.++|+.|+.+...+ |+++.+.+.+. ..+.++++ .++ +++++
T Consensus 325 LF~~~v~~~~~~~~~~i~~lak~v~~kC~GLPLAl~viG~~ma~K~t~~eW~~~~~~l~s~~~~~~~~~~~~i~-~iLkl 403 (889)
T KOG4658|consen 325 LFQKKVGPNTLGSHPDIEELAKEVAEKCGGLPLALNVLGGLLACKKTVQEWRRALNVLKSSLAADFSGMEESIL-PILKL 403 (889)
T ss_pred HHHHhhccccccccccHHHHHHHHHHHhCChHHHHHHHHHHhcCCCcHHHHHHHHccccccccCCCCchhhhhH-Hhhhc
Confidence 999999754 33455899999999999999999999999999998775 99999999855 33334434 488 99999
Q ss_pred HhccCCccchhhhhhhhcccCCCCCcchhhHhhhccccccccchhhHHHHHHHHHHHHHHHhhccccccCC---CcCcee
Q 000447 378 IYNYLEGEELKLTFLLCSLMKHPCDAPIMDLLKYGTGLGLFEDIYTMQERRDRVYALVRGLKDTCLLHDDD---TADWFS 454 (1497)
Q Consensus 378 sy~~L~~~~lk~cfl~~s~fp~~~~~~i~~li~~w~~~g~~~~~~~~e~~~~~~~~~l~~L~~~~ll~~~~---~~~~~~ 454 (1497)
||+.||++ +|.||+|||+||++|.++++.|+.+|+|+||+.+....+.+.+.+++|+++|++++|++..+ ....|+
T Consensus 404 Syd~L~~~-lK~CFLycalFPED~~I~~e~Li~yWiaEGfi~~~~~~~~~~d~G~~~i~~LV~~~Ll~~~~~~~~~~~~k 482 (889)
T KOG4658|consen 404 SYDNLPEE-LKSCFLYCALFPEDYEIKKEKLIEYWIAEGFIDPLDGGETAEDVGYDYIEELVRASLLIEERDEGRKETVK 482 (889)
T ss_pred cHhhhhHH-HHHHHHhhccCCcccccchHHHHHHHHhccCcCccccccchhcchHHHHHHHHHHHHHhhcccccceeEEE
Confidence 99999965 99999999999995555559999999999999775545566677788899999999998765 447899
Q ss_pred ehhhHHHHHHHHhh-----c-ceEEecC-ccccCCCccccccceEEEcccCCCCCCCCccCCCCccEEEcCCCCC-CCCC
Q 000447 455 MLGFVRNVAISIAS-----I-NLMVRND-ALIEWPNKDMLKNCIAIFLHDINTGELPEGLEYPHLTSLCMNPKDP-FLHI 526 (1497)
Q Consensus 455 mHdlv~d~a~~~~~-----~-~~~~~~~-~~~~~~~~~~~~~~~~lsl~~~~~~~lp~~~~~~~Lr~L~L~~~~~-~~~l 526 (1497)
|||+|||+|.++|. + +..+..+ +..+.|....+..+|+++++++.+..++....+++|++|.+.+|.. ...+
T Consensus 483 mHDvvRe~al~ias~~~~~~e~~iv~~~~~~~~~~~~~~~~~~rr~s~~~~~~~~~~~~~~~~~L~tLll~~n~~~l~~i 562 (889)
T KOG4658|consen 483 MHDVVREMALWIASDFGKQEENQIVSDGVGLSEIPQVKSWNSVRRMSLMNNKIEHIAGSSENPKLRTLLLQRNSDWLLEI 562 (889)
T ss_pred eeHHHHHHHHHHhccccccccceEEECCcCccccccccchhheeEEEEeccchhhccCCCCCCccceEEEeecchhhhhc
Confidence 99999999999999 3 4333332 4445666667788999999999999999999999999999999874 5778
Q ss_pred CchhhcCCCCccEEEecCc-cCccCCccCCCCCCCCEEeccCCCCCCCcccCCCCCCcEEEeecCCCcccchhhcCCCcc
Q 000447 527 PDNFFAGMPKLRVLVLTRM-KLLTLPSSFCHLPNLESLCLDQCILGDIAIIGNLKNLEILSLCCSDIEQLPREIGELTQL 605 (1497)
Q Consensus 527 p~~~f~~l~~Lr~L~L~~~-~i~~lp~~i~~L~~Lr~L~L~~~~l~~l~~i~~L~~L~~L~Ls~~~l~~LP~~i~~L~~L 605 (1497)
+..+|..++.||||||++| .+.++|++|+.|.|||| |+++++.++.||.++++|+.|
T Consensus 563 s~~ff~~m~~LrVLDLs~~~~l~~LP~~I~~Li~Lry----------------------L~L~~t~I~~LP~~l~~Lk~L 620 (889)
T KOG4658|consen 563 SGEFFRSLPLLRVLDLSGNSSLSKLPSSIGELVHLRY----------------------LDLSDTGISHLPSGLGNLKKL 620 (889)
T ss_pred CHHHHhhCcceEEEECCCCCccCcCChHHhhhhhhhc----------------------ccccCCCccccchHHHHHHhh
Confidence 8888999999999999976 45578877666555555 455556677788888888888
Q ss_pred CEEeccCCCCCCCcChhhhcCCCCCCEEEecCCcccccccccccccCccChhhcCCCCCCcEEEee
Q 000447 606 KLLDLSNCSKLKVIPPNVISSLSQLEELYLGNTSVEWEFEGLNLERNNASLQELSILSHLTTLEIH 671 (1497)
Q Consensus 606 ~~L~Ls~~~~l~~lp~~~l~~L~~L~~L~l~~~~~~~~~~~~~~~~~~~~~~~L~~L~~L~~L~l~ 671 (1497)
++||+..+..+..+| +++..|.+||+|.+...... .....+.++.++.+|+.+.+.
T Consensus 621 ~~Lnl~~~~~l~~~~-~i~~~L~~Lr~L~l~~s~~~---------~~~~~l~el~~Le~L~~ls~~ 676 (889)
T KOG4658|consen 621 IYLNLEVTGRLESIP-GILLELQSLRVLRLPRSALS---------NDKLLLKELENLEHLENLSIT 676 (889)
T ss_pred heecccccccccccc-chhhhcccccEEEeeccccc---------cchhhHHhhhcccchhhheee
Confidence 888888776555554 33566888888877654311 123345666667777766664
|
|
| >PLN03210 Resistant to P | Back alignment and domain information |
|---|
| >PF00931 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is the NB-ARC domain, a novel signalling motif found in bacteria and eukaryotes, shared by plant resistance gene products and regulators of cell death in animals [] | Back alignment and domain information |
|---|
| >PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
| >PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
| >KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PLN03210 Resistant to P | Back alignment and domain information |
|---|
| >KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0472 consensus Leucine-rich repeat protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG0472 consensus Leucine-rich repeat protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK04841 transcriptional regulator MalT; Provisional | Back alignment and domain information |
|---|
| >PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional | Back alignment and domain information |
|---|
| >PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional | Back alignment and domain information |
|---|
| >KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >COG2909 MalT ATP-dependent transcriptional regulator [Transcription] | Back alignment and domain information |
|---|
| >KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG4341 consensus F-box protein containing LRR [General function prediction only] | Back alignment and domain information |
|---|
| >PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional | Back alignment and domain information |
|---|
| >PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional | Back alignment and domain information |
|---|
| >PRK00411 cdc6 cell division control protein 6; Reviewed | Back alignment and domain information |
|---|
| >TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily | Back alignment and domain information |
|---|
| >KOG4341 consensus F-box protein containing LRR [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF01637 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 This domain has been found in a number of bacterial and archaeal proteins, all of which contain a conserved P-loop motif that is involved in binding ATP | Back alignment and domain information |
|---|
| >PF05729 NACHT: NACHT domain | Back alignment and domain information |
|---|
| >KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A | Back alignment and domain information |
|---|
| >KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] | Back alignment and domain information |
|---|
| >PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A | Back alignment and domain information |
|---|
| >TIGR02928 orc1/cdc6 family replication initiation protein | Back alignment and domain information |
|---|
| >cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily | Back alignment and domain information |
|---|
| >PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed | Back alignment and domain information |
|---|
| >cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily | Back alignment and domain information |
|---|
| >KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] | Back alignment and domain information |
|---|
| >COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PTZ00112 origin recognition complex 1 protein; Provisional | Back alignment and domain information |
|---|
| >KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] | Back alignment and domain information |
|---|
| >PRK13342 recombination factor protein RarA; Reviewed | Back alignment and domain information |
|---|
| >TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit | Back alignment and domain information |
|---|
| >PTZ00202 tuzin; Provisional | Back alignment and domain information |
|---|
| >PRK06893 DNA replication initiation factor; Validated | Back alignment and domain information |
|---|
| >COG4886 Leucine-rich repeat (LRR) protein [Function unknown] | Back alignment and domain information |
|---|
| >COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK07003 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PF13173 AAA_14: AAA domain | Back alignment and domain information |
|---|
| >PRK12402 replication factor C small subunit 2; Reviewed | Back alignment and domain information |
|---|
| >PRK14961 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >TIGR02903 spore_lon_C ATP-dependent protease, Lon family | Back alignment and domain information |
|---|
| >PRK14949 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B | Back alignment and domain information |
|---|
| >PRK12323 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >COG4886 Leucine-rich repeat (LRR) protein [Function unknown] | Back alignment and domain information |
|---|
| >PRK14960 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK05564 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda | Back alignment and domain information |
|---|
| >KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PLN03025 replication factor C subunit; Provisional | Back alignment and domain information |
|---|
| >PRK06645 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK14963 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >KOG2028 consensus ATPase related to the helicase subunit of the Holliday junction resolvase [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PRK14956 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold | Back alignment and domain information |
|---|
| >PRK00440 rfc replication factor C small subunit; Reviewed | Back alignment and domain information |
|---|
| >PRK14962 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK04195 replication factor C large subunit; Provisional | Back alignment and domain information |
|---|
| >KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK14957 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PLN03150 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK14964 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed | Back alignment and domain information |
|---|
| >TIGR00678 holB DNA polymerase III, delta' subunit | Back alignment and domain information |
|---|
| >cd01128 rho_factor Transcription termination factor rho is a bacterial ATP-dependent RNA/DNA helicase | Back alignment and domain information |
|---|
| >PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair | Back alignment and domain information |
|---|
| >PRK14951 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK09376 rho transcription termination factor Rho; Provisional | Back alignment and domain information |
|---|
| >PRK08691 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK14955 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK15386 type III secretion protein GogB; Provisional | Back alignment and domain information |
|---|
| >PRK05896 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PLN03150 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >COG3903 Predicted ATPase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK09112 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A | Back alignment and domain information |
|---|
| >TIGR02397 dnaX_nterm DNA polymerase III, subunit gamma and tau | Back alignment and domain information |
|---|
| >PRK07471 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PRK07940 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A | Back alignment and domain information |
|---|
| >PRK08727 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK07994 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK14958 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PF13191 AAA_16: AAA ATPase domain; PDB: 2V1U_A | Back alignment and domain information |
|---|
| >TIGR01242 26Sp45 26S proteasome subunit P45 family | Back alignment and domain information |
|---|
| >COG3899 Predicted ATPase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK15386 type III secretion protein GogB; Provisional | Back alignment and domain information |
|---|
| >PRK14969 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK14959 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK07764 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >KOG2227 consensus Pre-initiation complex, subunit CDC6, AAA+ superfamily ATPase [Replication, recombination and repair; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PRK14971 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK08084 DNA replication initiation factor; Provisional | Back alignment and domain information |
|---|
| >PRK09111 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK14954 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK09087 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK08451 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >KOG0989 consensus Replication factor C, subunit RFC4 [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PRK07133 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >TIGR00767 rho transcription termination factor Rho | Back alignment and domain information |
|---|
| >PRK14970 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PF14516 AAA_35: AAA-like domain | Back alignment and domain information |
|---|
| >PRK06305 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK14952 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PF05621 TniB: Bacterial TniB protein; InterPro: IPR008868 This family consists of several bacterial TniB NTP-binding proteins | Back alignment and domain information |
|---|
| >TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA | Back alignment and domain information |
|---|
| >KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] | Back alignment and domain information |
|---|
| >PRK14950 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK03992 proteasome-activating nucleotidase; Provisional | Back alignment and domain information |
|---|
| >PRK14953 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PHA02544 44 clamp loader, small subunit; Provisional | Back alignment and domain information |
|---|
| >KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] | Back alignment and domain information |
|---|
| >PRK14948 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication | Back alignment and domain information |
|---|
| >PRK11331 5-methylcytosine-specific restriction enzyme subunit McrB; Provisional | Back alignment and domain information |
|---|
| >TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family | Back alignment and domain information |
|---|
| >PRK08903 DnaA regulatory inactivator Hda; Validated | Back alignment and domain information |
|---|
| >PRK14087 dnaA chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >PRK06647 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >TIGR02881 spore_V_K stage V sporulation protein K | Back alignment and domain information |
|---|
| >PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B | Back alignment and domain information |
|---|
| >TIGR03689 pup_AAA proteasome ATPase | Back alignment and domain information |
|---|
| >PRK05563 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >CHL00095 clpC Clp protease ATP binding subunit | Back alignment and domain information |
|---|
| >PRK05642 DNA replication initiation factor; Validated | Back alignment and domain information |
|---|
| >PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B | Back alignment and domain information |
|---|
| >CHL00181 cbbX CbbX; Provisional | Back alignment and domain information |
|---|
| >PRK07399 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX | Back alignment and domain information |
|---|
| >KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] | Back alignment and domain information |
|---|
| >COG2255 RuvB Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR00362 DnaA chromosomal replication initiator protein DnaA | Back alignment and domain information |
|---|
| >PRK14965 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] | Back alignment and domain information |
|---|
| >PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional | Back alignment and domain information |
|---|
| >TIGR00602 rad24 checkpoint protein rad24 | Back alignment and domain information |
|---|
| >COG1373 Predicted ATPase (AAA+ superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >PRK05707 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >KOG2543 consensus Origin recognition complex, subunit 5 [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB | Back alignment and domain information |
|---|
| >PRK10865 protein disaggregation chaperone; Provisional | Back alignment and domain information |
|---|
| >PRK00149 dnaA chromosomal replication initiation protein; Reviewed | Back alignment and domain information |
|---|
| >PRK14088 dnaA chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] | Back alignment and domain information |
|---|
| >PTZ00361 26 proteosome regulatory subunit 4-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG2982 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PRK10536 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK14086 dnaA chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >KOG2982 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >CHL00176 ftsH cell division protein; Validated | Back alignment and domain information |
|---|
| >smart00382 AAA ATPases associated with a variety of cellular activities | Back alignment and domain information |
|---|
| >PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport | Back alignment and domain information |
|---|
| >PRK06620 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >TIGR00763 lon ATP-dependent protease La | Back alignment and domain information |
|---|
| >TIGR01241 FtsH_fam ATP-dependent metalloprotease FtsH | Back alignment and domain information |
|---|
| >PRK08769 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >COG1222 RPT1 ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK10787 DNA-binding ATP-dependent protease La; Provisional | Back alignment and domain information |
|---|
| >PRK08058 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >KOG2035 consensus Replication factor C, subunit RFC3 [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG0741 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0743 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] | Back alignment and domain information |
|---|
| >PRK06090 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PF13177 DNA_pol3_delta2: DNA polymerase III, delta subunit; PDB: 1NJF_B 3GLG_G 1XXH_I 1NJG_A 3GLF_B 3GLI_G 1IQP_E 2GNO_A 1SXJ_E 1A5T_A | Back alignment and domain information |
|---|
| >PRK12422 chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >PRK06871 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >KOG0731 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0733 consensus Nuclear AAA ATPase (VCP subfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG3267 ExeA Type II secretory pathway, component ExeA (predicted ATPase) [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >CHL00195 ycf46 Ycf46; Provisional | Back alignment and domain information |
|---|
| >KOG0730 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF05673 DUF815: Protein of unknown function (DUF815); InterPro: IPR008533 This domain consists of several bacterial proteins of unknown function | Back alignment and domain information |
|---|
| >COG0466 Lon ATP-dependent Lon protease, bacterial type [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK08118 topology modulation protein; Reviewed | Back alignment and domain information |
|---|
| >PRK12608 transcription termination factor Rho; Provisional | Back alignment and domain information |
|---|
| >KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] | Back alignment and domain information |
|---|
| >PRK10865 protein disaggregation chaperone; Provisional | Back alignment and domain information |
|---|
| >PF10443 RNA12: RNA12 protein; InterPro: IPR018850 Mitochondrial escape protein 2 (also known as RNA12) plays a role in maintaining the mitochondrial genome and in controlling mtDNA escape [, ] | Back alignment and domain information |
|---|
| >COG0593 DnaA ATPase involved in DNA replication initiation [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family | Back alignment and domain information |
|---|
| >COG1223 Predicted ATPase (AAA+ superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >COG2812 DnaX DNA polymerase III, gamma/tau subunits [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA | Back alignment and domain information |
|---|
| >PRK08116 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] | Back alignment and domain information |
|---|
| >PRK12727 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] | Back alignment and domain information |
|---|
| >TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily | Back alignment and domain information |
|---|
| >PF02562 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH is a cytoplasmic protein and predicted ATPase that is induced by phosphate starvation and belongings to the phosphate regulon (pho) in Escherichia coli [] | Back alignment and domain information |
|---|
| >PRK08939 primosomal protein DnaI; Reviewed | Back alignment and domain information |
|---|
| >TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN | Back alignment and domain information |
|---|
| >KOG0991 consensus Replication factor C, subunit RFC2 [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PRK06964 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PRK07993 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PRK07261 topology modulation protein; Provisional | Back alignment and domain information |
|---|
| >COG0542 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] | Back alignment and domain information |
|---|
| >PHA00729 NTP-binding motif containing protein | Back alignment and domain information |
|---|
| >KOG1514 consensus Origin recognition complex, subunit 1, and related proteins [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PRK08181 transposase; Validated | Back alignment and domain information |
|---|
| >TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily | Back alignment and domain information |
|---|
| >PF04665 Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 This entry contains uncharacterised proteins belonging to the B354L family which include the pox virus A32 protein | Back alignment and domain information |
|---|
| >smart00763 AAA_PrkA PrkA AAA domain | Back alignment and domain information |
|---|
| >PRK06526 transposase; Provisional | Back alignment and domain information |
|---|
| >KOG2004 consensus Mitochondrial ATP-dependent protease PIM1/LON [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR02237 recomb_radB DNA repair and recombination protein RadB | Back alignment and domain information |
|---|
| >PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif | Back alignment and domain information |
|---|
| >TIGR02902 spore_lonB ATP-dependent protease LonB | Back alignment and domain information |
|---|
| >COG1875 NYN ribonuclease and ATPase of PhoH family domains [General function prediction only] | Back alignment and domain information |
|---|
| >PRK12377 putative replication protein; Provisional | Back alignment and domain information |
|---|
| >cd01123 Rad51_DMC1_radA Rad51_DMC1_radA,B | Back alignment and domain information |
|---|
| >TIGR01425 SRP54_euk signal recognition particle protein SRP54 | Back alignment and domain information |
|---|
| >PRK04132 replication factor C small subunit; Provisional | Back alignment and domain information |
|---|
| >KOG0734 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG0470 HolB ATPase involved in DNA replication [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >TIGR03499 FlhF flagellar biosynthetic protein FlhF | Back alignment and domain information |
|---|
| >PRK06921 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG2123 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PRK00771 signal recognition particle protein Srp54; Provisional | Back alignment and domain information |
|---|
| >COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB | Back alignment and domain information |
|---|
| >PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A | Back alignment and domain information |
|---|
| >PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >CHL00095 clpC Clp protease ATP binding subunit | Back alignment and domain information |
|---|
| >KOG0736 consensus Peroxisome assembly factor 2 containing the AAA+-type ATPase domain [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0739 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] | Back alignment and domain information |
|---|
| >PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >TIGR02012 tigrfam_recA protein RecA | Back alignment and domain information |
|---|
| >PRK08699 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PF03215 Rad17: Rad17 cell cycle checkpoint protein | Back alignment and domain information |
|---|
| >PF08423 Rad51: Rad51; InterPro: IPR013632 This domain is found at the C terminus of the DNA repair and recombination protein Rad51 | Back alignment and domain information |
|---|
| >PRK09183 transposase/IS protein; Provisional | Back alignment and domain information |
|---|
| >COG2884 FtsE Predicted ATPase involved in cell division [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG1969 consensus DNA replication checkpoint protein CHL12/CTF18 [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PRK10867 signal recognition particle protein; Provisional | Back alignment and domain information |
|---|
| >PRK07952 DNA replication protein DnaC; Validated | Back alignment and domain information |
|---|
| >KOG0733 consensus Nuclear AAA ATPase (VCP subfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK06696 uridine kinase; Validated | Back alignment and domain information |
|---|
| >PRK06835 DNA replication protein DnaC; Validated | Back alignment and domain information |
|---|
| >COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] | Back alignment and domain information |
|---|
| >KOG0727 consensus 26S proteasome regulatory complex, ATPase RPT3 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd01393 recA_like RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response | Back alignment and domain information |
|---|
| >cd00983 recA RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response | Back alignment and domain information |
|---|
| >PF07693 KAP_NTPase: KAP family P-loop domain; InterPro: IPR011646 The KAP (after Kidins220/ARMS and PifA) family of predicted NTPases are sporadically distributed across a wide phylogenetic range in bacteria and in animals | Back alignment and domain information |
|---|
| >PRK09270 nucleoside triphosphate hydrolase domain-containing protein; Reviewed | Back alignment and domain information |
|---|
| >TIGR02238 recomb_DMC1 meiotic recombinase Dmc1 | Back alignment and domain information |
|---|
| >PRK09354 recA recombinase A; Provisional | Back alignment and domain information |
|---|
| >COG0464 SpoVK ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd01133 F1-ATPase_beta F1 ATP synthase beta subunit, nucleotide-binding domain | Back alignment and domain information |
|---|
| >PRK12723 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >PRK09361 radB DNA repair and recombination protein RadB; Provisional | Back alignment and domain information |
|---|
| >cd01120 RecA-like_NTPases RecA-like NTPases | Back alignment and domain information |
|---|
| >PLN03187 meiotic recombination protein DMC1 homolog; Provisional | Back alignment and domain information |
|---|
| >PTZ00494 tuzin-like protein; Provisional | Back alignment and domain information |
|---|
| >PRK10733 hflB ATP-dependent metalloprotease; Reviewed | Back alignment and domain information |
|---|
| >KOG0744 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK07132 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PRK15455 PrkA family serine protein kinase; Provisional | Back alignment and domain information |
|---|
| >PRK04296 thymidine kinase; Provisional | Back alignment and domain information |
|---|
| >KOG0735 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG0542 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR02858 spore_III_AA stage III sporulation protein AA | Back alignment and domain information |
|---|
| >PRK12724 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >PRK14974 cell division protein FtsY; Provisional | Back alignment and domain information |
|---|
| >COG1618 Predicted nucleotide kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >COG0541 Ffh Signal recognition particle GTPase [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >PRK05541 adenylylsulfate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK12726 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >COG1419 FlhF Flagellar GTP-binding protein [Cell motility and secretion] | Back alignment and domain information |
|---|
| >TIGR00959 ffh signal recognition particle protein | Back alignment and domain information |
|---|
| >COG2607 Predicted ATPase (AAA+ superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >PRK08533 flagellar accessory protein FlaH; Reviewed | Back alignment and domain information |
|---|
| >TIGR02236 recomb_radA DNA repair and recombination protein RadA | Back alignment and domain information |
|---|
| >PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated | Back alignment and domain information |
|---|
| >PLN03186 DNA repair protein RAD51 homolog; Provisional | Back alignment and domain information |
|---|
| >TIGR02239 recomb_RAD51 DNA repair protein RAD51 | Back alignment and domain information |
|---|
| >cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes | Back alignment and domain information |
|---|
| >KOG0729 consensus 26S proteasome regulatory complex, ATPase RPT1 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK04301 radA DNA repair and recombination protein RadA; Validated | Back alignment and domain information |
|---|
| >TIGR03877 thermo_KaiC_1 KaiC domain protein, Ph0284 family | Back alignment and domain information |
|---|
| >TIGR00064 ftsY signal recognition particle-docking protein FtsY | Back alignment and domain information |
|---|
| >COG0468 RecA RecA/RadA recombinase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >cd01121 Sms Sms (bacterial radA) DNA repair protein | Back alignment and domain information |
|---|
| >TIGR00554 panK_bact pantothenate kinase, bacterial type | Back alignment and domain information |
|---|
| >PRK06547 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PTZ00035 Rad51 protein; Provisional | Back alignment and domain information |
|---|
| >KOG2228 consensus Origin recognition complex, subunit 4 [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >TIGR01359 UMP_CMP_kin_fam UMP-CMP kinase family | Back alignment and domain information |
|---|
| >KOG2123 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PRK14723 flhF flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >cd02025 PanK Pantothenate kinase (PanK) catalyzes the phosphorylation of pantothenic acid to form 4'-phosphopantothenic, which is the first of five steps in coenzyme A (CoA) biosynthetic pathway | Back alignment and domain information |
|---|
| >PLN00020 ribulose bisphosphate carboxylase/oxygenase activase -RuBisCO activase (RCA); Provisional | Back alignment and domain information |
|---|
| >PF00006 ATP-synt_ab: ATP synthase alpha/beta family, nucleotide-binding domain This Pfam entry corresponds to chains a,b,c,d,e and f; InterPro: IPR000194 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane | Back alignment and domain information |
|---|
| >PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A | Back alignment and domain information |
|---|
| >PF06309 Torsin: Torsin; InterPro: IPR010448 This family consists of several eukaryotic torsin proteins | Back alignment and domain information |
|---|
| >PF13238 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB_A 3IIM_A 2AXP_A 3KB2_A 1KHT_A 1NKS_A 3H86_C | Back alignment and domain information |
|---|
| >cd01394 radB RadB | Back alignment and domain information |
|---|
| >PRK07667 uridine kinase; Provisional | Back alignment and domain information |
|---|
| >PRK14721 flhF flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >PRK04328 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK06995 flhF flagellar biosynthesis regulator FlhF; Validated | Back alignment and domain information |
|---|
| >PF07728 AAA_5: AAA domain (dynein-related subfamily); InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] | Back alignment and domain information |
|---|
| >PRK05917 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >KOG0728 consensus 26S proteasome regulatory complex, ATPase RPT6 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG0563 Adk Adenylate kinase and related kinases [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PF03308 ArgK: ArgK protein; InterPro: IPR005129 Bacterial periplasmic transport systems require the function of a specific substrate-binding protein, located in the periplasm, and several cytoplasmic membrane transport components | Back alignment and domain information |
|---|
| >PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A | Back alignment and domain information |
|---|
| >PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] | Back alignment and domain information |
|---|
| >cd03281 ABC_MSH5_euk MutS5 homolog in eukaryotes | Back alignment and domain information |
|---|
| >PRK13531 regulatory ATPase RavA; Provisional | Back alignment and domain information |
|---|
| >KOG0738 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF13481 AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C | Back alignment and domain information |
|---|
| >cd02019 NK Nucleoside/nucleotide kinase (NK) is a protein superfamily consisting of multiple families of enzymes that share structural similarity and are functionally related to the catalysis of the reversible phosphate group transfer from nucleoside triphosphates to nucleosides/nucleotides, nucleoside monophosphates, or sugars | Back alignment and domain information |
|---|
| >COG4088 Predicted nucleotide kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >cd01131 PilT Pilus retraction ATPase PilT | Back alignment and domain information |
|---|
| >PRK05439 pantothenate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK10463 hydrogenase nickel incorporation protein HypB; Provisional | Back alignment and domain information |
|---|
| >PRK06851 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF00485 PRK: Phosphoribulokinase / Uridine kinase family; InterPro: IPR006083 Phosphoribulokinase (PRK) 2 | Back alignment and domain information |
|---|
| >cd03214 ABC_Iron-Siderophores_B12_Hemin ABC transporters, involved in the uptake of siderophores, heme, and vitamin B12, are widely conserved in bacteria and archaea | Back alignment and domain information |
|---|
| >COG1428 Deoxynucleoside kinases [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PF13671 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B | Back alignment and domain information |
|---|
| >cd03247 ABCC_cytochrome_bd The CYD subfamily implicated in cytochrome bd biogenesis | Back alignment and domain information |
|---|
| >PF01583 APS_kinase: Adenylylsulphate kinase; InterPro: IPR002891 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases | Back alignment and domain information |
|---|
| >COG0465 HflB ATP-dependent Zn proteases [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG1066 Sms Predicted ATP-dependent serine protease [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF00154 RecA: recA bacterial DNA recombination protein; InterPro: IPR013765 The recA gene product is a multifunctional enzyme that plays a role in homologous recombination, DNA repair and induction of the SOS response [] | Back alignment and domain information |
|---|
| >COG3640 CooC CO dehydrogenase maturation factor [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PF10236 DAP3: Mitochondrial ribosomal death-associated protein 3; InterPro: IPR019368 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms | Back alignment and domain information |
|---|
| >cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs | Back alignment and domain information |
|---|
| >PRK08233 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >cd01135 V_A-ATPase_B V/A-type ATP synthase (non-catalytic) subunit B | Back alignment and domain information |
|---|
| >PRK06762 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK06067 flagellar accessory protein FlaH; Validated | Back alignment and domain information |
|---|
| >TIGR01360 aden_kin_iso1 adenylate kinase, isozyme 1 subfamily | Back alignment and domain information |
|---|
| >PF14532 Sigma54_activ_2: Sigma-54 interaction domain; PDB: 3CO5_B 3N70_H | Back alignment and domain information |
|---|
| >CHL00206 ycf2 Ycf2; Provisional | Back alignment and domain information |
|---|
| >COG1121 ZnuC ABC-type Mn/Zn transport systems, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK13765 ATP-dependent protease Lon; Provisional | Back alignment and domain information |
|---|
| >PF03205 MobB: Molybdopterin guanine dinucleotide synthesis protein B; PDB: 2F1R_B 1P9N_A 1NP6_B 2NPI_A 1XJC_A | Back alignment and domain information |
|---|
| >PRK05480 uridine/cytidine kinase; Provisional | Back alignment and domain information |
|---|
| >PF08298 AAA_PrkA: PrkA AAA domain; InterPro: IPR013153 This is entry is found at the N terminus of PrkA proteins - bacterial and archaeal serine kinases approximately 630 residues in length | Back alignment and domain information |
|---|
| >PRK09519 recA DNA recombination protein RecA; Reviewed | Back alignment and domain information |
|---|
| >PF08433 KTI12: Chromatin associated protein KTI12 ; InterPro: IPR013641 This is a family of chromatin associated proteins which interact with the Elongator complex, a component of the elongating form of RNA polymerase II [] | Back alignment and domain information |
|---|
| >PRK03839 putative kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR01069 mutS2 MutS2 family protein | Back alignment and domain information |
|---|
| >COG0194 Gmk Guanylate kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PTZ00301 uridine kinase; Provisional | Back alignment and domain information |
|---|
| >cd00561 CobA_CobO_BtuR ATP:corrinoid adenosyltransferase BtuR/CobO/CobP | Back alignment and domain information |
|---|
| >TIGR00235 udk uridine kinase | Back alignment and domain information |
|---|
| >cd03216 ABC_Carb_Monos_I This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos) | Back alignment and domain information |
|---|
| >cd03228 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-like transporters are involved in drug, peptide, and lipid export | Back alignment and domain information |
|---|
| >PF00910 RNA_helicase: RNA helicase; InterPro: IPR000605 Helicases have been classified in 5 superfamilies (SF1-SF5) | Back alignment and domain information |
|---|
| >PRK10416 signal recognition particle-docking protein FtsY; Provisional | Back alignment and domain information |
|---|
| >cd02027 APSK Adenosine 5'-phosphosulfate kinase (APSK) catalyzes the phosphorylation of adenosine 5'-phosphosulfate to form 3'-phosphoadenosine 5'-phosphosulfate (PAPS) | Back alignment and domain information |
|---|
| >PTZ00088 adenylate kinase 1; Provisional | Back alignment and domain information |
|---|
| >PRK05342 clpX ATP-dependent protease ATP-binding subunit ClpX; Provisional | Back alignment and domain information |
|---|
| >PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] | Back alignment and domain information |
|---|
| >COG1703 ArgK Putative periplasmic protein kinase ArgK and related GTPases of G3E family [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK12597 F0F1 ATP synthase subunit beta; Provisional | Back alignment and domain information |
|---|
| >PRK00625 shikimate kinase; Provisional | Back alignment and domain information |
|---|
| >KOG3864 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >TIGR00390 hslU ATP-dependent protease HslVU, ATPase subunit | Back alignment and domain information |
|---|
| >TIGR03878 thermo_KaiC_2 KaiC domain protein, AF_0795 family | Back alignment and domain information |
|---|
| >COG0572 Udk Uridine kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >cd03221 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth | Back alignment and domain information |
|---|
| >KOG0735 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0652 consensus 26S proteasome regulatory complex, ATPase RPT5 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd03238 ABC_UvrA The excision repair protein UvrA; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion | Back alignment and domain information |
|---|
| >cd03223 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette transporter (Pat) is involved in the import of very long-chain fatty acids (VLCFA) into the peroxisome | Back alignment and domain information |
|---|
| >KOG3347 consensus Predicted nucleotide kinase/nuclear protein involved oxidative stress response [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PRK04040 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR00416 sms DNA repair protein RadA | Back alignment and domain information |
|---|
| >PRK11823 DNA repair protein RadA; Provisional | Back alignment and domain information |
|---|
| >PF12775 AAA_7: P-loop containing dynein motor region D3; PDB: 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A 3VKH_A 3VKG_A | Back alignment and domain information |
|---|
| >TIGR03305 alt_F1F0_F1_bet alternate F1F0 ATPase, F1 subunit beta | Back alignment and domain information |
|---|
| >COG0488 Uup ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] | Back alignment and domain information |
|---|
| >PRK06217 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >TIGR03575 selen_PSTK_euk L-seryl-tRNA(Sec) kinase, eukaryotic | Back alignment and domain information |
|---|
| >PRK09280 F0F1 ATP synthase subunit beta; Validated | Back alignment and domain information |
|---|
| >TIGR00708 cobA cob(I)alamin adenosyltransferase | Back alignment and domain information |
|---|
| >KOG1051 consensus Chaperone HSP104 and related ATP-dependent Clp proteases [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK00409 recombination and DNA strand exchange inhibitor protein; Reviewed | Back alignment and domain information |
|---|
| >PRK08972 fliI flagellum-specific ATP synthase; Validated | Back alignment and domain information |
|---|
| >TIGR02655 circ_KaiC circadian clock protein KaiC | Back alignment and domain information |
|---|
| >cd01125 repA Hexameric Replicative Helicase RepA | Back alignment and domain information |
|---|
| >TIGR01817 nifA Nif-specific regulatory protein | Back alignment and domain information |
|---|
| >TIGR00750 lao LAO/AO transport system ATPase | Back alignment and domain information |
|---|
| >KOG0737 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK06002 fliI flagellum-specific ATP synthase; Validated | Back alignment and domain information |
|---|
| >cd00544 CobU Adenosylcobinamide kinase / adenosylcobinamide phosphate guanyltransferase (CobU) | Back alignment and domain information |
|---|
| >PF06745 KaiC: KaiC; InterPro: IPR014774 This entry represents a domain within bacterial and archaeal proteins, most of which are hypothetical | Back alignment and domain information |
|---|
| >COG0003 ArsA Predicted ATPase involved in chromosome partitioning [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG2170 consensus ATPase of the AAA+ superfamily [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0927 consensus Predicted transporter (ABC superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >PRK09435 membrane ATPase/protein kinase; Provisional | Back alignment and domain information |
|---|
| >PRK00131 aroK shikimate kinase; Reviewed | Back alignment and domain information |
|---|
| >KOG1532 consensus GTPase XAB1, interacts with DNA repair protein XPA [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PF13245 AAA_19: Part of AAA domain | Back alignment and domain information |
|---|
| >cd03283 ABC_MutS-like MutS-like homolog in eukaryotes | Back alignment and domain information |
|---|
| >TIGR00382 clpX endopeptidase Clp ATP-binding regulatory subunit (clpX) | Back alignment and domain information |
|---|
| >PF07726 AAA_3: ATPase family associated with various cellular activities (AAA); InterPro: IPR011703 This entry includes some of the AAA proteins not detected by the IPR003959 from INTERPRO model | Back alignment and domain information |
|---|
| >PRK13768 GTPase; Provisional | Back alignment and domain information |
|---|
| >cd01122 GP4d_helicase GP4d_helicase is a homohexameric 5'-3' helicases | Back alignment and domain information |
|---|
| >COG3854 SpoIIIAA ncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >TIGR03881 KaiC_arch_4 KaiC domain protein, PAE1156 family | Back alignment and domain information |
|---|
| >COG1224 TIP49 DNA helicase TIP49, TBP-interacting protein [Transcription] | Back alignment and domain information |
|---|
| >PRK10751 molybdopterin-guanine dinucleotide biosynthesis protein B; Provisional | Back alignment and domain information |
|---|
| >TIGR00150 HI0065_YjeE ATPase, YjeE family | Back alignment and domain information |
|---|
| >PRK00889 adenylylsulfate kinase; Provisional | Back alignment and domain information |
|---|
| >cd02020 CMPK Cytidine monophosphate kinase (CMPK) catalyzes the reversible phosphorylation of cytidine monophosphate (CMP) to produce cytidine diphosphate (CDP), using ATP as the preferred phosphoryl donor | Back alignment and domain information |
|---|
| >cd01134 V_A-ATPase_A V/A-type ATP synthase catalytic subunit A | Back alignment and domain information |
|---|
| >PRK11608 pspF phage shock protein operon transcriptional activator; Provisional | Back alignment and domain information |
|---|
| >PRK08927 fliI flagellum-specific ATP synthase; Validated | Back alignment and domain information |
|---|
| >COG4608 AppF ABC-type oligopeptide transport system, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK12678 transcription termination factor Rho; Provisional | Back alignment and domain information |
|---|
| >COG0529 CysC Adenylylsulfate kinase and related kinases [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK15429 formate hydrogenlyase transcriptional activator FhlA; Provisional | Back alignment and domain information |
|---|
| >TIGR02322 phosphon_PhnN phosphonate metabolism protein/1,5-bisphosphokinase (PRPP-forming) PhnN | Back alignment and domain information |
|---|
| >cd02021 GntK Gluconate kinase (GntK) catalyzes the phosphoryl transfer from ATP to gluconate | Back alignment and domain information |
|---|
| >COG1102 Cmk Cytidylate kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PRK13947 shikimate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK00279 adk adenylate kinase; Reviewed | Back alignment and domain information |
|---|
| >cd00227 CPT Chloramphenicol (Cm) phosphotransferase (CPT) | Back alignment and domain information |
|---|
| >cd02023 UMPK Uridine monophosphate kinase (UMPK, EC 2 | Back alignment and domain information |
|---|
| >cd01132 F1_ATPase_alpha F1 ATP synthase alpha, central domain | Back alignment and domain information |
|---|
| >TIGR00764 lon_rel lon-related putative ATP-dependent protease | Back alignment and domain information |
|---|
| >cd02024 NRK1 Nicotinamide riboside kinase (NRK) is an enzyme involved in the metabolism of nicotinamide adenine dinucleotide (NAD+) | Back alignment and domain information |
|---|
| >PTZ00185 ATPase alpha subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR02030 BchI-ChlI magnesium chelatase ATPase subunit I | Back alignment and domain information |
|---|
| >PRK13949 shikimate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK13407 bchI magnesium chelatase subunit I; Provisional | Back alignment and domain information |
|---|
| >TIGR01039 atpD ATP synthase, F1 beta subunit | Back alignment and domain information |
|---|
| >PF06068 TIP49: TIP49 C-terminus; InterPro: IPR010339 This family consists of the C-terminal region of several eukaryotic and archaeal RuvB-like 1 (Pontin or TIP49a) and RuvB-like 2 (Reptin or TIP49b) proteins | Back alignment and domain information |
|---|
| >COG1936 Predicted nucleotide kinase (related to CMP and AMP kinases) [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR00073 hypB hydrogenase accessory protein HypB | Back alignment and domain information |
|---|
| >PRK05201 hslU ATP-dependent protease ATP-binding subunit HslU; Provisional | Back alignment and domain information |
|---|
| >cd00267 ABC_ATPase ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules | Back alignment and domain information |
|---|
| >TIGR00176 mobB molybdopterin-guanine dinucleotide biosynthesis protein MobB | Back alignment and domain information |
|---|
| >COG0467 RAD55 RecA-superfamily ATPases implicated in signal transduction [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK14530 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK08149 ATP synthase SpaL; Validated | Back alignment and domain information |
|---|
| >cd00464 SK Shikimate kinase (SK) is the fifth enzyme in the shikimate pathway, a seven-step biosynthetic pathway which converts erythrose-4-phosphate to chorismic acid, found in bacteria, fungi and plants | Back alignment and domain information |
|---|
| >TIGR01040 V-ATPase_V1_B V-type (H+)-ATPase V1, B subunit | Back alignment and domain information |
|---|
| >KOG0726 consensus 26S proteasome regulatory complex, ATPase RPT2 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK14529 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK13975 thymidylate kinase; Provisional | Back alignment and domain information |
|---|
| >cd02028 UMPK_like Uridine monophosphate kinase_like (UMPK_like) is a family of proteins highly similar to the uridine monophosphate kinase (UMPK, EC 2 | Back alignment and domain information |
|---|
| >KOG3864 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG1942 consensus DNA helicase, TBP-interacting protein [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >CHL00081 chlI Mg-protoporyphyrin IX chelatase | Back alignment and domain information |
|---|
| >TIGR03263 guanyl_kin guanylate kinase | Back alignment and domain information |
|---|
| >PRK15453 phosphoribulokinase; Provisional | Back alignment and domain information |
|---|
| >cd03243 ABC_MutS_homologs The MutS protein initiates DNA mismatch repair by recognizing mispaired and unpaired bases embedded in duplex DNA and activating endo- and exonucleases to remove the mismatch | Back alignment and domain information |
|---|
| >cd03287 ABC_MSH3_euk MutS3 homolog in eukaryotes | Back alignment and domain information |
|---|
| >PF05970 PIF1: PIF1-like helicase; InterPro: IPR010285 This entry represents PIF1 helicase and related proteins | Back alignment and domain information |
|---|
| >PRK06731 flhF flagellar biosynthesis regulator FlhF; Validated | Back alignment and domain information |
|---|
| >PHA02774 E1; Provisional | Back alignment and domain information |
|---|
| >PRK12339 2-phosphoglycerate kinase; Provisional | Back alignment and domain information |
|---|
| >PF13086 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV_A 2XZP_A 2GK6_A 2GK7_A 2GJK_A | Back alignment and domain information |
|---|
| >TIGR01041 ATP_syn_B_arch ATP synthase archaeal, B subunit | Back alignment and domain information |
|---|
| >PRK05057 aroK shikimate kinase I; Reviewed | Back alignment and domain information |
|---|
| >cd03285 ABC_MSH2_euk MutS2 homolog in eukaryotes | Back alignment and domain information |
|---|
| >CHL00060 atpB ATP synthase CF1 beta subunit | Back alignment and domain information |
|---|
| >PRK10875 recD exonuclease V subunit alpha; Provisional | Back alignment and domain information |
|---|
| >cd00984 DnaB_C DnaB helicase C terminal domain | Back alignment and domain information |
|---|
| >TIGR01313 therm_gnt_kin carbohydrate kinase, thermoresistant glucokinase family | Back alignment and domain information |
|---|
| >COG2019 AdkA Archaeal adenylate kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >cd01136 ATPase_flagellum-secretory_path_III Flagellum-specific ATPase/type III secretory pathway virulence-related protein | Back alignment and domain information |
|---|
| >PF03266 NTPase_1: NTPase; InterPro: IPR004948 This entry represents a family of nucleoside-triphosphatases which have activity towards ATP, GTP, CTP, TTP and UTP and may hydrolyse nucleoside diphosphates with lower efficiency [] | Back alignment and domain information |
|---|
| >PRK13695 putative NTPase; Provisional | Back alignment and domain information |
|---|
| >cd03282 ABC_MSH4_euk MutS4 homolog in eukaryotes | Back alignment and domain information |
|---|
| >PRK03846 adenylylsulfate kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR02974 phageshock_pspF psp operon transcriptional activator PspF | Back alignment and domain information |
|---|
| >PRK14527 adenylate kinase; Provisional | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST
Original result of BLAST against Protein Data Bank
| ID | Alignment Graph | Length |
Definition |
E-value | |
| Query | 1497 | ||||
| 3iza_B | 1263 | Structure Of An Apoptosome-Procaspase-9 Card Comple | 2e-08 | ||
| 1z6t_A | 591 | Structure Of The Apoptotic Protease-activating Fact | 2e-08 | ||
| 3sfz_A | 1249 | Crystal Structure Of Full-Length Murine Apaf-1 Leng | 1e-07 | ||
| 3shf_A | 1256 | Crystal Structure Of The R265s Mutant Of Full-Lengt | 8e-07 | ||
| 1sq0_B | 288 | Crystal Structure Of The Complex Of The Wild-Type V | 2e-05 | ||
| 1p8v_A | 279 | Crystal Structure Of The Complex Of Platelet Recept | 2e-05 | ||
| 1gwb_B | 281 | Structure Of Glycoprotein 1b Length = 281 | 2e-05 | ||
| 1m0z_A | 290 | Crystal Structure Of The Von Willebrand Factor Bind | 2e-05 | ||
| 1m10_B | 290 | Crystal Structure Of The Complex Of Glycoprotein Ib | 2e-05 | ||
| 1u0n_D | 265 | The Ternary Von Willebrand Factor A1-Glycoprotein I | 2e-05 | ||
| 3p72_A | 269 | Structure Of Platelet Glycoprotein 1b Alpha With A | 2e-05 | ||
| 1p9a_G | 290 | Crystal Structure Of N-terminal Domain Of Human Pla | 6e-05 | ||
| 1ook_G | 290 | Crystal Structure Of The Complex Of Platelet Recept | 7e-05 | ||
| 3pmh_G | 290 | Mechanism Of Sulfotyrosine-Mediated Glycoprotein Ib | 7e-05 | ||
| 2o6q_A | 270 | Structural Diversity Of The Hagfish Variable Lympho | 8e-05 | ||
| 1o6s_A | 466 | Internalin (Listeria Monocytogenes) E-Cadherin (Hum | 2e-04 | ||
| 2omz_A | 466 | Crystal Structure Of Inla Y369a/hec1 Complex Length | 2e-04 | ||
| 2omy_A | 461 | Crystal Structure Of Inla S192n/hec1 Complex Length | 2e-04 | ||
| 2omv_A | 461 | Crystal Structure Of Inla S192n Y369s/hec1 Complex | 3e-04 | ||
| 2omx_A | 462 | Crystal Structure Of Inla S192n G194s+sHEC1 COMPLEX | 3e-04 | ||
| 2omu_A | 462 | Crystal Structure Of Inla G194s+s Y369s/hec1 Comple | 3e-04 | ||
| 2omt_A | 462 | Crystal Structure Of Inla G194s+sHEC1 COMPLEX Lengt | 3e-04 |
| >pdb|1Z6T|A Chain A, Structure Of The Apoptotic Protease-activating Factor 1 Bound To Adp Length = 591 | Back alignment and structure |
| >pdb|3SFZ|A Chain A, Crystal Structure Of Full-Length Murine Apaf-1 Length = 1249 | Back alignment and structure |
| >pdb|3SHF|A Chain A, Crystal Structure Of The R265s Mutant Of Full-Length Murine Apaf-1 Length = 1256 | Back alignment and structure |
| >pdb|1SQ0|B Chain B, Crystal Structure Of The Complex Of The Wild-Type Von Willebrand Factor A1 Domain And Glycoprotein Ib Alpha At 2.6 Angstrom Resolution Length = 288 | Back alignment and structure |
| >pdb|1P8V|A Chain A, Crystal Structure Of The Complex Of Platelet Receptor Gpib-alpha And Alpha-thrombin At 2.6a Length = 279 | Back alignment and structure |
| >pdb|1GWB|B Chain B, Structure Of Glycoprotein 1b Length = 281 | Back alignment and structure |
| >pdb|1M0Z|A Chain A, Crystal Structure Of The Von Willebrand Factor Binding Domain Of Glycoprotein Ib Alpha Length = 290 | Back alignment and structure |
| >pdb|1M10|B Chain B, Crystal Structure Of The Complex Of Glycoprotein Ib Alpha And The Von Willebrand Factor A1 Domain Length = 290 | Back alignment and structure |
| >pdb|1U0N|D Chain D, The Ternary Von Willebrand Factor A1-Glycoprotein Ibalpha- Botrocetin Complex Length = 265 | Back alignment and structure |
| >pdb|3P72|A Chain A, Structure Of Platelet Glycoprotein 1b Alpha With A Bound Peptide Inhibitor Length = 269 | Back alignment and structure |
| >pdb|1P9A|G Chain G, Crystal Structure Of N-terminal Domain Of Human Platelet Receptor Glycoprotein Ib-alpha At 1.7 Angstrom Resolution Length = 290 | Back alignment and structure |
| >pdb|1OOK|G Chain G, Crystal Structure Of The Complex Of Platelet Receptor Gpib-alpha And Human Alpha-thrombin Length = 290 | Back alignment and structure |
| >pdb|3PMH|G Chain G, Mechanism Of Sulfotyrosine-Mediated Glycoprotein Ib Interaction With Two Distinct Alpha-Thrombin Sites Length = 290 | Back alignment and structure |
| >pdb|2O6Q|A Chain A, Structural Diversity Of The Hagfish Variable Lymphocyte Receptors A29 Length = 270 | Back alignment and structure |
| >pdb|1O6S|A Chain A, Internalin (Listeria Monocytogenes) E-Cadherin (Human) Recognition Complex Length = 466 | Back alignment and structure |
| >pdb|2OMZ|A Chain A, Crystal Structure Of Inla Y369a/hec1 Complex Length = 466 | Back alignment and structure |
| >pdb|2OMY|A Chain A, Crystal Structure Of Inla S192n/hec1 Complex Length = 461 | Back alignment and structure |
| >pdb|2OMV|A Chain A, Crystal Structure Of Inla S192n Y369s/hec1 Complex Length = 461 | Back alignment and structure |
| >pdb|2OMX|A Chain A, Crystal Structure Of Inla S192n G194s+sHEC1 COMPLEX Length = 462 | Back alignment and structure |
| >pdb|2OMU|A Chain A, Crystal Structure Of Inla G194s+s Y369s/hec1 Complex Length = 462 | Back alignment and structure |
| >pdb|2OMT|A Chain A, Crystal Structure Of Inla G194s+sHEC1 COMPLEX Length = 462 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST
Original result of RPS-BLAST against PDB70 database
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
Score = 188 bits (477), Expect = 3e-48
Identities = 100/639 (15%), Positives = 207/639 (32%), Gaps = 136/639 (21%)
Query: 19 HLTKEVEKLRER-RESVQHRVD-FAKE-NGEEIEQSVENWLIS--VDKIVEEAGKFVEDD 73
H+ E + + + ++ + D F + ++++ ++ L +D I+ +D
Sbjct: 6 HMDFETGEHQYQYKDILSVFEDAFVDNFDCKDVQDMPKSILSKEEIDHIIMS-----KDA 60
Query: 74 EEANNPCFKVLCPNLKNRHHLSKKAAKEVKAIVELQDEGNFD------RVSVRGISRDRL 127
F L K + V+ VE N+ + R S
Sbjct: 61 VSGTLRLFWTLL----------SKQEEMVQKFVEEVLRINYKFLMSPIKTEQRQPSMMT- 109
Query: 128 VAYTES----YNEGHEFIE---SRESILNDILDALR----GPYVYMIGVYGMAGIGKTTL 176
Y E YN+ F + SR + AL V + G+ G GKT +
Sbjct: 110 RMYIEQRDRLYNDNQVFAKYNVSRLQPYLKLRQALLELRPAKNV---LIDGVLGSGKTWV 166
Query: 177 VKEVARLAKEGRIFDEVVF----AEVSQTPDLKRIRREIADQLGLNFCEESD-SERIMML 231
+V K D +F + + + +++ Q+ N+ SD S I +
Sbjct: 167 ALDVCLSYKVQCKMDFKIFWLNLKNCNSPETVLEMLQKLLYQIDPNWTSRSDHSSNIKLR 226
Query: 232 CNRLKREKKI----------LVILDDIWTSLDLERTGIPFGDVHRGCKILVTSRRRDVL- 280
+ ++ E + L++L ++ + F ++ CKIL+T+R + V
Sbjct: 227 IHSIQAELRRLLKSKPYENCLLVLLNVQNAKAWN----AF-NL--SCKILLTTRFKQVTD 279
Query: 281 ----VSEMHCQNNYCVSVLNKEEAWSLFSKVVGNCVEDPDLQTVAIQVANECGGLPIAIL 336
+ H ++ L +E SL K + DL P +
Sbjct: 280 FLSAATTTHISLDHHSMTLTPDEVKSLLLKYLD--CRPQDLPREV------LTTNPRRLS 331
Query: 337 TVARTLRNKPLFVWKKALQELRFSARNFTGLEALLGSTIELIYNYLEGEELKLTFLLCSL 396
+A ++R+ W + N L + IE N LE E + F S+
Sbjct: 332 IIAESIRDGLA-TWD------NWKHVNCDKLT----TIIESSLNVLEPAEYRKMFDRLSV 380
Query: 397 MKHPCDAPI-MDLLKYGTGLGLFEDIYTMQERRDRVYALVRGLKDTCLLHDDDTADWFSM 455
P A I LL + + V +V L L+ S+
Sbjct: 381 F--PPSAHIPTILLS----------LIWFDVIKSDVMVVVNKLHKYSLVEKQPKESTISI 428
Query: 456 LGFVRNVAISIASINLMVRNDALIE-------WPNKDMLKNCIA--IFLHDINTGELPEG 506
+ + + N + ++++ + + D++ + + H
Sbjct: 429 PSIYLELKVKLE--NEYALHRSIVDHYNIPKTFDSDDLIPPYLDQYFYSH---------- 476
Query: 507 LEYPHLTSLCMNPKD---PFLHIPDNFFAGMPKLRVLVLTRMKLLTLPSSFCHLPNLESL 563
+ + HL ++ + + + F K+R ++ ++ L +
Sbjct: 477 IGH-HLKNIEHPERMTLFRMVFLDFRFLEQ--KIRHDSTAWNASGSILNTLQQLKFYKPY 533
Query: 564 CLDQC-----ILGDIAIIGNLKNLEILSLCC--SDIEQL 595
D ++ I+ L +E +C +D+ ++
Sbjct: 534 ICDNDPKYERLVNA--ILDFLPKIEENLICSKYTDLLRI 570
|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Length = 549 | Back alignment and structure |
|---|
| >1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Length = 591 | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 | Back alignment and structure |
|---|
| >3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Length = 1249 | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 | Back alignment and structure |
|---|
| >2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 | Back alignment and structure |
|---|
| >2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 | Back alignment and structure |
|---|
| >1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 | Back alignment and structure |
|---|
| >1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 | Back alignment and structure |
|---|
| >3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 | Back alignment and structure |
|---|
| >3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 | Back alignment and structure |
|---|
| >3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 | Back alignment and structure |
|---|
| >1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 | Back alignment and structure |
|---|
| >1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 | Back alignment and structure |
|---|
| >2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 | Back alignment and structure |
|---|
| >2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 | Back alignment and structure |
|---|
| >4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 | Back alignment and structure |
|---|
| >4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 | Back alignment and structure |
|---|
| >2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 | Back alignment and structure |
|---|
| >2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 | Back alignment and structure |
|---|
| >2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 | Back alignment and structure |
|---|
| >1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 | Back alignment and structure |
|---|
| >1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 | Back alignment and structure |
|---|
| >1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 | Back alignment and structure |
|---|
| >1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 | Back alignment and structure |
|---|
| >1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 | Back alignment and structure |
|---|
| >1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 | Back alignment and structure |
|---|
| >1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 | Back alignment and structure |
|---|
| >3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 | Back alignment and structure |
|---|
| >3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 | Back alignment and structure |
|---|
| >3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 | Back alignment and structure |
|---|
| >3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 | Back alignment and structure |
|---|
| >2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 | Back alignment and structure |
|---|
| >2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 | Back alignment and structure |
|---|
| >2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 | Back alignment and structure |
|---|
| >2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 | Back alignment and structure |
|---|
| >2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 | Back alignment and structure |
|---|
| >2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 | Back alignment and structure |
|---|
| >2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 | Back alignment and structure |
|---|
| >2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 | Back alignment and structure |
|---|
| >2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 | Back alignment and structure |
|---|
| >2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 | Back alignment and structure |
|---|
| >1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 | Back alignment and structure |
|---|
| >1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 | Back alignment and structure |
|---|
| >1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 | Back alignment and structure |
|---|
| >1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 | Back alignment and structure |
|---|
| >2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 | Back alignment and structure |
|---|
| >2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 | Back alignment and structure |
|---|
| >1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 | Back alignment and structure |
|---|
| >1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 | Back alignment and structure |
|---|
| >1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 | Back alignment and structure |
|---|
| >1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 | Back alignment and structure |
|---|
| >1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 | Back alignment and structure |
|---|
| >1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 | Back alignment and structure |
|---|
| >1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 | Back alignment and structure |
|---|
| >1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 | Back alignment and structure |
|---|
| >3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 | Back alignment and structure |
|---|
| >3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 | Back alignment and structure |
|---|
| >1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 | Back alignment and structure |
|---|
| >1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 | Back alignment and structure |
|---|
| >2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 | Back alignment and structure |
|---|
| >2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 | Back alignment and structure |
|---|
| >2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 | Back alignment and structure |
|---|
| >3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 | Back alignment and structure |
|---|
| >1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 | Back alignment and structure |
|---|
| >1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 | Back alignment and structure |
|---|
| >1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 | Back alignment and structure |
|---|
| >3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 | Back alignment and structure |
|---|
| >1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 | Back alignment and structure |
|---|
| >1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 | Back alignment and structure |
|---|
| >2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 | Back alignment and structure |
|---|
| >2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 | Back alignment and structure |
|---|
| >3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 | Back alignment and structure |
|---|
| >2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 | Back alignment and structure |
|---|
| >2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 | Back alignment and structure |
|---|
| >3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 | Back alignment and structure |
|---|
| >1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 Length = 389 | Back alignment and structure |
|---|
| >2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 | Back alignment and structure |
|---|
| >2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 | Back alignment and structure |
|---|
| >2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 | Back alignment and structure |
|---|
| >2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 | Back alignment and structure |
|---|
| >2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 | Back alignment and structure |
|---|
| >1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 | Back alignment and structure |
|---|
| >2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 | Back alignment and structure |
|---|
| >2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 | Back alignment and structure |
|---|
| >2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 | Back alignment and structure |
|---|
| >2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 | Back alignment and structure |
|---|
| >2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 | Back alignment and structure |
|---|
| >2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Length = 384 | Back alignment and structure |
|---|
| >2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 | Back alignment and structure |
|---|
| >3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Length = 176 | Back alignment and structure |
|---|
| >2fna_A Conserved hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE ADP; 2.00A {Sulfolobus solfataricus} SCOP: a.4.5.11 c.37.1.20 Length = 357 | Back alignment and structure |
|---|
| >3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} Length = 318 | Back alignment and structure |
|---|
| >3lvg_D LCB, clathrin light chain B; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} Length = 190 | Back alignment and structure |
|---|
| >2qen_A Walker-type ATPase; unknown function; HET: ADP; 2.25A {Pyrococcus abyssi} Length = 350 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch
Original result of HHsearch against PDB70 database
No hit with probability above 80.00
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST
Original result of RPS-BLAST against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
E-value |
| 1497 | ||||
| d2a5yb3 | 277 | c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenor | 6e-32 | |
| d2omza2 | 384 | c.10.2.1 (A:33-416) Internalin A {Listeria monocyt | 7e-10 | |
| d2omza2 | 384 | c.10.2.1 (A:33-416) Internalin A {Listeria monocyt | 7e-09 | |
| d2omza2 | 384 | c.10.2.1 (A:33-416) Internalin A {Listeria monocyt | 1e-08 | |
| d1xkua_ | 305 | c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 | 1e-05 | |
| d1jl5a_ | 353 | c.10.2.6 (A:) Leucine rich effector protein YopM { | 1e-05 | |
| d1dcea3 | 124 | c.10.2.2 (A:444-567) Rab geranylgeranyltransferase | 2e-05 | |
| d1a9na_ | 162 | c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom | 8e-05 | |
| d1h6ua2 | 227 | c.10.2.1 (A:36-262) Internalin H {Listeria monocyt | 2e-04 | |
| d1h6ua2 | 227 | c.10.2.1 (A:36-262) Internalin H {Listeria monocyt | 3e-04 | |
| d1h6ua2 | 227 | c.10.2.1 (A:36-262) Internalin H {Listeria monocyt | 0.001 | |
| d1z7xw1 | 460 | c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( | 3e-04 | |
| d1z7xw1 | 460 | c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( | 0.004 | |
| d1koha1 | 162 | c.10.2.3 (A:201-362) mRNA export factor tap {Human | 0.001 | |
| d2astb2 | 284 | c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 | 0.002 | |
| d1ogqa_ | 313 | c.10.2.8 (A:) Polygalacturonase inhibiting protein | 0.002 | |
| d1h6ta2 | 210 | c.10.2.1 (A:31-240) Internalin B {Listeria monocyt | 0.003 | |
| d2fnaa2 | 283 | c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfo | 0.003 | |
| d1p9ag_ | 266 | c.10.2.7 (G:) von Willebrand factor binding domain | 0.004 | |
| d1m9la_ | 198 | c.10.3.1 (A:) Outer arm dynein light chain 1 {Gree | 0.004 |
| >d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Length = 277 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: P-loop containing nucleoside triphosphate hydrolases superfamily: P-loop containing nucleoside triphosphate hydrolases family: Extended AAA-ATPase domain domain: CED-4, NB-ARC domain species: Caenorhabditis elegans [TaxId: 6239]
Score = 124 bits (312), Expect = 6e-32
Identities = 34/230 (14%), Positives = 73/230 (31%), Gaps = 21/230 (9%)
Query: 144 RESILNDILDALR---GPYVYMIGVYGMAGIGKTTLVKEVARLAKE--GRIFDEVVFAEV 198
RE ++ ++ L + + ++G AG GK+ + + + + G +D +V+ +
Sbjct: 25 REYHVDRVIKKLDEMCDLDSFFLFLHGRAGSGKSVIASQALSKSDQLIGINYDSIVWLKD 84
Query: 199 SQTPDLKRIRREIADQLGLNFCEES----------DSERIMMLCNRLKREKKILVILDDI 248
S T L L ++ M+CN L L + DD+
Sbjct: 85 SGTAPKSTFDLFTDILLMLKSEDDLLNFPSVEHVTSVVLKRMICNALIDRPNTLFVFDDV 144
Query: 249 WTSLDLERTGIPFGDVHRGCKILVTSRRRDVLVSEMHCQNNYCVSVLNKEEAWSLFSKVV 308
+ + LVT+R ++ + V+ L +E +
Sbjct: 145 VQEETIRW------AQELRLRCLVTTRDVEISNAASQTCEFIEVTSLEIDECYDFLEAYG 198
Query: 309 GNCVEDPDLQTVAIQVANECGGLPIAILTVARTLRNKPLFVWKKALQELR 358
+ V + G P ++ ++ K + +L
Sbjct: 199 MPMPVGEKEEDVLNKTIELSSGNPATLMMFFKSCEPKTFEKMAQLNNKLE 248
|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 | Back information, alignment and structure |
|---|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 | Back information, alignment and structure |
|---|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 | Back information, alignment and structure |
|---|
| >d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 | Back information, alignment and structure |
|---|
| >d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 | Back information, alignment and structure |
|---|
| >d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 | Back information, alignment and structure |
|---|
| >d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 | Back information, alignment and structure |
|---|
| >d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 | Back information, alignment and structure |
|---|
| >d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 | Back information, alignment and structure |
|---|
| >d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 | Back information, alignment and structure |
|---|
| >d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 | Back information, alignment and structure |
|---|
| >d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 | Back information, alignment and structure |
|---|
| >d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 | Back information, alignment and structure |
|---|
| >d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Length = 283 | Back information, alignment and structure |
|---|
| >d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 | Back information, alignment and structure |
|---|
| >d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Length = 198 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch
Original result of HHsearch against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 1497 | |||
| d2a5yb3 | 277 | CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI | 100.0 | |
| d2omza2 | 384 | Internalin A {Listeria monocytogenes [TaxId: 1639] | 99.88 | |
| d2omza2 | 384 | Internalin A {Listeria monocytogenes [TaxId: 1639] | 99.87 | |
| d1xkua_ | 305 | Decorin {Cow (Bos taurus) [TaxId: 9913]} | 99.8 | |
| d1xkua_ | 305 | Decorin {Cow (Bos taurus) [TaxId: 9913]} | 99.75 | |
| d1p9ag_ | 266 | von Willebrand factor binding domain of glycoprote | 99.75 | |
| d1jl5a_ | 353 | Leucine rich effector protein YopM {Yersinia pesti | 99.75 | |
| d1jl5a_ | 353 | Leucine rich effector protein YopM {Yersinia pesti | 99.74 | |
| d1ozna_ | 284 | Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma | 99.72 | |
| d1p9ag_ | 266 | von Willebrand factor binding domain of glycoprote | 99.71 | |
| d1ogqa_ | 313 | Polygalacturonase inhibiting protein PGIP {Kidney | 99.71 | |
| d1ogqa_ | 313 | Polygalacturonase inhibiting protein PGIP {Kidney | 99.7 | |
| d1ozna_ | 284 | Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma | 99.69 | |
| d1h6ta2 | 210 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 99.68 | |
| d2omxa2 | 199 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 99.66 | |
| d2omxa2 | 199 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 99.64 | |
| d1h6ua2 | 227 | Internalin H {Listeria monocytogenes [TaxId: 1639] | 99.61 | |
| d1h6ta2 | 210 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 99.6 | |
| d1h6ua2 | 227 | Internalin H {Listeria monocytogenes [TaxId: 1639] | 99.56 | |
| d2astb2 | 284 | Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa | 99.46 | |
| d1xwdc1 | 242 | Follicle-stimulating hormone receptor {Human (Homo | 99.4 | |
| d1a9na_ | 162 | Splicesomal U2A' protein {Human (Homo sapiens) [Ta | 99.39 | |
| d2fnaa2 | 283 | Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ | 99.38 | |
| d1w8aa_ | 192 | Slit {Fruit fly (Drosophila melanogaster) [TaxId: | 99.37 | |
| d1w8aa_ | 192 | Slit {Fruit fly (Drosophila melanogaster) [TaxId: | 99.34 | |
| d1xwdc1 | 242 | Follicle-stimulating hormone receptor {Human (Homo | 99.33 | |
| d1a9na_ | 162 | Splicesomal U2A' protein {Human (Homo sapiens) [Ta | 99.32 | |
| d1dcea3 | 124 | Rab geranylgeranyltransferase alpha-subunit, C-ter | 99.31 | |
| d1dcea3 | 124 | Rab geranylgeranyltransferase alpha-subunit, C-ter | 99.23 | |
| d1fnna2 | 276 | CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T | 99.15 | |
| d1sxjc2 | 227 | Replication factor C3 {Baker's yeast (Saccharomyce | 99.13 | |
| d1sxjb2 | 224 | Replication factor C4 {Baker's yeast (Saccharomyce | 99.1 | |
| d1z7xw1 | 460 | Ribonuclease inhibitor {Human (Homo sapiens) [TaxI | 99.08 | |
| d1m9la_ | 198 | Outer arm dynein light chain 1 {Green algae (Chlam | 99.06 | |
| d1r6bx2 | 268 | ClpA, an Hsp100 chaperone, AAA+ modules {Escherich | 99.04 | |
| d1njfa_ | 239 | delta prime subunit of DNA polymerase III, N-domai | 98.99 | |
| d1iqpa2 | 231 | Replication factor C {Archaeon Pyrococcus furiosus | 98.99 | |
| d1sxjd2 | 237 | Replication factor C2 {Baker's yeast (Saccharomyce | 98.98 | |
| d1m9la_ | 198 | Outer arm dynein light chain 1 {Green algae (Chlam | 98.98 | |
| d1w5sa2 | 287 | CDC6-like protein APE0152, N-terminal domain {Aero | 98.98 | |
| d1z7xw1 | 460 | Ribonuclease inhibitor {Human (Homo sapiens) [TaxI | 98.95 | |
| d1sxje2 | 252 | Replication factor C5 {Baker's yeast (Saccharomyce | 98.91 | |
| d2ifga3 | 156 | High affinity nerve growth factor receptor, N-term | 98.85 | |
| d1qvra2 | 387 | ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 | 98.75 | |
| d2ifga3 | 156 | High affinity nerve growth factor receptor, N-term | 98.75 | |
| d1a5ta2 | 207 | delta prime subunit of DNA polymerase III, N-domai | 98.67 | |
| d1ixza_ | 247 | AAA domain of cell division protein FtsH {Thermus | 98.65 | |
| d1sxja2 | 253 | Replication factor C1 {Baker's yeast (Saccharomyce | 98.63 | |
| d1in4a2 | 238 | Holliday junction helicase RuvB {Thermotoga mariti | 98.62 | |
| d1lv7a_ | 256 | AAA domain of cell division protein FtsH {Escheric | 98.62 | |
| d1d2na_ | 246 | Hexamerization domain of N-ethylmalemide-sensitive | 98.6 | |
| d1e32a2 | 258 | Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu | 98.59 | |
| d2ca6a1 | 344 | Rna1p (RanGAP1), N-terminal domain {Fission yeast | 98.58 | |
| d1jbka_ | 195 | ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} | 98.53 | |
| d1ixsb2 | 239 | Holliday junction helicase RuvB {Thermus thermophi | 98.49 | |
| d1r7ra3 | 265 | Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu | 98.28 | |
| d1l8qa2 | 213 | Chromosomal replication initiation factor DnaA {Aq | 98.28 | |
| d2gnoa2 | 198 | gamma subunit of DNA polymerase III, N-domain {The | 97.81 | |
| d1qvra3 | 315 | ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 | 97.5 | |
| d1mo6a1 | 269 | RecA protein, ATPase-domain {Mycobacterium tubercu | 97.4 | |
| d1r6bx3 | 315 | ClpA, an Hsp100 chaperone, AAA+ modules {Escherich | 97.35 | |
| d1koha1 | 162 | mRNA export factor tap {Human (Homo sapiens) [TaxI | 97.32 | |
| d1xp8a1 | 268 | RecA protein, ATPase-domain {Deinococcus radiodura | 97.3 | |
| d2qy9a2 | 211 | GTPase domain of the signal recognition particle r | 97.12 | |
| d1okkd2 | 207 | GTPase domain of the signal recognition particle r | 97.08 | |
| d1ls1a2 | 207 | GTPase domain of the signal sequence recognition p | 97.02 | |
| d1u94a1 | 263 | RecA protein, ATPase-domain {Escherichia coli [Tax | 97.0 | |
| d1koha1 | 162 | mRNA export factor tap {Human (Homo sapiens) [TaxI | 96.98 | |
| d1vmaa2 | 213 | GTPase domain of the signal recognition particle r | 96.95 | |
| d1j8yf2 | 211 | GTPase domain of the signal sequence recognition p | 96.88 | |
| d1ihua2 | 279 | Arsenite-translocating ATPase ArsA {Escherichia co | 96.83 | |
| d1tf7a2 | 242 | Circadian clock protein KaiC {Synechococcus sp. st | 96.82 | |
| d1m8pa3 | 183 | ATP sulfurylase C-terminal domain {Fungus (Penicil | 96.78 | |
| d1ofha_ | 309 | HslU {Haemophilus influenzae [TaxId: 727]} | 96.72 | |
| d1lw7a2 | 192 | Transcriptional regulator NadR, ribosylnicotinamid | 96.67 | |
| d2jdid3 | 276 | Central domain of beta subunit of F1 ATP synthase | 96.66 | |
| d1rz3a_ | 198 | Hypothetical protein rbstp0775 {Bacillus stearothe | 96.64 | |
| d1bifa1 | 213 | 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata | 96.63 | |
| d2qm8a1 | 323 | Metallochaperone MeaB {Methylobacterium extorquens | 96.61 | |
| d2p67a1 | 327 | LAO/AO transport system kinase ArgK {Escherichia c | 96.55 | |
| d1gvnb_ | 273 | Plasmid maintenance system epsilon/zeta, toxin zet | 96.5 | |
| d1xpua3 | 289 | Transcription termination factor Rho, ATPase domai | 96.48 | |
| d1cp2a_ | 269 | Nitrogenase iron protein {Clostridium pasteurianum | 96.41 | |
| d1np6a_ | 170 | Molybdopterin-guanine dinucleotide biosynthesis pr | 96.36 | |
| d1qf9a_ | 194 | UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 | 96.36 | |
| d2i3ba1 | 189 | Cancer-related NTPase, C1orf57 {Human (Homo sapien | 96.33 | |
| d1kaga_ | 169 | Shikimate kinase (AroK) {Escherichia coli [TaxId: | 96.32 | |
| d1sq5a_ | 308 | Pantothenate kinase PanK {Escherichia coli [TaxId: | 96.32 | |
| d2bdta1 | 176 | Hypothetical protein BH3686 {Bacillus halodurans [ | 96.31 | |
| d1pgva_ | 167 | Tropomodulin C-terminal domain {nematode (Caenorha | 96.24 | |
| d1ihua1 | 296 | Arsenite-translocating ATPase ArsA {Escherichia co | 96.16 | |
| d1ly1a_ | 152 | Polynucleotide kinase, kinase domain {Bacteriophag | 96.15 | |
| d1rkba_ | 173 | Adenylate kinase {Human (Homo sapiens), isoenzyme | 96.11 | |
| d1szpa2 | 251 | DNA repair protein Rad51, catalytic domain {Baker' | 96.09 | |
| d1g8pa_ | 333 | ATPase subunit of magnesium chelatase, BchI {Rhodo | 96.09 | |
| d1x6va3 | 195 | Adenosine-5'phosphosulfate kinase (APS kinase) {Hu | 96.08 | |
| d1ukza_ | 196 | Uridylate kinase {Baker's yeast (Saccharomyces cer | 96.03 | |
| d1w44a_ | 321 | NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} | 95.98 | |
| d1knqa_ | 171 | Gluconate kinase {Escherichia coli [TaxId: 562]} | 95.96 | |
| d1khta_ | 190 | Adenylate kinase {Archaeon Methanococcus voltae [T | 95.93 | |
| d1yj5a2 | 172 | 5' polynucleotide kinase-3' phosphatase, C-termina | 95.9 | |
| d2afhe1 | 289 | Nitrogenase iron protein {Azotobacter vinelandii [ | 95.88 | |
| d1xjca_ | 165 | Molybdopterin-guanine dinucleotide biosynthesis pr | 95.87 | |
| d1m7ga_ | 208 | Adenosine-5'phosphosulfate kinase (APS kinase) {Fu | 95.87 | |
| d1viaa_ | 161 | Shikimate kinase (AroK) {Campylobacter jejuni [Tax | 95.76 | |
| d1nksa_ | 194 | Adenylate kinase {Archaeon Sulfolobus acidocaldari | 95.68 | |
| d1qhxa_ | 178 | Chloramphenicol phosphotransferase {Streptomyces v | 95.68 | |
| d1ckea_ | 225 | CMP kinase {Escherichia coli [TaxId: 562]} | 95.66 | |
| d2iyva1 | 165 | Shikimate kinase (AroK) {Mycobacterium tuberculosi | 95.59 | |
| d1y63a_ | 174 | Probable kinase LmjF30.1890 {Leishmania major [Tax | 95.55 | |
| d1q3ta_ | 223 | CMP kinase {Streptococcus pneumoniae [TaxId: 1313] | 95.55 | |
| d1svma_ | 362 | Papillomavirus large T antigen helicase domain {Si | 95.49 | |
| d1e6ca_ | 170 | Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax | 95.47 | |
| d1odfa_ | 286 | Hypothetical protein Ygr205W {Baker's yeast (Sacch | 95.41 | |
| d1uj2a_ | 213 | Uridine-cytidine kinase 2 {Human (Homo sapiens) [T | 95.37 | |
| d1teva_ | 194 | UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] | 95.36 | |
| d1zp6a1 | 176 | Hypothetical protein Atu3015 {Agrobacterium tumefa | 95.27 | |
| d1pzna2 | 254 | DNA repair protein Rad51, catalytic domain {Archae | 95.25 | |
| d1um8a_ | 364 | ClpX {Helicobacter pylori [TaxId: 210]} | 95.18 | |
| d1w36d1 | 359 | Exodeoxyribonuclease V alpha chain (RecD) {Escheri | 95.18 | |
| d1ye8a1 | 178 | Hypothetical kinase-like protein Aq_1292 {Aquifex | 95.07 | |
| d1nn5a_ | 209 | Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 | 94.92 | |
| d1hyqa_ | 232 | Cell division regulator MinD {Archaeon Archaeoglob | 94.89 | |
| d1ak2a1 | 190 | Adenylate kinase {Cow (Bos taurus), mitochondrial | 94.88 | |
| d1fx0a3 | 276 | Central domain of alpha subunit of F1 ATP synthase | 94.56 | |
| d1a7ja_ | 288 | Phosphoribulokinase {Rhodobacter sphaeroides [TaxI | 94.55 | |
| d1zina1 | 182 | Adenylate kinase {Bacillus stearothermophilus [Tax | 94.49 | |
| d3adka_ | 194 | Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} | 94.49 | |
| d1lvga_ | 190 | Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 | 94.36 | |
| d1zaka1 | 189 | Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} | 94.33 | |
| d4tmka_ | 210 | Thymidylate kinase {Escherichia coli [TaxId: 562]} | 94.31 | |
| d1wb9a2 | 234 | DNA repair protein MutS, the C-terminal domain {Es | 94.27 | |
| d2cdna1 | 181 | Adenylate kinase {Mycobacterium tuberculosis [TaxI | 94.27 | |
| d2ak3a1 | 189 | Adenylate kinase {Cow (Bos taurus), mitochondrial | 94.25 | |
| d1io0a_ | 166 | Tropomodulin C-terminal domain {Chicken (Gallus ga | 94.23 | |
| d1yrba1 | 244 | ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss | 94.12 | |
| d1s3ga1 | 182 | Adenylate kinase {Bacillus globisporus [TaxId: 145 | 94.12 | |
| d1znwa1 | 182 | Guanylate kinase {Mycobacterium tuberculosis [TaxI | 94.08 | |
| d2ocpa1 | 241 | Deoxyguanosine kinase {Human (Homo sapiens) [TaxId | 94.04 | |
| d1gkya_ | 186 | Guanylate kinase {Baker's yeast (Saccharomyces cer | 93.98 | |
| d2i1qa2 | 258 | DNA repair protein Rad51, catalytic domain {Archae | 93.91 | |
| d1ny5a2 | 247 | Transcriptional activator sigm54 (NtrC1), C-termin | 93.89 | |
| d1v5wa_ | 258 | Meiotic recombination protein DMC1/LIM15 homolog { | 93.81 | |
| d1gsia_ | 208 | Thymidylate kinase {Mycobacterium tuberculosis [Ta | 93.77 | |
| d1tf7a1 | 242 | Circadian clock protein KaiC {Synechococcus sp. st | 93.73 | |
| d1akya1 | 180 | Adenylate kinase {Baker's yeast (Saccharomyces cer | 93.71 | |
| d1g3qa_ | 237 | Cell division regulator MinD {Archaeon Pyrococcus | 93.67 | |
| d1uf9a_ | 191 | Dephospho-CoA kinase {Thermus thermophilus [TaxId: | 93.58 | |
| d2jdia3 | 285 | Central domain of alpha subunit of F1 ATP synthase | 93.53 | |
| d1kgda_ | 178 | Guanylate kinase-like domain of Cask {Human (Homo | 93.49 | |
| d1tmka_ | 214 | Thymidylate kinase {Baker's yeast (Saccharomyces c | 93.47 | |
| d1e4va1 | 179 | Adenylate kinase {Escherichia coli [TaxId: 562]} | 93.43 | |
| d2vp4a1 | 197 | Deoxyribonucleoside kinase {Fruit fly (Drosophila | 93.03 | |
| d1s96a_ | 205 | Guanylate kinase {Escherichia coli [TaxId: 562]} | 92.82 | |
| d1p5zb_ | 241 | Deoxycytidine kinase {Human (Homo sapiens) [TaxId: | 92.27 | |
| d1htwa_ | 158 | Hypothetical protein HI0065 {Haemophilus influenza | 92.22 | |
| d1byia_ | 224 | Dethiobiotin synthetase {Escherichia coli [TaxId: | 91.95 | |
| d1n0wa_ | 242 | DNA repair protein Rad51, catalytic domain {Human | 91.9 | |
| d1g41a_ | 443 | HslU {Haemophilus influenzae [TaxId: 727]} | 91.82 | |
| d1vhta_ | 208 | Dephospho-CoA kinase {Escherichia coli [TaxId: 562 | 91.42 | |
| d1f6ba_ | 186 | SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: | 91.32 | |
| d1g2912 | 240 | Maltose transport protein MalK, N-terminal domain | 91.26 | |
| d1deka_ | 241 | Deoxynucleoside monophosphate kinase {Bacteriophag | 91.23 | |
| d1r0wa_ | 281 | Cystic fibrosis transmembrane conductance regulato | 91.21 | |
| d1r8sa_ | 160 | ADP-ribosylation factor {Human (Homo sapiens), ARF | 91.18 | |
| d1zj6a1 | 177 | ADP-ribosylation factor {Human (Homo sapiens), ARL | 91.1 | |
| d2pmka1 | 241 | Haemolysin B ATP-binding protein {Escherichia coli | 90.87 | |
| d1nija1 | 222 | Hypothetical protein YjiA, N-terminal domain {Esch | 90.82 | |
| d1b0ua_ | 258 | ATP-binding subunit of the histidine permease {Sal | 90.78 | |
| d1jjva_ | 205 | Dephospho-CoA kinase {Haemophilus influenzae [TaxI | 90.73 | |
| d3b60a1 | 253 | Multidrug resistance ABC transporter MsbA, C-termi | 90.69 | |
| d1svsa1 | 195 | Transducin (alpha subunit) {Rat (Rattus norvegicus | 90.67 | |
| d1mv5a_ | 242 | Multidrug resistance ABC transporter LmrA, C-termi | 90.59 | |
| d1l2ta_ | 230 | MJ0796 {Archaeon Methanococcus jannaschii [TaxId: | 90.56 | |
| d3dhwc1 | 240 | Methionine import ATP-binding protein MetN {Escher | 90.37 | |
| d1jj7a_ | 251 | Peptide transporter Tap1, C-terminal ABC domain {H | 90.36 | |
| d2awna2 | 232 | Maltose transport protein MalK, N-terminal domain | 90.33 | |
| d1svia_ | 195 | Probable GTPase EngB {Bacillus subtilis [TaxId: 14 | 90.32 | |
| d1cr2a_ | 277 | Gene 4 protein (g4p, DNA primase), helicase domain | 90.27 | |
| d1z06a1 | 165 | Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} | 90.21 | |
| d2a5ja1 | 173 | Rab2b {Human (Homo sapiens) [TaxId: 9606]} | 90.16 | |
| d3d31a2 | 229 | Sulfate/molybdate ABC transporter, ATP-binding pro | 90.07 | |
| d1v43a3 | 239 | Hypothetical protein PH0022, N-terminal domain {Py | 90.06 | |
| d1z0fa1 | 166 | Rab14 {Human (Homo sapiens) [TaxId: 9606]} | 90.03 | |
| d1nlfa_ | 274 | Hexameric replicative helicase repA {Escherichia c | 89.96 | |
| d1z2aa1 | 164 | Rab23 {Mouse (Mus musculus) [TaxId: 10090]} | 89.95 | |
| d1upta_ | 169 | ADP-ribosylation factor {Human (Homo sapiens), ARL | 89.84 | |
| d2onka1 | 240 | Molybdate/tungstate import ATP-binding protein Wtp | 89.82 | |
| d1p6xa_ | 333 | Thymidine kinase {Equine herpesvirus type 4 [TaxId | 89.68 | |
| d1sgwa_ | 200 | Putative ABC transporter PF0895 {Pyrococcus furios | 89.58 | |
| d1ewqa2 | 224 | DNA repair protein MutS, the C-terminal domain {Th | 89.57 | |
| d3raba_ | 169 | Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} | 89.36 | |
| d2ew1a1 | 171 | Rab30 {Human (Homo sapiens) [TaxId: 9606]} | 89.34 | |
| d1z08a1 | 167 | Rab21 {Human (Homo sapiens) [TaxId: 9606]} | 89.25 | |
| d1z0ja1 | 167 | Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} | 89.2 | |
| d1r2qa_ | 170 | Rab5a {Human (Homo sapiens) [TaxId: 9606]} | 89.17 | |
| d2bcgy1 | 194 | GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisi | 89.13 | |
| d1xtqa1 | 167 | GTP-binding protein RheB {Human (Homo sapiens) [Ta | 89.12 | |
| d2fn4a1 | 173 | r-Ras {Human (Homo sapiens) [TaxId: 9606]} | 89.1 | |
| d1oxxk2 | 242 | Glucose transport protein GlcV, N-terminal domain | 89.07 | |
| d2atva1 | 168 | Ras-like estrogen-regulated growth inhibitor, RERG | 89.07 | |
| d2f7sa1 | 186 | Rab27b {Human (Homo sapiens) [TaxId: 9606]} | 89.05 | |
| d1kaoa_ | 167 | Rap2a {Human (Homo sapiens) [TaxId: 9606]} | 89.05 | |
| d1yzqa1 | 164 | Rab6 {Human (Homo sapiens) [TaxId: 9606]} | 89.05 | |
| d1ky3a_ | 175 | Rab-related protein ypt7p {Baker's yeast (Saccharo | 89.02 | |
| d2bmea1 | 174 | Rab4a {Human (Homo sapiens) [TaxId: 9606]} | 88.96 | |
| d2erxa1 | 171 | di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} | 88.9 | |
| d2f9la1 | 175 | Rab11b {Human (Homo sapiens) [TaxId: 9606]} | 88.68 | |
| d1g16a_ | 166 | Rab-related protein Sec4 {Baker's yeast (Saccharom | 88.67 | |
| d1kmqa_ | 177 | RhoA {Human (Homo sapiens) [TaxId: 9606]} | 88.6 | |
| d1c1ya_ | 167 | Rap1A {Human (Homo sapiens) [TaxId: 9606]} | 88.51 | |
| d2fh5b1 | 207 | Signal recognition particle receptor beta-subunit | 88.51 | |
| d2gjsa1 | 168 | Rad {Human (Homo sapiens) [TaxId: 9606]} | 88.45 | |
| d1azta2 | 221 | Transducin (alpha subunit) {Cow (Bos taurus) [TaxI | 88.39 | |
| d1pjra1 | 318 | DEXX box DNA helicase {Bacillus stearothermophilus | 88.38 | |
| d2bcjq2 | 200 | Transducin (alpha subunit) {Mouse (Mus musculus) [ | 88.37 | |
| d1ksha_ | 165 | ADP-ribosylation factor {Mouse (Mus musculus), ARL | 88.35 | |
| d1vpla_ | 238 | Putative ABC transporter TM0544 {Thermotoga mariti | 88.29 | |
| d2erya1 | 171 | r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} | 88.27 | |
| d1mh1a_ | 183 | Rac {Human (Homo sapiens) [TaxId: 9606]} | 88.25 | |
| d2atxa1 | 185 | RhoQ {Human (Homo sapiens) [TaxId: 9606]} | 88.25 | |
| d1ji0a_ | 240 | Branched chain aminoacid ABC transporter {Thermoto | 88.17 | |
| d1zcba2 | 200 | Transducin (alpha subunit) {Mouse (Mus musculus) [ | 88.11 | |
| d2g6ba1 | 170 | Rab26 {Human (Homo sapiens) [TaxId: 9606]} | 88.1 | |
| d1ek0a_ | 170 | Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [T | 88.07 | |
| d2bv3a2 | 276 | Elongation factor G (EF-G), N-terminal (G) domain | 88.06 | |
| d1g6ha_ | 254 | MJ1267 {Archaeon Methanococcus jannaschii [TaxId: | 88.06 | |
| d1nrjb_ | 209 | Signal recognition particle receptor beta-subunit | 87.86 | |
| d1fzqa_ | 176 | ADP-ribosylation factor {Mouse (Mus musculus), ARL | 87.83 | |
| d1ctqa_ | 166 | cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 | 87.75 | |
| d1wf3a1 | 178 | GTPase Era, N-terminal domain {Thermus thermophilu | 87.7 | |
| d1uaaa1 | 306 | DEXX box DNA helicase {Escherichia coli, RepD [Tax | 87.6 | |
| d1vg8a_ | 184 | Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} | 87.57 | |
| d1mkya1 | 171 | Probable GTPase Der, N-terminal and middle domains | 87.56 | |
| d1m7ba_ | 179 | RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} | 87.27 | |
| d2ngra_ | 191 | CDC42 {Human (Homo sapiens) [TaxId: 9606]} | 87.25 | |
| d1e0sa_ | 173 | ADP-ribosylation factor {Human (Homo sapiens), ARF | 87.23 | |
| d1x3sa1 | 177 | Rab18 {Human (Homo sapiens) [TaxId: 9606]} | 87.1 | |
| d1egaa1 | 179 | GTPase Era, N-terminal domain {Escherichia coli [T | 87.09 | |
| d2g3ya1 | 172 | GTP-binding protein GEM {Human (Homo sapiens) [Tax | 87.02 | |
| d2bmja1 | 175 | Centaurin gamma 1, G domain {Human (Homo sapiens) | 86.9 | |
| d1wmsa_ | 174 | Rab9a {Human (Homo sapiens) [TaxId: 9606]} | 86.84 | |
| d1udxa2 | 180 | Obg GTP-binding protein middle domain {Thermus the | 86.8 | |
| d2hyda1 | 255 | Putative multidrug export ATP-binding/permease pro | 86.8 | |
| d1zd9a1 | 164 | ADP-ribosylation factor {Human (Homo sapiens), ARL | 86.77 | |
| d1u8za_ | 168 | Ras-related protein RalA {Cotton-top tamarin (Sagu | 86.55 | |
| d1x1ra1 | 169 | Ras-related protein M-Ras (XRas) {Mouse (Mus muscu | 86.46 | |
| d2qtvb1 | 166 | SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta | 86.39 | |
| d1moza_ | 182 | ADP-ribosylation factor {Baker's yeast (Saccharomy | 85.69 | |
| d1u0la2 | 225 | Probable GTPase EngC (YjeQ), C-terminal domain {Th | 85.55 | |
| d1e2ka_ | 329 | Thymidine kinase {Herpes simplex virus type 1, dif | 85.49 | |
| d1l7vc_ | 231 | ABC transporter involved in vitamin B12 uptake, Bt | 85.45 | |
| d2dy1a2 | 267 | Elongation factor G (EF-G), N-terminal (G) domain | 85.45 | |
| d1f5na2 | 277 | Interferon-induced guanylate-binding protein 1 (GB | 85.44 | |
| d1tuea_ | 205 | Replication protein E1 helicase domain {Human papi | 85.27 | |
| d1i2ma_ | 170 | Ran {Human (Homo sapiens) [TaxId: 9606]} | 85.08 | |
| d1osna_ | 331 | Thymidine kinase {Varicella-zoster virus [TaxId: 1 | 84.91 | |
| d1lnza2 | 185 | Obg GTP-binding protein middle domain {Bacillus su | 84.88 | |
| d1kkma_ | 176 | HPr kinase HprK C-terminal domain {Lactobacillus c | 84.34 | |
| d2cxxa1 | 184 | GTP-binding protein engB {Pyrococcus horikoshii [T | 84.16 | |
| d2fu5c1 | 173 | Rab8a {Mouse (Mus musculus) [TaxId: 10090]} | 83.66 | |
| d1mkya2 | 186 | Probable GTPase Der, N-terminal and middle domains | 83.07 | |
| d2gj8a1 | 161 | Probable tRNA modification GTPase TrmE (MnmE), G d | 82.54 | |
| d1puia_ | 188 | Probable GTPase EngB {Escherichia coli [TaxId: 562 | 82.46 | |
| d1knxa2 | 177 | HPr kinase HprK C-terminal domain {Mycoplasma pneu | 81.39 | |
| d1ko7a2 | 169 | HPr kinase HprK C-terminal domain {Staphylococcus | 81.28 | |
| d1g6oa_ | 323 | Hexameric traffic ATPase, HP0525 {Helicobacter pyl | 80.88 | |
| d1u0ja_ | 267 | Rep 40 protein helicase domain {Adeno-associated v | 80.54 |
| >d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: P-loop containing nucleoside triphosphate hydrolases superfamily: P-loop containing nucleoside triphosphate hydrolases family: Extended AAA-ATPase domain domain: CED-4, NB-ARC domain species: Caenorhabditis elegans [TaxId: 6239]
Probab=100.00 E-value=8.4e-45 Score=304.02 Aligned_cols=244 Identities=15% Similarity=0.149 Sum_probs=194.0
Q ss_pred CCCCCCHHHHHHHHHHHHC---CCCEEEEEEECCCCCHHHHHHHHHHHHHH--CCCCCCEEEEEEECCCCCHHHHHHHHH
Q ss_conf 4332116999999999973---99839999992797439999999999974--047865079999257969899999999
Q 000447 138 HEFIESRESILNDILDALR---GPYVYMIGVYGMAGIGKTTLVKEVARLAK--EGRIFDEVVFAEVSQTPDLKRIRREIA 212 (1497)
Q Consensus 138 ~~~~~gR~~~~~~l~~~L~---~~~~~vi~I~G~gGiGKTtLa~~v~~~~~--~~~~F~~~~wv~v~~~~~~~~~~~~i~ 212 (1497)
...++||+.++++|+++|. +.+.++|+|+||||+||||||+++|++.+ .+.+|++++|+++++.++...+...+.
T Consensus 19 ~~~~~gR~~~~~~i~~~L~~~~~~~~~~v~I~GmgGiGKTtLA~~v~~~~~~~~~~~f~~~~Wv~vs~~~~~~~l~~~~~ 98 (277)
T d2a5yb3 19 QMTCYIREYHVDRVIKKLDEMCDLDSFFLFLHGRAGSGKSVIASQALSKSDQLIGINYDSIVWLKDSGTAPKSTFDLFTD 98 (277)
T ss_dssp CCCSCCCHHHHHHHHHHHHHHTTSSSEEEEEECSTTSSHHHHHHHHHHHCSSTBTTTBSEEEEEECCCCSTTHHHHHHHH
T ss_pred CCCEECCHHHHHHHHHHHHHCCCCCCEEEEEECCCCCCHHHHHHHHHHHHHHHHHHCCCEEEEEEECCCCCHHHHHHHHH
T ss_conf 88623739999999999873468784089997799788899999999855655401276489999368777778999999
Q ss_pred HHH---CCCCC-------CCCHHHHHHHHHHHHHCCCEEEEEECCCCCHHHHHHCCCCCCCCCCCEEEEEEECCHHHHHH
Q ss_conf 982---79878-------99949999999999832781999995988801010004888889987199998186023300
Q 000447 213 DQL---GLNFC-------EESDSERIMMLCNRLKREKKILVILDDIWTSLDLERTGIPFGDVHRGCKILVTSRRRDVLVS 282 (1497)
Q Consensus 213 ~~l---~~~~~-------~~~~~~~~~~l~~~l~~~k~~LlVlDdv~~~~~~~~l~~~l~~~~~gskIiiTTR~~~v~~~ 282 (1497)
..+ +.... .................++|+|+|+||||+..+|+.+. ..|||||||||+..++..
T Consensus 99 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~L~~kr~LlVLDDv~~~~~~~~~~------~~~srilvTTR~~~v~~~ 172 (277)
T d2a5yb3 99 ILLMLKSEDDLLNFPSVEHVTSVVLKRMICNALIDRPNTLFVFDDVVQEETIRWAQ------ELRLRCLVTTRDVEISNA 172 (277)
T ss_dssp HHHHHTTTSCCTTCCCCTTCCHHHHHHHHHHHHTTSTTEEEEEEEECCHHHHHHHH------HTTCEEEEEESBGGGGGG
T ss_pred HHHHHHCCHHHCCCCCCHHHHHHHHHHHHHHHHHCCCCEEEECCHHHHHHHHHHHC------CCCCEEEEEEEHHHHHHH
T ss_conf 99987220220278632123369999999999844688167525066776655520------457559999644899986
Q ss_pred CCCCCCEEEECCCCHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHCCCHHHHHHHHHHHCCCCHHHHHHHHHHHHHHCC
Q ss_conf 18644219902899889999999882899999408999999999938991999999999608992799999999873015
Q 000447 283 EMHCQNNYCVSVLNKEEAWSLFSKVVGNCVEDPDLQTVAIQVANECGGLPIAILTVARTLRNKPLFVWKKALQELRFSAR 362 (1497)
Q Consensus 283 ~~~~~~~~~l~~L~~~e~~~Lf~~~~~~~~~~~~~~~~~~~i~~~c~GlPLai~~~~~~L~~~~~~~w~~~l~~l~~~~~ 362 (1497)
.....+.|++++|+.+|||+||.++++.....+..++++++|+++|+|+|||++++|+.++.++...|....+.+. ..
T Consensus 173 ~~~~~~~~~l~~L~~~ea~~Lf~~~~~~~~~~~~~~~~~~~iv~~c~GlPLAl~~ig~~l~~k~~~~~~~~~~~L~--~~ 250 (277)
T d2a5yb3 173 ASQTCEFIEVTSLEIDECYDFLEAYGMPMPVGEKEEDVLNKTIELSSGNPATLMMFFKSCEPKTFEKMAQLNNKLE--SR 250 (277)
T ss_dssp CCSCEEEEECCCCCHHHHHHHHHHTSCCCC--CHHHHHHHHHHHHHTTCHHHHHHHHTTCCSSSHHHHHHHHHHHH--HH
T ss_pred CCCCCCEEECCCCCHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHCCCHHHHHHHHHHHCCCCHHHHHHHHHHHH--CC
T ss_conf 3788716877889979999999998477667425679999999995899899999999865598999999999973--48
Q ss_pred CCCCHHHHHHHHHHHHHCCCCCCCHHHHHHHH
Q ss_conf 86534788874899985157964102366430
Q 000447 363 NFTGLEALLGSTIELIYNYLEGEELKLTFLLC 394 (1497)
Q Consensus 363 ~~~~~~~~~~~~l~~sy~~L~~~~lk~cfl~~ 394 (1497)
.. .++. .++.+||++||++ +|.||-++
T Consensus 251 ~~---~~v~-~il~~sY~~L~~~-lk~c~~~l 277 (277)
T d2a5yb3 251 GL---VGVE-CITPYSYKSLAMA-LQRCVEVL 277 (277)
T ss_dssp CS---STTC-CCSSSSSSSHHHH-HHHHHHTS
T ss_pred CH---HHHH-HHHHHHHHCCCHH-HHHHHHHC
T ss_conf 67---8899-9999988512699-99999739
|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} | Back information, alignment and structure |
|---|
| >d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} | Back information, alignment and structure |
|---|
| >d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} | Back information, alignment and structure |
|---|
| >d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} | Back information, alignment and structure |
|---|
| >d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} | Back information, alignment and structure |
|---|
| >d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} | Back information, alignment and structure |
|---|
| >d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} | Back information, alignment and structure |
|---|
| >d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]} | Back information, alignment and structure |
|---|
| >d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} | Back information, alignment and structure |
|---|
| >d1ihua2 c.37.1.10 (A:308-586) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} | Back information, alignment and structure |
|---|
| >d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} | Back information, alignment and structure |
|---|
| >d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d2jdid3 c.37.1.11 (D:82-357) Central domain of beta subunit of F1 ATP synthase {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} | Back information, alignment and structure |
|---|
| >d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d1xpua3 c.37.1.11 (A:129-417) Transcription termination factor Rho, ATPase domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1cp2a_ c.37.1.10 (A:) Nitrogenase iron protein {Clostridium pasteurianum [TaxId: 1501]} | Back information, alignment and structure |
|---|
| >d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} | Back information, alignment and structure |
|---|
| >d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} | Back information, alignment and structure |
|---|
| >d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1ihua1 c.37.1.10 (A:1-296) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} | Back information, alignment and structure |
|---|
| >d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} | Back information, alignment and structure |
|---|
| >d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} | Back information, alignment and structure |
|---|
| >d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} | Back information, alignment and structure |
|---|
| >d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2afhe1 c.37.1.10 (E:1-289) Nitrogenase iron protein {Azotobacter vinelandii [TaxId: 354]} | Back information, alignment and structure |
|---|
| >d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} | Back information, alignment and structure |
|---|
| >d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} | Back information, alignment and structure |
|---|
| >d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} | Back information, alignment and structure |
|---|
| >d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} | Back information, alignment and structure |
|---|
| >d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} | Back information, alignment and structure |
|---|
| >d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} | Back information, alignment and structure |
|---|
| >d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} | Back information, alignment and structure |
|---|
| >d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hyqa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1fx0a3 c.37.1.11 (A:97-372) Central domain of alpha subunit of F1 ATP synthase {Spinach (Spinacia oleracea), chloroplast [TaxId: 3562]} | Back information, alignment and structure |
|---|
| >d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]} | Back information, alignment and structure |
|---|
| >d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} | Back information, alignment and structure |
|---|
| >d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1wb9a2 c.37.1.12 (A:567-800) DNA repair protein MutS, the C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} | Back information, alignment and structure |
|---|
| >d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} | Back information, alignment and structure |
|---|
| >d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2ocpa1 c.37.1.1 (A:37-277) Deoxyguanosine kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} | Back information, alignment and structure |
|---|
| >d1ny5a2 c.37.1.20 (A:138-384) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} | Back information, alignment and structure |
|---|
| >d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1g3qa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2jdia3 c.37.1.11 (A:95-379) Central domain of alpha subunit of F1 ATP synthase {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tmka_ c.37.1.1 (A:) Thymidylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1p5zb_ c.37.1.1 (B:) Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1htwa_ c.37.1.18 (A:) Hypothetical protein HI0065 {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1byia_ c.37.1.10 (A:) Dethiobiotin synthetase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1vhta_ c.37.1.1 (A:) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} | Back information, alignment and structure |
|---|
| >d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} | Back information, alignment and structure |
|---|
| >d1deka_ c.37.1.1 (A:) Deoxynucleoside monophosphate kinase {Bacteriophage T4 [TaxId: 10665]} | Back information, alignment and structure |
|---|
| >d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1nija1 c.37.1.10 (A:2-223) Hypothetical protein YjiA, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1jjva_ c.37.1.1 (A:) Dephospho-CoA kinase {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1svsa1 c.37.1.8 (A:32-60,A:182-347) Transducin (alpha subunit) {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} | Back information, alignment and structure |
|---|
| >d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} | Back information, alignment and structure |
|---|
| >d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} | Back information, alignment and structure |
|---|
| >d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1p6xa_ c.37.1.1 (A:) Thymidine kinase {Equine herpesvirus type 4 [TaxId: 10331]} | Back information, alignment and structure |
|---|
| >d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1ewqa2 c.37.1.12 (A:542-765) DNA repair protein MutS, the C-terminal domain {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1azta2 c.37.1.8 (A:35-65,A:202-391) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d2bcjq2 c.37.1.8 (Q:38-66,Q:184-354) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2bv3a2 c.37.1.8 (A:7-282) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2bmja1 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} | Back information, alignment and structure |
|---|
| >d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1e2ka_ c.37.1.1 (A:) Thymidine kinase {Herpes simplex virus type 1, different strains [TaxId: 10298]} | Back information, alignment and structure |
|---|
| >d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2dy1a2 c.37.1.8 (A:8-274) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus, EF-G-2 [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1f5na2 c.37.1.8 (A:7-283) Interferon-induced guanylate-binding protein 1 (GBP1), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tuea_ c.37.1.20 (A:) Replication protein E1 helicase domain {Human papillomavirus type 18 [TaxId: 333761]} | Back information, alignment and structure |
|---|
| >d1i2ma_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1osna_ c.37.1.1 (A:) Thymidine kinase {Varicella-zoster virus [TaxId: 10335]} | Back information, alignment and structure |
|---|
| >d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1kkma_ c.91.1.2 (A:) HPr kinase HprK C-terminal domain {Lactobacillus casei [TaxId: 1582]} | Back information, alignment and structure |
|---|
| >d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1knxa2 c.91.1.2 (A:133-309) HPr kinase HprK C-terminal domain {Mycoplasma pneumoniae [TaxId: 2104]} | Back information, alignment and structure |
|---|
| >d1ko7a2 c.91.1.2 (A:130-298) HPr kinase HprK C-terminal domain {Staphylococcus xylosus [TaxId: 1288]} | Back information, alignment and structure |
|---|
| >d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d1u0ja_ c.37.1.20 (A:) Rep 40 protein helicase domain {Adeno-associated virus 2, AAV2 [TaxId: 10804]} | Back information, alignment and structure |
|---|