Citrus Sinensis ID: 000509
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
|
|
Close Homologs for Annotation Transfer
Close Homologs in SWISS-PROT Database Detected by BLAST 
Original result of BLAST against SWISS-PROT Database
| ID | Alignment graph | Length |
Definition |
RBH(Q2H) |
RBH(H2Q) |
Q cover |
H cover |
Identity |
E-value |
| Query | 1456 | 2.2.26 [Sep-21-2011] | |||||||
| O60306 | 1485 | Intron-binding protein aq | yes | no | 0.843 | 0.826 | 0.474 | 0.0 | |
| Q8CFQ3 | 1481 | Intron-binding protein aq | yes | no | 0.836 | 0.822 | 0.472 | 0.0 | |
| O94508 | 1284 | Pre-mRNA-splicing factor | yes | no | 0.657 | 0.745 | 0.250 | 9e-67 | |
| Q8R151 | 1909 | NFX1-type zinc finger-con | no | no | 0.159 | 0.121 | 0.333 | 8e-26 | |
| Q9P2E3 | 1918 | NFX1-type zinc finger-con | no | no | 0.160 | 0.122 | 0.319 | 3e-24 | |
| Q9FJR0 | 1254 | Regulator of nonsense tra | no | no | 0.182 | 0.212 | 0.278 | 5e-19 | |
| Q9HEH1 | 1093 | Regulator of nonsense tra | N/A | no | 0.177 | 0.236 | 0.293 | 2e-18 | |
| Q9EPU0 | 1124 | Regulator of nonsense tra | no | no | 0.170 | 0.220 | 0.290 | 1e-17 | |
| Q92900 | 1129 | Regulator of nonsense tra | no | no | 0.170 | 0.219 | 0.283 | 1e-17 | |
| O74465 | 999 | Helicase required for RNA | no | no | 0.166 | 0.243 | 0.307 | 9e-17 |
| >sp|O60306|AQR_HUMAN Intron-binding protein aquarius OS=Homo sapiens GN=AQR PE=1 SV=4 | Back alignment and function desciption |
|---|
Score = 1231 bits (3186), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 657/1386 (47%), Positives = 884/1386 (63%), Gaps = 158/1386 (11%)
Query: 46 TLSEIQRDRLTKIASENW---LKTEKPFDAELVKEIYRTELTVKEGRKTVPLHRVMILEV 102
T+S+I + +T++A + W +K + PFD +++++IY E+ + + ++M+LE
Sbjct: 14 TVSQINAEFVTQLACKYWAPHIKKKSPFDIKVIEDIYEKEIV----KSRFAIRKIMLLEF 69
Query: 103 SQYLENYLWPNFDAETAS-----------------------------------FEHVMSM 127
SQYLENYLW N+ E +S F+H++
Sbjct: 70 SQYLENYLWMNYSPEVSSKAYLMSICCMVNEKFRENVPAWEIFKKKPDHFPFFFKHILKA 129
Query: 128 ILMVNE-------------------KSLEDEIVSKTVLRLASLQSWHSLSYGRFQMELCL 168
L + SLE +++ V +L SL W L R ++EL
Sbjct: 130 ALAETDGEFSLHEQTVLLLFLDHCFNSLEVDLIRSQVQQLISLPMWMGLQLARLELELKK 189
Query: 169 NPDLIKKWKRMVKREFKEAMKRGEPFDP----SAMLEVKFLRNFIEEFLEVLENEVFVQR 224
P L K W + K + E DP A E +FL I++F+ VL++ +
Sbjct: 190 TPKLRKFWNLIKKND--------EKMDPEAREQAYQERRFLSQLIQKFISVLKSVPLSEP 241
Query: 225 HHVNNEDDHADANSFLQPNDACVLYCERFMEFLIDLLSQLPTRRYLRPLVADLAIVAKCH 284
++ V YCERF+E +IDL + LPTRR+ ++ D ++ C+
Sbjct: 242 VTMDK-----------------VHYCERFIELMIDLEALLPTRRWFNTILDDSHLLVHCY 284
Query: 285 LSTLYRHEK-GKLFAQLVDLLQFYEKFEINDHVGKQLTDDEVLQSHYDRFQSFQLLAFKK 343
LS L R E+ G LF+QL+D+L+FY FEIND G LT++E+ HYDR S Q AF
Sbjct: 285 LSNLVRREEDGHLFSQLLDMLKFYTGFEINDQTGNALTENEMTTIHYDRITSLQRAAFAH 344
Query: 344 IPKLQELALANIGSIHKRADLSKRLSVLS---LKELQDLVCCKLKLLSSKDPWLDSYDFL 400
P+L + AL+N+ + R L K LS L ++ +C L ++D D +FL
Sbjct: 345 FPELYDFALSNVAEVDTRESLVKFFGPLSSNTLHQVASYLCLLPTLPKNEDTTFDK-EFL 403
Query: 401 VEVIVSFFEKQQSQKEAINALPLYPNEQIMWDESLVPSINYSGEGCLALPKLNLQFLTLH 460
+E++VS E++ SQ + +N +PLYP E+I+WDE++VP+ YSGEGCLALPKLNLQFLTLH
Sbjct: 404 LELLVSRHERRISQIQQLNQMPLYPTEKIIWDENIVPTEYYSGEGCLALPKLNLQFLTLH 463
Query: 461 DYLLRNFNLFRLESTYEIREDIQEAVPHLLAYINNEGEAAFRGWSRMAVPIKEFKITEVK 520
DYLLRNFNLFRLESTYEIR+DI+++V + + + G F GW+RMA PI F + EV
Sbjct: 464 DYLLRNFNLFRLESTYEIRQDIEDSVSRMKPWQSEYGGVVFGGWARMAQPIVAFTVVEVA 523
Query: 521 QPNIGEVKPSSVTAAITFSISSYKAHVRSEWNALKEHDVLFLLSIRPSFEPLSAEEAAKA 580
+PNIGE P+ V A +T +++ + H++ EW L++HDV FL+++RP+ +P + +
Sbjct: 524 KPNIGENWPTRVRADVTINLN-VRDHIKDEWEGLRKHDVCFLITVRPT-KPYGTKFDRRR 581
Query: 581 SVPQKLGLQCVRGCEIIEIRDEDGTLMNDFTGRIKRDEWKPP-KGELRTVTVALDTAQYH 639
+++GL VRGCEI + D+ G ++ D E +P +GE RT V LD QY
Sbjct: 582 PFIEQVGLVYVRGCEIQGMLDDKGRVIED------GPEPRPNLRGESRTFRVFLDPNQYQ 635
Query: 640 MDVTDIAEKGAEDAYGTFNVLMRRKPKENNFKAILESIRDLMNEYCIVPDWLHNIFLGYG 699
D+T+ + GAED Y TFN++MRRKPKENNFKA+LE+IR+LMN C+VPDWLH+I LGYG
Sbjct: 636 QDMTNTIQNGAEDVYETFNIIMRRKPKENNFKAVLETIRNLMNTDCVVPDWLHDIILGYG 695
Query: 700 NPSAAQWTNMPDFLEVVDFKDTFIDTAHLEECFSDYEVSFVHPDGTENLDPRPPFRIRLP 759
+PS+A ++ MP+ + +DF DTF+ HL+ F + V D + PPFRI P
Sbjct: 696 DPSSAHYSKMPNQIATLDFNDTFLSIEHLKASFPGHNVKVTVEDPALQI---PPFRITFP 752
Query: 760 RTLKGTSRALPGNKKLTSDSMQVVNMVDASDGKDQLIVEAYTPPDPGPYPQDQPRQNSVR 819
R+ G K+ +D V D + K LIVE + P+ GPYP +QP++N+++
Sbjct: 753 ------VRSGKGKKRKDAD----VEDEDTEEAKT-LIVEPHVIPNRGPYPYNQPKRNTIQ 801
Query: 820 FTPTQVGAIISGIQPGLTMVVGPPGTGKTDTAVQILNVLYHNCPSQRTLIITHSNQALND 879
FT TQ+ AI +G+QPGLTMVVGPPGTGKTD AVQI++ +YHN P QRTLI+THSNQALN
Sbjct: 802 FTHTQIEAIRAGMQPGLTMVVGPPGTGKTDVAVQIISNIYHNFPEQRTLIVTHSNQALNQ 861
Query: 880 LFEKIMQRDVPARYLLRLGQGEQELATDLDFSRQGRVNAMLVRRLELLSEVERLARSLQL 939
LFEKIM D+ R+LLRLG GE+EL T+ DFSR GRVN +L RR+ELL EV+RL +SL +
Sbjct: 862 LFEKIMALDIDERHLLRLGHGEEELETEKDFSRYGRVNYVLARRIELLEEVKRLQKSLGV 921
Query: 940 PEDVGYTCETAGYFWLLHVYSRWEQFLAACADNEGKP----TFVRDRFPFKEFFSNTPQP 995
P D YTCETAGYF+L V SRWE++++ N+G T V FPF E+F+N PQP
Sbjct: 922 PGDASYTCETAGYFFLYQVMSRWEEYISK-VKNKGSTLPDVTEVSTFFPFHEYFANAPQP 980
Query: 996 IFTGDSFEKDMRAAKGCFRHLQTLFQELEECRAFELLKSTADRANYLMTKQAKIVAMTCT 1055
IF G S+E+DM A+GCFRH++ +F +LEE RA ELL+S DR+ YL+ K+AKI+AMTCT
Sbjct: 981 IFKGRSYEEDMEIAEGCFRHIKKIFTQLEEFRASELLRSGLDRSKYLLVKEAKIIAMTCT 1040
Query: 1056 HAALKRKDFLQLGFKYDNLLMEESAQILEIETFIPMLL----------------NDRRML 1099
HAALKR D ++LGFKYDN+LMEE+AQILEIETFIP+LL D L
Sbjct: 1041 HAALKRHDLVKLGFKYDNILMEEAAQILEIETFIPLLLQNPQDGFSRLKRWIMIGDHHQL 1100
Query: 1100 PPVVKNMAFQKYSHMDQSLFTRFVRLGIPYIELNAQGRARPSIAQLYNWRYRDLGDLPF- 1158
PPV+KNMAFQKYS+M+QSLFTRFVR+G+P ++L+AQGRAR S+ LYNWRY++LG+LP
Sbjct: 1101 PPVIKNMAFQKYSNMEQSLFTRFVRVGVPTVDLDAQGRARASLCNLYNWRYKNLGNLPHV 1160
Query: 1159 ------------------LVDVPDYNGRGESAPSPWFYQNEGEAEYVVSVYIYMRLLGYP 1200
L++V D+ G GES P+P+FYQN GEAEYVV++++YM LLGYP
Sbjct: 1161 QLLPEFSTANAGLLYDFQLINVEDFQGVGESEPNPYFYQNLGEAEYVVALFMYMCLLGYP 1220
Query: 1201 ANKISILTTYNGQKLLIRDVINRQCVPYPFIGPPSKVTTVDKFQGQQNDFILLSLVRTRF 1260
A+KISILTTYNGQK LIRD+INR+C P IG P+KVTTVD+FQGQQND+ILLSLVRTR
Sbjct: 1221 ADKISILTTYNGQKHLIRDIINRRCGNNPLIGRPNKVTTVDRFQGQQNDYILLSLVRTRA 1280
Query: 1261 VGHLRDVRRLVVAMSRARLGLYVFCRRSLFEQCYELQPTFRLLLQRPDKLALTMNEKTSY 1320
VGHLRDVRRLVVAMSRARLGLY+F R SLF+ C+EL P F L RP L + E
Sbjct: 1281 VGHLRDVRRLVVAMSRARLGLYIFARVSLFQNCFELTPAFSQLTARPLHLHIIPTEPFPT 1340
Query: 1321 TDRHVE 1326
T ++ E
Sbjct: 1341 TRKNGE 1346
|
Intron-binding spliceosomal protein required to link pre-mRNA splicing and snoRNP (small nucleolar ribonucleoprotein) biogenesis. Plays a key role in position-dependent assembly of intron-encoded box C/D small snoRNP, splicing being required for snoRNP assembly. May act by helping the folding of the snoRNA sequence. Binds to intron of pre-mRNAs in a sequence-independent manner, contacting the region between snoRNA and the branchpoint of introns (40 nucleotides upstream of the branchpoint) during the late stages of splicing. Homo sapiens (taxid: 9606) |
| >sp|Q8CFQ3|AQR_MOUSE Intron-binding protein aquarius OS=Mus musculus GN=Aqr PE=2 SV=2 | Back alignment and function description |
|---|
| >sp|O94508|CWF11_SCHPO Pre-mRNA-splicing factor cwf11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cwf11 PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|Q8R151|ZNFX1_MOUSE NFX1-type zinc finger-containing protein 1 OS=Mus musculus GN=Znfx1 PE=2 SV=3 | Back alignment and function description |
|---|
| >sp|Q9P2E3|ZNFX1_HUMAN NFX1-type zinc finger-containing protein 1 OS=Homo sapiens GN=ZNFX1 PE=1 SV=2 | Back alignment and function description |
|---|
| >sp|Q9FJR0|RENT1_ARATH Regulator of nonsense transcripts 1 homolog OS=Arabidopsis thaliana GN=UPF1 PE=1 SV=2 | Back alignment and function description |
|---|
| >sp|Q9HEH1|RENT1_NEUCR Regulator of nonsense transcripts 1 homolog OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=2E4.130 PE=3 SV=1 | Back alignment and function description |
|---|
| >sp|Q9EPU0|RENT1_MOUSE Regulator of nonsense transcripts 1 OS=Mus musculus GN=Upf1 PE=1 SV=2 | Back alignment and function description |
|---|
| >sp|Q92900|RENT1_HUMAN Regulator of nonsense transcripts 1 OS=Homo sapiens GN=UPF1 PE=1 SV=2 | Back alignment and function description |
|---|
| >sp|O74465|HRR1_SCHPO Helicase required for RNAi-mediated heterochromatin assembly 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hrr1 PE=1 SV=2 | Back alignment and function description |
|---|
Close Homologs in the Non-Redundant Database Detected by BLAST
Original result of BLAST against Nonredundant Database
| GI | Alignment Graph | Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 1456 | ||||||
| 359480945 | 1552 | PREDICTED: intron-binding protein aquari | 0.994 | 0.932 | 0.773 | 0.0 | |
| 225449865 | 1552 | PREDICTED: intron-binding protein aquari | 0.995 | 0.933 | 0.774 | 0.0 | |
| 307136393 | 2201 | aquarius [Cucumis melo subsp. melo] | 0.985 | 0.651 | 0.776 | 0.0 | |
| 224072853 | 1554 | predicted protein [Populus trichocarpa] | 0.988 | 0.925 | 0.750 | 0.0 | |
| 255544057 | 1492 | conserved hypothetical protein [Ricinus | 0.958 | 0.935 | 0.744 | 0.0 | |
| 356574068 | 1524 | PREDICTED: intron-binding protein aquari | 0.978 | 0.934 | 0.743 | 0.0 | |
| 356577720 | 1526 | PREDICTED: intron-binding protein aquari | 0.946 | 0.903 | 0.752 | 0.0 | |
| 297827467 | 1512 | hypothetical protein ARALYDRAFT_482889 [ | 0.973 | 0.937 | 0.735 | 0.0 | |
| 30687628 | 1509 | intron-binding protein aquarius [Arabido | 0.973 | 0.939 | 0.737 | 0.0 | |
| 3785995 | 1444 | unknown protein [Arabidopsis thaliana] | 0.916 | 0.924 | 0.773 | 0.0 |
| >gi|359480945|ref|XP_002268303.2| PREDICTED: intron-binding protein aquarius-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 2423 bits (6280), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 1207/1560 (77%), Positives = 1300/1560 (83%), Gaps = 112/1560 (7%)
Query: 1 MTKVYGTGAYDFKRHRVAEYPVELPSQQDDKPVESKPGSTLPSSITLSEIQRDRLTKIAS 60
MTKVYGTGAYDFKRHRVAEYPVE +Q E K GS +P++ITL EIQRDRLTKIA
Sbjct: 1 MTKVYGTGAYDFKRHRVAEYPVESANQV----AEPKTGSAIPNTITLLEIQRDRLTKIAE 56
Query: 61 ENWLKT------EKPFDAELVKEIYRTELTVKEGRKTVPLHRVMILEVSQYLENYLWPNF 114
W K +KPFD +LVKEIY TEL V GRKTVPL RVMILEVSQYLENYLWPNF
Sbjct: 57 AKWSKAGEDSKPKKPFDPKLVKEIYETELVVSGGRKTVPLQRVMILEVSQYLENYLWPNF 116
Query: 115 DAETASFEHVMSMILMVNEK---------------------------------------- 134
D ETASFEHVMSMILMVNEK
Sbjct: 117 DPETASFEHVMSMILMVNEKFRENVAAWICFYDRKDVFKAFIEKVLRLKEQGRSLSIAEK 176
Query: 135 ------------SLEDEIVSKTVLRLASLQSWHSLSYGRFQMELCLNPDLIKKWKRMVKR 182
SLEDEIVS+TVLRLASLQSW SLSYGRFQMELCLN DLIKKWKRM+KR
Sbjct: 177 TNYLLFMINAFQSLEDEIVSETVLRLASLQSWLSLSYGRFQMELCLNTDLIKKWKRMIKR 236
Query: 183 EFKEAMKRGEPFDPSAMLEVKFLRNFIEEFLEVLENEVFVQRHHVNNEDDHADANSFLQP 242
E KEAMK+G+PFDPS MLE KFLRN IEEFLEVL+++VF H + +++ DA F +
Sbjct: 237 EAKEAMKQGDPFDPSTMLEAKFLRNIIEEFLEVLDSKVFSHSHGDDEDNELVDAIGFEKV 296
Query: 243 NDACVLYCERFMEFLIDLLSQLPTRRYLRPLVADLAIVAKCHLSTLYRHEKGKLFAQLVD 302
NDAC+LYCERFMEFLIDLLSQLPTRRYLRP+V+D+A+VAKCHLS LY HEKGKLFAQLVD
Sbjct: 297 NDACILYCERFMEFLIDLLSQLPTRRYLRPIVSDVAVVAKCHLSALYTHEKGKLFAQLVD 356
Query: 303 LLQFYEKFEINDHVGKQLTDDEVLQSHYDRFQSFQLLAFKKIPKLQELALANIGSIHKRA 362
LLQFYE FEINDHVG QL DDEVLQSHYDR QSFQLLAFKKIPKL+ELALANIG IH+RA
Sbjct: 357 LLQFYEGFEINDHVGTQLNDDEVLQSHYDRLQSFQLLAFKKIPKLRELALANIGGIHRRA 416
Query: 363 DLSKRLSVLSLKELQDLVCCKLKLLSSKDPWLDSYDFLVEVIVSFFEKQQSQKEAINALP 422
DLSKRLSVLS +EL+DLVCCKLKL+S KDPW + DFL+EV+VSFFEKQQSQKEAINALP
Sbjct: 417 DLSKRLSVLSPEELKDLVCCKLKLVSMKDPWSERVDFLIEVMVSFFEKQQSQKEAINALP 476
Query: 423 LYPNEQIMWDESLVPSINYSGEGCLALPKLNLQFLTLHDYLLRNFNLFRLESTYEIREDI 482
LYPNEQIMWDESLVPSINYSGEGCLALPKLNLQFLTLHDYLLRNFNLFRLESTYEIREDI
Sbjct: 477 LYPNEQIMWDESLVPSINYSGEGCLALPKLNLQFLTLHDYLLRNFNLFRLESTYEIREDI 536
Query: 483 QEAVPHLLAYINNEGEAAFRGWSRMAVPIKEFKITEVKQPNIGEVKPSSVTAAITFSISS 542
QEAVPHLLAYIN+EGE AFRGWSRMAVPI+EFKITEVKQPNIGEVKPSSVTAA+TFSISS
Sbjct: 537 QEAVPHLLAYINHEGETAFRGWSRMAVPIREFKITEVKQPNIGEVKPSSVTAAVTFSISS 596
Query: 543 YKAHVRSEWNALKEHDVLFLLSIRPSFEPLSAEEAAKASVPQKLGLQCVRGCEIIEIRDE 602
YKA +RSEWNALKEHDVLFLLSIRPSFEPLSAEEAAKASVPQ+LGLQ VRGCE+IEIRDE
Sbjct: 597 YKARMRSEWNALKEHDVLFLLSIRPSFEPLSAEEAAKASVPQRLGLQFVRGCEVIEIRDE 656
Query: 603 DGTLMNDFTGRIKRDEWKPPKGELRTVTVALDTAQYHMDVTDIAEKGAEDAYGTFNVLMR 662
+GTLMNDFTGRIKRDEWKPPKGELRTV VALDTAQYHMDV DIAEK AED YGTFN+LMR
Sbjct: 657 EGTLMNDFTGRIKRDEWKPPKGELRTVIVALDTAQYHMDVGDIAEKDAEDVYGTFNILMR 716
Query: 663 RKPKENNFKAILESIRDLMNEYCIVPDWLHNIFLGYGNPSAAQWTNMPDFLEVVDFKDTF 722
RKPKENNFKAILESIRDLMNE CIVPDWLHNIFLGYGNPSAAQWTNMPD LE VDFKDTF
Sbjct: 717 RKPKENNFKAILESIRDLMNETCIVPDWLHNIFLGYGNPSAAQWTNMPDLLETVDFKDTF 776
Query: 723 IDTAHLEECFSDYEVSFVHPDGTENLDPRPPFRIRLPRTLKGTSRALPGNKKLTSDSMQV 782
+D HL E FSDY+V F++PDGTENL PRPPFRIRLPRTLKG ALPGNKK ++ SM
Sbjct: 777 LDADHLRESFSDYQVQFINPDGTENLHPRPPFRIRLPRTLKGNIHALPGNKKSSTASMND 836
Query: 783 VNMVDASDGKDQLIVEAYTPPDPGPYPQDQPRQNSVRFTPTQVGAIISGIQPGLTMVVGP 842
V+M DA +++LIVEAY PPDPGPYPQDQP+QNSVRFTPTQ+ AI SGIQPGLTMVVGP
Sbjct: 837 VSMADAGSEQEKLIVEAYIPPDPGPYPQDQPKQNSVRFTPTQIVAINSGIQPGLTMVVGP 896
Query: 843 PGTGKTDTAVQILNVLYHNCPSQRTLIITHSNQALNDLFEKIMQRDVPARYLLRLGQGEQ 902
PGTGKTDTAVQILNVLYHNCPSQRTLIITHSNQALNDLFEKIMQRDVPARYLLRLGQGEQ
Sbjct: 897 PGTGKTDTAVQILNVLYHNCPSQRTLIITHSNQALNDLFEKIMQRDVPARYLLRLGQGEQ 956
Query: 903 ELATDLDFSRQGRVNAMLVRRLELLSEVERLARSLQLPEDVGYTCETAGYFWLLHVYSRW 962
ELATDLDFSRQGRVNAMLVRRLELLSEVERLARSLQLPEDVGYTCETAGYFWLLHVYS W
Sbjct: 957 ELATDLDFSRQGRVNAMLVRRLELLSEVERLARSLQLPEDVGYTCETAGYFWLLHVYSHW 1016
Query: 963 EQFLAACADNEGKPTFVRDRFPFKEFFSNTPQPIFTGDSFEKDMRAAKGCFRHLQTLFQE 1022
EQFLAAC+ NE KPTFV+DRFPFKEFFSNT +P+FTG+SFEKDMRAAKGCFRHL+T+FQE
Sbjct: 1017 EQFLAACSGNEDKPTFVQDRFPFKEFFSNT-RPVFTGESFEKDMRAAKGCFRHLKTMFQE 1075
Query: 1023 LEECRAFELLKSTADRANYLMTKQAKIVAMTCTHAALKRKDFLQLGFKYDNLLMEESAQI 1082
LEECRAFELLKSTADRANYLMTKQAKIVAMTCTHAALKRKDFLQLGFKYDNLLMEESAQI
Sbjct: 1076 LEECRAFELLKSTADRANYLMTKQAKIVAMTCTHAALKRKDFLQLGFKYDNLLMEESAQI 1135
Query: 1083 LEIETFIPMLL----------------NDRRMLPPVVKNMAFQKYSHMDQSLFTRFVRLG 1126
LEIETFIPMLL D LPPVVKNMAFQKYSHMDQSLFTRFVRLG
Sbjct: 1136 LEIETFIPMLLQRQEDGYARLKRCILIGDHHQLPPVVKNMAFQKYSHMDQSLFTRFVRLG 1195
Query: 1127 IPYIELNAQGRARPSIAQLYNWRYRDLGDLPF-------------------LVDVPDYNG 1167
IPYIELNAQGRARPSIAQLYNWRYR+LGDLP+ LVDVPDY G
Sbjct: 1196 IPYIELNAQGRARPSIAQLYNWRYRELGDLPYVKEAGIFHKANAGFSYDYQLVDVPDYLG 1255
Query: 1168 RGESAPSPWFYQNEGEAEYVVSVYIYMRLLGYPANKISILTTYNGQKLLIRDVINRQCVP 1227
+GE+APSPWFYQNEGEAEYVVSVY+YMRLLGYPA+KISILTTYNGQKLLIRDVINR+C+P
Sbjct: 1256 KGETAPSPWFYQNEGEAEYVVSVYMYMRLLGYPASKISILTTYNGQKLLIRDVINRRCIP 1315
Query: 1228 YPFIGPPSKVTTVDKFQGQQNDFILLSLVRTRFVGHLRDVRRLVVAMSRARLGLYVFCRR 1287
Y FIGPPSKVTTVDKFQGQQNDFILLSLVRTRFVGHLRDVRRLVVAMSRARLGLYVFCRR
Sbjct: 1316 YDFIGPPSKVTTVDKFQGQQNDFILLSLVRTRFVGHLRDVRRLVVAMSRARLGLYVFCRR 1375
Query: 1288 SLFEQCYELQPTFRLLLQRPDKLALTMNEKTSYTDRHVEDIGVPYLVSGIEDIHAIVNSL 1347
SLFEQCYELQPTF+LLLQRPD LAL +NE TS+TDRHV D G+ LVSG+E++ IVN
Sbjct: 1376 SLFEQCYELQPTFQLLLQRPDHLALNLNETTSFTDRHVADPGLVQLVSGVEEMSGIVNFK 1435
Query: 1348 LYQRHLA--IQSQYVAYSGTTDAYA------MEQISHQNSILEHNAMDTDMPAVANGSLG 1399
++Q + A + Q+ +S + A EQ S NS +H MD D PA ++ + G
Sbjct: 1436 MHQVYQARVMGHQFDQFSAHSGQVAPSLGGWEEQNSQLNSTSQHQPMDADRPADSHDANG 1495
Query: 1400 DTSHGSQSEEATEMNGPANGEIPLEGQLNGESGSEPPTD---DKNGTPPESDSNEATKME 1456
D S+S EATEM N +G + E+ + TD D+ G P ES S++ +ME
Sbjct: 1496 DLPPESKSGEATEMEVLENRR---DGASSPENNLKEKTDMNGDRGGAPVESSSHDENRME 1552
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|225449865|ref|XP_002265477.1| PREDICTED: intron-binding protein aquarius-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|307136393|gb|ADN34203.1| aquarius [Cucumis melo subsp. melo] | Back alignment and taxonomy information |
|---|
| >gi|224072853|ref|XP_002303913.1| predicted protein [Populus trichocarpa] gi|222841345|gb|EEE78892.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|255544057|ref|XP_002513091.1| conserved hypothetical protein [Ricinus communis] gi|223548102|gb|EEF49594.1| conserved hypothetical protein [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|356574068|ref|XP_003555174.1| PREDICTED: intron-binding protein aquarius-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356577720|ref|XP_003556971.1| PREDICTED: intron-binding protein aquarius-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|297827467|ref|XP_002881616.1| hypothetical protein ARALYDRAFT_482889 [Arabidopsis lyrata subsp. lyrata] gi|297327455|gb|EFH57875.1| hypothetical protein ARALYDRAFT_482889 [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|30687628|ref|NP_850297.1| intron-binding protein aquarius [Arabidopsis thaliana] gi|20466796|gb|AAM20715.1| unknown protein [Arabidopsis thaliana] gi|330254488|gb|AEC09582.1| intron-binding protein aquarius [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|3785995|gb|AAC67341.1| unknown protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Annotation Transfer from SWISS-PROT Entries
Original result of BLAST against SWISS-PROT
| ID | Name | Annotated EC number | Identity | Query coverage | Hit coverage | RBH(Q2H) | RBH(H2Q) |
| O60306 | AQR_HUMAN | No assigned EC number | 0.4740 | 0.8434 | 0.8269 | yes | no |
| Q8CFQ3 | AQR_MOUSE | No assigned EC number | 0.4724 | 0.8365 | 0.8224 | yes | no |
EC Number Prediction by Ezypred Server
Original result from Ezypred Server
Fail to connect to Ezypred Server
EC Number Prediction by EFICAz Software
No EC number assignment, probably not an enzyme!
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING
Original result from the STRING server
 |
 |
 |
 |
 |
 |
 |
 |
 |
|||
 | GSVIVG00005499001 | SubName- Full=Chromosome chr13 scaffold_152, whole genome shotgun sequence; (1446 aa) | |||||||||
(Vitis vinifera) | |||||||||||
 | GSVIVG00017780001 | • | • | 0.410 |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST
Original result of RPS-BLAST against CDD database part I
| ID | Alignment Graph | Length |
Definition |
E-value |
| Query | 1456 | |||
| pfam13087 | 195 | pfam13087, AAA_12, AAA domain | 5e-31 | |
| COG1112 | 767 | COG1112, COG1112, Superfamily I DNA and RNA helica | 5e-23 | |
| TIGR00376 | 637 | TIGR00376, TIGR00376, DNA helicase, putative | 2e-19 | |
| pfam13086 | 220 | pfam13086, AAA_11, AAA domain | 2e-12 | |
| pfam13086 | 220 | pfam13086, AAA_11, AAA domain | 1e-06 | |
| pfam13245 | 73 | pfam13245, AAA_19, Part of AAA domain | 3e-04 |
| >gnl|CDD|221913 pfam13087, AAA_12, AAA domain | Back alignment and domain information |
|---|
Score = 120 bits (304), Expect = 5e-31
Identities = 61/199 (30%), Positives = 88/199 (44%), Gaps = 34/199 (17%)
Query: 1114 MDQSLFTRFVRLG-IPYIELNAQGRARPSIAQ---------------------LYNWRYR 1151
+D+SLF R G + L+ Q R P I++ L +
Sbjct: 1 LDRSLFERLQEAGPEAVVMLDTQYRMHPDISEFPSELFYGGKLKDGESVAERPLPWDFHL 60
Query: 1152 DLGDLPFL-VDVPDYNGRGESAPSPWFYQNEGEAEYVVSVYIYMRLLGYPAN-KISILTT 1209
P + +DV E + S Y NE EAE VV + + G N I I+T
Sbjct: 61 PDPLGPLVFIDVDGSEEEEEKSTS---YSNEAEAELVVQLVEKLLKSGPEKNKDIGIITP 117
Query: 1210 YNGQKLLIRDVINRQCVPYPFIGPPSKVTTVDKFQGQQNDFILLSLVRTR---FVGHLRD 1266
Y Q LI+ ++ R+ P I +V TVD FQG++ D I+ S VR+ +G L D
Sbjct: 118 YRAQVRLIKKLLKRKFGGEPDI----EVNTVDGFQGREKDVIIFSTVRSNEKGGIGFLSD 173
Query: 1267 VRRLVVAMSRARLGLYVFC 1285
RRL VA++RA+ GL +
Sbjct: 174 PRRLNVALTRAKRGLIIVG 192
|
This family of domains contain a P-loop motif that is characteristic of the AAA superfamily. Many of the proteins in this family are conjugative transfer proteins. Length = 195 |
| >gnl|CDD|224037 COG1112, COG1112, Superfamily I DNA and RNA helicases and helicase subunits [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|232945 TIGR00376, TIGR00376, DNA helicase, putative | Back alignment and domain information |
|---|
| >gnl|CDD|221912 pfam13086, AAA_11, AAA domain | Back alignment and domain information |
|---|
| >gnl|CDD|221912 pfam13086, AAA_11, AAA domain | Back alignment and domain information |
|---|
| >gnl|CDD|222005 pfam13245, AAA_19, Part of AAA domain | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch
Original result of HHsearch against CDD database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 1456 | |||
| KOG1806 | 1320 | consensus DEAD box containing helicases [Replicati | 100.0 | |
| KOG1806 | 1320 | consensus DEAD box containing helicases [Replicati | 100.0 | |
| KOG1802 | 935 | consensus RNA helicase nonsense mRNA reducing fact | 100.0 | |
| KOG1803 | 649 | consensus DNA helicase [Replication, recombination | 100.0 | |
| TIGR00376 | 637 | DNA helicase, putative. The gene product may repre | 100.0 | |
| KOG1807 | 1025 | consensus Helicases [Replication, recombination an | 100.0 | |
| KOG1805 | 1100 | consensus DNA replication helicase [Replication, r | 100.0 | |
| COG1112 | 767 | Superfamily I DNA and RNA helicases and helicase s | 100.0 | |
| PF13087 | 200 | AAA_12: AAA domain; PDB: 2XZO_A 2WJY_A 2WJV_A 2XZP | 99.97 | |
| KOG1801 | 827 | consensus tRNA-splicing endonuclease positive effe | 99.97 | |
| KOG1804 | 775 | consensus RNA helicase [RNA processing and modific | 99.96 | |
| PF13086 | 236 | AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV | 99.94 | |
| PRK11054 | 684 | helD DNA helicase IV; Provisional | 99.87 | |
| PRK11773 | 721 | uvrD DNA-dependent helicase II; Provisional | 99.85 | |
| TIGR01075 | 715 | uvrD DNA helicase II. Designed to identify uvrD me | 99.83 | |
| TIGR01073 | 726 | pcrA ATP-dependent DNA helicase PcrA. Designed to | 99.82 | |
| PRK10919 | 672 | ATP-dependent DNA helicase Rep; Provisional | 99.82 | |
| TIGR01448 | 720 | recD_rel helicase, putative, RecD/TraA family. Thi | 99.78 | |
| TIGR01447 | 586 | recD exodeoxyribonuclease V, alpha subunit. This f | 99.76 | |
| PRK10875 | 615 | recD exonuclease V subunit alpha; Provisional | 99.75 | |
| TIGR02768 | 744 | TraA_Ti Ti-type conjugative transfer relaxase TraA | 99.71 | |
| COG3973 | 747 | Superfamily I DNA and RNA helicases [General funct | 99.65 | |
| TIGR02785 | 1232 | addA_Gpos recombination helicase AddA, Firmicutes | 99.65 | |
| TIGR01074 | 664 | rep ATP-dependent DNA helicase Rep. Designed to id | 99.61 | |
| PRK13826 | 1102 | Dtr system oriT relaxase; Provisional | 99.59 | |
| TIGR00609 | 1087 | recB exodeoxyribonuclease V, beta subunit. All pro | 99.59 | |
| PRK13889 | 988 | conjugal transfer relaxase TraA; Provisional | 99.58 | |
| PRK13909 | 910 | putative recombination protein RecB; Provisional | 99.54 | |
| COG1074 | 1139 | RecB ATP-dependent exoDNAse (exonuclease V) beta s | 99.5 | |
| PRK10876 | 1181 | recB exonuclease V subunit beta; Provisional | 99.48 | |
| COG0210 | 655 | UvrD Superfamily I DNA and RNA helicases [DNA repl | 99.44 | |
| PF13604 | 196 | AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL | 99.42 | |
| TIGR02784 | 1141 | addA_alphas double-strand break repair helicase Ad | 99.36 | |
| PRK13709 | 1747 | conjugal transfer nickase/helicase TraI; Provision | 99.26 | |
| PRK14712 | 1623 | conjugal transfer nickase/helicase TraI; Provision | 99.25 | |
| PF13245 | 76 | AAA_19: Part of AAA domain | 99.17 | |
| PF00580 | 315 | UvrD-helicase: UvrD/REP helicase N-terminal domain | 99.15 | |
| PF09848 | 352 | DUF2075: Uncharacterized conserved protein (DUF207 | 99.12 | |
| PF01443 | 234 | Viral_helicase1: Viral (Superfamily 1) RNA helicas | 99.08 | |
| TIGR02760 | 1960 | TraI_TIGR conjugative transfer relaxase protein Tr | 99.03 | |
| COG0507 | 696 | RecD ATP-dependent exoDNAse (exonuclease V), alpha | 98.78 | |
| COG3972 | 660 | Superfamily I DNA and RNA helicases [General funct | 98.64 | |
| TIGR02760 | 1960 | TraI_TIGR conjugative transfer relaxase protein Tr | 98.51 | |
| PF13361 | 351 | UvrD_C: UvrD-like helicase C-terminal domain; PDB: | 98.42 | |
| KOG1804 | 775 | consensus RNA helicase [RNA processing and modific | 98.27 | |
| cd00046 | 144 | DEXDc DEAD-like helicases superfamily. A diverse f | 98.26 | |
| PF02562 | 205 | PhoH: PhoH-like protein; InterPro: IPR003714 PhoH | 98.23 | |
| PRK11192 | 434 | ATP-dependent RNA helicase SrmB; Provisional | 98.19 | |
| smart00487 | 201 | DEXDc DEAD-like helicases superfamily. | 98.15 | |
| PRK11776 | 460 | ATP-dependent RNA helicase DbpA; Provisional | 98.14 | |
| PRK11634 | 629 | ATP-dependent RNA helicase DeaD; Provisional | 98.06 | |
| PRK10536 | 262 | hypothetical protein; Provisional | 98.05 | |
| PRK10590 | 456 | ATP-dependent RNA helicase RhlE; Provisional | 98.04 | |
| PHA02558 | 501 | uvsW UvsW helicase; Provisional | 97.99 | |
| PTZ00424 | 401 | helicase 45; Provisional | 97.94 | |
| TIGR02773 | 1158 | addB_Gpos ATP-dependent nuclease subunit B. DNA re | 97.93 | |
| PF04851 | 184 | ResIII: Type III restriction enzyme, res subunit; | 97.92 | |
| COG1061 | 442 | SSL2 DNA or RNA helicases of superfamily II [Trans | 97.9 | |
| PRK04837 | 423 | ATP-dependent RNA helicase RhlB; Provisional | 97.82 | |
| PF00270 | 169 | DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 | 97.81 | |
| PF13538 | 104 | UvrD_C_2: UvrD-like helicase C-terminal domain; PD | 97.73 | |
| PRK05580 | 679 | primosome assembly protein PriA; Validated | 97.65 | |
| PRK04537 | 572 | ATP-dependent RNA helicase RhlB; Provisional | 97.62 | |
| PTZ00110 | 545 | helicase; Provisional | 97.6 | |
| PRK01172 | 674 | ski2-like helicase; Provisional | 97.58 | |
| PLN00206 | 518 | DEAD-box ATP-dependent RNA helicase; Provisional | 97.56 | |
| PRK13767 | 876 | ATP-dependent helicase; Provisional | 97.55 | |
| PF05970 | 364 | PIF1: PIF1-like helicase; InterPro: IPR010285 This | 97.52 | |
| PRK13766 | 773 | Hef nuclease; Provisional | 97.38 | |
| TIGR01054 | 1171 | rgy reverse gyrase. Generally, these gyrases are e | 97.37 | |
| PRK09401 | 1176 | reverse gyrase; Reviewed | 97.35 | |
| cd00268 | 203 | DEADc DEAD-box helicases. A diverse family of prot | 97.35 | |
| TIGR03117 | 636 | cas_csf4 CRISPR-associated DEAD/DEAH-box helicase | 97.33 | |
| PRK02362 | 737 | ski2-like helicase; Provisional | 97.33 | |
| TIGR00614 | 470 | recQ_fam ATP-dependent DNA helicase, RecQ family. | 97.31 | |
| PRK01297 | 475 | ATP-dependent RNA helicase RhlB; Provisional | 97.26 | |
| PRK11664 | 812 | ATP-dependent RNA helicase HrpB; Provisional | 97.23 | |
| PRK00254 | 720 | ski2-like helicase; Provisional | 97.23 | |
| COG1200 | 677 | RecG RecG-like helicase [DNA replication, recombin | 97.22 | |
| TIGR01970 | 819 | DEAH_box_HrpB ATP-dependent helicase HrpB. This mo | 97.2 | |
| TIGR03817 | 742 | DECH_helic helicase/secretion neighborhood putativ | 97.19 | |
| PRK14701 | 1638 | reverse gyrase; Provisional | 97.19 | |
| cd01124 | 187 | KaiC KaiC is a circadian clock protein primarily f | 97.18 | |
| PF02399 | 824 | Herpes_ori_bp: Origin of replication binding prote | 97.13 | |
| PRK05973 | 237 | replicative DNA helicase; Provisional | 96.87 | |
| KOG0354 | 746 | consensus DEAD-box like helicase [General function | 96.86 | |
| COG1111 | 542 | MPH1 ERCC4-like helicases [DNA replication, recomb | 96.85 | |
| PRK10917 | 681 | ATP-dependent DNA helicase RecG; Provisional | 96.85 | |
| COG0513 | 513 | SrmB Superfamily II DNA and RNA helicases [DNA rep | 96.83 | |
| TIGR00643 | 630 | recG ATP-dependent DNA helicase RecG. | 96.82 | |
| cd00009 | 151 | AAA The AAA+ (ATPases Associated with a wide varie | 96.82 | |
| PRK11057 | 607 | ATP-dependent DNA helicase RecQ; Provisional | 96.76 | |
| PF00448 | 196 | SRP54: SRP54-type protein, GTPase domain; InterPro | 96.72 | |
| PRK08074 | 928 | bifunctional ATP-dependent DNA helicase/DNA polyme | 96.68 | |
| TIGR01389 | 591 | recQ ATP-dependent DNA helicase RecQ. The ATP-depe | 96.67 | |
| PRK08181 | 269 | transposase; Validated | 96.64 | |
| PRK07952 | 244 | DNA replication protein DnaC; Validated | 96.57 | |
| TIGR01407 | 850 | dinG_rel DnaQ family exonuclease/DinG family helic | 96.56 | |
| COG4889 | 1518 | Predicted helicase [General function prediction on | 96.54 | |
| TIGR00603 | 732 | rad25 DNA repair helicase rad25. All proteins in t | 96.54 | |
| TIGR00595 | 505 | priA primosomal protein N'. All proteins in this f | 96.45 | |
| smart00382 | 148 | AAA ATPases associated with a variety of cellular | 96.41 | |
| PRK12377 | 248 | putative replication protein; Provisional | 96.4 | |
| PRK06526 | 254 | transposase; Provisional | 96.39 | |
| TIGR01967 | 1283 | DEAH_box_HrpA ATP-dependent helicase HrpA. This mo | 96.39 | |
| PF01695 | 178 | IstB_IS21: IstB-like ATP binding protein; InterPro | 96.38 | |
| PRK11448 | 1123 | hsdR type I restriction enzyme EcoKI subunit R; Pr | 96.37 | |
| TIGR00580 | 926 | mfd transcription-repair coupling factor (mfd). Al | 96.34 | |
| PRK13833 | 323 | conjugal transfer protein TrbB; Provisional | 96.31 | |
| TIGR03877 | 237 | thermo_KaiC_1 KaiC domain protein, Ph0284 family. | 96.3 | |
| PRK07246 | 820 | bifunctional ATP-dependent DNA helicase/DNA polyme | 96.29 | |
| PF06745 | 226 | KaiC: KaiC; InterPro: IPR014774 This entry represe | 96.28 | |
| TIGR02525 | 372 | plasmid_TraJ plasmid transfer ATPase TraJ. Members | 96.27 | |
| PRK08116 | 268 | hypothetical protein; Validated | 96.26 | |
| PRK08533 | 230 | flagellar accessory protein FlaH; Reviewed | 96.25 | |
| PRK14974 | 336 | cell division protein FtsY; Provisional | 96.18 | |
| PRK13894 | 319 | conjugal transfer ATPase TrbB; Provisional | 96.18 | |
| PRK10689 | 1147 | transcription-repair coupling factor; Provisional | 96.12 | |
| PF00176 | 299 | SNF2_N: SNF2 family N-terminal domain; InterPro: I | 96.11 | |
| TIGR03878 | 259 | thermo_KaiC_2 KaiC domain protein, AF_0795 family. | 96.08 | |
| COG1110 | 1187 | Reverse gyrase [DNA replication, recombination, an | 96.08 | |
| PRK06067 | 234 | flagellar accessory protein FlaH; Validated | 96.04 | |
| TIGR00064 | 272 | ftsY signal recognition particle-docking protein F | 96.02 | |
| PF13401 | 131 | AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S | 96.02 | |
| TIGR03880 | 224 | KaiC_arch_3 KaiC domain protein, AF_0351 family. T | 95.99 | |
| cd01120 | 165 | RecA-like_NTPases RecA-like NTPases. This family i | 95.97 | |
| PRK06893 | 229 | DNA replication initiation factor; Validated | 95.96 | |
| TIGR02782 | 299 | TrbB_P P-type conjugative transfer ATPase TrbB. Th | 95.95 | |
| KOG0922 | 674 | consensus DEAH-box RNA helicase [RNA processing an | 95.93 | |
| PRK00771 | 437 | signal recognition particle protein Srp54; Provisi | 95.93 | |
| COG1204 | 766 | Superfamily II helicase [General function predicti | 95.92 | |
| TIGR01650 | 327 | PD_CobS cobaltochelatase, CobS subunit. This model | 95.91 | |
| PRK14722 | 374 | flhF flagellar biosynthesis regulator FlhF; Provis | 95.88 | |
| PRK09361 | 225 | radB DNA repair and recombination protein RadB; Pr | 95.85 | |
| PRK09183 | 259 | transposase/IS protein; Provisional | 95.84 | |
| PRK11131 | 1294 | ATP-dependent RNA helicase HrpA; Provisional | 95.84 | |
| TIGR02655 | 484 | circ_KaiC circadian clock protein KaiC. Members of | 95.84 | |
| PRK08084 | 235 | DNA replication initiation factor; Provisional | 95.83 | |
| cd01129 | 264 | PulE-GspE PulE/GspE The type II secretory pathway | 95.83 | |
| cd00984 | 242 | DnaB_C DnaB helicase C terminal domain. The hexame | 95.83 | |
| PF00004 | 132 | AAA: ATPase family associated with various cellula | 95.82 | |
| TIGR00348 | 667 | hsdR type I site-specific deoxyribonuclease, HsdR | 95.79 | |
| PRK04328 | 249 | hypothetical protein; Provisional | 95.79 | |
| PF00308 | 219 | Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013 | 95.76 | |
| COG4098 | 441 | comFA Superfamily II DNA/RNA helicase required for | 95.76 | |
| TIGR01587 | 358 | cas3_core CRISPR-associated helicase Cas3. This mo | 95.75 | |
| PRK09694 | 878 | helicase Cas3; Provisional | 95.74 | |
| PRK10867 | 433 | signal recognition particle protein; Provisional | 95.74 | |
| PRK10416 | 318 | signal recognition particle-docking protein FtsY; | 95.73 | |
| COG1484 | 254 | DnaC DNA replication protein [DNA replication, rec | 95.7 | |
| TIGR03420 | 226 | DnaA_homol_Hda DnaA regulatory inactivator Hda. Me | 95.67 | |
| PRK08727 | 233 | hypothetical protein; Validated | 95.61 | |
| smart00489 | 289 | DEXDc3 DEAD-like helicases superfamily. | 95.6 | |
| smart00488 | 289 | DEXDc2 DEAD-like helicases superfamily. | 95.6 | |
| KOG0744 | 423 | consensus AAA+-type ATPase [Posttranslational modi | 95.6 | |
| TIGR00959 | 428 | ffh signal recognition particle protein. This mode | 95.58 | |
| PRK04296 | 190 | thymidine kinase; Provisional | 95.57 | |
| TIGR02237 | 209 | recomb_radB DNA repair and recombination protein R | 95.56 | |
| cd03115 | 173 | SRP The signal recognition particle (SRP) mediates | 95.55 | |
| TIGR01425 | 429 | SRP54_euk signal recognition particle protein SRP5 | 95.53 | |
| PRK06835 | 329 | DNA replication protein DnaC; Validated | 95.52 | |
| PF13191 | 185 | AAA_16: AAA ATPase domain; PDB: 2V1U_A. | 95.49 | |
| COG0467 | 260 | RAD55 RecA-superfamily ATPases implicated in signa | 95.49 | |
| PF13207 | 121 | AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6 | 95.48 | |
| COG0552 | 340 | FtsY Signal recognition particle GTPase [Intracell | 95.44 | |
| cd01394 | 218 | radB RadB. The archaeal protein radB shares simila | 95.41 | |
| PF13481 | 193 | AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C. | 95.4 | |
| TIGR03499 | 282 | FlhF flagellar biosynthetic protein FlhF. | 95.35 | |
| PF07652 | 148 | Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR | 95.34 | |
| TIGR02928 | 365 | orc1/cdc6 family replication initiation protein. M | 95.34 | |
| PRK12723 | 388 | flagellar biosynthesis regulator FlhF; Provisional | 95.32 | |
| COG1198 | 730 | PriA Primosomal protein N' (replication factor Y) | 95.31 | |
| PRK08903 | 227 | DnaA regulatory inactivator Hda; Validated | 95.28 | |
| TIGR02881 | 261 | spore_V_K stage V sporulation protein K. Members o | 95.27 | |
| TIGR03881 | 229 | KaiC_arch_4 KaiC domain protein, PAE1156 family. M | 95.24 | |
| PF07728 | 139 | AAA_5: AAA domain (dynein-related subfamily); Inte | 95.23 | |
| PRK11889 | 436 | flhF flagellar biosynthesis regulator FlhF; Provis | 95.19 | |
| KOG0989 | 346 | consensus Replication factor C, subunit RFC4 [Repl | 95.17 | |
| TIGR02524 | 358 | dot_icm_DotB Dot/Icm secretion system ATPase DotB. | 95.16 | |
| COG2805 | 353 | PilT Tfp pilus assembly protein, pilus retraction | 95.14 | |
| PF13671 | 143 | AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1 | 95.14 | |
| PF05729 | 166 | NACHT: NACHT domain | 95.14 | |
| KOG2108 | 853 | consensus 3'-5' DNA helicase [Replication, recombi | 95.12 | |
| cd01131 | 198 | PilT Pilus retraction ATPase PilT. PilT is a nucle | 95.1 | |
| TIGR02012 | 321 | tigrfam_recA protein RecA. This model describes or | 95.1 | |
| TIGR02533 | 486 | type_II_gspE general secretory pathway protein E. | 95.1 | |
| PF13173 | 128 | AAA_14: AAA domain | 95.08 | |
| TIGR02655 | 484 | circ_KaiC circadian clock protein KaiC. Members of | 95.08 | |
| COG1643 | 845 | HrpA HrpA-like helicases [DNA replication, recombi | 95.08 | |
| PRK10436 | 462 | hypothetical protein; Provisional | 95.07 | |
| PRK05703 | 424 | flhF flagellar biosynthesis regulator FlhF; Valida | 95.05 | |
| COG2256 | 436 | MGS1 ATPase related to the helicase subunit of the | 95.05 | |
| PF05496 | 233 | RuvB_N: Holliday junction DNA helicase ruvB N-term | 95.04 | |
| PLN03025 | 319 | replication factor C subunit; Provisional | 95.01 | |
| TIGR00604 | 705 | rad3 DNA repair helicase (rad3). All proteins in t | 94.97 | |
| COG4096 | 875 | HsdR Type I site-specific restriction-modification | 94.97 | |
| PRK00149 | 450 | dnaA chromosomal replication initiation protein; R | 94.96 | |
| PRK14088 | 440 | dnaA chromosomal replication initiation protein; P | 94.93 | |
| PRK12899 | 970 | secA preprotein translocase subunit SecA; Reviewed | 94.92 | |
| PRK00411 | 394 | cdc6 cell division control protein 6; Reviewed | 94.91 | |
| PRK11823 | 446 | DNA repair protein RadA; Provisional | 94.87 | |
| TIGR01074 | 664 | rep ATP-dependent DNA helicase Rep. Designed to id | 94.85 | |
| cd00983 | 325 | recA RecA is a bacterial enzyme which has roles in | 94.8 | |
| TIGR02538 | 564 | type_IV_pilB type IV-A pilus assembly ATPase PilB. | 94.79 | |
| KOG0342 | 543 | consensus ATP-dependent RNA helicase pitchoune [RN | 94.77 | |
| TIGR02640 | 262 | gas_vesic_GvpN gas vesicle protein GvpN. Members o | 94.76 | |
| PRK12402 | 337 | replication factor C small subunit 2; Reviewed | 94.76 | |
| PRK06851 | 367 | hypothetical protein; Provisional | 94.75 | |
| cd01121 | 372 | Sms Sms (bacterial radA) DNA repair protein. This | 94.72 | |
| KOG0991 | 333 | consensus Replication factor C, subunit RFC2 [Repl | 94.72 | |
| TIGR00362 | 405 | DnaA chromosomal replication initiator protein Dna | 94.72 | |
| PRK11331 | 459 | 5-methylcytosine-specific restriction enzyme subun | 94.71 | |
| PHA00729 | 226 | NTP-binding motif containing protein | 94.7 | |
| PRK05642 | 234 | DNA replication initiation factor; Validated | 94.69 | |
| TIGR00416 | 454 | sms DNA repair protein RadA. The gene protuct code | 94.63 | |
| PHA03368 | 738 | DNA packaging terminase subunit 1; Provisional | 94.61 | |
| cd01122 | 271 | GP4d_helicase GP4d_helicase is a homohexameric 5'- | 94.59 | |
| cd01130 | 186 | VirB11-like_ATPase Type IV secretory pathway compo | 94.57 | |
| PRK09302 | 509 | circadian clock protein KaiC; Reviewed | 94.57 | |
| KOG0345 | 567 | consensus ATP-dependent RNA helicase [RNA processi | 94.57 | |
| PRK08939 | 306 | primosomal protein DnaI; Reviewed | 94.54 | |
| PRK12726 | 407 | flagellar biosynthesis regulator FlhF; Provisional | 94.5 | |
| COG0556 | 663 | UvrB Helicase subunit of the DNA excision repair c | 94.5 | |
| TIGR02880 | 284 | cbbX_cfxQ probable Rubsico expression protein CbbX | 94.48 | |
| PHA02653 | 675 | RNA helicase NPH-II; Provisional | 94.46 | |
| TIGR03015 | 269 | pepcterm_ATPase putative secretion ATPase, PEP-CTE | 94.37 | |
| COG2804 | 500 | PulE Type II secretory pathway, ATPase PulE/Tfp pi | 94.35 | |
| KOG0743 | 457 | consensus AAA+-type ATPase [Posttranslational modi | 94.35 | |
| PRK04914 | 956 | ATP-dependent helicase HepA; Validated | 94.34 | |
| PRK06921 | 266 | hypothetical protein; Provisional | 94.32 | |
| PF13238 | 129 | AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB | 94.19 | |
| TIGR00635 | 305 | ruvB Holliday junction DNA helicase, RuvB subunit. | 94.15 | |
| PRK12608 | 380 | transcription termination factor Rho; Provisional | 94.14 | |
| PRK14087 | 450 | dnaA chromosomal replication initiation protein; P | 94.08 | |
| PTZ00301 | 210 | uridine kinase; Provisional | 94.05 | |
| cd02019 | 69 | NK Nucleoside/nucleotide kinase (NK) is a protein | 94.05 | |
| PRK09354 | 349 | recA recombinase A; Provisional | 94.05 | |
| PRK12724 | 432 | flagellar biosynthesis regulator FlhF; Provisional | 94.04 | |
| PRK09302 | 509 | circadian clock protein KaiC; Reviewed | 93.98 | |
| TIGR03158 | 357 | cas3_cyano CRISPR-associated helicase, Cyano-type. | 93.97 | |
| COG1702 | 348 | PhoH Phosphate starvation-inducible protein PhoH, | 93.93 | |
| PRK13768 | 253 | GTPase; Provisional | 93.93 | |
| cd01393 | 226 | recA_like RecA is a bacterial enzyme which has rol | 93.91 | |
| TIGR01359 | 183 | UMP_CMP_kin_fam UMP-CMP kinase family. This subfam | 93.9 | |
| KOG2028 | 554 | consensus ATPase related to the helicase subunit o | 93.88 | |
| PF02492 | 178 | cobW: CobW/HypB/UreG, nucleotide-binding domain; I | 93.79 | |
| PF03205 | 140 | MobB: Molybdopterin guanine dinucleotide synthesis | 93.78 | |
| CHL00181 | 287 | cbbX CbbX; Provisional | 93.78 | |
| PRK12727 | 559 | flagellar biosynthesis regulator FlhF; Provisional | 93.71 | |
| PF00437 | 270 | T2SE: Type II/IV secretion system protein; InterPr | 93.69 | |
| PRK04195 | 482 | replication factor C large subunit; Provisional | 93.68 | |
| COG1102 | 179 | Cmk Cytidylate kinase [Nucleotide transport and me | 93.67 | |
| PRK08233 | 182 | hypothetical protein; Provisional | 93.65 | |
| PRK06995 | 484 | flhF flagellar biosynthesis regulator FlhF; Valida | 93.64 | |
| PRK00440 | 319 | rfc replication factor C small subunit; Reviewed | 93.59 | |
| PRK13342 | 413 | recombination factor protein RarA; Reviewed | 93.54 | |
| PRK08118 | 167 | topology modulation protein; Reviewed | 93.5 | |
| cd01983 | 99 | Fer4_NifH The Fer4_NifH superfamily contains a var | 93.49 | |
| PRK14962 | 472 | DNA polymerase III subunits gamma and tau; Provisi | 93.49 | |
| TIGR01360 | 188 | aden_kin_iso1 adenylate kinase, isozyme 1 subfamil | 93.48 | |
| PF00910 | 107 | RNA_helicase: RNA helicase; InterPro: IPR000605 He | 93.48 | |
| COG5192 | 1077 | BMS1 GTP-binding protein required for 40S ribosome | 93.44 | |
| COG1224 | 450 | TIP49 DNA helicase TIP49, TBP-interacting protein | 93.42 | |
| cd01123 | 235 | Rad51_DMC1_radA Rad51_DMC1_radA,B. This group of r | 93.41 | |
| PRK00080 | 328 | ruvB Holliday junction DNA helicase RuvB; Reviewed | 93.37 | |
| KOG0923 | 902 | consensus mRNA splicing factor ATP-dependent RNA h | 93.36 | |
| COG3854 | 308 | SpoIIIAA ncharacterized protein conserved in bacte | 93.35 | |
| COG1474 | 366 | CDC6 Cdc6-related protein, AAA superfamily ATPase | 93.33 | |
| PHA02544 | 316 | 44 clamp loader, small subunit; Provisional | 93.27 | |
| PRK03992 | 389 | proteasome-activating nucleotidase; Provisional | 93.26 | |
| cd01125 | 239 | repA Hexameric Replicative Helicase RepA. RepA is | 93.24 | |
| PRK13531 | 498 | regulatory ATPase RavA; Provisional | 93.23 | |
| TIGR03689 | 512 | pup_AAA proteasome ATPase. In the Actinobacteria, | 93.21 | |
| TIGR01242 | 364 | 26Sp45 26S proteasome subunit P45 family. Many pro | 93.13 | |
| TIGR01420 | 343 | pilT_fam pilus retraction protein PilT. This model | 93.08 | |
| PRK06762 | 166 | hypothetical protein; Provisional | 93.07 | |
| cd00544 | 169 | CobU Adenosylcobinamide kinase / adenosylcobinamid | 93.06 | |
| smart00763 | 361 | AAA_PrkA PrkA AAA domain. This is a family of PrkA | 93.04 | |
| cd02021 | 150 | GntK Gluconate kinase (GntK) catalyzes the phospho | 93.03 | |
| TIGR00750 | 300 | lao LAO/AO transport system ATPase. Mutations have | 92.98 | |
| TIGR03600 | 421 | phage_DnaB phage replicative helicase, DnaB family | 92.95 | |
| PRK12422 | 445 | chromosomal replication initiation protein; Provis | 92.93 | |
| PF04665 | 241 | Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 | 92.91 | |
| PF12846 | 304 | AAA_10: AAA-like domain | 92.91 | |
| PRK00131 | 175 | aroK shikimate kinase; Reviewed | 92.89 | |
| KOG0731 | 774 | consensus AAA+-type ATPase containing the peptidas | 92.89 | |
| PRK04301 | 317 | radA DNA repair and recombination protein RadA; Va | 92.89 | |
| ) proteins. It has been suggested that torsins play a role in effectively managing protein folding and that possible breakdown in a neuroprotective mechanism that is, in part, mediated by torsins may be responsible for the neuronal dysfunction associated with dystonia [].; GO: 0005524 ATP binding, 0051085 chaperone mediated protein folding requiring cofactor" target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=PF06309">PF06309 | 127 | Torsin: Torsin; InterPro: IPR010448 This family co | 92.86 | |
| PRK05541 | 176 | adenylylsulfate kinase; Provisional | 92.79 | |
| PLN03142 | 1033 | Probable chromatin-remodeling complex ATPase chain | 92.77 | |
| TIGR00176 | 155 | mobB molybdopterin-guanine dinucleotide biosynthes | 92.77 | |
| PRK14530 | 215 | adenylate kinase; Provisional | 92.73 | |
| PRK14086 | 617 | dnaA chromosomal replication initiation protein; P | 92.72 | |
| PRK14963 | 504 | DNA polymerase III subunits gamma and tau; Provisi | 92.67 | |
| PTZ00361 | 438 | 26 proteosome regulatory subunit 4-like protein; P | 92.64 | |
| PRK10751 | 173 | molybdopterin-guanine dinucleotide biosynthesis pr | 92.61 | |
| PF01078 | 206 | Mg_chelatase: Magnesium chelatase, subunit ChlI; I | 92.57 | |
| PTZ00112 | 1164 | origin recognition complex 1 protein; Provisional | 92.49 | |
| PRK03839 | 180 | putative kinase; Provisional | 92.46 | |
| cd02020 | 147 | CMPK Cytidine monophosphate kinase (CMPK) catalyze | 92.45 | |
| PF03029 | 238 | ATP_bind_1: Conserved hypothetical ATP binding pro | 92.43 | |
| TIGR03574 | 249 | selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal. Mem | 92.41 | |
| COG0714 | 329 | MoxR-like ATPases [General function prediction onl | 92.4 | |
| PF00931 | 287 | NB-ARC: NB-ARC domain; InterPro: IPR002182 This is | 92.4 | |
| PRK14527 | 191 | adenylate kinase; Provisional | 92.38 | |
| cd03114 | 148 | ArgK-like The function of this protein family is u | 92.38 | |
| cd02025 | 220 | PanK Pantothenate kinase (PanK) catalyzes the phos | 92.37 | |
| TIGR00665 | 434 | DnaB replicative DNA helicase. This model describe | 92.33 | |
| PRK14723 | 767 | flhF flagellar biosynthesis regulator FlhF; Provis | 92.33 | |
| PRK07261 | 171 | topology modulation protein; Provisional | 92.32 | |
| PF13555 | 62 | AAA_29: P-loop containing region of AAA domain | 92.31 | |
| PRK14961 | 363 | DNA polymerase III subunits gamma and tau; Provisi | 92.29 | |
| cd02028 | 179 | UMPK_like Uridine monophosphate kinase_like (UMPK_ | 92.28 | |
| cd02023 | 198 | UMPK Uridine monophosphate kinase (UMPK, EC 2.7.1. | 92.27 | |
| PRK06851 | 367 | hypothetical protein; Provisional | 92.27 | |
| KOG0333 | 673 | consensus U5 snRNP-like RNA helicase subunit [RNA | 92.26 | |
| KOG4284 | 980 | consensus DEAD box protein [Transcription] | 92.23 | |
| PRK06620 | 214 | hypothetical protein; Validated | 92.22 | |
| PHA02244 | 383 | ATPase-like protein | 92.22 | |
| PRK00889 | 175 | adenylylsulfate kinase; Provisional | 92.22 | |
| PF00406 | 151 | ADK: Adenylate kinase; InterPro: IPR000850 Adenyla | 92.17 | |
| COG1419 | 407 | FlhF Flagellar GTP-binding protein [Cell motility | 92.15 | |
| TIGR02236 | 310 | recomb_radA DNA repair and recombination protein R | 92.11 | |
| KOG0952 | 1230 | consensus DNA/RNA helicase MER3/SLH1, DEAD-box sup | 92.11 | |
| PLN00020 | 413 | ribulose bisphosphate carboxylase/oxygenase activa | 92.08 | |
| PRK05480 | 209 | uridine/cytidine kinase; Provisional | 92.05 | |
| PRK08506 | 472 | replicative DNA helicase; Provisional | 91.98 | |
| TIGR01313 | 163 | therm_gnt_kin carbohydrate kinase, thermoresistant | 91.97 | |
| cd01428 | 194 | ADK Adenylate kinase (ADK) catalyzes the reversibl | 91.96 | |
| PRK14532 | 188 | adenylate kinase; Provisional | 91.95 | |
| PRK14531 | 183 | adenylate kinase; Provisional | 91.92 | |
| PRK04040 | 188 | adenylate kinase; Provisional | 91.91 | |
| PRK06696 | 223 | uridine kinase; Validated | 91.88 | |
| KOG0727 | 408 | consensus 26S proteasome regulatory complex, ATPas | 91.88 | |
| PLN02200 | 234 | adenylate kinase family protein | 91.87 | |
| PHA02542 | 473 | 41 41 helicase; Provisional | 91.84 | |
| PRK13341 | 725 | recombination factor protein RarA/unknown domain f | 91.77 | |
| PRK14956 | 484 | DNA polymerase III subunits gamma and tau; Provisi | 91.77 | |
| PF03308 | 266 | ArgK: ArgK protein; InterPro: IPR005129 Bacterial | 91.74 | |
| PF07726 | 131 | AAA_3: ATPase family associated with various cellu | 91.71 | |
| PF03266 | 168 | NTPase_1: NTPase; InterPro: IPR004948 This entry r | 91.69 | |
| TIGR02322 | 179 | phosphon_PhnN phosphonate metabolism protein/1,5-b | 91.68 | |
| PRK11747 | 697 | dinG ATP-dependent DNA helicase DinG; Provisional | 91.62 | |
| KOG1533 | 290 | consensus Predicted GTPase [General function predi | 91.57 | |
| PRK09165 | 497 | replicative DNA helicase; Provisional | 91.57 | |
| PRK13900 | 332 | type IV secretion system ATPase VirB11; Provisiona | 91.55 | |
| PTZ00454 | 398 | 26S protease regulatory subunit 6B-like protein; P | 91.53 | |
| TIGR00041 | 195 | DTMP_kinase thymidylate kinase. Function: phosphor | 91.51 | |
| cd00227 | 175 | CPT Chloramphenicol (Cm) phosphotransferase (CPT). | 91.5 | |
| KOG0738 | 491 | consensus AAA+-type ATPase [Posttranslational modi | 91.48 | |
| PRK09376 | 416 | rho transcription termination factor Rho; Provisio | 91.45 | |
| PF13476 | 202 | AAA_23: AAA domain; PDB: 3AV0_B 3AUY_B 3AUX_A 2O5V | 91.43 | |
| PRK06645 | 507 | DNA polymerase III subunits gamma and tau; Validat | 91.43 | |
| PRK13851 | 344 | type IV secretion system protein VirB11; Provision | 91.42 | |
| PRK12678 | 672 | transcription termination factor Rho; Provisional | 91.42 | |
| TIGR00631 | 655 | uvrb excinuclease ABC, B subunit. This family is b | 91.4 | |
| PRK07667 | 193 | uridine kinase; Provisional | 91.38 | |
| PRK05439 | 311 | pantothenate kinase; Provisional | 91.38 | |
| PRK02496 | 184 | adk adenylate kinase; Provisional | 91.35 | |
| KOG0651 | 388 | consensus 26S proteasome regulatory complex, ATPas | 91.35 | |
| cd02027 | 149 | APSK Adenosine 5'-phosphosulfate kinase (APSK) cat | 91.34 | |
| PLN03187 | 344 | meiotic recombination protein DMC1 homolog; Provis | 91.34 | |
| KOG0733 | 802 | consensus Nuclear AAA ATPase (VCP subfamily) [Post | 91.33 | |
| COG0541 | 451 | Ffh Signal recognition particle GTPase [Intracellu | 91.3 | |
| PRK09435 | 332 | membrane ATPase/protein kinase; Provisional | 91.28 | |
| PRK13764 | 602 | ATPase; Provisional | 91.26 | |
| PF03215 | 519 | Rad17: Rad17 cell cycle checkpoint protein | 91.25 | |
| PRK05748 | 448 | replicative DNA helicase; Provisional | 91.22 | |
| COG0563 | 178 | Adk Adenylate kinase and related kinases [Nucleoti | 91.19 | |
| PF13521 | 163 | AAA_28: AAA domain; PDB: 1LW7_A. | 91.17 | |
| COG4088 | 261 | Predicted nucleotide kinase [Nucleotide transport | 91.14 | |
| PRK14528 | 186 | adenylate kinase; Provisional | 91.13 | |
| PF03796 | 259 | DnaB_C: DnaB-like helicase C terminal domain; Inte | 91.11 | |
| TIGR02238 | 313 | recomb_DMC1 meiotic recombinase Dmc1. This model d | 91.0 | |
| PF06068 | 398 | TIP49: TIP49 C-terminus; InterPro: IPR010339 This | 90.98 | |
| CHL00195 | 489 | ycf46 Ycf46; Provisional | 90.98 | |
| PRK13947 | 171 | shikimate kinase; Provisional | 90.94 | |
| cd02034 | 116 | CooC The accessory protein CooC, which contains a | 90.93 | |
| COG1222 | 406 | RPT1 ATP-dependent 26S proteasome regulatory subun | 90.88 | |
| PF00485 | 194 | PRK: Phosphoribulokinase / Uridine kinase family; | 90.84 | |
| COG2255 | 332 | RuvB Holliday junction resolvasome, helicase subun | 90.81 | |
| PF05673 | 249 | DUF815: Protein of unknown function (DUF815); Inte | 90.8 | |
| cd00464 | 154 | SK Shikimate kinase (SK) is the fifth enzyme in th | 90.78 | |
| PRK14955 | 397 | DNA polymerase III subunits gamma and tau; Provisi | 90.74 | |
| PRK09751 | 1490 | putative ATP-dependent helicase Lhr; Provisional | 90.72 | |
| PRK05800 | 170 | cobU adenosylcobinamide kinase/adenosylcobinamide- | 90.71 | |
| PRK14957 | 546 | DNA polymerase III subunits gamma and tau; Provisi | 90.7 | |
| COG1618 | 179 | Predicted nucleotide kinase [Nucleotide transport | 90.7 | |
| TIGR01351 | 210 | adk adenylate kinases. Adenylate kinase (EC 2.7.4. | 90.67 | |
| PRK08760 | 476 | replicative DNA helicase; Provisional | 90.66 | |
| PF08433 | 270 | KTI12: Chromatin associated protein KTI12 ; InterP | 90.65 | |
| COG1936 | 180 | Predicted nucleotide kinase (related to CMP and AM | 90.65 | |
| COG0593 | 408 | DnaA ATPase involved in DNA replication initiation | 90.64 | |
| cd00550 | 254 | ArsA_ATPase Oxyanion-translocating ATPase (ArsA). | 90.6 | |
| PRK05896 | 605 | DNA polymerase III subunits gamma and tau; Validat | 90.54 | |
| COG4581 | 1041 | Superfamily II RNA helicase [DNA replication, reco | 90.54 | |
| KOG0733 | 802 | consensus Nuclear AAA ATPase (VCP subfamily) [Post | 90.42 | |
| PRK00279 | 215 | adk adenylate kinase; Reviewed | 90.4 | |
| TIGR00455 | 184 | apsK adenylylsulfate kinase (apsK). Important resi | 90.34 | |
| COG0378 | 202 | HypB Ni2+-binding GTPase involved in regulation of | 90.33 | |
| KOG1970 | 634 | consensus Checkpoint RAD17-RFC complex, RAD17/RAD2 | 90.33 | |
| COG1201 | 814 | Lhr Lhr-like helicases [General function predictio | 90.32 | |
| TIGR00554 | 290 | panK_bact pantothenate kinase, bacterial type. Sho | 90.3 | |
| PF06414 | 199 | Zeta_toxin: Zeta toxin; InterPro: IPR010488 This e | 90.27 | |
| TIGR00150 | 133 | HI0065_YjeE ATPase, YjeE family. Members of this f | 90.25 | |
| PHA02530 | 300 | pseT polynucleotide kinase; Provisional | 90.25 | |
| TIGR02397 | 355 | dnaX_nterm DNA polymerase III, subunit gamma and t | 90.24 | |
| PRK05595 | 444 | replicative DNA helicase; Provisional | 90.23 | |
| cd01672 | 200 | TMPK Thymidine monophosphate kinase (TMPK), also k | 90.21 | |
| TIGR00678 | 188 | holB DNA polymerase III, delta' subunit. At positi | 90.2 | |
| PHA02624 | 647 | large T antigen; Provisional | 90.19 | |
| PRK05298 | 652 | excinuclease ABC subunit B; Provisional | 90.19 | |
| PRK06547 | 172 | hypothetical protein; Provisional | 90.19 | |
| TIGR02621 | 844 | cas3_GSU0051 CRISPR-associated helicase Cas3, Anae | 90.16 | |
| TIGR01241 | 495 | FtsH_fam ATP-dependent metalloprotease FtsH. HflB( | 90.08 | |
| COG1223 | 368 | Predicted ATPase (AAA+ superfamily) [General funct | 90.03 | |
| COG0210 | 655 | UvrD Superfamily I DNA and RNA helicases [DNA repl | 90.02 | |
| PTZ00088 | 229 | adenylate kinase 1; Provisional | 89.92 | |
| PRK14960 | 702 | DNA polymerase III subunits gamma and tau; Provisi | 89.89 | |
| TIGR00767 | 415 | rho transcription termination factor Rho. Members | 89.85 | |
| PRK14949 | 944 | DNA polymerase III subunits gamma and tau; Provisi | 89.78 | |
| PRK14721 | 420 | flhF flagellar biosynthesis regulator FlhF; Provis | 89.76 | |
| PLN02165 | 334 | adenylate isopentenyltransferase | 89.74 | |
| PRK06217 | 183 | hypothetical protein; Validated | 89.7 | |
| COG0470 | 325 | HolB ATPase involved in DNA replication [DNA repli | 89.64 | |
| PRK03846 | 198 | adenylylsulfate kinase; Provisional | 89.52 | |
| PRK14964 | 491 | DNA polymerase III subunits gamma and tau; Provisi | 89.48 | |
| cd02035 | 217 | ArsA ArsA ATPase functionas as an efflux pump loca | 89.45 | |
| KOG3347 | 176 | consensus Predicted nucleotide kinase/nuclear prot | 89.44 | |
| KOG0735 | 952 | consensus AAA+-type ATPase [Posttranslational modi | 89.28 | |
| PLN03137 | 1195 | ATP-dependent DNA helicase; Q4-like; Provisional | 89.25 | |
| PRK14489 | 366 | putative bifunctional molybdopterin-guanine dinucl | 89.24 | |
| TIGR00708 | 173 | cobA cob(I)alamin adenosyltransferase. Alternate n | 89.24 | |
| TIGR00764 | 608 | lon_rel lon-related putative ATP-dependent proteas | 89.22 | |
| cd03116 | 159 | MobB Molybdenum is an essential trace element in t | 89.19 | |
| KOG1942 | 456 | consensus DNA helicase, TBP-interacting protein [R | 89.19 | |
| COG1199 | 654 | DinG Rad3-related DNA helicases [Transcription / D | 89.18 | |
| PRK09519 | 790 | recA DNA recombination protein RecA; Reviewed | 89.18 | |
| PRK13407 | 334 | bchI magnesium chelatase subunit I; Provisional | 89.17 | |
| PRK10865 | 857 | protein disaggregation chaperone; Provisional | 89.16 | |
| PRK14493 | 274 | putative bifunctional molybdopterin-guanine dinucl | 89.13 | |
| COG1703 | 323 | ArgK Putative periplasmic protein kinase ArgK and | 89.1 | |
| PRK06761 | 282 | hypothetical protein; Provisional | 89.08 | |
| PF12775 | 272 | AAA_7: P-loop containing dynein motor region D3; P | 89.08 | |
| PRK13949 | 169 | shikimate kinase; Provisional | 89.08 | |
| PRK12339 | 197 | 2-phosphoglycerate kinase; Provisional | 89.06 | |
| PF01583 | 156 | APS_kinase: Adenylylsulphate kinase; InterPro: IPR | 89.03 | |
| PRK00625 | 173 | shikimate kinase; Provisional | 89.0 | |
| PRK01184 | 184 | hypothetical protein; Provisional | 88.99 | |
| PRK14970 | 367 | DNA polymerase III subunits gamma and tau; Provisi | 88.99 | |
| cd01128 | 249 | rho_factor Transcription termination factor rho is | 88.96 | |
| TIGR01618 | 220 | phage_P_loop phage nucleotide-binding protein. Thi | 88.94 | |
| PRK14958 | 509 | DNA polymerase III subunits gamma and tau; Provisi | 88.93 | |
| PRK05342 | 412 | clpX ATP-dependent protease ATP-binding subunit Cl | 88.8 | |
| PHA03372 | 668 | DNA packaging terminase subunit 1; Provisional | 88.8 | |
| cd02037 | 169 | MRP-like MRP (Multiple Resistance and pH adaptatio | 88.8 | |
| PRK14494 | 229 | putative molybdopterin-guanine dinucleotide biosyn | 88.74 | |
| TIGR03263 | 180 | guanyl_kin guanylate kinase. Members of this famil | 88.71 | |
| COG0606 | 490 | Predicted ATPase with chaperone activity [Posttran | 88.7 | |
| PF02374 | 305 | ArsA_ATPase: Anion-transporting ATPase; PDB: 2WOO_ | 88.58 | |
| PRK14952 | 584 | DNA polymerase III subunits gamma and tau; Provisi | 88.55 | |
| PRK00698 | 205 | tmk thymidylate kinase; Validated | 88.54 | |
| PRK14738 | 206 | gmk guanylate kinase; Provisional | 88.53 | |
| KOG0335 | 482 | consensus ATP-dependent RNA helicase [RNA processi | 88.47 | |
| PRK09087 | 226 | hypothetical protein; Validated | 88.39 | |
| PRK08356 | 195 | hypothetical protein; Provisional | 88.39 | |
| cd02024 | 187 | NRK1 Nicotinamide riboside kinase (NRK) is an enzy | 88.37 | |
| KOG0734 | 752 | consensus AAA+-type ATPase containing the peptidas | 88.3 | |
| TIGR00235 | 207 | udk uridine kinase. Model contains a number of lon | 88.27 | |
| COG0464 | 494 | SpoVK ATPases of the AAA+ class [Posttranslational | 88.24 | |
| cd02117 | 212 | NifH_like This family contains the NifH (iron prot | 88.22 | |
| PRK05986 | 191 | cob(I)alamin adenolsyltransferase/cobinamide ATP-d | 88.19 | |
| PRK14737 | 186 | gmk guanylate kinase; Provisional | 88.17 | |
| PRK08154 | 309 | anaerobic benzoate catabolism transcriptional regu | 88.14 | |
| KOG0948 | 1041 | consensus Nuclear exosomal RNA helicase MTR4, DEAD | 88.13 | |
| PHA02774 | 613 | E1; Provisional | 88.1 | |
| PRK14526 | 211 | adenylate kinase; Provisional | 88.1 | |
| PRK10078 | 186 | ribose 1,5-bisphosphokinase; Provisional | 88.1 | |
| PRK00300 | 205 | gmk guanylate kinase; Provisional | 88.09 | |
| cd00561 | 159 | CobA_CobO_BtuR ATP:corrinoid adenosyltransferase B | 88.03 | |
| PF13479 | 213 | AAA_24: AAA domain | 87.97 | |
| COG0466 | 782 | Lon ATP-dependent Lon protease, bacterial type [Po | 87.94 | |
| PRK13975 | 196 | thymidylate kinase; Provisional | 87.77 | |
| PRK15453 | 290 | phosphoribulokinase; Provisional | 87.77 | |
| PRK14529 | 223 | adenylate kinase; Provisional | 87.76 | |
| TIGR02688 | 449 | conserved hypothetical protein TIGR02688. Members | 87.75 | |
| TIGR00382 | 413 | clpX endopeptidase Clp ATP-binding regulatory subu | 87.75 | |
| cd00071 | 137 | GMPK Guanosine monophosphate kinase (GMPK, EC 2.7. | 87.7 | |
| TIGR03819 | 340 | heli_sec_ATPase helicase/secretion neighborhood AT | 87.65 | |
| TIGR03575 | 340 | selen_PSTK_euk L-seryl-tRNA(Sec) kinase, eukaryoti | 87.61 | |
| CHL00176 | 638 | ftsH cell division protein; Validated | 87.61 | |
| PRK14969 | 527 | DNA polymerase III subunits gamma and tau; Provisi | 87.6 | |
| PRK13765 | 637 | ATP-dependent protease Lon; Provisional | 87.59 | |
| PRK14954 | 620 | DNA polymerase III subunits gamma and tau; Provisi | 87.38 | |
| cd03112 | 158 | CobW_like The function of this protein family is u | 87.36 | |
| PF05127 | 177 | Helicase_RecD: Helicase; InterPro: IPR007807 This | 87.35 | |
| PLN02674 | 244 | adenylate kinase | 87.35 | |
| PRK09825 | 176 | idnK D-gluconate kinase; Provisional | 87.31 | |
| PTZ00035 | 337 | Rad51 protein; Provisional | 87.22 | |
| KOG0742 | 630 | consensus AAA+-type ATPase [Posttranslational modi | 87.2 |
| >KOG1806 consensus DEAD box containing helicases [Replication, recombination and repair] | Back alignment and domain information |
|---|
Probab=100.00 E-value=1.2e-229 Score=2044.26 Aligned_cols=1223 Identities=55% Similarity=0.864 Sum_probs=1152.6
Q ss_pred ChHhhhhchhhhHHhhccCCC-CCCCCHHHHHHHHHHHhhhcccCCCCCcchhhhHhhhhhhhhhcCCCCCccccchhhH
Q 000509 46 TLSEIQRDRLTKIASENWLKT-EKPFDAELVKEIYRTELTVKEGRKTVPLHRVMILEVSQYLENYLWPNFDAETASFEHV 124 (1456)
Q Consensus 46 t~~~~~~d~~~~la~~~W~~~-~~~~~~~vv~~i~~~~l~~~~~~~~f~~~~~~~Le~sqyLE~yLWp~f~~~~as~~hv 124 (1456)
|+++|+.+++|++|.++|.++ .+|||++||++||+.|+.+ +. +.+++|+||+||||||||||||+++.| .+||
T Consensus 1 ~l~~~~~~~~~~~a~~~w~~~~~~~f~~~~~~~i~~~~i~~----~~-~~q~~~ll~~~q~~en~lw~~~~~e~s-~~~~ 74 (1320)
T KOG1806|consen 1 TLSKIKKKQITNYANSNWGQNEGVPFDETVLQCIYEAEIVS----KD-AKQVLMLLEESQYLENYLWQNVNPEMS-LNHI 74 (1320)
T ss_pred ChhhHHHHHHHHHHHhhcccCCCCCCCHHHHHHHHHHHhhc----cc-HHHHHHHHHHHHHHHHhhhccCCHHHH-HHHH
Confidence 789999999999999999998 9999999999999999993 22 779999999999999999999999966 8999
Q ss_pred HHHHHhhhhc----------------------------------------------ccchHHHHHHHhhccccccccCCC
Q 000509 125 MSMILMVNEK----------------------------------------------SLEDEIVSKTVLRLASLQSWHSLS 158 (1456)
Q Consensus 125 ~si~lmvneK----------------------------------------------sle~~~vr~~~~~Lvsi~iW~~L~ 158 (1456)
||+|+|+||| |||++.||+.|.+|.+|+|||+|+
T Consensus 75 ~~~~~m~~~k~r~~~~aw~~~~~d~f~~ff~kvl~~~~~~l~e~~~~l~f~~~~fq~~~~~~~r~~v~ql~~l~~~~sl~ 154 (1320)
T KOG1806|consen 75 MSTCMMLNEKFRENVIAWDLFDEDRFQLFFEKVLEVSLSLLSEVTYMLQFITLCFQSLEIEKLRKLVYQLTNLSIWNSLD 154 (1320)
T ss_pred HHHHHHHHHHHhhhcchhhhcchhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhHhHHHHHHHHHHHHhcchhhhccc
Confidence 9999999999 999999999999999999999999
Q ss_pred HHHHHHHhccCchhHHHHHHHHHHHhHhhhccCCCCCCchhhHHHHHHHHHHHHHHHHhhhhhhcccCCCCCCccccccc
Q 000509 159 YGRFQMELCLNPDLIKKWKRMVKREFKEAMKRGEPFDPSAMLEVKFLRNFIEEFLEVLENEVFVQRHHVNNEDDHADANS 238 (1456)
Q Consensus 159 ~~~~~~~l~~~~~l~K~w~~~~kk~~~~~~~~~~~~~~~~~~er~~l~~l~~~F~~~l~~~~~~~~~~~~~~~~~~~~~~ 238 (1456)
-+|.+.||+.+|+|.|+|+.++|+..+ ..+.++.....||.|+..||+.|..+|+.
T Consensus 155 ~~r~~~~l~~~~~l~k~~~~~k~~~~s----~~~k~~~~~~~~~~~~s~li~~~~~~~~~-------------------- 210 (1320)
T KOG1806|consen 155 LDRVKYELHDSPSLTKAWDSYKKKRPS----IVEKFPLHNLLERWFHSLLIKSFSYVLTE-------------------- 210 (1320)
T ss_pred hHhHHhhhccChHHHHHHHHhhhhccc----ccccccccccHHHHHHHHHHHHHHHHHcc--------------------
Confidence 999999999999999999999987433 33457788999999999999999999964
Q ss_pred cCCCCchhhhHHHHHHHHHHHHhhccCchhhHhHHhhhcceeeeecccccccccccchHHHHHHHHhhhccccccCCCCC
Q 000509 239 FLQPNDACVLYCERFMEFLIDLLSQLPTRRYLRPLVADLAIVAKCHLSTLYRHEKGKLFAQLVDLLQFYEKFEINDHVGK 318 (1456)
Q Consensus 239 ~~~~~~~~~~ycerflelliDL~sqlpTRR~~~~ll~d~~~l~~~~ls~l~~~~~~~lf~~l~~~l~~y~~f~idd~tG~ 318 (1456)
...+.|.||||||||+|||+|+||||||+||+++|.|++++|+|| ||.++.| ||+||+|+|+||+.|+|+|++|.
T Consensus 211 ---~~~~kv~~~~~~i~~~i~l~~~~ptrr~~~p~~~d~~~~~~~~ls-l~~~~~~-lf~ql~d~l~~~~~f~~t~~~g~ 285 (1320)
T KOG1806|consen 211 ---KQEAKVTYCERFIEMSIDLLSALPTRRFAHPVIEDSCFYTACRLS-LYYDENG-LFKQLTDDLNFYLKFEITDTRGN 285 (1320)
T ss_pred ---cccccchHHHHHHHHHHHHHHhccchhhhhhhhhhHHHHHHHhhe-eeeccch-HHHHHHHHHHhhcCCceecCcCc
Confidence 115689999999999999999999999999999999999999999 9998888 99999999999999999999999
Q ss_pred CCCHHHHHHHHHHHHHHHHHHHhhccchhhHHHhhccccccChHHHHHhhcCCCHhhHhhccccceee---ecCC-CCCC
Q 000509 319 QLTDDEVLQSHYDRFQSFQLLAFKKIPKLQELALANIGSIHKRADLSKRLSVLSLKELQDLVCCKLKL---LSSK-DPWL 394 (1456)
Q Consensus 319 ~l~~~~~~~~h~~~~~~lQ~~~f~~f~~l~~~~l~~~~~i~~~~~l~~~l~~l~~~~l~~l~~~~l~l---~~~~-~~~~ 394 (1456)
+++.+++++.||.+..++|..+|++|+++.+|+++|+++|.+++.|.+.++.++ .|..| |....| .||. ..+.
T Consensus 286 ~~~t~~~i~~d~i~~~a~Q~waf~t~~~hld~sak~i~sIy~~e~l~~~~~sls--~l~mL-e~sqyLe~yL~p~y~~e~ 362 (1320)
T KOG1806|consen 286 ALTTEEAIRNDYIRYYALQLWAFSTFPKHLDLSAKNITSIYQREKLEEIFSSLS--SLKML-ESSQYLETYLPPNYYPEK 362 (1320)
T ss_pred eechhhhhhhhHHHHHHHHHhcccchhhhccchhHHHHHHHHHHHHhhcccHHH--HHHHH-HHHHHHHHhcCcccCchh
Confidence 999999999999999999999999999888999999999999999999999999 77777 766665 3454 7888
Q ss_pred CCHHHHHHHHHHHhhccccHHHHhhcCCCCCccccccccCCCcccccCCcccccCCccccccCChHHHHHHhHHHHHHHH
Q 000509 395 DSYDFLVEVIVSFFEKQQSQKEAINALPLYPNEQIMWDESLVPSINYSGEGCLALPKLNLQFLTLHDYLLRNFNLFRLES 474 (1456)
Q Consensus 395 ~~~~~l~e~l~~~~~~~~~~~~~~~~~~l~ptE~~l~~~~~~~~~~y~~~~~l~lpkLnlQyL~~~Dyl~R~~~l~r~e~ 474 (1456)
.+++||++++++.+||++++.+..+++|+||+|++|||+++.++++|. ++||||||||||||||+||+.|+|++||+|+
T Consensus 363 a~k~fLmsvvVm~nEK~rs~ve~~~~~~l~p~~~i~wd~~v~~~e~~l-e~cl~l~kl~lq~ltL~~~er~all~F~~~~ 441 (1320)
T KOG1806|consen 363 ADKEFLMSVVVMTNEKTRSQVEDYNEIPLYPLEDILWDESVMPSENYL-EGCLALPKLNLQFLTLHDYERRALLLFRLES 441 (1320)
T ss_pred hhHHHHHHHhhhhhHHHHHHHHHHHhhhcCchhhhccccccchhhhhh-hhhhcchhhHHHHhHHHHHHHHHHHHHHHHH
Confidence 999999999999999999999999999999999999999999999999 8999999999999999999999999999999
Q ss_pred HHHHHHhHHHHhhhcccccCCCCceeecccccccccCCceeEEEecCCCCCccCCceeEEEEEEEccccchhHHHHhhhc
Q 000509 475 TYEIREDIQEAVPHLLAYINNEGEAAFRGWSRMAVPIKEFKITEVKQPNIGEVKPSSVTAAITFSISSYKAHVRSEWNAL 554 (1456)
Q Consensus 475 ~~~ir~die~~i~rl~p~~~~~~~~~f~g~srma~pi~~~~i~~v~~p~~g~~~p~~V~a~i~~~l~~~~~~~r~ew~~l 554 (1456)
+|+|+.||.+.+.|+.| ..|++.|+||+||+.|+..|.|++|++|+||+..|.+|+|++++++...+.+++++|+.+
T Consensus 442 f~sie~ei~~~~~~~l~---~~~~vs~~~W~~l~~~r~~f~v~eV~~p~ige~~p~kv~ad~~~~~~~eRh~~~nli~~f 518 (1320)
T KOG1806|consen 442 FYSIEAEILNFVERYLR---LSGKVAFKGWARLAFPRNDFKVTEVAPPNIGENLPQKVTADVTLSRPGERHSILNLIENF 518 (1320)
T ss_pred HHHHHHHHHHHHHHHhh---hccchhhhhhhhccchhhhheeeecCCcchhhhhhhhhhhhccccCcchHHHHHHHHHHh
Confidence 99999999999999998 678899999999999999999999999999999999999999999998899999999999
Q ss_pred CCCCEEEEEEeeCCCCCCchhhhhcCCCccccCcceeeeeeEEEEEcCCCCccccccccccCCCCCCCCCCceEEEEEcc
Q 000509 555 KEHDVLFLLSIRPSFEPLSAEEAAKASVPQKLGLQCVRGCEIIEIRDEDGTLMNDFTGRIKRDEWKPPKGELRTVTVALD 634 (1456)
Q Consensus 555 r~~dv~fL~~v~~~~~~~~~~~~~~~~~~~~~gi~~vr~~ev~~~~d~~g~~~~~~~~~~~~~~~~~~~~~~r~~~v~lD 634 (1456)
++||||||++|+| ..+.+..+........+.|+++|||||+.+++|.+|++|.| +.|+|.|.||
T Consensus 519 ~k~~~~~Li~i~P-~e~~~~~~~~~~~~eg~vp~~~v~yCErf~~f~idlesild---------------trRffnvvLd 582 (1320)
T KOG1806|consen 519 KKHDVLFLIYIRP-MEPKGLEGNALDPLEGRVPLTYVRYCERFGMFDIDLESILD---------------TRRFFNVVLD 582 (1320)
T ss_pred hhcCeeEEEEecc-CcccCcccccccccccccCcccchhhhhhhhhhhhhhhccC---------------CcceEEEecc
Confidence 9999999999999 44455555555555779999999999999999999999988 2499999999
Q ss_pred hhhhhhhHHHHhhcCCccccccceEEEecCccccchHHHHHHHHHHhhcccCCChhhHHHhhccCCCCcccccCCCCccc
Q 000509 635 TAQYHMDVTDIAEKGAEDAYGTFNVLMRRKPKENNFKAILESIRDLMNEYCIVPDWLHNIFLGYGNPSAAQWTNMPDFLE 714 (1456)
Q Consensus 635 ~~qy~~d~~~~~~~~~~d~y~~fN~~vrr~~~ennfk~vl~~i~~l~~~~~~~p~Wl~difLGygdp~~a~y~~~~~~~~ 714 (1456)
+.||+.|+..+.+.++.++|.+||+++||+|++||||++|++|++|||+.|.+|.|||++|||||+|++|||.+|++.+.
T Consensus 583 ~~h~~~lLs~li~~~ag~lf~qF~~~l~~~~~~n~~~~~l~~l~~l~n~~~~~p~wl~~~~Lg~g~pS~~~~~n~~~~~~ 662 (1320)
T KOG1806|consen 583 PFHYHHLLSGLIEYGAGDLFFQFNLLLRRKPEENNFKAILEIIRSLMNRACEVPKWLHDLFLGYGTPSIAHYPNMPNLSI 662 (1320)
T ss_pred hHHHHHHhhHHhhcCchhhhhhhhheeeeccCcchhHhHHHHHHHHHHhhhccchhhhccccccCCcchhhccCchhhHH
Confidence 99999999999999999999999999999999999999999999999999999999999999999999999999999988
Q ss_pred ccccccccCChhhhhhhcCCCeEEeeCCCCCCCCCCCCCeeEecCccccCccCCCCCCCccCCcccccccccccCCCCcc
Q 000509 715 VVDFKDTFIDTAHLEECFSDYEVSFVHPDGTENLDPRPPFRIRLPRTLKGTSRALPGNKKLTSDSMQVVNMVDASDGKDQ 794 (1456)
Q Consensus 715 ~~~~~dtf~~~~hl~~s~~~~~v~~~~~~~~~~~~~~~pf~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 794 (1456)
..| |||+...|+.++||++.|.+..+.+... ++ |... +++-.+++...+.++
T Consensus 663 ~~~--~~f~~~~ql~~~f~~~~v~~v~~~~al~--------~~---------------k~~~---~~nki~~~~~ae~~~ 714 (1320)
T KOG1806|consen 663 YAD--DTFLTVEHLQSSFPNCNVSSNLSTEALQ--------IK---------------KFYT---DQNKISADVTAEVPA 714 (1320)
T ss_pred HHH--HhhhhHHHHHHhccCCCccccCccHHHH--------HH---------------Hhhh---hccccCccccccchh
Confidence 888 9999999999999999986654443210 00 0000 011001111245678
Q ss_pred EEEEecCCCCCCCCCCCCCCCCCCCCCHHHHHHHHhccCCCcEEEEcCCCCChHHHHHHHHHHHHHcCCCCcEEEEecCH
Q 000509 795 LIVEAYTPPDPGPYPQDQPRQNSVRFTPTQVGAIISGIQPGLTMVVGPPGTGKTDTAVQILNVLYHNCPSQRTLIITHSN 874 (1456)
Q Consensus 795 ~~v~~~~~~~~~p~p~~~p~~n~v~Ln~sQ~eAI~sal~~gltLI~GPPGTGKT~tia~iI~~L~~~~p~~rILIvA~SN 874 (1456)
+.+.++..|.++|||.+ |+.|.+.+|+.|.+||.++++||+|+|+||||||||+++++|+..+++++|++|+||++|||
T Consensus 715 ~~v~~~~lp~~~py~y~-p~~n~v~ft~~qveai~sg~qpgltmvvgppgtgktd~avqil~~lyhn~p~qrTlivthsn 793 (1320)
T KOG1806|consen 715 LIVEPFTLPSNGPYPYN-PKKNQVKFTPTQVEAILSGMQPGLTMVVGPPGTGKTDVAVQILSVLYHNSPNQRTLIVTHSN 793 (1320)
T ss_pred hccCccccCCCCCCCcC-cccchhccCHHHHHHHHhcCCCCceeeecCCCCCCcchhhhhhhhhhhcCCCcceEEEEecc
Confidence 99999999999999999 99999999999999999999999999999999999999999999999999999999999999
Q ss_pred HHHHHHHHHHHhcCCCcccEEEccCcccccccccchhhhhHHHHHHHHHHHHHHHHHHHHHhcCCCCccccccccchhhh
Q 000509 875 QALNDLFEKIMQRDVPARYLLRLGQGEQELATDLDFSRQGRVNAMLVRRLELLSEVERLARSLQLPEDVGYTCETAGYFW 954 (1456)
Q Consensus 875 ~AlD~L~ekL~~l~i~e~~llRlG~~e~~l~~~~~~sr~gRv~~~l~~r~~lL~ev~kLa~~l~~~~~~~~sceta~~f~ 954 (1456)
+|++++++|+.++++++++++|+|+|+.+++++.+|+++|||++++.+|..++.++++++++++.+++++++|++|+||+
T Consensus 794 qaln~lfeKi~~~d~d~rhLlrlg~ge~eletd~dfsrygrvn~~l~~r~~ll~ev~rla~sl~~pgdv~ytcetagyf~ 873 (1320)
T KOG1806|consen 794 QALNQLFEKIMALDVDERHLLRLGHGEEELETDKDFSRYGRVNYVLSRRLELLREVERLAKSLQAPGDVDYTCETAGYFF 873 (1320)
T ss_pred cchhHHHHHHHhcccchhhHHHhcccHHhhhcccchhheeeEeeeeccchHHHHHHHHhhhhhcCccccccccchhhhhh
Confidence 99999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred HhhhHHHHHHHHHHhhccCCC--CcccccccchhhhhhcCCCCCCCCccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q 000509 955 LLHVYSRWEQFLAACADNEGK--PTFVRDRFPFKEFFSNTPQPIFTGDSFEKDMRAAKGCFRHLQTLFQELEECRAFELL 1032 (1456)
Q Consensus 955 ~~~v~~~w~~fl~~l~~~~~~--~~~i~~~fpf~~~f~~~p~~l~~~~s~e~~l~~a~~~~~~i~~if~eL~e~r~fElL 1032 (1456)
..++.++|++|+..+....+. ..++...|||+.||.+.|+++|.+.+.+.+++.+.+|+++++.+|++|+++|+|++|
T Consensus 874 ~~~V~~~wee~l~~v~~~~~~~~~~~~~~~fpf~~~f~d~p~~vfeg~n~~~d~~~a~~cf~hl~~ifqqLee~rafell 953 (1320)
T KOG1806|consen 874 LAYVKRRWEEYLAKVDKGCDKDSVDIVSNRFPFHSYFGDKPKPPFEGYNKENDMDYATGCFRHLEYIFQQLEEFRAFELL 953 (1320)
T ss_pred hhHHHhhhHHHHHHhccCCCchhhhhHhhhCcchhhhhcCCCccccccchhhhhhhhhhhHHHHHHHHHHHHhccccccc
Confidence 999999999999999854444 456788999999999999999999999999999999999999999999999999999
Q ss_pred HHHHHHHHHhhhccCcEEEEcchhHhhhhhHHhhcCCCCCEEEEecCCCCChHHHHHHHHhC----------------CC
Q 000509 1033 KSTADRANYLMTKQAKIVAMTCTHAALKRKDFLQLGFKYDNLLMEESAQILEIETFIPMLLN----------------DR 1096 (1456)
Q Consensus 1033 r~~~~r~~~lllk~a~IIa~T~t~aa~~~~~l~~lg~kfD~VIIDEAsQitE~EtlIPLll~----------------Dh 1096 (1456)
+...++..|++.++|+||+|||||++.++.++..+||+||+++|+|++|++|.++++|++++ ||
T Consensus 954 r~~~dr~~Yll~kqakiiamtcthaalkr~el~~lgf~ydnl~mEesaqile~etfiplLlq~p~dg~~rlkr~iligdh 1033 (1320)
T KOG1806|consen 954 RSGEDRELYLLVKQAKIIAMTCTHAALRRGDLVKLGFKYDNLLMEESAQILEIETFIPLLLQNPQDGHNRLKRWILIGDH 1033 (1320)
T ss_pred ccchhHhhccCcccceeeecccCChhhChhhHhhhceeechhhhhhccCCcccccccHHHhcCCcchhhHhhheeecccc
Confidence 99999999999999999999999999999999999999999999999999999999999987 99
Q ss_pred CCCCceecchhhhhhcCCcccHHHHHHHcCCCeeeccccccCchhHHHHHHHHhccCCCCCc------------------
Q 000509 1097 RMLPPVVKNMAFQKYSHMDQSLFTRFVRLGIPYIELNAQGRARPSIAQLYNWRYRDLGDLPF------------------ 1158 (1456)
Q Consensus 1097 ~QLpPvV~s~~~~~~~~l~qSLFeRL~~~g~p~i~L~~QYR~~PsIa~~~n~~yy~l~dlp~------------------ 1158 (1456)
+|+||++++.++++|++++||+|.|+++.++|++.|+.|||.+++|+.+|+|+|..++++|+
T Consensus 1034 hqlPPv~~n~afqkysnm~qslf~r~vRl~ip~i~lnaqgrar~sI~~Ly~wry~lLg~l~~v~~lp~f~~aNagf~~~~ 1113 (1320)
T KOG1806|consen 1034 HQLPPVVKNQAFQKYSNMEQSLFTRLVRLGVPIIDLNAQGRARASIASLYNWRYPLLGNLPHVSPLPRFQYANAGFAYEF 1113 (1320)
T ss_pred cccCCcccchHHHHHhcchhhhhhcceecccceecchhhhhHHHHHHHHHHhhhcccccCcCCccchhhhccccCceeeE
Confidence 99999999999999999999999999999999999999999999999999999999999887
Q ss_pred -eeecCCCCCCCccCCCCCccCCHHHHHHHHHHHHHHHHhCCCCCCEEEecCCHHHHHHHHHHHHhcCCCCCCCCCCcee
Q 000509 1159 -LVDVPDYNGRGESAPSPWFYQNEGEAEYVVSVYIYMRLLGYPANKISILTTYNGQKLLIRDVINRQCVPYPFIGPPSKV 1237 (1456)
Q Consensus 1159 -fidV~~~~g~~e~~~~~~S~~N~~EAe~vv~iv~~L~~~Gy~~~~IgILTpY~aQ~~lIr~~L~~r~~~~~~~g~~v~V 1237 (1456)
|++|+++.|.+++.|++++++|.+||+|+++++.||+..|||+++|.|+|+|++|+.+|++++..+|..+|++|.|-+|
T Consensus 1114 qlinv~Df~g~gEt~p~p~fyQnlgeaey~vAly~YMr~Lgypa~Kisilttyngq~~lirdii~rrc~~nPfig~pAkv 1193 (1320)
T KOG1806|consen 1114 QFINVPDFKGSGETEPSPGFYQNLGEAEYAVALFQYMRLLGYPANKISILTTYNGQKSLIRDIINRRCSHNPFIGQPAKV 1193 (1320)
T ss_pred EEecchhhccccccCCCcccccCCchhhhHHHHHHHHHHhCCchhHeeEEEeecchHHHHHHHHHHhccCCCccCCcccC
Confidence 9999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred ecccCCCCccCCEEEEEecccCCccccccchhhHHHHhhhhccEEEEechhhhhhhccchHHHHHHHcCccccccccCCc
Q 000509 1238 TTVDKFQGQQNDFILLSLVRTRFVGHLRDVRRLVVAMSRARLGLYVFCRRSLFEQCYELQPTFRLLLQRPDKLALTMNEK 1317 (1456)
Q Consensus 1238 ~TVD~fQG~E~DvVIlSlVRs~~~GfL~d~rRLNVAlSRAR~~LiIvGn~~~l~~~~~~~~~~~~Ll~~~~~l~l~~~e~ 1317 (1456)
+|||+|||+++|+||+|+|+++.+|+++|++|+.||+||||.|+||+|+.++|.+|.++.++|+.|.++|+++.+.+++.
T Consensus 1194 ~tvdk~qgqqndfiIlslv~tr~~gh~rdvrrlvva~srarlglyv~~r~~lf~~c~eLtp~~~~l~k~p~~lll~~~ei 1273 (1320)
T KOG1806|consen 1194 TTVDKFQGQQNDFIILSLVRTREVGHLRDVRRLVVAMSRARLGLYVLCRRSLFRSCRELTPAFNELEKRPDKLLLTPGEI 1273 (1320)
T ss_pred CccccccccccceEEeeehhhhhhhhhccHHHHHHHHHHhhccchhHHHHHHHHHHHhccHHHHHHhhCcchhccccCcc
Confidence 99999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred cccccccccCCCCceeccChHHHHHHHHHHHHHHHHHHH
Q 000509 1318 TSYTDRHVEDIGVPYLVSGIEDIHAIVNSLLYQRHLAIQ 1356 (1456)
Q Consensus 1318 ~p~~~r~~~~~~~~~~~~~~~~l~~~v~~~~~~~~~~~~ 1356 (1456)
+|+. |..+....++++.|+.||+.+|++|++...+...
T Consensus 1274 ~pt~-r~~~~~~~~~~I~nm~~m~~~v~e~~~~~~~t~~ 1311 (1320)
T KOG1806|consen 1274 YPTS-RKIGSSVETFEIENLLHMANFVVEMYMKRLQTNM 1311 (1320)
T ss_pred cccc-cCCCcccccHHHHhHHHHHHHHHHHHHHHHHHHH
Confidence 9999 6777788899999999999999999999988654
|
|
| >KOG1806 consensus DEAD box containing helicases [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG1802 consensus RNA helicase nonsense mRNA reducing factor (pNORF1) [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG1803 consensus DNA helicase [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >TIGR00376 DNA helicase, putative | Back alignment and domain information |
|---|
| >KOG1807 consensus Helicases [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG1805 consensus DNA replication helicase [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >COG1112 Superfamily I DNA and RNA helicases and helicase subunits [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PF13087 AAA_12: AAA domain; PDB: 2XZO_A 2WJY_A 2WJV_A 2XZP_A 2GK6_A 2GK7_A 2GJK_A 2XZL_A | Back alignment and domain information |
|---|
| >KOG1801 consensus tRNA-splicing endonuclease positive effector (SEN1) [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG1804 consensus RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >PF13086 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV_A 2XZP_A 2GK6_A 2GK7_A 2GJK_A | Back alignment and domain information |
|---|
| >PRK11054 helD DNA helicase IV; Provisional | Back alignment and domain information |
|---|
| >PRK11773 uvrD DNA-dependent helicase II; Provisional | Back alignment and domain information |
|---|
| >TIGR01075 uvrD DNA helicase II | Back alignment and domain information |
|---|
| >TIGR01073 pcrA ATP-dependent DNA helicase PcrA | Back alignment and domain information |
|---|
| >PRK10919 ATP-dependent DNA helicase Rep; Provisional | Back alignment and domain information |
|---|
| >TIGR01448 recD_rel helicase, putative, RecD/TraA family | Back alignment and domain information |
|---|
| >TIGR01447 recD exodeoxyribonuclease V, alpha subunit | Back alignment and domain information |
|---|
| >PRK10875 recD exonuclease V subunit alpha; Provisional | Back alignment and domain information |
|---|
| >TIGR02768 TraA_Ti Ti-type conjugative transfer relaxase TraA | Back alignment and domain information |
|---|
| >COG3973 Superfamily I DNA and RNA helicases [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR02785 addA_Gpos recombination helicase AddA, Firmicutes type | Back alignment and domain information |
|---|
| >TIGR01074 rep ATP-dependent DNA helicase Rep | Back alignment and domain information |
|---|
| >PRK13826 Dtr system oriT relaxase; Provisional | Back alignment and domain information |
|---|
| >TIGR00609 recB exodeoxyribonuclease V, beta subunit | Back alignment and domain information |
|---|
| >PRK13889 conjugal transfer relaxase TraA; Provisional | Back alignment and domain information |
|---|
| >PRK13909 putative recombination protein RecB; Provisional | Back alignment and domain information |
|---|
| >COG1074 RecB ATP-dependent exoDNAse (exonuclease V) beta subunit (contains helicase and exonuclease domains) [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK10876 recB exonuclease V subunit beta; Provisional | Back alignment and domain information |
|---|
| >COG0210 UvrD Superfamily I DNA and RNA helicases [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PF13604 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL_A 3E1S_A 3GP8_A | Back alignment and domain information |
|---|
| >TIGR02784 addA_alphas double-strand break repair helicase AddA, alphaproteobacterial type | Back alignment and domain information |
|---|
| >PRK13709 conjugal transfer nickase/helicase TraI; Provisional | Back alignment and domain information |
|---|
| >PRK14712 conjugal transfer nickase/helicase TraI; Provisional | Back alignment and domain information |
|---|
| >PF13245 AAA_19: Part of AAA domain | Back alignment and domain information |
|---|
| >PF00580 UvrD-helicase: UvrD/REP helicase N-terminal domain; InterPro: IPR000212 Members of this family are helicases that catalyse ATP dependent unwinding of double stranded DNA to single stranded DNA | Back alignment and domain information |
|---|
| >PF09848 DUF2075: Uncharacterized conserved protein (DUF2075); InterPro: IPR018647 This domain, found in putative ATP/GTP binding proteins, has no known function | Back alignment and domain information |
|---|
| >PF01443 Viral_helicase1: Viral (Superfamily 1) RNA helicase; InterPro: IPR000606 This entry includes RNA and DNA helicases | Back alignment and domain information |
|---|
| >TIGR02760 TraI_TIGR conjugative transfer relaxase protein TraI | Back alignment and domain information |
|---|
| >COG0507 RecD ATP-dependent exoDNAse (exonuclease V), alpha subunit - helicase superfamily I member [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >COG3972 Superfamily I DNA and RNA helicases [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR02760 TraI_TIGR conjugative transfer relaxase protein TraI | Back alignment and domain information |
|---|
| >PF13361 UvrD_C: UvrD-like helicase C-terminal domain; PDB: 1UAA_B 3U4Q_A 3U44_A 1W36_B 3K70_B 2IS6_B 3LFU_A 2IS2_B 2IS1_B 2IS4_A | Back alignment and domain information |
|---|
| >KOG1804 consensus RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >cd00046 DEXDc DEAD-like helicases superfamily | Back alignment and domain information |
|---|
| >PF02562 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH is a cytoplasmic protein and predicted ATPase that is induced by phosphate starvation and belongings to the phosphate regulon (pho) in Escherichia coli [] | Back alignment and domain information |
|---|
| >PRK11192 ATP-dependent RNA helicase SrmB; Provisional | Back alignment and domain information |
|---|
| >smart00487 DEXDc DEAD-like helicases superfamily | Back alignment and domain information |
|---|
| >PRK11776 ATP-dependent RNA helicase DbpA; Provisional | Back alignment and domain information |
|---|
| >PRK11634 ATP-dependent RNA helicase DeaD; Provisional | Back alignment and domain information |
|---|
| >PRK10536 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK10590 ATP-dependent RNA helicase RhlE; Provisional | Back alignment and domain information |
|---|
| >PHA02558 uvsW UvsW helicase; Provisional | Back alignment and domain information |
|---|
| >PTZ00424 helicase 45; Provisional | Back alignment and domain information |
|---|
| >TIGR02773 addB_Gpos ATP-dependent nuclease subunit B | Back alignment and domain information |
|---|
| >PF04851 ResIII: Type III restriction enzyme, res subunit; InterPro: IPR006935 This entry represents a domain found in the N terminus of several proteins, including helicases, the R subunit (HsdR) of type I restriction endonucleases (3 | Back alignment and domain information |
|---|
| >COG1061 SSL2 DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK04837 ATP-dependent RNA helicase RhlB; Provisional | Back alignment and domain information |
|---|
| >PF00270 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 Members of this family include the DEAD and DEAH box helicases | Back alignment and domain information |
|---|
| >PF13538 UvrD_C_2: UvrD-like helicase C-terminal domain; PDB: 1W36_G 3K70_G 3DMN_A 3UPU_B 3GPL_A 3E1S_A 3GP8_A | Back alignment and domain information |
|---|
| >PRK05580 primosome assembly protein PriA; Validated | Back alignment and domain information |
|---|
| >PRK04537 ATP-dependent RNA helicase RhlB; Provisional | Back alignment and domain information |
|---|
| >PTZ00110 helicase; Provisional | Back alignment and domain information |
|---|
| >PRK01172 ski2-like helicase; Provisional | Back alignment and domain information |
|---|
| >PLN00206 DEAD-box ATP-dependent RNA helicase; Provisional | Back alignment and domain information |
|---|
| >PRK13767 ATP-dependent helicase; Provisional | Back alignment and domain information |
|---|
| >PF05970 PIF1: PIF1-like helicase; InterPro: IPR010285 This entry represents PIF1 helicase and related proteins | Back alignment and domain information |
|---|
| >PRK13766 Hef nuclease; Provisional | Back alignment and domain information |
|---|
| >TIGR01054 rgy reverse gyrase | Back alignment and domain information |
|---|
| >PRK09401 reverse gyrase; Reviewed | Back alignment and domain information |
|---|
| >cd00268 DEADc DEAD-box helicases | Back alignment and domain information |
|---|
| >TIGR03117 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase Csf4 | Back alignment and domain information |
|---|
| >PRK02362 ski2-like helicase; Provisional | Back alignment and domain information |
|---|
| >TIGR00614 recQ_fam ATP-dependent DNA helicase, RecQ family | Back alignment and domain information |
|---|
| >PRK01297 ATP-dependent RNA helicase RhlB; Provisional | Back alignment and domain information |
|---|
| >PRK11664 ATP-dependent RNA helicase HrpB; Provisional | Back alignment and domain information |
|---|
| >PRK00254 ski2-like helicase; Provisional | Back alignment and domain information |
|---|
| >COG1200 RecG RecG-like helicase [DNA replication, recombination, and repair / Transcription] | Back alignment and domain information |
|---|
| >TIGR01970 DEAH_box_HrpB ATP-dependent helicase HrpB | Back alignment and domain information |
|---|
| >TIGR03817 DECH_helic helicase/secretion neighborhood putative DEAH-box helicase | Back alignment and domain information |
|---|
| >PRK14701 reverse gyrase; Provisional | Back alignment and domain information |
|---|
| >cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs | Back alignment and domain information |
|---|
| >PF02399 Herpes_ori_bp: Origin of replication binding protein; InterPro: IPR003450 This entry represents replication origin binding protein | Back alignment and domain information |
|---|
| >PRK05973 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >KOG0354 consensus DEAD-box like helicase [General function prediction only] | Back alignment and domain information |
|---|
| >COG1111 MPH1 ERCC4-like helicases [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK10917 ATP-dependent DNA helicase RecG; Provisional | Back alignment and domain information |
|---|
| >COG0513 SrmB Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >TIGR00643 recG ATP-dependent DNA helicase RecG | Back alignment and domain information |
|---|
| >cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold | Back alignment and domain information |
|---|
| >PRK11057 ATP-dependent DNA helicase RecQ; Provisional | Back alignment and domain information |
|---|
| >PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] | Back alignment and domain information |
|---|
| >PRK08074 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated | Back alignment and domain information |
|---|
| >TIGR01389 recQ ATP-dependent DNA helicase RecQ | Back alignment and domain information |
|---|
| >PRK08181 transposase; Validated | Back alignment and domain information |
|---|
| >PRK07952 DNA replication protein DnaC; Validated | Back alignment and domain information |
|---|
| >TIGR01407 dinG_rel DnaQ family exonuclease/DinG family helicase, putative | Back alignment and domain information |
|---|
| >COG4889 Predicted helicase [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR00603 rad25 DNA repair helicase rad25 | Back alignment and domain information |
|---|
| >TIGR00595 priA primosomal protein N' | Back alignment and domain information |
|---|
| >smart00382 AAA ATPases associated with a variety of cellular activities | Back alignment and domain information |
|---|
| >PRK12377 putative replication protein; Provisional | Back alignment and domain information |
|---|
| >PRK06526 transposase; Provisional | Back alignment and domain information |
|---|
| >TIGR01967 DEAH_box_HrpA ATP-dependent helicase HrpA | Back alignment and domain information |
|---|
| >PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif | Back alignment and domain information |
|---|
| >PRK11448 hsdR type I restriction enzyme EcoKI subunit R; Provisional | Back alignment and domain information |
|---|
| >TIGR00580 mfd transcription-repair coupling factor (mfd) | Back alignment and domain information |
|---|
| >PRK13833 conjugal transfer protein TrbB; Provisional | Back alignment and domain information |
|---|
| >TIGR03877 thermo_KaiC_1 KaiC domain protein, Ph0284 family | Back alignment and domain information |
|---|
| >PRK07246 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated | Back alignment and domain information |
|---|
| >PF06745 KaiC: KaiC; InterPro: IPR014774 This entry represents a domain within bacterial and archaeal proteins, most of which are hypothetical | Back alignment and domain information |
|---|
| >TIGR02525 plasmid_TraJ plasmid transfer ATPase TraJ | Back alignment and domain information |
|---|
| >PRK08116 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK08533 flagellar accessory protein FlaH; Reviewed | Back alignment and domain information |
|---|
| >PRK14974 cell division protein FtsY; Provisional | Back alignment and domain information |
|---|
| >PRK13894 conjugal transfer ATPase TrbB; Provisional | Back alignment and domain information |
|---|
| >PRK10689 transcription-repair coupling factor; Provisional | Back alignment and domain information |
|---|
| >PF00176 SNF2_N: SNF2 family N-terminal domain; InterPro: IPR000330 This domain is found in proteins involved in a variety of processes including transcription regulation (e | Back alignment and domain information |
|---|
| >TIGR03878 thermo_KaiC_2 KaiC domain protein, AF_0795 family | Back alignment and domain information |
|---|
| >COG1110 Reverse gyrase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK06067 flagellar accessory protein FlaH; Validated | Back alignment and domain information |
|---|
| >TIGR00064 ftsY signal recognition particle-docking protein FtsY | Back alignment and domain information |
|---|
| >PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B | Back alignment and domain information |
|---|
| >TIGR03880 KaiC_arch_3 KaiC domain protein, AF_0351 family | Back alignment and domain information |
|---|
| >cd01120 RecA-like_NTPases RecA-like NTPases | Back alignment and domain information |
|---|
| >PRK06893 DNA replication initiation factor; Validated | Back alignment and domain information |
|---|
| >TIGR02782 TrbB_P P-type conjugative transfer ATPase TrbB | Back alignment and domain information |
|---|
| >KOG0922 consensus DEAH-box RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >PRK00771 signal recognition particle protein Srp54; Provisional | Back alignment and domain information |
|---|
| >COG1204 Superfamily II helicase [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR01650 PD_CobS cobaltochelatase, CobS subunit | Back alignment and domain information |
|---|
| >PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >PRK09361 radB DNA repair and recombination protein RadB; Provisional | Back alignment and domain information |
|---|
| >PRK09183 transposase/IS protein; Provisional | Back alignment and domain information |
|---|
| >PRK11131 ATP-dependent RNA helicase HrpA; Provisional | Back alignment and domain information |
|---|
| >TIGR02655 circ_KaiC circadian clock protein KaiC | Back alignment and domain information |
|---|
| >PRK08084 DNA replication initiation factor; Provisional | Back alignment and domain information |
|---|
| >cd01129 PulE-GspE PulE/GspE The type II secretory pathway is the main terminal branch of the general secretory pathway (GSP) | Back alignment and domain information |
|---|
| >cd00984 DnaB_C DnaB helicase C terminal domain | Back alignment and domain information |
|---|
| >PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport | Back alignment and domain information |
|---|
| >TIGR00348 hsdR type I site-specific deoxyribonuclease, HsdR family | Back alignment and domain information |
|---|
| >PRK04328 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication | Back alignment and domain information |
|---|
| >COG4098 comFA Superfamily II DNA/RNA helicase required for DNA uptake (late competence protein) [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >TIGR01587 cas3_core CRISPR-associated helicase Cas3 | Back alignment and domain information |
|---|
| >PRK09694 helicase Cas3; Provisional | Back alignment and domain information |
|---|
| >PRK10867 signal recognition particle protein; Provisional | Back alignment and domain information |
|---|
| >PRK10416 signal recognition particle-docking protein FtsY; Provisional | Back alignment and domain information |
|---|
| >COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda | Back alignment and domain information |
|---|
| >PRK08727 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >smart00489 DEXDc3 DEAD-like helicases superfamily | Back alignment and domain information |
|---|
| >smart00488 DEXDc2 DEAD-like helicases superfamily | Back alignment and domain information |
|---|
| >KOG0744 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR00959 ffh signal recognition particle protein | Back alignment and domain information |
|---|
| >PRK04296 thymidine kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR02237 recomb_radB DNA repair and recombination protein RadB | Back alignment and domain information |
|---|
| >cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes | Back alignment and domain information |
|---|
| >TIGR01425 SRP54_euk signal recognition particle protein SRP54 | Back alignment and domain information |
|---|
| >PRK06835 DNA replication protein DnaC; Validated | Back alignment and domain information |
|---|
| >PF13191 AAA_16: AAA ATPase domain; PDB: 2V1U_A | Back alignment and domain information |
|---|
| >COG0467 RAD55 RecA-superfamily ATPases implicated in signal transduction [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A | Back alignment and domain information |
|---|
| >COG0552 FtsY Signal recognition particle GTPase [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >cd01394 radB RadB | Back alignment and domain information |
|---|
| >PF13481 AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C | Back alignment and domain information |
|---|
| >TIGR03499 FlhF flagellar biosynthetic protein FlhF | Back alignment and domain information |
|---|
| >PF07652 Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR011492 This is the Flavivirus DEAD domain | Back alignment and domain information |
|---|
| >TIGR02928 orc1/cdc6 family replication initiation protein | Back alignment and domain information |
|---|
| >PRK12723 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK08903 DnaA regulatory inactivator Hda; Validated | Back alignment and domain information |
|---|
| >TIGR02881 spore_V_K stage V sporulation protein K | Back alignment and domain information |
|---|
| >TIGR03881 KaiC_arch_4 KaiC domain protein, PAE1156 family | Back alignment and domain information |
|---|
| >PF07728 AAA_5: AAA domain (dynein-related subfamily); InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] | Back alignment and domain information |
|---|
| >PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >KOG0989 consensus Replication factor C, subunit RFC4 [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >TIGR02524 dot_icm_DotB Dot/Icm secretion system ATPase DotB | Back alignment and domain information |
|---|
| >COG2805 PilT Tfp pilus assembly protein, pilus retraction ATPase PilT [Cell motility and secretion / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >PF13671 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B | Back alignment and domain information |
|---|
| >PF05729 NACHT: NACHT domain | Back alignment and domain information |
|---|
| >KOG2108 consensus 3'-5' DNA helicase [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >cd01131 PilT Pilus retraction ATPase PilT | Back alignment and domain information |
|---|
| >TIGR02012 tigrfam_recA protein RecA | Back alignment and domain information |
|---|
| >TIGR02533 type_II_gspE general secretory pathway protein E | Back alignment and domain information |
|---|
| >PF13173 AAA_14: AAA domain | Back alignment and domain information |
|---|
| >TIGR02655 circ_KaiC circadian clock protein KaiC | Back alignment and domain information |
|---|
| >COG1643 HrpA HrpA-like helicases [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK10436 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated | Back alignment and domain information |
|---|
| >COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair | Back alignment and domain information |
|---|
| >PLN03025 replication factor C subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR00604 rad3 DNA repair helicase (rad3) | Back alignment and domain information |
|---|
| >COG4096 HsdR Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms] | Back alignment and domain information |
|---|
| >PRK00149 dnaA chromosomal replication initiation protein; Reviewed | Back alignment and domain information |
|---|
| >PRK14088 dnaA chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >PRK12899 secA preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >PRK00411 cdc6 cell division control protein 6; Reviewed | Back alignment and domain information |
|---|
| >PRK11823 DNA repair protein RadA; Provisional | Back alignment and domain information |
|---|
| >TIGR01074 rep ATP-dependent DNA helicase Rep | Back alignment and domain information |
|---|
| >cd00983 recA RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response | Back alignment and domain information |
|---|
| >TIGR02538 type_IV_pilB type IV-A pilus assembly ATPase PilB | Back alignment and domain information |
|---|
| >KOG0342 consensus ATP-dependent RNA helicase pitchoune [RNA processing and modification] | Back alignment and domain information |
|---|
| >TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN | Back alignment and domain information |
|---|
| >PRK12402 replication factor C small subunit 2; Reviewed | Back alignment and domain information |
|---|
| >PRK06851 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >cd01121 Sms Sms (bacterial radA) DNA repair protein | Back alignment and domain information |
|---|
| >KOG0991 consensus Replication factor C, subunit RFC2 [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >TIGR00362 DnaA chromosomal replication initiator protein DnaA | Back alignment and domain information |
|---|
| >PRK11331 5-methylcytosine-specific restriction enzyme subunit McrB; Provisional | Back alignment and domain information |
|---|
| >PHA00729 NTP-binding motif containing protein | Back alignment and domain information |
|---|
| >PRK05642 DNA replication initiation factor; Validated | Back alignment and domain information |
|---|
| >TIGR00416 sms DNA repair protein RadA | Back alignment and domain information |
|---|
| >PHA03368 DNA packaging terminase subunit 1; Provisional | Back alignment and domain information |
|---|
| >cd01122 GP4d_helicase GP4d_helicase is a homohexameric 5'-3' helicases | Back alignment and domain information |
|---|
| >cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases | Back alignment and domain information |
|---|
| >PRK09302 circadian clock protein KaiC; Reviewed | Back alignment and domain information |
|---|
| >KOG0345 consensus ATP-dependent RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >PRK08939 primosomal protein DnaI; Reviewed | Back alignment and domain information |
|---|
| >PRK12726 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >COG0556 UvrB Helicase subunit of the DNA excision repair complex [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX | Back alignment and domain information |
|---|
| >PHA02653 RNA helicase NPH-II; Provisional | Back alignment and domain information |
|---|
| >TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily | Back alignment and domain information |
|---|
| >COG2804 PulE Type II secretory pathway, ATPase PulE/Tfp pilus assembly pathway, ATPase PilB [Cell motility and secretion / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >KOG0743 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK04914 ATP-dependent helicase HepA; Validated | Back alignment and domain information |
|---|
| >PRK06921 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF13238 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB_A 3IIM_A 2AXP_A 3KB2_A 1KHT_A 1NKS_A 3H86_C | Back alignment and domain information |
|---|
| >TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit | Back alignment and domain information |
|---|
| >PRK12608 transcription termination factor Rho; Provisional | Back alignment and domain information |
|---|
| >PRK14087 dnaA chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >PTZ00301 uridine kinase; Provisional | Back alignment and domain information |
|---|
| >cd02019 NK Nucleoside/nucleotide kinase (NK) is a protein superfamily consisting of multiple families of enzymes that share structural similarity and are functionally related to the catalysis of the reversible phosphate group transfer from nucleoside triphosphates to nucleosides/nucleotides, nucleoside monophosphates, or sugars | Back alignment and domain information |
|---|
| >PRK09354 recA recombinase A; Provisional | Back alignment and domain information |
|---|
| >PRK12724 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >PRK09302 circadian clock protein KaiC; Reviewed | Back alignment and domain information |
|---|
| >TIGR03158 cas3_cyano CRISPR-associated helicase, Cyano-type | Back alignment and domain information |
|---|
| >COG1702 PhoH Phosphate starvation-inducible protein PhoH, predicted ATPase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK13768 GTPase; Provisional | Back alignment and domain information |
|---|
| >cd01393 recA_like RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response | Back alignment and domain information |
|---|
| >TIGR01359 UMP_CMP_kin_fam UMP-CMP kinase family | Back alignment and domain information |
|---|
| >KOG2028 consensus ATPase related to the helicase subunit of the Holliday junction resolvase [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PF02492 cobW: CobW/HypB/UreG, nucleotide-binding domain; InterPro: IPR003495 Cobalamin (vitamin B12) is a structurally complex cofactor, consisting of a modified tetrapyrrole with a centrally chelated cobalt | Back alignment and domain information |
|---|
| >PF03205 MobB: Molybdopterin guanine dinucleotide synthesis protein B; PDB: 2F1R_B 1P9N_A 1NP6_B 2NPI_A 1XJC_A | Back alignment and domain information |
|---|
| >CHL00181 cbbX CbbX; Provisional | Back alignment and domain information |
|---|
| >PRK12727 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >PF00437 T2SE: Type II/IV secretion system protein; InterPro: IPR001482 A number of bacterial proteins, some of which are involved in a general secretion pathway (GSP) for the export of proteins (also called the type II pathway) belong to this group [, ] | Back alignment and domain information |
|---|
| >PRK04195 replication factor C large subunit; Provisional | Back alignment and domain information |
|---|
| >COG1102 Cmk Cytidylate kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PRK08233 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK06995 flhF flagellar biosynthesis regulator FlhF; Validated | Back alignment and domain information |
|---|
| >PRK00440 rfc replication factor C small subunit; Reviewed | Back alignment and domain information |
|---|
| >PRK13342 recombination factor protein RarA; Reviewed | Back alignment and domain information |
|---|
| >PRK08118 topology modulation protein; Reviewed | Back alignment and domain information |
|---|
| >cd01983 Fer4_NifH The Fer4_NifH superfamily contains a variety of proteins which share a common ATP-binding domain | Back alignment and domain information |
|---|
| >PRK14962 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >TIGR01360 aden_kin_iso1 adenylate kinase, isozyme 1 subfamily | Back alignment and domain information |
|---|
| >PF00910 RNA_helicase: RNA helicase; InterPro: IPR000605 Helicases have been classified in 5 superfamilies (SF1-SF5) | Back alignment and domain information |
|---|
| >COG5192 BMS1 GTP-binding protein required for 40S ribosome biogenesis [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >COG1224 TIP49 DNA helicase TIP49, TBP-interacting protein [Transcription] | Back alignment and domain information |
|---|
| >cd01123 Rad51_DMC1_radA Rad51_DMC1_radA,B | Back alignment and domain information |
|---|
| >PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed | Back alignment and domain information |
|---|
| >KOG0923 consensus mRNA splicing factor ATP-dependent RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >COG3854 SpoIIIAA ncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PHA02544 44 clamp loader, small subunit; Provisional | Back alignment and domain information |
|---|
| >PRK03992 proteasome-activating nucleotidase; Provisional | Back alignment and domain information |
|---|
| >cd01125 repA Hexameric Replicative Helicase RepA | Back alignment and domain information |
|---|
| >PRK13531 regulatory ATPase RavA; Provisional | Back alignment and domain information |
|---|
| >TIGR03689 pup_AAA proteasome ATPase | Back alignment and domain information |
|---|
| >TIGR01242 26Sp45 26S proteasome subunit P45 family | Back alignment and domain information |
|---|
| >TIGR01420 pilT_fam pilus retraction protein PilT | Back alignment and domain information |
|---|
| >PRK06762 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >cd00544 CobU Adenosylcobinamide kinase / adenosylcobinamide phosphate guanyltransferase (CobU) | Back alignment and domain information |
|---|
| >smart00763 AAA_PrkA PrkA AAA domain | Back alignment and domain information |
|---|
| >cd02021 GntK Gluconate kinase (GntK) catalyzes the phosphoryl transfer from ATP to gluconate | Back alignment and domain information |
|---|
| >TIGR00750 lao LAO/AO transport system ATPase | Back alignment and domain information |
|---|
| >TIGR03600 phage_DnaB phage replicative helicase, DnaB family, HK022 subfamily | Back alignment and domain information |
|---|
| >PRK12422 chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >PF04665 Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 This entry contains uncharacterised proteins belonging to the B354L family which include the pox virus A32 protein | Back alignment and domain information |
|---|
| >PF12846 AAA_10: AAA-like domain | Back alignment and domain information |
|---|
| >PRK00131 aroK shikimate kinase; Reviewed | Back alignment and domain information |
|---|
| >KOG0731 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK04301 radA DNA repair and recombination protein RadA; Validated | Back alignment and domain information |
|---|
| >PF06309 Torsin: Torsin; InterPro: IPR010448 This family consists of several eukaryotic torsin proteins | Back alignment and domain information |
|---|
| >PRK05541 adenylylsulfate kinase; Provisional | Back alignment and domain information |
|---|
| >PLN03142 Probable chromatin-remodeling complex ATPase chain; Provisional | Back alignment and domain information |
|---|
| >TIGR00176 mobB molybdopterin-guanine dinucleotide biosynthesis protein MobB | Back alignment and domain information |
|---|
| >PRK14530 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK14086 dnaA chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >PRK14963 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PTZ00361 26 proteosome regulatory subunit 4-like protein; Provisional | Back alignment and domain information |
|---|
| >PRK10751 molybdopterin-guanine dinucleotide biosynthesis protein B; Provisional | Back alignment and domain information |
|---|
| >PF01078 Mg_chelatase: Magnesium chelatase, subunit ChlI; InterPro: IPR000523 Magnesium-chelatase is a three-component enzyme that catalyses the insertion of Mg2+ into protoporphyrin IX | Back alignment and domain information |
|---|
| >PTZ00112 origin recognition complex 1 protein; Provisional | Back alignment and domain information |
|---|
| >PRK03839 putative kinase; Provisional | Back alignment and domain information |
|---|
| >cd02020 CMPK Cytidine monophosphate kinase (CMPK) catalyzes the reversible phosphorylation of cytidine monophosphate (CMP) to produce cytidine diphosphate (CDP), using ATP as the preferred phosphoryl donor | Back alignment and domain information |
|---|
| >PF03029 ATP_bind_1: Conserved hypothetical ATP binding protein; InterPro: IPR004130 Members of this family are found in a range of archaea and eukaryotes and have hypothesised ATP binding activity | Back alignment and domain information |
|---|
| >TIGR03574 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal | Back alignment and domain information |
|---|
| >COG0714 MoxR-like ATPases [General function prediction only] | Back alignment and domain information |
|---|
| >PF00931 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is the NB-ARC domain, a novel signalling motif found in bacteria and eukaryotes, shared by plant resistance gene products and regulators of cell death in animals [] | Back alignment and domain information |
|---|
| >PRK14527 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >cd03114 ArgK-like The function of this protein family is unkown | Back alignment and domain information |
|---|
| >cd02025 PanK Pantothenate kinase (PanK) catalyzes the phosphorylation of pantothenic acid to form 4'-phosphopantothenic, which is the first of five steps in coenzyme A (CoA) biosynthetic pathway | Back alignment and domain information |
|---|
| >TIGR00665 DnaB replicative DNA helicase | Back alignment and domain information |
|---|
| >PRK14723 flhF flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >PRK07261 topology modulation protein; Provisional | Back alignment and domain information |
|---|
| >PF13555 AAA_29: P-loop containing region of AAA domain | Back alignment and domain information |
|---|
| >PRK14961 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >cd02028 UMPK_like Uridine monophosphate kinase_like (UMPK_like) is a family of proteins highly similar to the uridine monophosphate kinase (UMPK, EC 2 | Back alignment and domain information |
|---|
| >cd02023 UMPK Uridine monophosphate kinase (UMPK, EC 2 | Back alignment and domain information |
|---|
| >PRK06851 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG0333 consensus U5 snRNP-like RNA helicase subunit [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG4284 consensus DEAD box protein [Transcription] | Back alignment and domain information |
|---|
| >PRK06620 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PHA02244 ATPase-like protein | Back alignment and domain information |
|---|
| >PRK00889 adenylylsulfate kinase; Provisional | Back alignment and domain information |
|---|
| >PF00406 ADK: Adenylate kinase; InterPro: IPR000850 Adenylate kinases (ADK) are phosphotransferases that catalyse the reversible reaction |
Back alignment and domain information |
|---|
| >COG1419 FlhF Flagellar GTP-binding protein [Cell motility and secretion] | Back alignment and domain information |
|---|
| >TIGR02236 recomb_radA DNA repair and recombination protein RadA | Back alignment and domain information |
|---|
| >KOG0952 consensus DNA/RNA helicase MER3/SLH1, DEAD-box superfamily [RNA processing and modification] | Back alignment and domain information |
|---|
| >PLN00020 ribulose bisphosphate carboxylase/oxygenase activase -RuBisCO activase (RCA); Provisional | Back alignment and domain information |
|---|
| >PRK05480 uridine/cytidine kinase; Provisional | Back alignment and domain information |
|---|
| >PRK08506 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >TIGR01313 therm_gnt_kin carbohydrate kinase, thermoresistant glucokinase family | Back alignment and domain information |
|---|
| >cd01428 ADK Adenylate kinase (ADK) catalyzes the reversible phosphoryl transfer from adenosine triphosphates (ATP) to adenosine monophosphates (AMP) and to yield adenosine diphosphates (ADP) | Back alignment and domain information |
|---|
| >PRK14532 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK14531 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK04040 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK06696 uridine kinase; Validated | Back alignment and domain information |
|---|
| >KOG0727 consensus 26S proteasome regulatory complex, ATPase RPT3 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PLN02200 adenylate kinase family protein | Back alignment and domain information |
|---|
| >PHA02542 41 41 helicase; Provisional | Back alignment and domain information |
|---|
| >PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed | Back alignment and domain information |
|---|
| >PRK14956 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PF03308 ArgK: ArgK protein; InterPro: IPR005129 Bacterial periplasmic transport systems require the function of a specific substrate-binding protein, located in the periplasm, and several cytoplasmic membrane transport components | Back alignment and domain information |
|---|
| >PF07726 AAA_3: ATPase family associated with various cellular activities (AAA); InterPro: IPR011703 This entry includes some of the AAA proteins not detected by the IPR003959 from INTERPRO model | Back alignment and domain information |
|---|
| >PF03266 NTPase_1: NTPase; InterPro: IPR004948 This entry represents a family of nucleoside-triphosphatases which have activity towards ATP, GTP, CTP, TTP and UTP and may hydrolyse nucleoside diphosphates with lower efficiency [] | Back alignment and domain information |
|---|
| >TIGR02322 phosphon_PhnN phosphonate metabolism protein/1,5-bisphosphokinase (PRPP-forming) PhnN | Back alignment and domain information |
|---|
| >PRK11747 dinG ATP-dependent DNA helicase DinG; Provisional | Back alignment and domain information |
|---|
| >KOG1533 consensus Predicted GTPase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK09165 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >PRK13900 type IV secretion system ATPase VirB11; Provisional | Back alignment and domain information |
|---|
| >PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional | Back alignment and domain information |
|---|
| >TIGR00041 DTMP_kinase thymidylate kinase | Back alignment and domain information |
|---|
| >cd00227 CPT Chloramphenicol (Cm) phosphotransferase (CPT) | Back alignment and domain information |
|---|
| >KOG0738 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK09376 rho transcription termination factor Rho; Provisional | Back alignment and domain information |
|---|
| >PF13476 AAA_23: AAA domain; PDB: 3AV0_B 3AUY_B 3AUX_A 2O5V_A 3QG5_B 3QF7_A 3THO_A | Back alignment and domain information |
|---|
| >PRK06645 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK13851 type IV secretion system protein VirB11; Provisional | Back alignment and domain information |
|---|
| >PRK12678 transcription termination factor Rho; Provisional | Back alignment and domain information |
|---|
| >TIGR00631 uvrb excinuclease ABC, B subunit | Back alignment and domain information |
|---|
| >PRK07667 uridine kinase; Provisional | Back alignment and domain information |
|---|
| >PRK05439 pantothenate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK02496 adk adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >KOG0651 consensus 26S proteasome regulatory complex, ATPase RPT4 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd02027 APSK Adenosine 5'-phosphosulfate kinase (APSK) catalyzes the phosphorylation of adenosine 5'-phosphosulfate to form 3'-phosphoadenosine 5'-phosphosulfate (PAPS) | Back alignment and domain information |
|---|
| >PLN03187 meiotic recombination protein DMC1 homolog; Provisional | Back alignment and domain information |
|---|
| >KOG0733 consensus Nuclear AAA ATPase (VCP subfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG0541 Ffh Signal recognition particle GTPase [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >PRK09435 membrane ATPase/protein kinase; Provisional | Back alignment and domain information |
|---|
| >PRK13764 ATPase; Provisional | Back alignment and domain information |
|---|
| >PF03215 Rad17: Rad17 cell cycle checkpoint protein | Back alignment and domain information |
|---|
| >PRK05748 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >COG0563 Adk Adenylate kinase and related kinases [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PF13521 AAA_28: AAA domain; PDB: 1LW7_A | Back alignment and domain information |
|---|
| >COG4088 Predicted nucleotide kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PRK14528 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >PF03796 DnaB_C: DnaB-like helicase C terminal domain; InterPro: IPR007694 The hexameric helicase DnaB unwinds the DNA duplex at the Escherichia coli chromosome replication fork | Back alignment and domain information |
|---|
| >TIGR02238 recomb_DMC1 meiotic recombinase Dmc1 | Back alignment and domain information |
|---|
| >PF06068 TIP49: TIP49 C-terminus; InterPro: IPR010339 This family consists of the C-terminal region of several eukaryotic and archaeal RuvB-like 1 (Pontin or TIP49a) and RuvB-like 2 (Reptin or TIP49b) proteins | Back alignment and domain information |
|---|
| >CHL00195 ycf46 Ycf46; Provisional | Back alignment and domain information |
|---|
| >PRK13947 shikimate kinase; Provisional | Back alignment and domain information |
|---|
| >cd02034 CooC The accessory protein CooC, which contains a nucleotide-binding domain (P-loop) near the N-terminus, participates in the maturation of the nickel center of carbon monoxide dehydrogenase (CODH) | Back alignment and domain information |
|---|
| >COG1222 RPT1 ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF00485 PRK: Phosphoribulokinase / Uridine kinase family; InterPro: IPR006083 Phosphoribulokinase (PRK) 2 | Back alignment and domain information |
|---|
| >COG2255 RuvB Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PF05673 DUF815: Protein of unknown function (DUF815); InterPro: IPR008533 This domain consists of several bacterial proteins of unknown function | Back alignment and domain information |
|---|
| >cd00464 SK Shikimate kinase (SK) is the fifth enzyme in the shikimate pathway, a seven-step biosynthetic pathway which converts erythrose-4-phosphate to chorismic acid, found in bacteria, fungi and plants | Back alignment and domain information |
|---|
| >PRK14955 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK09751 putative ATP-dependent helicase Lhr; Provisional | Back alignment and domain information |
|---|
| >PRK05800 cobU adenosylcobinamide kinase/adenosylcobinamide-phosphate guanylyltransferase; Validated | Back alignment and domain information |
|---|
| >PRK14957 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >COG1618 Predicted nucleotide kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR01351 adk adenylate kinases | Back alignment and domain information |
|---|
| >PRK08760 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >PF08433 KTI12: Chromatin associated protein KTI12 ; InterPro: IPR013641 This is a family of chromatin associated proteins which interact with the Elongator complex, a component of the elongating form of RNA polymerase II [] | Back alignment and domain information |
|---|
| >COG1936 Predicted nucleotide kinase (related to CMP and AMP kinases) [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >COG0593 DnaA ATPase involved in DNA replication initiation [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >cd00550 ArsA_ATPase Oxyanion-translocating ATPase (ArsA) | Back alignment and domain information |
|---|
| >PRK05896 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >COG4581 Superfamily II RNA helicase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >KOG0733 consensus Nuclear AAA ATPase (VCP subfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK00279 adk adenylate kinase; Reviewed | Back alignment and domain information |
|---|
| >TIGR00455 apsK adenylylsulfate kinase (apsK) | Back alignment and domain information |
|---|
| >COG0378 HypB Ni2+-binding GTPase involved in regulation of expression and maturation of urease and hydrogenase [Posttranslational modification, protein turnover, chaperones / Transcription] | Back alignment and domain information |
|---|
| >KOG1970 consensus Checkpoint RAD17-RFC complex, RAD17/RAD24 component [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] | Back alignment and domain information |
|---|
| >COG1201 Lhr Lhr-like helicases [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR00554 panK_bact pantothenate kinase, bacterial type | Back alignment and domain information |
|---|
| >PF06414 Zeta_toxin: Zeta toxin; InterPro: IPR010488 This entry represents a domain originally identified in bacterial zeta toxin proteins, where it comprises the whole protein [] | Back alignment and domain information |
|---|
| >TIGR00150 HI0065_YjeE ATPase, YjeE family | Back alignment and domain information |
|---|
| >PHA02530 pseT polynucleotide kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR02397 dnaX_nterm DNA polymerase III, subunit gamma and tau | Back alignment and domain information |
|---|
| >PRK05595 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >cd01672 TMPK Thymidine monophosphate kinase (TMPK), also known as thymidylate kinase, catalyzes the phosphorylation of thymidine monophosphate (TMP) to thymidine diphosphate (TDP) utilizing ATP as its preferred phophoryl donor | Back alignment and domain information |
|---|
| >TIGR00678 holB DNA polymerase III, delta' subunit | Back alignment and domain information |
|---|
| >PHA02624 large T antigen; Provisional | Back alignment and domain information |
|---|
| >PRK05298 excinuclease ABC subunit B; Provisional | Back alignment and domain information |
|---|
| >PRK06547 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR02621 cas3_GSU0051 CRISPR-associated helicase Cas3, Anaes-subtype | Back alignment and domain information |
|---|
| >TIGR01241 FtsH_fam ATP-dependent metalloprotease FtsH | Back alignment and domain information |
|---|
| >COG1223 Predicted ATPase (AAA+ superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >COG0210 UvrD Superfamily I DNA and RNA helicases [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PTZ00088 adenylate kinase 1; Provisional | Back alignment and domain information |
|---|
| >PRK14960 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >TIGR00767 rho transcription termination factor Rho | Back alignment and domain information |
|---|
| >PRK14949 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK14721 flhF flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >PLN02165 adenylate isopentenyltransferase | Back alignment and domain information |
|---|
| >PRK06217 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >COG0470 HolB ATPase involved in DNA replication [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK03846 adenylylsulfate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK14964 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >cd02035 ArsA ArsA ATPase functionas as an efflux pump located on the inner membrane of the cell | Back alignment and domain information |
|---|
| >KOG3347 consensus Predicted nucleotide kinase/nuclear protein involved oxidative stress response [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >KOG0735 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PLN03137 ATP-dependent DNA helicase; Q4-like; Provisional | Back alignment and domain information |
|---|
| >PRK14489 putative bifunctional molybdopterin-guanine dinucleotide biosynthesis protein MobA/MobB; Provisional | Back alignment and domain information |
|---|
| >TIGR00708 cobA cob(I)alamin adenosyltransferase | Back alignment and domain information |
|---|
| >TIGR00764 lon_rel lon-related putative ATP-dependent protease | Back alignment and domain information |
|---|
| >cd03116 MobB Molybdenum is an essential trace element in the form of molybdenum cofactor (Moco) which is associated with the metabolism of nitrogen, carbon and sulfur by redox active enzymes | Back alignment and domain information |
|---|
| >KOG1942 consensus DNA helicase, TBP-interacting protein [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >COG1199 DinG Rad3-related DNA helicases [Transcription / DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK09519 recA DNA recombination protein RecA; Reviewed | Back alignment and domain information |
|---|
| >PRK13407 bchI magnesium chelatase subunit I; Provisional | Back alignment and domain information |
|---|
| >PRK10865 protein disaggregation chaperone; Provisional | Back alignment and domain information |
|---|
| >PRK14493 putative bifunctional molybdopterin-guanine dinucleotide biosynthesis protein MobB/MoaE; Provisional | Back alignment and domain information |
|---|
| >COG1703 ArgK Putative periplasmic protein kinase ArgK and related GTPases of G3E family [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK06761 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF12775 AAA_7: P-loop containing dynein motor region D3; PDB: 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A 3VKH_A 3VKG_A | Back alignment and domain information |
|---|
| >PRK13949 shikimate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK12339 2-phosphoglycerate kinase; Provisional | Back alignment and domain information |
|---|
| >PF01583 APS_kinase: Adenylylsulphate kinase; InterPro: IPR002891 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases | Back alignment and domain information |
|---|
| >PRK00625 shikimate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK01184 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK14970 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >cd01128 rho_factor Transcription termination factor rho is a bacterial ATP-dependent RNA/DNA helicase | Back alignment and domain information |
|---|
| >TIGR01618 phage_P_loop phage nucleotide-binding protein | Back alignment and domain information |
|---|
| >PRK14958 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK05342 clpX ATP-dependent protease ATP-binding subunit ClpX; Provisional | Back alignment and domain information |
|---|
| >PHA03372 DNA packaging terminase subunit 1; Provisional | Back alignment and domain information |
|---|
| >cd02037 MRP-like MRP (Multiple Resistance and pH adaptation) is a homologue of the Fer4_NifH superfamily | Back alignment and domain information |
|---|
| >PRK14494 putative molybdopterin-guanine dinucleotide biosynthesis protein MobB/FeS domain-containing protein protein; Provisional | Back alignment and domain information |
|---|
| >TIGR03263 guanyl_kin guanylate kinase | Back alignment and domain information |
|---|
| >COG0606 Predicted ATPase with chaperone activity [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF02374 ArsA_ATPase: Anion-transporting ATPase; PDB: 2WOO_A 3IBG_B 3SJA_A 3H84_B 3SJD_A 3ZS9_A 3A37_A 2WOJ_A 3SJC_B 3A36_B | Back alignment and domain information |
|---|
| >PRK14952 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK00698 tmk thymidylate kinase; Validated | Back alignment and domain information |
|---|
| >PRK14738 gmk guanylate kinase; Provisional | Back alignment and domain information |
|---|
| >KOG0335 consensus ATP-dependent RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >PRK09087 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK08356 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >cd02024 NRK1 Nicotinamide riboside kinase (NRK) is an enzyme involved in the metabolism of nicotinamide adenine dinucleotide (NAD+) | Back alignment and domain information |
|---|
| >KOG0734 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR00235 udk uridine kinase | Back alignment and domain information |
|---|
| >COG0464 SpoVK ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd02117 NifH_like This family contains the NifH (iron protein) of nitrogenase, L subunit (BchL/ChlL) of the protochlorophyllide reductase and the BchX subunit of the Chlorophyllide reductase | Back alignment and domain information |
|---|
| >PRK05986 cob(I)alamin adenolsyltransferase/cobinamide ATP-dependent adenolsyltransferase; Validated | Back alignment and domain information |
|---|
| >PRK14737 gmk guanylate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK08154 anaerobic benzoate catabolism transcriptional regulator; Reviewed | Back alignment and domain information |
|---|
| >KOG0948 consensus Nuclear exosomal RNA helicase MTR4, DEAD-box superfamily [RNA processing and modification] | Back alignment and domain information |
|---|
| >PHA02774 E1; Provisional | Back alignment and domain information |
|---|
| >PRK14526 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK10078 ribose 1,5-bisphosphokinase; Provisional | Back alignment and domain information |
|---|
| >PRK00300 gmk guanylate kinase; Provisional | Back alignment and domain information |
|---|
| >cd00561 CobA_CobO_BtuR ATP:corrinoid adenosyltransferase BtuR/CobO/CobP | Back alignment and domain information |
|---|
| >PF13479 AAA_24: AAA domain | Back alignment and domain information |
|---|
| >COG0466 Lon ATP-dependent Lon protease, bacterial type [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK13975 thymidylate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK15453 phosphoribulokinase; Provisional | Back alignment and domain information |
|---|
| >PRK14529 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR02688 conserved hypothetical protein TIGR02688 | Back alignment and domain information |
|---|
| >TIGR00382 clpX endopeptidase Clp ATP-binding regulatory subunit (clpX) | Back alignment and domain information |
|---|
| >cd00071 GMPK Guanosine monophosphate kinase (GMPK, EC 2 | Back alignment and domain information |
|---|
| >TIGR03819 heli_sec_ATPase helicase/secretion neighborhood ATPase | Back alignment and domain information |
|---|
| >TIGR03575 selen_PSTK_euk L-seryl-tRNA(Sec) kinase, eukaryotic | Back alignment and domain information |
|---|
| >CHL00176 ftsH cell division protein; Validated | Back alignment and domain information |
|---|
| >PRK14969 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK13765 ATP-dependent protease Lon; Provisional | Back alignment and domain information |
|---|
| >PRK14954 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >cd03112 CobW_like The function of this protein family is unkown | Back alignment and domain information |
|---|
| >PF05127 Helicase_RecD: Helicase; InterPro: IPR007807 This domain is about 350 amino acid residues long and appears to have a P-loop motif, suggesting this is an ATPase | Back alignment and domain information |
|---|
| >PLN02674 adenylate kinase | Back alignment and domain information |
|---|
| >PRK09825 idnK D-gluconate kinase; Provisional | Back alignment and domain information |
|---|
| >PTZ00035 Rad51 protein; Provisional | Back alignment and domain information |
|---|
| >KOG0742 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST
Original result of BLAST against Protein Data Bank
| ID | Alignment Graph | Length |
Definition |
E-value | |
| Query | 1456 | ||||
| 2wjv_A | 800 | Crystal Structure Of The Complex Between Human Nons | 9e-19 | ||
| 2gjk_A | 624 | Structural And Functional Insights Into The Human U | 2e-18 | ||
| 2xzo_A | 623 | Upf1 Helicase - Rna Complex Length = 623 | 2e-18 | ||
| 2xzl_A | 802 | Upf1-Rna Complex Length = 802 | 5e-17 | ||
| 4b3g_A | 646 | Crystal Structure Of Ighmbp2 Helicase In Complex Wi | 2e-08 | ||
| 4b3f_X | 646 | Crystal Structure Of 1ghmbp2 Helicase Length = 646 | 2e-08 |
| >pdb|2WJV|A Chain A, Crystal Structure Of The Complex Between Human Nonsense Mediated Decay Factors Upf1 And Upf2 Length = 800 | Back alignment and structure |
|
| >pdb|2GJK|A Chain A, Structural And Functional Insights Into The Human Upf1 Helicase Core Length = 624 | Back alignment and structure |
| >pdb|2XZO|A Chain A, Upf1 Helicase - Rna Complex Length = 623 | Back alignment and structure |
| >pdb|2XZL|A Chain A, Upf1-Rna Complex Length = 802 | Back alignment and structure |
| >pdb|4B3G|A Chain A, Crystal Structure Of Ighmbp2 Helicase In Complex With Rna Length = 646 | Back alignment and structure |
| >pdb|4B3F|X Chain X, Crystal Structure Of 1ghmbp2 Helicase Length = 646 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST
Original result of RPS-BLAST against PDB70 database
| >2gk6_A Regulator of nonsense transcripts 1; UPF1, helicase, NMD, hydrolase; HET: ADP; 2.40A {Homo sapiens} PDB: 2gjk_A* 2gk7_A 2xzo_A* 2xzp_A Length = 624 | Back alignment and structure |
|---|
Score = 165 bits (419), Expect = 1e-42
Identities = 90/372 (24%), Positives = 149/372 (40%), Gaps = 56/372 (15%)
Query: 973 EGKPTFVRDRFPFKEFFSNTPQPIFTGDSFEKDMRAAKGCFRHLQTLFQELEECRAFE-- 1030
+ VR +E ++P + ++M + + LQ L E E + +
Sbjct: 246 QTGLKVVRLCAKSREAI-DSPVSFLALHNQIRNMDSMP-ELQKLQQLKDETGELSSADEK 303
Query: 1031 LLKSTADRANYLMTKQAKIVAMTCT---HAALKRKDFLQLGFKYDNLLMEESAQILEIET 1087
++ A + A ++ TC L + F ++L++ES Q E E
Sbjct: 304 RYRALKRTAERELLMNADVICCTCVGAGDPRLAKMQF-------RSILIDESTQATEPEC 356
Query: 1088 FIPMLLNDRRM--------LPPVVKNMAFQKYSHMDQSLFTRFVRLGIPYIELNAQGRAR 1139
+P++L +++ L PVV K + QSLF R V LGI I L Q R
Sbjct: 357 MVPVVLGAKQLILVGDHCQLGPVVMCKKAAKAG-LSQSLFERLVVLGIRPIRLQVQYRMH 415
Query: 1140 PSIAQLYNWRY-------------RDLGDLPFLVDVPD-----YNGRGE-----SAPSPW 1176
P+++ + + R F PD Y +G+ S S
Sbjct: 416 PALSAFPSNIFYEGSLQNGVTAADRVKKGFDFQWPQPDKPMFFYVTQGQEEIASSGTS-- 473
Query: 1177 FYQNEGEAEYVVSVYIYMRLLGYPANKISILTTYNGQKLLIRDVINRQCVPYPFIGPPSK 1236
Y N EA V + + G ++I I+T Y GQ+ + + + + +
Sbjct: 474 -YLNRTEAANVEKITTKLLKAGAKPDQIGIITPYEGQRSYLVQYMQFSGSLHTKLYQEVE 532
Query: 1237 VTTVDKFQGQQNDFILLSLVRT---RFVGHLRDVRRLVVAMSRARLGLYVFCRRSLFEQC 1293
+ +VD FQG++ DFI+LS VR + +G L D RRL VA++RAR G+ + +
Sbjct: 533 IASVDAFQGREKDFIILSCVRANEHQGIGFLNDPRRLNVALTRARYGVIIVGNPKALSKQ 592
Query: 1294 YELQPTFRLLLQ 1305
P + LL
Sbjct: 593 ----PLWNHLLN 600
|
| >2gk6_A Regulator of nonsense transcripts 1; UPF1, helicase, NMD, hydrolase; HET: ADP; 2.40A {Homo sapiens} PDB: 2gjk_A* 2gk7_A 2xzo_A* 2xzp_A Length = 624 | Back alignment and structure |
|---|
| >2wjy_A Regulator of nonsense transcripts 1; nonsense mediated decay, zinc-finger, ATP-binding, metal-BIN UPF2, UPF1, helicase, hydrolase; 2.50A {Homo sapiens} PDB: 2wjv_A 2iyk_A Length = 800 | Back alignment and structure |
|---|
| >2wjy_A Regulator of nonsense transcripts 1; nonsense mediated decay, zinc-finger, ATP-binding, metal-BIN UPF2, UPF1, helicase, hydrolase; 2.50A {Homo sapiens} PDB: 2wjv_A 2iyk_A Length = 800 | Back alignment and structure |
|---|
| >2xzl_A ATP-dependent helicase NAM7; hydrolase-RNA complex, NMD, RNA degradation, allosteric REGU; HET: ADP 1PE; 2.40A {Saccharomyces cerevisiae} Length = 802 | Back alignment and structure |
|---|
| >2xzl_A ATP-dependent helicase NAM7; hydrolase-RNA complex, NMD, RNA degradation, allosteric REGU; HET: ADP 1PE; 2.40A {Saccharomyces cerevisiae} Length = 802 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch
Original result of HHsearch against PDB70 database
No hit with probability above 80.00
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST
Original result of RPS-BLAST against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
E-value |
| 1456 | ||||
| d1uaaa1 | 306 | c.37.1.19 (A:2-307) DEXX box DNA helicase {Escheri | 3e-04 | |
| d1nlfa_ | 274 | c.37.1.11 (A:) Hexameric replicative helicase repA | 0.003 | |
| g1qhh.1 | 623 | c.37.1.19 (A:,B:,C:,D:) DEXX box DNA helicase {Bac | 0.004 |
| >d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} Length = 306 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: P-loop containing nucleoside triphosphate hydrolases superfamily: P-loop containing nucleoside triphosphate hydrolases family: Tandem AAA-ATPase domain domain: DEXX box DNA helicase species: Escherichia coli, RepD [TaxId: 562]
Score = 42.0 bits (97), Expect = 3e-04
Identities = 16/74 (21%), Positives = 32/74 (43%), Gaps = 4/74 (5%)
Query: 819 RFTPTQVGAIISGIQPGLTMVVGPPGTGKTDTAVQ-ILNVLY-HNCPSQRTLIITHSNQA 876
R P Q A+ P +V+ G+GKT I +++ ++ +T +N+A
Sbjct: 1 RLNPGQQQAVEFVTGP--CLVLAGAGSGKTRVITNKIAHLIRGCGYQARHIAAVTFTNKA 58
Query: 877 LNDLFEKIMQRDVP 890
++ E++ Q
Sbjct: 59 AREMKERVGQTLGR 72
|
| >d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} Length = 274 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch
Original result of HHsearch against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 1456 | |||
| g1qhh.1 | 623 | DEXX box DNA helicase {Bacillus stearothermophilus | 99.95 | |
| d1uaaa1 | 306 | DEXX box DNA helicase {Escherichia coli, RepD [Tax | 99.86 | |
| d1w36d1 | 359 | Exodeoxyribonuclease V alpha chain (RecD) {Escheri | 99.8 | |
| d1pjra1 | 318 | DEXX box DNA helicase {Bacillus stearothermophilus | 99.8 | |
| d1w36b1 | 485 | Exodeoxyribonuclease V beta chain (RecB), N-termin | 99.45 | |
| d2fz4a1 | 206 | DNA repair protein RAD25 {Archaeoglobus fulgidus [ | 98.99 | |
| d1gkub1 | 237 | Helicase-like "domain" of reverse gyrase {Archaeon | 98.78 | |
| d1rifa_ | 282 | DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665] | 98.75 | |
| d1wp9a1 | 200 | putative ATP-dependent RNA helicase PF2015 {Pyroco | 98.74 | |
| d1uaaa2 | 333 | DEXX box DNA helicase {Escherichia coli, RepD [Tax | 98.72 | |
| d2p6ra3 | 202 | Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 | 98.69 | |
| d1pjra2 | 333 | DEXX box DNA helicase {Bacillus stearothermophilus | 98.65 | |
| d1w36b2 | 395 | Exodeoxyribonuclease V beta chain (RecB), N-termin | 98.61 | |
| d1gm5a3 | 264 | RecG helicase domain {Thermotoga maritima [TaxId: | 98.57 | |
| d1hv8a1 | 208 | Putative DEAD box RNA helicase {Archaeon Methanoco | 98.43 | |
| d2g9na1 | 218 | Initiation factor 4a {Human (Homo sapiens) [TaxId: | 98.33 | |
| d1qdea_ | 212 | Initiation factor 4a {Baker's yeast (Saccharomyces | 98.31 | |
| d2bmfa2 | 305 | Dengue virus helicase {Dengue virus type 2 [TaxId: | 98.23 | |
| d1a1va1 | 136 | HCV helicase domain {Human hepatitis C virus (HCV) | 98.2 | |
| d2j0sa1 | 222 | Probable ATP-dependent RNA helicase DDX48 {Human ( | 98.18 | |
| d1w36d2 | 246 | Exodeoxyribonuclease V alpha chain (RecD) {Escheri | 98.16 | |
| d1veca_ | 206 | DEAD box RNA helicase rck/p54 {Human (Homo sapiens | 98.16 | |
| d1t6na_ | 207 | Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo | 98.09 | |
| d1oywa2 | 206 | RecQ helicase domain {Escherichia coli [TaxId: 562 | 98.09 | |
| d1wrba1 | 238 | putative ATP-dependent RNA helicase VlgB {Flatworm | 98.05 | |
| d2eyqa3 | 233 | Transcription-repair coupling factor, TRCF {Escher | 98.05 | |
| d1z63a1 | 230 | Helicase of the SNF2/Rad54 hamily {Sulfolobus solf | 97.91 | |
| d1s2ma1 | 206 | Putative ATP-dependent RNA helicase DHH1 {Baker's | 97.87 | |
| d1yksa1 | 140 | YFV helicase domain {Yellow fever virus [TaxId: 11 | 97.86 | |
| d1z3ix2 | 298 | Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxI | 97.78 | |
| d1ls1a2 | 207 | GTPase domain of the signal sequence recognition p | 97.7 | |
| d2qy9a2 | 211 | GTPase domain of the signal recognition particle r | 97.63 | |
| d1okkd2 | 207 | GTPase domain of the signal recognition particle r | 97.62 | |
| d1vmaa2 | 213 | GTPase domain of the signal recognition particle r | 97.58 | |
| d1j8yf2 | 211 | GTPase domain of the signal sequence recognition p | 97.57 | |
| d1fnna2 | 276 | CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T | 97.42 | |
| d1tf7a2 | 242 | Circadian clock protein KaiC {Synechococcus sp. st | 97.34 | |
| d1p9ra_ | 401 | Extracellular secretion NTPase EpsE {Vibrio choler | 97.26 | |
| d1q0ua_ | 209 | Probable DEAD box RNA helicase YqfR {Bacillus stea | 97.25 | |
| d2i3ba1 | 189 | Cancer-related NTPase, C1orf57 {Human (Homo sapien | 97.23 | |
| d1in4a2 | 238 | Holliday junction helicase RuvB {Thermotoga mariti | 97.1 | |
| d1np6a_ | 170 | Molybdopterin-guanine dinucleotide biosynthesis pr | 97.09 | |
| d1cr2a_ | 277 | Gene 4 protein (g4p, DNA primase), helicase domain | 97.01 | |
| d1gvnb_ | 273 | Plasmid maintenance system epsilon/zeta, toxin zet | 96.99 | |
| d1sxja2 | 253 | Replication factor C1 {Baker's yeast (Saccharomyce | 96.91 | |
| d1iqpa2 | 231 | Replication factor C {Archaeon Pyrococcus furiosus | 96.89 | |
| d1ofha_ | 309 | HslU {Haemophilus influenzae [TaxId: 727]} | 96.78 | |
| d1d2na_ | 246 | Hexamerization domain of N-ethylmalemide-sensitive | 96.71 | |
| d1svma_ | 362 | Papillomavirus large T antigen helicase domain {Si | 96.71 | |
| d1sxjc2 | 227 | Replication factor C3 {Baker's yeast (Saccharomyce | 96.69 | |
| d1sxje2 | 252 | Replication factor C5 {Baker's yeast (Saccharomyce | 96.69 | |
| d1t5la1 | 413 | Nucleotide excision repair enzyme UvrB {Bacillus c | 96.69 | |
| d1sxjd2 | 237 | Replication factor C2 {Baker's yeast (Saccharomyce | 96.68 | |
| d1sxjb2 | 224 | Replication factor C4 {Baker's yeast (Saccharomyce | 96.66 | |
| d1ixsb2 | 239 | Holliday junction helicase RuvB {Thermus thermophi | 96.63 | |
| d1w5sa2 | 287 | CDC6-like protein APE0152, N-terminal domain {Aero | 96.63 | |
| d1l8qa2 | 213 | Chromosomal replication initiation factor DnaA {Aq | 96.6 | |
| d1ixza_ | 247 | AAA domain of cell division protein FtsH {Thermus | 96.58 | |
| d1khta_ | 190 | Adenylate kinase {Archaeon Methanococcus voltae [T | 96.55 | |
| d1lv7a_ | 256 | AAA domain of cell division protein FtsH {Escheric | 96.43 | |
| d1w36c2 | 470 | Exodeoxyribonuclease V gamma chain (RecC), N-termi | 96.41 | |
| d1pzna2 | 254 | DNA repair protein Rad51, catalytic domain {Archae | 96.32 | |
| d1szpa2 | 251 | DNA repair protein Rad51, catalytic domain {Baker' | 96.31 | |
| d1u94a1 | 263 | RecA protein, ATPase-domain {Escherichia coli [Tax | 96.28 | |
| d2bdta1 | 176 | Hypothetical protein BH3686 {Bacillus halodurans [ | 96.25 | |
| d1qf9a_ | 194 | UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 | 96.23 | |
| d1v5wa_ | 258 | Meiotic recombination protein DMC1/LIM15 homolog { | 96.21 | |
| d1ckea_ | 225 | CMP kinase {Escherichia coli [TaxId: 562]} | 96.2 | |
| d1xjca_ | 165 | Molybdopterin-guanine dinucleotide biosynthesis pr | 96.18 | |
| d1e32a2 | 258 | Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu | 96.17 | |
| d1rkba_ | 173 | Adenylate kinase {Human (Homo sapiens), isoenzyme | 96.17 | |
| d1bifa1 | 213 | 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata | 96.08 | |
| d1knqa_ | 171 | Gluconate kinase {Escherichia coli [TaxId: 562]} | 96.05 | |
| d1qhxa_ | 178 | Chloramphenicol phosphotransferase {Streptomyces v | 96.02 | |
| d1nlfa_ | 274 | Hexameric replicative helicase repA {Escherichia c | 96.01 | |
| d1n0wa_ | 242 | DNA repair protein Rad51, catalytic domain {Human | 96.0 | |
| d1njfa_ | 239 | delta prime subunit of DNA polymerase III, N-domai | 96.0 | |
| d1nksa_ | 194 | Adenylate kinase {Archaeon Sulfolobus acidocaldari | 95.98 | |
| d2qm8a1 | 323 | Metallochaperone MeaB {Methylobacterium extorquens | 95.95 | |
| d1tf7a1 | 242 | Circadian clock protein KaiC {Synechococcus sp. st | 95.93 | |
| d1teva_ | 194 | UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] | 95.88 | |
| d1w44a_ | 321 | NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} | 95.83 | |
| d1m8pa3 | 183 | ATP sulfurylase C-terminal domain {Fungus (Penicil | 95.81 | |
| d2i1qa2 | 258 | DNA repair protein Rad51, catalytic domain {Archae | 95.74 | |
| d1ly1a_ | 152 | Polynucleotide kinase, kinase domain {Bacteriophag | 95.7 | |
| d1zina1 | 182 | Adenylate kinase {Bacillus stearothermophilus [Tax | 95.63 | |
| d3adka_ | 194 | Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} | 95.63 | |
| d1lw7a2 | 192 | Transcriptional regulator NadR, ribosylnicotinamid | 95.63 | |
| d1e6ca_ | 170 | Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax | 95.62 | |
| d1zp6a1 | 176 | Hypothetical protein Atu3015 {Agrobacterium tumefa | 95.61 | |
| d1zaka1 | 189 | Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} | 95.59 | |
| d1kaga_ | 169 | Shikimate kinase (AroK) {Escherichia coli [TaxId: | 95.47 | |
| d1c4oa1 | 408 | Nucleotide excision repair enzyme UvrB {Thermus th | 95.47 | |
| d2p67a1 | 327 | LAO/AO transport system kinase ArgK {Escherichia c | 95.46 | |
| d1r7ra3 | 265 | Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu | 95.43 | |
| d1a5ta2 | 207 | delta prime subunit of DNA polymerase III, N-domai | 95.42 | |
| d1ukza_ | 196 | Uridylate kinase {Baker's yeast (Saccharomyces cer | 95.38 | |
| d2cdna1 | 181 | Adenylate kinase {Mycobacterium tuberculosis [TaxI | 95.38 | |
| d1mo6a1 | 269 | RecA protein, ATPase-domain {Mycobacterium tubercu | 95.38 | |
| d1q3ta_ | 223 | CMP kinase {Streptococcus pneumoniae [TaxId: 1313] | 95.35 | |
| d2iyva1 | 165 | Shikimate kinase (AroK) {Mycobacterium tuberculosi | 95.33 | |
| d1ak2a1 | 190 | Adenylate kinase {Cow (Bos taurus), mitochondrial | 95.32 | |
| d1s3ga1 | 182 | Adenylate kinase {Bacillus globisporus [TaxId: 145 | 95.29 | |
| d1yj5a2 | 172 | 5' polynucleotide kinase-3' phosphatase, C-termina | 95.29 | |
| d1e9ra_ | 433 | Bacterial conjugative coupling protein TrwB {Esche | 95.26 | |
| d1ihua1 | 296 | Arsenite-translocating ATPase ArsA {Escherichia co | 95.23 | |
| d1xp8a1 | 268 | RecA protein, ATPase-domain {Deinococcus radiodura | 95.16 | |
| d1ye8a1 | 178 | Hypothetical kinase-like protein Aq_1292 {Aquifex | 95.15 | |
| d1y63a_ | 174 | Probable kinase LmjF30.1890 {Leishmania major [Tax | 95.1 | |
| d2fnaa2 | 283 | Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ | 95.08 | |
| d1rz3a_ | 198 | Hypothetical protein rbstp0775 {Bacillus stearothe | 95.07 | |
| d1g6oa_ | 323 | Hexameric traffic ATPase, HP0525 {Helicobacter pyl | 95.04 | |
| d1e4va1 | 179 | Adenylate kinase {Escherichia coli [TaxId: 562]} | 94.99 | |
| d1g8pa_ | 333 | ATPase subunit of magnesium chelatase, BchI {Rhodo | 94.94 | |
| d1akya1 | 180 | Adenylate kinase {Baker's yeast (Saccharomyces cer | 94.93 | |
| d2ak3a1 | 189 | Adenylate kinase {Cow (Bos taurus), mitochondrial | 94.92 | |
| d1x6va3 | 195 | Adenosine-5'phosphosulfate kinase (APS kinase) {Hu | 94.85 | |
| d1r6bx2 | 268 | ClpA, an Hsp100 chaperone, AAA+ modules {Escherich | 94.78 | |
| d1jbka_ | 195 | ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} | 94.75 | |
| d1ny5a2 | 247 | Transcriptional activator sigm54 (NtrC1), C-termin | 94.67 | |
| d1sq5a_ | 308 | Pantothenate kinase PanK {Escherichia coli [TaxId: | 94.41 | |
| d1viaa_ | 161 | Shikimate kinase (AroK) {Campylobacter jejuni [Tax | 94.38 | |
| d1xpua3 | 289 | Transcription termination factor Rho, ATPase domai | 94.36 | |
| d1qvra2 | 387 | ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 | 94.25 | |
| d1odfa_ | 286 | Hypothetical protein Ygr205W {Baker's yeast (Sacch | 94.12 | |
| d1nija1 | 222 | Hypothetical protein YjiA, N-terminal domain {Esch | 93.88 | |
| d1m7ga_ | 208 | Adenosine-5'phosphosulfate kinase (APS kinase) {Fu | 93.86 | |
| d1ihua2 | 279 | Arsenite-translocating ATPase ArsA {Escherichia co | 93.72 | |
| d1yrba1 | 244 | ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss | 93.31 | |
| d1nn5a_ | 209 | Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 | 93.12 | |
| d1g41a_ | 443 | HslU {Haemophilus influenzae [TaxId: 727]} | 93.07 | |
| d1gkya_ | 186 | Guanylate kinase {Baker's yeast (Saccharomyces cer | 93.02 | |
| d1lvga_ | 190 | Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 | 92.68 | |
| d4tmka_ | 210 | Thymidylate kinase {Escherichia coli [TaxId: 562]} | 92.58 | |
| g1f2t.1 | 292 | Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} | 92.31 | |
| d1tuea_ | 205 | Replication protein E1 helicase domain {Human papi | 92.28 | |
| d2afhe1 | 289 | Nitrogenase iron protein {Azotobacter vinelandii [ | 92.13 | |
| d1r6bx3 | 315 | ClpA, an Hsp100 chaperone, AAA+ modules {Escherich | 92.0 | |
| d1znwa1 | 182 | Guanylate kinase {Mycobacterium tuberculosis [TaxI | 91.91 | |
| d1byia_ | 224 | Dethiobiotin synthetase {Escherichia coli [TaxId: | 91.86 | |
| d1qvra3 | 315 | ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 | 91.61 | |
| d1gsia_ | 208 | Thymidylate kinase {Mycobacterium tuberculosis [Ta | 91.6 | |
| d2gnoa2 | 198 | gamma subunit of DNA polymerase III, N-domain {The | 91.58 | |
| d2a5yb3 | 277 | CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI | 91.47 | |
| d1cp2a_ | 269 | Nitrogenase iron protein {Clostridium pasteurianum | 91.11 | |
| d1hyqa_ | 232 | Cell division regulator MinD {Archaeon Archaeoglob | 90.87 | |
| g1xew.1 | 329 | Smc head domain {Pyrococcus furiosus [TaxId: 2261] | 90.75 | |
| d1s96a_ | 205 | Guanylate kinase {Escherichia coli [TaxId: 562]} | 90.15 | |
| d1uj2a_ | 213 | Uridine-cytidine kinase 2 {Human (Homo sapiens) [T | 89.68 | |
| d1a7ja_ | 288 | Phosphoribulokinase {Rhodobacter sphaeroides [TaxI | 89.48 | |
| d1g3qa_ | 237 | Cell division regulator MinD {Archaeon Pyrococcus | 89.25 | |
| d1kgda_ | 178 | Guanylate kinase-like domain of Cask {Human (Homo | 89.18 | |
| d2jdid3 | 276 | Central domain of beta subunit of F1 ATP synthase | 89.11 | |
| d1um8a_ | 364 | ClpX {Helicobacter pylori [TaxId: 210]} | 87.97 | |
| g1ii8.1 | 369 | Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} | 87.37 | |
| d1w1wa_ | 427 | Smc head domain {Baker's yeast (Saccharomyces cere | 86.69 | |
| d1r8sa_ | 160 | ADP-ribosylation factor {Human (Homo sapiens), ARF | 86.19 | |
| d1kkma_ | 176 | HPr kinase HprK C-terminal domain {Lactobacillus c | 85.86 | |
| d1uf9a_ | 191 | Dephospho-CoA kinase {Thermus thermophilus [TaxId: | 84.62 | |
| d1u0ja_ | 267 | Rep 40 protein helicase domain {Adeno-associated v | 84.47 | |
| d2ocpa1 | 241 | Deoxyguanosine kinase {Human (Homo sapiens) [TaxId | 84.41 | |
| d2a5ja1 | 173 | Rab2b {Human (Homo sapiens) [TaxId: 9606]} | 84.37 | |
| d1nrjb_ | 209 | Signal recognition particle receptor beta-subunit | 83.68 | |
| d2fh5b1 | 207 | Signal recognition particle receptor beta-subunit | 83.25 | |
| d2qtvb1 | 166 | SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta | 83.1 | |
| d1ko7a2 | 169 | HPr kinase HprK C-terminal domain {Staphylococcus | 82.99 | |
| d1knxa2 | 177 | HPr kinase HprK C-terminal domain {Mycoplasma pneu | 82.93 | |
| d2f7sa1 | 186 | Rab27b {Human (Homo sapiens) [TaxId: 9606]} | 81.93 | |
| d1ksha_ | 165 | ADP-ribosylation factor {Mouse (Mus musculus), ARL | 81.8 | |
| d2f9la1 | 175 | Rab11b {Human (Homo sapiens) [TaxId: 9606]} | 81.2 | |
| d1vhta_ | 208 | Dephospho-CoA kinase {Escherichia coli [TaxId: 562 | 80.81 | |
| d1upta_ | 169 | ADP-ribosylation factor {Human (Homo sapiens), ARL | 80.74 | |
| d1zj6a1 | 177 | ADP-ribosylation factor {Human (Homo sapiens), ARL | 80.63 | |
| d2bcgy1 | 194 | GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisi | 80.59 | |
| d1xx6a1 | 141 | Thymidine kinase, TK1, N-terminal domain {Clostrid | 80.06 |
| >d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1w36b1 c.37.1.19 (B:1-485) Exodeoxyribonuclease V beta chain (RecB), N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1rifa_ c.37.1.23 (A:) DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665]} | Back information, alignment and structure |
|---|
| >d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1uaaa2 c.37.1.19 (A:308-640) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1pjra2 c.37.1.19 (A:319-651) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1w36b2 c.37.1.19 (B:486-880) Exodeoxyribonuclease V beta chain (RecB), N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d2g9na1 c.37.1.19 (A:21-238) Initiation factor 4a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} | Back information, alignment and structure |
|---|
| >d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} | Back information, alignment and structure |
|---|
| >d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1w36d2 c.37.1.19 (D:361-606) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1veca_ c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1t6na_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1oywa2 c.37.1.19 (A:1-206) RecQ helicase domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1wrba1 c.37.1.19 (A:164-401) putative ATP-dependent RNA helicase VlgB {Flatworm (Dugesia japonica) [TaxId: 6161]} | Back information, alignment and structure |
|---|
| >d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1z63a1 c.37.1.19 (A:432-661) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1s2ma1 c.37.1.19 (A:46-251) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} | Back information, alignment and structure |
|---|
| >d1z3ix2 c.37.1.19 (X:92-389) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]} | Back information, alignment and structure |
|---|
| >d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} | Back information, alignment and structure |
|---|
| >d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} | Back information, alignment and structure |
|---|
| >d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} | Back information, alignment and structure |
|---|
| >d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d1q0ua_ c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} | Back information, alignment and structure |
|---|
| >d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} | Back information, alignment and structure |
|---|
| >d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} | Back information, alignment and structure |
|---|
| >d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1t5la1 c.37.1.19 (A:2-414) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} | Back information, alignment and structure |
|---|
| >d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} | Back information, alignment and structure |
|---|
| >d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1w36c2 c.37.1.19 (C:348-817) Exodeoxyribonuclease V gamma chain (RecC), N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} | Back information, alignment and structure |
|---|
| >d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} | Back information, alignment and structure |
|---|
| >d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} | Back information, alignment and structure |
|---|
| >d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} | Back information, alignment and structure |
|---|
| >d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} | Back information, alignment and structure |
|---|
| >d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} | Back information, alignment and structure |
|---|
| >d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} | Back information, alignment and structure |
|---|
| >d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} | Back information, alignment and structure |
|---|
| >d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} | Back information, alignment and structure |
|---|
| >d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} | Back information, alignment and structure |
|---|
| >d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} | Back information, alignment and structure |
|---|
| >d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} | Back information, alignment and structure |
|---|
| >d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1c4oa1 c.37.1.19 (A:2-409) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} | Back information, alignment and structure |
|---|
| >d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1e9ra_ c.37.1.11 (A:) Bacterial conjugative coupling protein TrwB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ihua1 c.37.1.10 (A:1-296) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]} | Back information, alignment and structure |
|---|
| >d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} | Back information, alignment and structure |
|---|
| >d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} | Back information, alignment and structure |
|---|
| >d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ny5a2 c.37.1.20 (A:138-384) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} | Back information, alignment and structure |
|---|
| >d1xpua3 c.37.1.11 (A:129-417) Transcription termination factor Rho, ATPase domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1nija1 c.37.1.10 (A:2-223) Hypothetical protein YjiA, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} | Back information, alignment and structure |
|---|
| >d1ihua2 c.37.1.10 (A:308-586) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} | Back information, alignment and structure |
|---|
| >d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1tuea_ c.37.1.20 (A:) Replication protein E1 helicase domain {Human papillomavirus type 18 [TaxId: 333761]} | Back information, alignment and structure |
|---|
| >d2afhe1 c.37.1.10 (E:1-289) Nitrogenase iron protein {Azotobacter vinelandii [TaxId: 354]} | Back information, alignment and structure |
|---|
| >d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1byia_ c.37.1.10 (A:) Dethiobiotin synthetase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1cp2a_ c.37.1.10 (A:) Nitrogenase iron protein {Clostridium pasteurianum [TaxId: 1501]} | Back information, alignment and structure |
|---|
| >d1hyqa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]} | Back information, alignment and structure |
|---|
| >d1g3qa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2jdid3 c.37.1.11 (D:82-357) Central domain of beta subunit of F1 ATP synthase {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d1w1wa_ c.37.1.12 (A:) Smc head domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kkma_ c.91.1.2 (A:) HPr kinase HprK C-terminal domain {Lactobacillus casei [TaxId: 1582]} | Back information, alignment and structure |
|---|
| >d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1u0ja_ c.37.1.20 (A:) Rep 40 protein helicase domain {Adeno-associated virus 2, AAV2 [TaxId: 10804]} | Back information, alignment and structure |
|---|
| >d2ocpa1 c.37.1.1 (A:37-277) Deoxyguanosine kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1ko7a2 c.91.1.2 (A:130-298) HPr kinase HprK C-terminal domain {Staphylococcus xylosus [TaxId: 1288]} | Back information, alignment and structure |
|---|
| >d1knxa2 c.91.1.2 (A:133-309) HPr kinase HprK C-terminal domain {Mycoplasma pneumoniae [TaxId: 2104]} | Back information, alignment and structure |
|---|
| >d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vhta_ c.37.1.1 (A:) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1xx6a1 c.37.1.24 (A:2-142) Thymidine kinase, TK1, N-terminal domain {Clostridium acetobutylicum [TaxId: 1488]} | Back information, alignment and structure |
|---|