Citrus Sinensis ID: 000523


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------1000------1010------1020------1030------1040------1050------1060------1070------1080------1090------1100------1110------1120------1130------1140------1150------1160------1170------1180------1190------1200------1210------1220------1230------1240------1250------1260------1270------1280------1290------1300------1310------1320------1330------1340------1350------1360------1370------1380------1390------1400------1410------1420------1430------1440-----
MEGTHDIFMASTSLRRSASRWNTNSIGAFSRSSREEDDEEALKWAALEKLPTYNRLRKGILTTSRGEANEVDVYNLGLQERQRLIDKLVKVTDVDNERFLLKLKNRIDRVGIDLPKVEVRYEHLNVEAEAFLASNALPSFIKFYTNIFEDILNYLRIIPSKKRHLTILKDVSGVIKPGRLTLLLGPPSSGKTTLLLALAGKLDPTLKVSGTVTYNGHDMDEFVPQRTAAYISQHDNHIGEMTVRETLAFSARCQGVGTRYEMLTELARREKAAGIKPDPDIDVYMKAIATEGQEANVITDYYLKVLGLDVCADTMVGDEMIRGISGGQKKRVTTGEMMVGPALALFMDEISTGLDSSTTFQIVNCLRQNIHINSGTAVISLLQPAPETYDLFDDIILLSDGQIVYQGPRELVLEFFASMGFRCPKRKGVADFLQEVTSRKDQRQYWAHKEKPYRFVTVQEFAEAFQSFHVGQKISDELRTPFDKSKSHRAALTTETYGVGKRELLKANISRELLLMKRNSFVYIFKLIQIAFVAVVYMTLFLRTKMHKDTVTDGGIFAGATFFAITMVNFNGFSEISMTIAKLPVFYKQRDFRFFPPWAYAIPSWILKIPVSFLEVAVWVFLSYYVVGYDSNAGRFFKQYALLLGVNQMASALFRFIAVTGRNMVVANTFGSFALLVLLSLGGFILSREDIKKWWKWAYWCSPLTYAQNAIVANEFLGHSWKKFTQDSSETLGVQVLKSRGFFAHEYWYWLGLGALFGFVLLLNFAYTLALTFLDPFEKPRAVITEEIESNEQDDRIGGNVQLSTLGGSTDDIRGQQSSSQSLSLAEAEASRPKKKGMVLPFEPHSLTFDEVVYSVDMPEEMKVQGVLEDKLVLLNGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGYITGNITISGYPKKQETFARISGYCEQNDIHSPFVTIYESLLFSAWLRLSPEVDSETRKMFIDEVMELVELNPLRQSLVGLPGVSGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFEAFDELFLMKRGGQEIYVGPLGRHSCHLISYFEAIPGVQKIKDGYNPATWMLEVSAASQELALGIDFTEHYKRSDLYRRNKALIEDLSRPPPGSKDLYFPTQFSQSSWIQFVACLWKQHWSYWRNPPYTAVRFFFTAFIALLFGSLFWDLGGRTKRNQDLFNAMGSMFTAVLFLGVQYCSSVQPIVSVERTVFYREKAAGMYAGIPWALAQVMIEIPYILVQSVVYGAIVYAMIGFEWTAAKFFWYIFFMYFTLLFFTFYGMMAVALTPNHHIAAIVSTLFYGLWNVFSGFIIPRPRIPIWWRWYYWANPIAWTLYGLVASQFGDMDDKKMDTGETVKQFLKDYFDFKHDFLGVVAAVLVVFAVLFGFLFALGIKMFNFQRR
cccccccccccccccccccccccccccccccccccccHHHHHHHHHHHccccHHHHcccccccccccccccccccccHHHHHHHHccccccccccHHHHHHHHHHHHHcccccccccEEEEEEEEEEEEEEccccccccHHHHHHHHHHHHHHHHcccccccccccccccccEEEEccEEEEEEccccccHHHHHHHHHccccccccEEEEEEEccccccccccccEEEEEcccccccccccHHHHHHHHHHHcccccccHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccHHHHHHHHcccccccEEcccccHHHHHHHHHHHHHHHHHHHccccEEEEEcccccHHHHHcccEEEEcccEEEEEccHHHHHHHHHcccccccccccccccccccccccccHHcccccccccccccHHHHHHHHHccHHHHHHHHHHccccccccccccccccccccccHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHEEcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHccEEccccccccHHHHHHHcHHHHHHHHHHHcccccccccccccccccccccEEEEcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccEEEEEccccccccccccccccccccccccccccccccccHHHHHHHHHcccccccccccccccEEEEccEEEEEcccccccccccccccccccccccEEEEcccEEEccccccccHHHHHHHHHccccccEEEEEEEEccccccccccccccHHHHHccccccccHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHcccccccccccccccccccHHHHcHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHHHHcccEEEEccccccHHHHHHHHHHHcccccccEEEEcccccccHHHHHHHHccccccccccccccHHHHHHHccccccccccccHHHHHcccHHHHHHHHHHHHccccccccccccccccccccHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHcccccccEEccHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHEEEEEccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHcccccccccccccEEEEEcccHHHHHHHHHHHHHHcccccccccccccHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHcccc
ccccHHHHHHHccccccccccccccccccccccccccHHHHHHHHHHHccccHHHHHHHHHcccccccEEEEHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccEEEEEEEEEEEEEEEEEcccccHHHHHHHHHHHHHHHHHHccccccccEEEEEccccEEEccccEEEEcccccccHHHHHHHHHcccccccEEEEEEEEcccccccccccccEEEEEccccccccEEHHHHHHHHHHHcccccHHHHHHHHHHHHHHcccccccHHHHHHHHHHcccccccHHHHHHHHHHccHHHHHcEcccHHHccccccccEEEcccEEEEccHHHEEHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHEEccccccHHHHHHHHHEHccccEEEcccHHHHHHHHHHccccccccccHHHHHHHHHcHHHHHHHHcccccccEEEEHHHHHHHHHHccHHHHHHHHHccccccccccccHHccccccccHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHccHHHHHHHHHHccHHHHHHHHcccHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEccccccHHEHHHHHHcHHHHHHHHHHHHHHHcccHccccccccccHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccEEEEccHHHHHccccccccEEcccccccccccccccccccccccccccccccccccEEEccccEEEEEccEEEEEccHHHHHHccccHHHHHHHHcccccccccEHEEEEccccccHHHHHHHHcccccccEEEEEEEEEccccccccEHEEEEccEccccccccEEEEEEEHHHHHHcccccccHHHHHHHHHHHHHHHcccHHHHHHccccccccccHHHHHHHHHHHHHHccccEEEEccccccHHHHHHHHHHHHHHHccccccEEEEEEccccHHHHHHHHHHHHHHcccEEEEEcccccccHHHHHHHHcccccccccccccccEEEEEEccHHHHHHHcccHHHHHHccHHHHHHHHHHHHHccccccccccccccccccHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHcccccccccEEEEEEEHEHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHcccccccccccHEEEEEEEccHHHHHHHHHHHHcccccccccccccccHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccc
MEGTHDIFMASTSLRRSasrwntnsigafsrssreedDEEALKWAALEklptynrlrKGILttsrgeanevdvynLGLQERQRLIDKLVKVTDVDNERFLLKLKNRIDrvgidlpkVEVRYEHLNVEAEAFlasnalpsfIKFYTNIFEDILNYLRiipskkrhLTILKdvsgvikpgrltlllgppssgkTTLLLALAgkldptlkvsgtvtynghdmdefvpqRTAAYISQHDNHIGEMTVRETLAFSARCQGVGTRYEMLTELARREkaagikpdpdiDVYMKAIATEGQEANVITDYYLKVLgldvcadtmvgdemirgisggqkkrvttgemmvgPALALFMDEistgldssttFQIVNCLRQNIHINSGTAVISllqpapetydlfddiillsdgqivyqgPRELVLEFFAsmgfrcpkrkgVADFLQEVTSRKDQRqywahkekpyrfVTVQEFAEAFQSFHvgqkisdelrtpfdkskshraalttetygvgKRELLKANISRELLLMKRNSFVYIFKLIQIAFVAVVYMTLFLRTkmhkdtvtdggifaGATFFAITMVNFNGFSEISMTIAKlpvfykqrdfrffppwayaipswilkiPVSFLEVAVWVFLSYYVVgydsnagrFFKQYALLLGVNQMASALFRFIAVTGRNMVVANTFGSFALLVLLSLGGFILSREDIKKWWKWaywcspltyAQNAIVANEFLGHSWKKFTQDSSETLGVQVLKSRGFFAHEYWYWLGLGALFGFVLLLNFAYTLAltfldpfekpraVITEEIesneqddriggnvqlstlggstddirgqqsssqSLSLAEAEasrpkkkgmvlpfephsltfdevvysvdmpeemkvQGVLEDKLVLLngvsgafrpGVLTALMgvsgagktTLMDVLAgrktggyitgnitisgypkkqeTFARISGyceqndihspFVTIYESLLFSAWLrlspevdseTRKMFIDEVMELVElnplrqslvglpgvsglsteQRKRLTIAVELVanpsiifmdeptsgldARAAAIVMRTVRNTVDTGRTVVCtihqpsidiFEAFDELFLMKrggqeiyvgplgrhschlisyfeaipgvqkikdgynpaTWMLEVSAASQELALGidftehykrsdlYRRNKALiedlsrpppgskdlyfptqfsqsSWIQFVACLWKQHwsywrnppytAVRFFFTAFIALLFGSLfwdlggrtkRNQDLFNAMGSMFTAVLFLGVQycssvqpivsveRTVFYREKAAGMYAGIPWALAQVMIEIPYILVQSVVYGAIVYAMIGFEWTAAKFFWYIFFMYFTLLFFTFYGMMAVALTPNHHIAAIVSTLFYGLWnvfsgfiiprpripiwwrwyywanPIAWTLYGLVasqfgdmddkkmdtgETVKQFLKDYFDFKHDFLGVVAAVLVVFAVLFGFLFALGIKMFNFQRR
megthdifmastslrrsasrwntnsigafsrssreeddEEALKWAaleklptynrlrkgilttsrgeanevdvynlglqerqrLIDKlvkvtdvdnerfllklknridrvgidlPKVEVRYEHLNVEAEAFLASNALPSFIKFYTNIFEDILNYLRIIPSKKRHLTILKDvsgvikpgrltlllgppssGKTTLLLALAGKLDPTLKVSGTVTYNGHDMDEFVPQRTAAYISQHDNHIGEMTVRETLAFSARCQGVGTRYEMLTELARRekaagikpdpdiDVYMKAIATEGQEANVITDYYLKVLGLDVCADTMVGDEmirgisggqkkrvttGEMMVGPALALFMDEISTGLDSSTTFQIVNCLRQNIHINSGTAVISLLQPAPETYDLFDDIILLSDGQIVYQGPRELVLEFFASMGFRCPKRKGVADFLQEvtsrkdqrqywaHKEKPYRFVTVQEFAEAFQSFHVGQKISDElrtpfdkskshraalttetygvgkrellKANISRELLLMKRNSFVYIFKLIQIAFVAVVYMTLFLRTKMHKDTVTDGGIFAGATFFAITMVNFNGFSEISMTIAKLPVFYKQRDFRFFPPWAYAIPSWILKIPVSFLEVAVWVFLSYYVVGYDSNAGRFFKQYALLLGVNQMASALFRFIAVTGRNMVVANTFGSFALLVLLSLGGFILSREDIKKWWKWAYWCSPLTYAQNAIVANEFLGHSWKKFTQDSSETLGVQVLKSRGFFAHEYWYWLGLGALFGFVLLLNFAYTLALTFLDPFEKPRAVITEEiesneqddriggNVQLSTLGGSTDDIRGQQSSSQSLSLAEAEasrpkkkgmvlpfephslTFDEVVYSVDMPEEMKVQGVLEDKLVLLNGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGrktggyitgnitisgypKKQETFARISGYCEQNDIHSPFVTIYESLLFSAWLRLSPEVDSETRKMFIDEVMELVELNPLRQSLVGLpgvsglsteqRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFEAFDELFLMKRGGQEIYVGPLGRHSCHLISYFEAIPGVQKIKDGYNPATWMLEVSAASQELALGIDFTEHYKRSDLYRRNKALiedlsrpppgskDLYFPTQFSQSSWIQFVACLWKQHWSYWRNPPYTAVRFFFTAFIALLFGSLFWDLGGRTKRNQDLFNAMGSMFTAVLFLGVQYCSSVQPIVSVERTVFYREKAAGMYAGIPWALAQVMIEIPYILVQSVVYGAIVYAMIGFEWTAAKFFWYIFFMYFTLLFFTFYGMMAVALTPNHHIAAIVSTLFYGLWNVFSGFIIPRPRIPIWWRWYYWANPIAWTLYGLVASQFGDMDDKKMDTGETVKQFLKDYFDFKHDFLGVVAAVLVVFAVLFGFLFALGIKMFNFQRR
MEGTHDIFMASTSLRRSASRWNTNSIGAFsrssreeddeeALKWAALEKLPTYNRLRKGILTTSRGEANEVDVYNLGLQERQRLIDKLVKVTDVDNERFLLKLKNRIDRVGIDLPKVEVRYEHLNVEAEAFLASNALPSFIKFYTNIFEDILNYLRIIPSKKRHLTILKDVSGVIKPGRLTLLLGPPssgkttlllalagklDPTLKVSGTVTYNGHDMDEFVPQRTAAYISQHDNHIGEMTVRETLAFSARCQGVGTRYEMLTELARREKAAGIKPDPDIDVYMKAIATEGQEANVITDYYLKVLGLDVCADTMVGDEMIRGISGGQKKRVTTGEMMVGPALALFMDEISTGLDSSTTFQIVNCLRQNIHINSGTAVISLLQPAPETYDLFDDIILLSDGQIVYQGPRELVLEFFASMGFRCPKRKGVADFLQEVTSRKDQRQYWAHKEKPYRFVTVQEFAEAFQSFHVGQKISDELRTPFDKSKSHRAALTTETYGVGKRELLKANISRELLLMKRNSFVYIFKLIQIAFVAVVYMTLFLRTKMHKDTVTDGGIFAGATFFAITMVNFNGFSEISMTIAKLPVFYKQRDFRFFPPWAYAIPSWILKIPVSFLEVAVWVFLSYYVVGYDSNAGRFFKQYALLLGVNQMASALFRFIAVTGRNMVVANTfgsfallvllslggfilsREDIKKWWKWAYWCSPLTYAQNAIVANEFLGHSWKKFTQDSSETLGVQVLKSRGFFAHEYWYWlglgalfgfvlllnfAYTLALTFLDPFEKPRAVITEEIESNEQDDRIGGNVQLSTLGGSTDDIRGqqsssqslslaeaeasRPKKKGMVLPFEPHSLTFDEVVYSVDMPEEMKVQGVLEDKLVLLNGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGYITGNITISGYPKKQETFARISGYCEQNDIHSPFVTIYESLLFSAWLRLSPEVDSETRKMFIDEVMELVELNPLRQSLVGLPGVSGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFEAFDELFLMKRGGQEIYVGPLGRHSCHLISYFEAIPGVQKIKDGYNPATWMLEVSAASQELALGIDFTEHYKRSDLYRRNKALIEDLSRPPPGSKDLYFPTQFSQSSWIQFVACLWKQHWSYWRNPPYTAVRFFFTAFIALLFGSLFWDLGGRTKRNQDLFNAMGSMFTAVLFLGVQYCSSVQPIVSVERTVFYREKAAGMYAGIPWALAQVMIEIPYILVQSVVYGAIVYAMIGFEWTAAKFFWYIffmyftllfftfygmMAVALTPNHHIAAIVSTLFYGLWNVFSGFiiprpripiwwrwYYWANPIAWTLYGLVASQFGDMDDKKMDTGETVKQFLKDYFDFKHDflgvvaavlvvfavlfgflfalgIKMFNFQRR
*****************************************LKWAALEKLPTYNRLRKGILTTSRGEANEVDVYNLGLQERQRLIDKLVKVTDVDNERFLLKLKNRIDRVGIDLPKVEVRYEHLNVEAEAFLASNALPSFIKFYTNIFEDILNYLRIIPSKKRHLTILKDVSGVIKPGRLTLLLGPPSSGKTTLLLALAGKLDPTLKVSGTVTYNGHDMDEFVPQRTAAYISQHDNHIGEMTVRETLAFSARCQGVGTRYEMLTELARREKAAGIKPDPDIDVYMKAIATEGQEANVITDYYLKVLGLDVCADTMVGDEMIRGISGGQKKRVTTGEMMVGPALALFMDEISTGLDSSTTFQIVNCLRQNIHINSGTAVISLLQPAPETYDLFDDIILLSDGQIVYQGPRELVLEFFASMGFRCPKRKGVADFLQEVTSRKDQRQYWAHKEKPYRFVTVQEFAEAFQSFHVGQKI****************ALTTETYGVGKRELLKANISRELLLMKRNSFVYIFKLIQIAFVAVVYMTLFLRTKMHKDTVTDGGIFAGATFFAITMVNFNGFSEISMTIAKLPVFYKQRDFRFFPPWAYAIPSWILKIPVSFLEVAVWVFLSYYVVGYDSNAGRFFKQYALLLGVNQMASALFRFIAVTGRNMVVANTFGSFALLVLLSLGGFILSREDIKKWWKWAYWCSPLTYAQNAIVANEFLGHSWKKFTQDSSETLGVQVLKSRGFFAHEYWYWLGLGALFGFVLLLNFAYTLALTFLDPFEKPRAVI*******************************************************LPFEPHSLTFDEVVYSVDMPEEMKVQGVLEDKLVLLNGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGYITGNITISGYPKKQETFARISGYCEQNDIHSPFVTIYESLLFSAWLRLSPEVDSETRKMFIDEVMELVELNPLRQSLVGLPGVSGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFEAFDELFLMKRGGQEIYVGPLGRHSCHLISYFEAIPGVQKIKDGYNPATWMLEVSAASQELALGIDFTEHYKRSDLYRRNKALI***********DLYFPTQFSQSSWIQFVACLWKQHWSYWRNPPYTAVRFFFTAFIALLFGSLFWDLGGRTKRNQDLFNAMGSMFTAVLFLGVQYCSSVQPIVSVERTVFYREKAAGMYAGIPWALAQVMIEIPYILVQSVVYGAIVYAMIGFEWTAAKFFWYIFFMYFTLLFFTFYGMMAVALTPNHHIAAIVSTLFYGLWNVFSGFIIPRPRIPIWWRWYYWANPIAWTLYGLVASQFGDMDDKKMDTGETVKQFLKDYFDFKHDFLGVVAAVLVVFAVLFGFLFALGIKMFNF***
*********************************************************************************************VDNERFLLKLK***********KVEVRYEHLNVEAEAFLASNALPSFIKFYTNIFEDILNY***********TILKDVSGVIKPGRLTLLLGPPSSGKTTLLLALAGKLDPTLKVSGTVTYNGHDMDEFVPQRTAAYISQHDNHIGEMTVRETLAFSARCQGVGTRYEM*************KPDPDIDVYMKAIATEGQEANVITDYYLKVLGLDVCADTMVGDEMIRGISGGQKKRVTTGEMMVGPALALFMDEISTGLDSSTTFQIVNCLRQNIHINSGTAVISLLQPAPETYDLFDDIILLSDGQIVYQGPRELVLEFFASMGFRCPKRKGVADFLQEVTSRKDQRQYWAHKEKPYRFVTVQEFAEAFQSFHVGQKIS************************GKRELLKANISRELLLMKRNSFVYIFKLIQIAFVAVVYMTLFLRTKMHKDTVTDGGIFAGATFFAITMVNFNGFSEISMTIAKLPVFYKQRDFRFFPPWAYAIPSWILKIPVSFLEVAVWVFLSYYVVGYDSNAGRFFKQYALLLGVNQMASALFRFIAVTGRNMVVANTFGSFALLVLLSLGGFILSREDIKKWWKWAYWCSPLTYAQNAIVANEFLGHSWKKFTQDSSETLGVQVLKSRGFFAHEYWYWLGLGALFGFVLLLNFAYTLALTFLDPFE***************************************************************FEPHSLTFDEVVYSVDMPEEMKV*GVLEDKLVLLNGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGYITGNITISGYPKKQETFARISGYCEQNDIHSPFVTIYESLLFSAWLRLSPEVDSETRKMFIDEVMELVELNPLRQSLVGLPGVSGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFEAFDELFLMKRGGQEIYVGPLGRHSCHLISYFEAIPGVQKIKDGYNPATWMLEVSAASQELALGIDFTEHYKRSDLYRRN***********************SQSSWIQFVACLWKQHWSYWRNPPYTAVRFFFTAFIALLFGSLFWDLGGRTKRNQDLFNAMGSMFTAVLFLGVQYCSSVQPIVSVERTVFYREKAAGMYAGIPWALAQVMIEIPYILVQSVVYGAIVYAMIGFEWTAAKFFWYIFFMYFTLLFFTFYGMMAVALTPNHHIAAIVSTLFYGLWNVFSGFIIPRPRIPIWWRWYYWANPIAWTLYGLVASQFGDMDDKKMDTGETVKQFLKDYFDFKHDFLGVVAAVLVVFAVLFGFLFALGIKMFNFQRR
MEGTHDIFMASTSLRRSASRWNTNSIGA*************LKWAALEKLPTYNRLRKGILTTSRGEANEVDVYNLGLQERQRLIDKLVKVTDVDNERFLLKLKNRIDRVGIDLPKVEVRYEHLNVEAEAFLASNALPSFIKFYTNIFEDILNYLRIIPSKKRHLTILKDVSGVIKPGRLTLLLGPPSSGKTTLLLALAGKLDPTLKVSGTVTYNGHDMDEFVPQRTAAYISQHDNHIGEMTVRETLAFSARCQGVGTRYEMLTELARREKAAGIKPDPDIDVYMKAIATEGQEANVITDYYLKVLGLDVCADTMVGDEMIRGISGGQKKRVTTGEMMVGPALALFMDEISTGLDSSTTFQIVNCLRQNIHINSGTAVISLLQPAPETYDLFDDIILLSDGQIVYQGPRELVLEFFASMGFRCPKRKGVADFLQEVTSRKDQRQYWAHKEKPYRFVTVQEFAEAFQSFHVGQKISDELRTPFDKSKSHRAALTTETYGVGKRELLKANISRELLLMKRNSFVYIFKLIQIAFVAVVYMTLFLRTKMHKDTVTDGGIFAGATFFAITMVNFNGFSEISMTIAKLPVFYKQRDFRFFPPWAYAIPSWILKIPVSFLEVAVWVFLSYYVVGYDSNAGRFFKQYALLLGVNQMASALFRFIAVTGRNMVVANTFGSFALLVLLSLGGFILSREDIKKWWKWAYWCSPLTYAQNAIVANEFLGHSWKKFTQDSSETLGVQVLKSRGFFAHEYWYWLGLGALFGFVLLLNFAYTLALTFLDPFEKPRAVITEEIESNEQDDRIGGNVQLSTLGGSTD***********************KKGMVLPFEPHSLTFDEVVYSVDMPEEMKVQGVLEDKLVLLNGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGYITGNITISGYPKKQETFARISGYCEQNDIHSPFVTIYESLLFSAWLRLSPEVDSETRKMFIDEVMELVELNPLRQSLVGLPGVSGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFEAFDELFLMKRGGQEIYVGPLGRHSCHLISYFEAIPGVQKIKDGYNPATWMLEVSAASQELALGIDFTEHYKRSDLYRRNKALIEDLSRPPPGSKDLYFPTQFSQSSWIQFVACLWKQHWSYWRNPPYTAVRFFFTAFIALLFGSLFWDLGGRTKRNQDLFNAMGSMFTAVLFLGVQYCSSVQPIVSVERTVFYREKAAGMYAGIPWALAQVMIEIPYILVQSVVYGAIVYAMIGFEWTAAKFFWYIFFMYFTLLFFTFYGMMAVALTPNHHIAAIVSTLFYGLWNVFSGFIIPRPRIPIWWRWYYWANPIAWTLYGLVASQFGDMDDKKMDTGETVKQFLKDYFDFKHDFLGVVAAVLVVFAVLFGFLFALGIKMFNFQRR
************************************DDEEALKWAALEKLPTYNRLRKGILTTSRGEANEVDVYNLGLQERQRLIDKLVKVTDVDNERFLLKLKNRIDRVGIDLPKVEVRYEHLNVEAEAFLASNALPSFIKFYTNIFEDILNYLRIIPSKKRHLTILKDVSGVIKPGRLTLLLGPPSSGKTTLLLALAGKLDPTLKVSGTVTYNGHDMDEFVPQRTAAYISQHDNHIGEMTVRETLAFSARCQGVGTRYEMLTELARREKAAGIKPDPDIDVYMKAIATEGQEANVITDYYLKVLGLDVCADTMVGDEMIRGISGGQKKRVTTGEMMVGPALALFMDEISTGLDSSTTFQIVNCLRQNIHINSGTAVISLLQPAPETYDLFDDIILLSDGQIVYQGPRELVLEFFASMGFRCPKRKGVADFLQEVTSRKDQRQYWAHKEKPYRFVTVQEFAEAFQSFHVGQKISDELRTPFDKSKSHRAALTTETYGVGKRELLKANISRELLLMKRNSFVYIFKLIQIAFVAVVYMTLFLRTKMHKDTVTDGGIFAGATFFAITMVNFNGFSEISMTIAKLPVFYKQRDFRFFPPWAYAIPSWILKIPVSFLEVAVWVFLSYYVVGYDSNAGRFFKQYALLLGVNQMASALFRFIAVTGRNMVVANTFGSFALLVLLSLGGFILSREDIKKWWKWAYWCSPLTYAQNAIVANEFLGHSWKKFTQDSSETLGVQVLKSRGFFAHEYWYWLGLGALFGFVLLLNFAYTLALTFLDPFEKPRAVITEEI*S*********************************************KGMVLPFEPHSLTFDEVVYSVDMPEEMKVQGVLEDKLVLLNGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGYITGNITISGYPKKQETFARISGYCEQNDIHSPFVTIYESLLFSAWLRLSPEVDSETRKMFIDEVMELVELNPLRQSLVGLPGVSGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFEAFDELFLMKRGGQEIYVGPLGRHSCHLISYFEAIPGVQKIKDGYNPATWMLEVSAASQELALGIDFTEHYKRSDLYRRNKALIEDLSRPPPGSKDLYFPTQFSQSSWIQFVACLWKQHWSYWRNPPYTAVRFFFTAFIALLFGSLFWDLGGRTKRNQDLFNAMGSMFTAVLFLGVQYCSSVQPIVSVERTVFYREKAAGMYAGIPWALAQVMIEIPYILVQSVVYGAIVYAMIGFEWTAAKFFWYIFFMYFTLLFFTFYGMMAVALTPNHHIAAIVSTLFYGLWNVFSGFIIPRPRIPIWWRWYYWANPIAWTLYGLVASQFGDMDDKKMDTGETVKQFLKDYFDFKHDFLGVVAAVLVVFAVLFGFLFALGIKMFNFQR*
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooHHHHHHHHHHHHHHHHHHHHHiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHoooooooooooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHiiiHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHoooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHiiiHHHHHHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHoooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEGTHDIFMASTSLRRSASRWNTNSIGAFSRSSREEDDEEALKWAALEKLPTYNRLRKGILTTSRGEANEVDVYNLGLQERQRLIDKLVKVTDVDNERFLLKLKNRIDRVGIDLPKVEVRYEHLNVEAEAFLASNALPSFIKFYTNIFEDILNYLRIIPSKKRHLTILKDVSGVIKPGRLTLLLGPPSSGKTTLLLALAGKLDPTLKVSGTVTYNGHDMDEFVPQRTAAYISQHDNHIGEMTVRETLAFSARCQGVGTRYEMLTELARREKAAGIKPDPDIDVYMKAIATEGQEANVITDYYLKVLGLDVCADTMVGDEMIRGISGGQKKRVTTGEMMVGPALALFMDEISTGLDSSTTFQIVNCLRQNIHINSGTAVISLLQPAPETYDLFDDIILLSDGQIVYQGPRELVLEFFASMGFRCPKRKGVADFLQEVTSRKDQRQYWAHKEKPYRFVTVQEFAEAFQSFHVGQKISDELRTPFDKSKSHRAALTTETYGVGKRELLKANISRELLLMKRNSFVYIFKLIQIAFVAVVYMTLFLRTKMHKDTVTDGGIFAGATFFAITMVNFNGFSEISMTIAKLPVFYKQRDFRFFPPWAYAIPSWILKIPVSFLEVAVWVFLSYYVVGYDSNAGRFFKQYALLLGVNQMASALFRFIAVTGRNMVVANTFGSFALLVLLSLGGFILSREDIKKWWKWAYWCSPLTYAQNAIVANEFLGHSWKKFTQDSSETLGVQVLKSRGFFAHEYWYWLGLGALFGFVLLLNFAYTLALTFLDPFEKPRAVITEEIESNEQDDRIGGNVQLSTLGGSTDDIRGQQSSSQSLSLAEAEASRPKKKGMVLPFEPHSLTFDEVVYSVDMPEEMKVQGVLEDKLVLLNGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGYITGNITISGYPKKQETFARISGYCEQNDIHSPFVTIYESLLFSAWLRLSPEVDSETRKMFIDEVMELVELNPLRQSLVGLPGVSGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFEAFDELFLMKRGGQEIYVGPLGRHSCHLISYFEAIPGVQKIKDGYNPATWMLEVSAASQELALGIDFTEHYKRSDLYRRNKALIEDLSRPPPGSKDLYFPTQFSQSSWIQFVACLWKQHWSYWRNPPYTAVRFFFTAFIALLFGSLFWDLGGRTKRNQDLFNAMGSMFTAVLFLGVQYCSSVQPIVSVERTVFYREKAAGMYAGIPWALAQVMIEIPYILVQSVVYGAIVYAMIGFEWTAAKFFWYIFFMYFTLLFFTFYGMMAVALTPNHHIAAIVSTLFYGLWNVFSGFIIPRPRIPIWWRWYYWANPIAWTLYGLVASQFGDMDDKKMDTGETVKQFLKDYFDFKHDFLGVVAAVLVVFAVLFGFLFALGIKMFNFQRR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query1445 2.2.26 [Sep-21-2011]
Q76CU21434 Pleiotropic drug resistan N/A no 0.977 0.985 0.728 0.0
Q9M9E11423 ABC transporter G family yes no 0.982 0.997 0.690 0.0
Q949G31436 Pleiotropic drug resistan N/A no 0.978 0.984 0.712 0.0
Q0JLC51457 Pleiotropic drug resistan yes no 0.984 0.975 0.696 0.0
A2WSH01457 Pleiotropic drug resistan N/A no 0.984 0.975 0.696 0.0
Q8GU881444 Putative pleiotropic drug no no 0.986 0.987 0.687 0.0
Q8GU891450 Pleiotropic drug resistan no no 0.985 0.982 0.682 0.0
Q8GU921464 Probable pleiotropic drug no no 0.984 0.971 0.693 0.0
O243671441 Pleiotropic drug resistan N/A no 0.984 0.987 0.694 0.0
Q7PC801468 Probable pleiotropic drug no no 0.971 0.956 0.685 0.0
>sp|Q76CU2|PDR1_TOBAC Pleiotropic drug resistance protein 1 OS=Nicotiana tabacum GN=PDR1 PE=2 SV=1 Back     alignment and function desciption
 Score = 2190 bits (5675), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1045/1434 (72%), Positives = 1210/1434 (84%), Gaps = 21/1434 (1%)

Query: 13   SLR-RSASRWNTNSIGAFSRSSREEDDEEALKWAALEKLPTYNRLRKGILTTSRGEANEV 71
            SLR  S S W  N +  FSRSSR+EDDEEALKWAALEKLPT++RLRKG+L  S+G A EV
Sbjct: 21   SLRANSNSIWRNNGVEIFSRSSRDEDDEEALKWAALEKLPTFDRLRKGLLFGSQGAAAEV 80

Query: 72   DVYNLGLQERQRLIDKLVKVTDVDNERFLLKLKNRIDRVGIDLPKVEVRYEHLNVEAEAF 131
            D+ +LG QER+ L+++LVKV D DNE+FLLKLKNRIDRVGIDLP +EVRYEHLN++A+A+
Sbjct: 81   DINDLGFQERKNLLERLVKVADEDNEKFLLKLKNRIDRVGIDLPTIEVRYEHLNIDADAY 140

Query: 132  LASNALPSFIKFYTNIFEDILNYLRIIPSKKRHLTILKDVSGVIKPGRLTLLLGPPSSGK 191
            + S +LP+F+ F TN  E +LN L I+ S+KR LTILKD+SG+IKP R+TLLLGPPSSGK
Sbjct: 141  VGSRSLPTFMNFMTNFVETLLNSLHILSSRKRQLTILKDISGIIKPCRMTLLLGPPSSGK 200

Query: 192  TTLLLALAGKLDPTLKVSGTVTYNGHDMDEFVPQRTAAYISQHDNHIGEMTVRETLAFSA 251
            TTLLLALAGKLDP LKV+G V+YNGH++ EFVPQRTAAYISQHD HIGEMTVRETL FSA
Sbjct: 201  TTLLLALAGKLDPALKVTGKVSYNGHELHEFVPQRTAAYISQHDLHIGEMTVRETLEFSA 260

Query: 252  RCQGVGTRYEMLTELARREKAAGIKPDPDIDVYMKAIATEGQEANVITDYYLKVLGLDVC 311
            RCQGVG+R+EML EL+RREKAA IKPD DID+YMKA ATEGQEANV+TDY LK+LGLD+C
Sbjct: 261  RCQGVGSRFEMLAELSRREKAANIKPDADIDIYMKAAATEGQEANVVTDYVLKILGLDIC 320

Query: 312  ADTMVGDEMIRGISGGQKKRVTTGEMMVGPALALFMDEISTGLDSSTTFQIVNCLRQNIH 371
            ADTMVGD+MIRGISGGQKKRVTTGEM+VGP+ ALFMDEISTGLDSSTT+ IVN LRQ++ 
Sbjct: 321  ADTMVGDDMIRGISGGQKKRVTTGEMLVGPSKALFMDEISTGLDSSTTYSIVNSLRQSVQ 380

Query: 372  INSGTAVISLLQPAPETYDLFDDIILLSDGQIVYQGPRELVLEFFASMGFRCPKRKGVAD 431
            I  GTAVISLLQPAPETY+LFDDIILLSDG IVYQGPR+ VLEFF SMGF+CP+RKGVAD
Sbjct: 381  ILKGTAVISLLQPAPETYNLFDDIILLSDGYIVYQGPRDDVLEFFESMGFKCPQRKGVAD 440

Query: 432  FLQEVTSRKDQRQYWAHKEKPYRFVTVQEFAEAFQSFHVGQKISDELRTPFDKSKSHRAA 491
            FLQEVTS+KDQ+QYW+ + +PYRF+T +EFAEA+QSFHVG+K+ DEL TPFDK+K H AA
Sbjct: 441  FLQEVTSKKDQQQYWSKRNEPYRFITSKEFAEAYQSFHVGRKLGDELATPFDKTKCHPAA 500

Query: 492  LTTETYGVGKRELLKANISRELLLMKRNSFVYIFKLIQIAFVAVVYMTLFLRTKMHKDTV 551
            LT E YG+GK+ELLK    RELLLMKRNSFVY+FK  Q+  +A++ MTLF RT+M +DT 
Sbjct: 501  LTNEKYGIGKKELLKVCTERELLLMKRNSFVYMFKFSQLTIMALITMTLFFRTEMPRDTT 560

Query: 552  TDGGIFAGATFFAITMVNFNGFSEISMTIAKLPVFYKQRDFRFFPPWAYAIPSWILKIPV 611
             DGGI+AGA FF + M+ FNG SE++MTI KLPVFYKQRD  FFP WAYAIPSWILKIPV
Sbjct: 561  DDGGIYAGALFFVVIMIMFNGMSELAMTIFKLPVFYKQRDLLFFPSWAYAIPSWILKIPV 620

Query: 612  SFLEVAVWVFLSYYVVGYDSNAGRFFKQYALLLGVNQMASALFRFIAVTGRNMVVANTFG 671
            + +EV +WV L+YYV+G+D N  RF KQ+ LL+ VNQMAS +FRFI   GR M VA+TFG
Sbjct: 621  TLVEVGLWVILTYYVIGFDPNITRFLKQFLLLIVVNQMASGMFRFIGAVGRTMGVASTFG 680

Query: 672  SFALLVLLSLGGFILSREDIKKWWKWAYWCSPLTYAQNAIVANEFLGHSWKKFTQDSSET 731
            SFALL+  +LGGF+LSR+D+K WW W YW SP+ Y+ N+I+ NEF G  W       +ET
Sbjct: 681  SFALLLQFALGGFVLSRDDVKSWWIWGYWISPMMYSVNSILVNEFDGKKWNHIVPGGNET 740

Query: 732  LGVQVLKSRGFFAHEYWYWLGLGALFGFVLLLNFAYTLALTFLDPFEKPRAVITEEIESN 791
            LG  V+KSRGFF   YWYW+G+GAL GF ++ NF Y+LAL +L+PF+KP+AV+ E+ E+ 
Sbjct: 741  LGSTVVKSRGFFPEAYWYWIGVGALVGFTVVFNFCYSLALAYLNPFDKPQAVLPEDGENA 800

Query: 792  EQDDRIGGNVQLSTLGGSTDDIRGQQSSSQSLSLAEAEASRPKKKGMVLPFEPHSLTFDE 851
            E       N ++S+   STD   G  S S+         S+  KKGMVLPFEPHS+TFD+
Sbjct: 801  E-------NGEVSSQITSTD---GGDSISE---------SQNNKKGMVLPFEPHSITFDD 841

Query: 852  VVYSVDMPEEMKVQGVLEDKLVLLNGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRKTG 911
            VVYSVDMP+EMK QG  ED+LVLL GVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRKTG
Sbjct: 842  VVYSVDMPQEMKEQGAGEDRLVLLKGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRKTG 901

Query: 912  GYITGNITISGYPKKQETFARISGYCEQNDIHSPFVTIYESLLFSAWLRLSPEVDSETRK 971
            GYI G I ISGYPKKQETFARISGYCEQNDIHSP+VT+YESL++SAWLRL  +VD +TRK
Sbjct: 902  GYIDGEIKISGYPKKQETFARISGYCEQNDIHSPYVTVYESLVYSAWLRLPQDVDEKTRK 961

Query: 972  MFIDEVMELVELNPLRQSLVGLPGVSGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDA 1031
            MF+DEVMELVEL PLR +LVGLPGV+GLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDA
Sbjct: 962  MFVDEVMELVELGPLRSALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDA 1021

Query: 1032 RAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFEAFDELFLMKRGGQEIYVGPLGRHSCHL 1091
            RAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFEAFDELFLMKRGGQEIYVGPLGRHSCHL
Sbjct: 1022 RAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFEAFDELFLMKRGGQEIYVGPLGRHSCHL 1081

Query: 1092 ISYFEAIPGVQKIKDGYNPATWMLEVSAASQELALGIDFTEHYKRSDLYRRNKALIEDLS 1151
            I YFE+ PGV KIK+GYNPATWMLEV+A++QE+ LGIDFTE YK SDLYRRNKALI +L 
Sbjct: 1082 IKYFESNPGVAKIKEGYNPATWMLEVTASAQEMMLGIDFTEVYKNSDLYRRNKALISELG 1141

Query: 1152 RPPPGSKDLYFPTQFSQSSWIQFVACLWKQHWSYWRNPPYTAVRFFFTAFIALLFGSLFW 1211
             P PGSKDL+F TQ+SQS W Q VACLWKQHWSYWRNP YTAVRF FT FIAL+FG++FW
Sbjct: 1142 VPRPGSKDLHFETQYSQSFWTQCVACLWKQHWSYWRNPAYTAVRFIFTTFIALIFGTMFW 1201

Query: 1212 DLGGRTKRNQDLFNAMGSMFTAVLFLGVQYCSSVQPIVSVERTVFYREKAAGMYAGIPWA 1271
            DLG +  ++QDL NAMGSM+ AVLFLGVQ  SSVQP+V++ERTVFYRE+AAGMY+ IP+A
Sbjct: 1202 DLGTKVSKSQDLLNAMGSMYAAVLFLGVQNASSVQPVVAIERTVFYRERAAGMYSAIPYA 1261

Query: 1272 LAQVMIEIPYILVQSVVYGAIVYAMIGFEWTAAKFFWYIFFMYFTLLFFTFYGMMAVALT 1331
              QV IEIPYI VQSV YG IVYAMIGFEW   KFFWY+F M+FTLL+FTFYGMM VA+T
Sbjct: 1262 FGQVSIEIPYIFVQSVFYGIIVYAMIGFEWDVGKFFWYLFIMFFTLLYFTFYGMMGVAVT 1321

Query: 1332 PNHHIAAIVSTLFYGLWNVFSGFIIPRPRIPIWWRWYYWANPIAWTLYGLVASQFGDMDD 1391
            PN ++A+IV+  FYG+WN+FSGFIIPRPR+P+WWRWYYWANP+AWTLYGLVASQFGD+  
Sbjct: 1322 PNQNVASIVAAFFYGVWNLFSGFIIPRPRMPVWWRWYYWANPVAWTLYGLVASQFGDIQT 1381

Query: 1392 KKMDTGETVKQFLKDYFDFKHDFLGVVAAVLVVFAVLFGFLFALGIKMFNFQRR 1445
            K  D  ETV+QFL+ YF FKHDFLGVVAAVL  +  +F F FA  IK FNFQRR
Sbjct: 1382 KLSDN-ETVEQFLRRYFGFKHDFLGVVAAVLTAYVFMFAFTFAFAIKAFNFQRR 1434




May be a general defense protein.
Nicotiana tabacum (taxid: 4097)
>sp|Q9M9E1|AB40G_ARATH ABC transporter G family member 40 OS=Arabidopsis thaliana GN=ABCG40 PE=1 SV=1 Back     alignment and function description
>sp|Q949G3|PDR1_NICPL Pleiotropic drug resistance protein 1 OS=Nicotiana plumbaginifolia GN=PDR1 PE=1 SV=1 Back     alignment and function description
>sp|Q0JLC5|PDR3_ORYSJ Pleiotropic drug resistance protein 3 OS=Oryza sativa subsp. japonica GN=PDR3 PE=2 SV=1 Back     alignment and function description
>sp|A2WSH0|PDR3_ORYSI Pleiotropic drug resistance protein 3 OS=Oryza sativa subsp. indica GN=PDR3 PE=2 SV=1 Back     alignment and function description
>sp|Q8GU88|PDR7_ORYSJ Putative pleiotropic drug resistance protein 7 OS=Oryza sativa subsp. japonica GN=PDR7 PE=3 SV=1 Back     alignment and function description
>sp|Q8GU89|PDR4_ORYSJ Pleiotropic drug resistance protein 4 OS=Oryza sativa subsp. japonica GN=PDR4 PE=2 SV=1 Back     alignment and function description
>sp|Q8GU92|PDR2_ORYSJ Probable pleiotropic drug resistance protein 2 OS=Oryza sativa subsp. japonica GN=PDR2 PE=3 SV=1 Back     alignment and function description
>sp|O24367|TUR2_SPIPO Pleiotropic drug resistance protein TUR2 OS=Spirodela polyrrhiza GN=TUR2 PE=1 SV=1 Back     alignment and function description
>sp|Q7PC80|PDR1_ORYSJ Probable pleiotropic drug resistance protein 1 OS=Oryza sativa subsp. japonica GN=PDR1 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1445
3565558251427 PREDICTED: pleiotropic drug resistance p 0.984 0.997 0.736 0.0
2555433311429 ATP-binding cassette transporter, putati 0.986 0.997 0.735 0.0
297743362 3142 unnamed protein product [Vitis vinifera] 0.986 0.453 0.748 0.0
3594826421429 PREDICTED: pleiotropic drug resistance p 0.987 0.998 0.735 0.0
1478166881471 hypothetical protein VITISV_022715 [Viti 0.995 0.978 0.734 0.0
3574550751427 Pleiotropic drug resistance protein [Med 0.986 0.998 0.724 0.0
297743343 1642 unnamed protein product [Vitis vinifera] 0.977 0.859 0.734 0.0
3594829931430 PREDICTED: pleiotropic drug resistance p 0.988 0.999 0.745 0.0
3594829911445 PREDICTED: pleiotropic drug resistance p 0.994 0.994 0.743 0.0
3565194091426 PREDICTED: pleiotropic drug resistance p 0.984 0.997 0.717 0.0
>gi|356555825|ref|XP_003546230.1| PREDICTED: pleiotropic drug resistance protein 1-like [Glycine max] Back     alignment and taxonomy information
 Score = 2254 bits (5840), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1067/1449 (73%), Positives = 1235/1449 (85%), Gaps = 26/1449 (1%)

Query: 1    MEGTHDIFMASTSLR-RSASRWNTNSIGAFSRSSREEDDEEALKWAALEKLPTYNRLRKG 59
            MEG+ DI+ AS SLR RS++ W  + + AFSRSSREEDDEEALKWAALEKLPTYNRLRKG
Sbjct: 1    MEGS-DIYRASNSLRSRSSTVWRNSGVEAFSRSSREEDDEEALKWAALEKLPTYNRLRKG 59

Query: 60   ILTTSRGEANEVDVYNLGLQERQRLIDKLVKVTDVDNERFLLKLKNRIDRVGIDLPKVEV 119
            +LT S G ANE+DV +LG+QERQ+L+++LVKV + DNERFLLKLK RIDRVG+D+P +EV
Sbjct: 60   LLTASHGVANEIDVSDLGIQERQKLLERLVKVAEEDNERFLLKLKERIDRVGLDIPTIEV 119

Query: 120  RYEHLNVEAEAFLASNALPSFIKFYTNIFEDILNYLRIIPSKKRHLTILKDVSGVIKPGR 179
            RYEHLN+EAEAF+ S ALPSFI   TN+ E   N L +  SKK+H+TILKDVSG+IKP R
Sbjct: 120  RYEHLNIEAEAFVGSRALPSFINSVTNVVEGFFNLLHVSTSKKKHVTILKDVSGIIKPRR 179

Query: 180  LTLLLGPPSSGKTTLLLALAGKLDPTLKVSGTVTYNGHDMDEFVPQRTAAYISQHDNHIG 239
            +TLLLGPPSSGKTTLLLAL+GKLD TLKVSG VTYNGH+++EFVPQRTAAYISQHD HIG
Sbjct: 180  MTLLLGPPSSGKTTLLLALSGKLDKTLKVSGRVTYNGHELNEFVPQRTAAYISQHDLHIG 239

Query: 240  EMTVRETLAFSARCQGVGTRYEMLTELARREKAAGIKPDPDIDVYMKAIATEGQEANVIT 299
            EMTVRETLAFSARCQGVG+RY+ML+EL+RREKAA IKPDPD+DVYMKA ATEGQE+N++T
Sbjct: 240  EMTVRETLAFSARCQGVGSRYDMLSELSRREKAANIKPDPDLDVYMKATATEGQESNIVT 299

Query: 300  DYYLKVLGLDVCADTMVGDEMIRGISGGQKKRVTTGEMMVGPALALFMDEISTGLDSSTT 359
            DY LK+LGLD+CADTMVGDEM+RGISGGQ+KRVTTGEM+VGPA ALFMDEISTGLDSSTT
Sbjct: 300  DYTLKILGLDICADTMVGDEMLRGISGGQRKRVTTGEMLVGPANALFMDEISTGLDSSTT 359

Query: 360  FQIVNCLRQNIHINSGTAVISLLQPAPETYDLFDDIILLSDGQIVYQGPRELVLEFFASM 419
            FQIV+ LR  +HI +GTAVISLLQPAPETYDLFDDIIL+SDGQ+VY GPRE VL+FF SM
Sbjct: 360  FQIVSSLRHYVHILNGTAVISLLQPAPETYDLFDDIILISDGQVVYHGPREYVLDFFESM 419

Query: 420  GFRCPKRKGVADFLQEVTSRKDQRQYWAHKEKPYRFVTVQEFAEAFQSFHVGQKISDELR 479
            GFRCP+RKGVADFLQEVTS+KDQ QYW  +++PYRFVTV +FAEAFQSFH+G K+ +EL 
Sbjct: 420  GFRCPERKGVADFLQEVTSKKDQAQYWVRRDQPYRFVTVTQFAEAFQSFHIGGKLGEELT 479

Query: 480  TPFDKSKSHRAALTTETYGVGKRELLKANISRELLLMKRNSFVYIFKLIQIAFVAVVYMT 539
             PFD++KSH AALTT+ YG+ K+ELLKAN SRE LLMKRNSFVY+FKL Q+  +A+V MT
Sbjct: 480  VPFDRTKSHPAALTTKKYGINKKELLKANFSREYLLMKRNSFVYLFKLSQLFIMALVAMT 539

Query: 540  LFLRTKMHKDTVTDGGIFAGATFFAITMVNFNGFSEISMTIAKLPVFYKQRDFRFFPPWA 599
            LFLRT+MH + + D G++AGA FF +  V FNG +EISMTIAKLPVFYKQR+  F+P WA
Sbjct: 540  LFLRTEMHHENMDDAGVYAGAVFFMLITVMFNGLAEISMTIAKLPVFYKQRNLLFYPSWA 599

Query: 600  YAIPSWILKIPVSFLEVAVWVFLSYYVVGYDSNAGRFFKQYALLLGVNQMASALFRFIAV 659
            YAIPSWILKIPV+ +EVAVWVFL+YYV+G+D N GRFFKQY +LL V+QMAS LFR IA 
Sbjct: 600  YAIPSWILKIPVTIVEVAVWVFLTYYVIGFDPNVGRFFKQYLVLLIVSQMASGLFRTIAA 659

Query: 660  TGRNMVVANTFGSFALLVLLSLGGFILSREDIKKWWKWAYWCSPLTYAQNAIVANEFLGH 719
             GRNM+VANTFG+FA++ +++LGGFILS+ DIK WW W YW SPL Y QNA++ NEFL +
Sbjct: 660  LGRNMIVANTFGAFAIITVVALGGFILSKRDIKSWWIWGYWISPLMYGQNALMVNEFLSN 719

Query: 720  SWKKFTQDSSETLGVQVLKSRGFFAHEYWYWLGLGALFGFVLLLNFAYTLALTFLDPFEK 779
            SW     +++  LGV+ L+SR FF   YWYWLGLGAL GFV L N  + LAL FL PF+K
Sbjct: 720  SW----HNATHNLGVEYLESRAFFTDSYWYWLGLGALVGFVFLFNVMFGLALEFLGPFDK 775

Query: 780  PRAVITEEIESNEQDDRIGGNVQLSTLGGSTDDIR--GQQSSSQSLSLAEAEASRPKKKG 837
            P+A ITE+  SNE               G+  DI   G +SS +  SL   E+S  KKKG
Sbjct: 776  PQATITEDESSNE---------------GTLADIELPGIESSGRGDSL--VESSHGKKKG 818

Query: 838  MVLPFEPHSLTFDEVVYSVDMPEEMKVQGVLEDKLVLLNGVSGAFRPGVLTALMGVSGAG 897
            MVLPFEPHS+TFDEVVYSVDMP+EMK QGV ED+LVLL GVSGAFRPGVLTALMGVSGAG
Sbjct: 819  MVLPFEPHSITFDEVVYSVDMPQEMKEQGVQEDRLVLLKGVSGAFRPGVLTALMGVSGAG 878

Query: 898  KTTLMDVLAGRKTGGYITGNITISGYPKKQETFARISGYCEQNDIHSPFVTIYESLLFSA 957
            KTTLMDVLAGRKTGGYI G+I ISGYPKKQETFARISGYCEQNDIHSP VT+YESLL+SA
Sbjct: 879  KTTLMDVLAGRKTGGYIDGSIKISGYPKKQETFARISGYCEQNDIHSPHVTVYESLLYSA 938

Query: 958  WLRLSPEVDSETRKMFIDEVMELVELNPLRQSLVGLPGVSGLSTEQRKRLTIAVELVANP 1017
            WLRL   VDS+TRKMFI+EVMELVELNP+R SLVGLPGVSGLSTEQRKRLTIAVELVANP
Sbjct: 939  WLRLPSSVDSKTRKMFIEEVMELVELNPVRNSLVGLPGVSGLSTEQRKRLTIAVELVANP 998

Query: 1018 SIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFEAFDELFLMKRGGQ 1077
            SIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFEAFDELFLMKRGGQ
Sbjct: 999  SIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFEAFDELFLMKRGGQ 1058

Query: 1078 EIYVGPLGRHSCHLISYFEAIPGVQKIKDGYNPATWMLEVSAASQELALGIDFTEHYKRS 1137
            EIYVGPLGRHS HLI YFE+I GV KIKDGYNPATWMLEV+A +QEL+LG+DFT+ YK S
Sbjct: 1059 EIYVGPLGRHSSHLIKYFESIEGVSKIKDGYNPATWMLEVTATAQELSLGVDFTDLYKNS 1118

Query: 1138 DLYRRNKALIEDLSRPPPGSKDLYFPTQFSQSSWIQFVACLWKQHWSYWRNPPYTAVRFF 1197
            DLYRRNK LI++L +P PGSKDL+FPTQ+SQS  +Q  ACLWKQ WSYWRNPPYTAVRFF
Sbjct: 1119 DLYRRNKQLIQELGQPAPGSKDLHFPTQYSQSFLVQCQACLWKQRWSYWRNPPYTAVRFF 1178

Query: 1198 FTAFIALLFGSLFWDLGGRTKRNQDLFNAMGSMFTAVLFLGVQYCSSVQPIVSVERTVFY 1257
            FT FIAL+FG++FWDLGG+     DL NA+GSM+TAVLFLGVQ  SSVQP+V++ERTVFY
Sbjct: 1179 FTTFIALMFGTIFWDLGGKHSTRGDLLNAIGSMYTAVLFLGVQNASSVQPVVAIERTVFY 1238

Query: 1258 REKAAGMYAGIPWALAQVMIEIPYILVQSVVYGAIVYAMIGFEWTAAKFFWYIFFMYFTL 1317
            REKAAGMY+ +P+A AQ+++E+PY+ VQ+V YG IVYAMIGFEWTA KFFWY+FFMYFTL
Sbjct: 1239 REKAAGMYSALPYAFAQILVELPYVFVQAVTYGVIVYAMIGFEWTAEKFFWYLFFMYFTL 1298

Query: 1318 LFFTFYGMMAVALTPNHHIAAIVSTLFYGLWNVFSGFIIPRPRIPIWWRWYYWANPIAWT 1377
            L++TFYGMM V LTPNHHIA+IV+  FY +WN+FSGF++ RP IP+WWRWYYWA P+AWT
Sbjct: 1299 LYYTFYGMMTVGLTPNHHIASIVAAAFYAVWNLFSGFVVTRPSIPVWWRWYYWACPVAWT 1358

Query: 1378 LYGLVASQFGDMDDKKMDTGET-VKQFLKDYFDFKHDFLGVVAAVLVVFAVLFGFLFALG 1436
            +YGLVASQFGD+ +     G+  VK FL+DY+  KHDF+GV A V+   AVLF  +FA+ 
Sbjct: 1359 IYGLVASQFGDLTEPMTSEGQKIVKDFLEDYYGIKHDFIGVSAVVVAGIAVLFALIFAVS 1418

Query: 1437 IKMFNFQRR 1445
            IK FNFQ+R
Sbjct: 1419 IKTFNFQKR 1427




Source: Glycine max

Species: Glycine max

Genus: Glycine

Family: Fabaceae

Order: Fabales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|255543331|ref|XP_002512728.1| ATP-binding cassette transporter, putative [Ricinus communis] gi|223547739|gb|EEF49231.1| ATP-binding cassette transporter, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|297743362|emb|CBI36229.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|359482642|ref|XP_002285020.2| PREDICTED: pleiotropic drug resistance protein 1-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|147816688|emb|CAN77690.1| hypothetical protein VITISV_022715 [Vitis vinifera] Back     alignment and taxonomy information
>gi|357455075|ref|XP_003597818.1| Pleiotropic drug resistance protein [Medicago truncatula] gi|355486866|gb|AES68069.1| Pleiotropic drug resistance protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|297743343|emb|CBI36210.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|359482993|ref|XP_002285178.2| PREDICTED: pleiotropic drug resistance protein 1 isoform 1 [Vitis vinifera] Back     alignment and taxonomy information
>gi|359482991|ref|XP_003632876.1| PREDICTED: pleiotropic drug resistance protein 1 isoform 3 [Vitis vinifera] Back     alignment and taxonomy information
>gi|356519409|ref|XP_003528365.1| PREDICTED: pleiotropic drug resistance protein 1-like [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1445
TAIR|locus:20448931453 ABCG34 "ATP-binding cassette G 0.958 0.953 0.557 0.0
TAIR|locus:20259311469 PEN3 "PENETRATION 3" [Arabidop 0.989 0.973 0.537 0.0
TAIR|locus:20395231420 ABCG32 "ATP-binding cassette G 0.974 0.991 0.527 0.0
TAIR|locus:21965931423 ABCG40 "ATP-binding cassette G 0.548 0.556 0.602 0.0
TAIR|locus:20196931454 ABCG39 "ATP-binding cassette G 0.532 0.529 0.516 0.0
TAIR|locus:20377031442 ABCG35 "ATP-binding cassette G 0.524 0.525 0.536 0.0
TAIR|locus:20949521416 ABCG29 "ATP-binding cassette G 0.520 0.531 0.515 0.0
TAIR|locus:20456831426 ABCG31 "ATP-binding cassette G 0.519 0.525 0.470 0.0
TAIR|locus:20498671413 ABCG33 "ATP-binding cassette G 0.514 0.525 0.471 0.0
TAIR|locus:20840811450 ABCG37 "ATP-binding cassette G 0.512 0.510 0.482 0.0
TAIR|locus:2044893 ABCG34 "ATP-binding cassette G34" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 4068 (1437.1 bits), Expect = 0., P = 0.
 Identities = 788/1414 (55%), Positives = 989/1414 (69%)

Query:    42 LKWAALEKLPTYNRLRKGIL--TTSRGEAN--EVDVYNLGLQERQRLIDKLVKVTDVDNE 97
             L+WAALE+LPTY+RLRKG+L  T   G+    +VDV NL  +E++ L++ ++K  + DNE
Sbjct:    59 LRWAALERLPTYDRLRKGMLPQTMVNGKIGLEDVDVTNLAPKEKKHLMEMILKFVEEDNE 118

Query:    98 RFLLKLKNRIDRVGIDLPKVEVRYEHLNVEAEAFLASNALPSFIKFYTNIFEDILNYLRI 157
             +FL +L+ R DRVGI++PK+EVRYE+L+VE +   AS ALP+      N  E IL    +
Sbjct:   119 KFLRRLRERTDRVGIEVPKIEVRYENLSVEGDVRSASRALPTLFNVTLNTIESILGLFHL 178

Query:   158 IPSKKRHLTILKDVSGVIKPGRLTLLLGPPXXXXXXXXXXXXXXXDPTLKVSGTVTYNGH 217
             +PSKKR + ILKD+SG+IKP R+TLLLGPP               D TL++SG +TY GH
Sbjct:   179 LPSKKRKIEILKDISGIIKPSRMTLLLGPPSSGKTTLLQALAGKLDDTLQMSGRITYCGH 238

Query:   218 DMDEFVPQRTAAYISQHDNHIGEMTVRETLAFSARCQGVGTRYEMLTELARREKAAGIKP 277
             +  EFVPQ+T AYISQHD H GEMTVRE+L FS RC GVGTRY++LTEL+RRE+ AGIKP
Sbjct:   239 EFREFVPQKTCAYISQHDLHFGEMTVRESLDFSGRCLGVGTRYQLLTELSRREREAGIKP 298

Query:   278 DPDIDVYMKAIATEGQEANVITDYYLKVLGLDVCADTMVGDEMIRGISGGQKKRVTTGEM 337
             DP+ID +MK+IA  GQE +++TDY LK+LGLD+CADT+VGD M RGISGGQ+KR+TTGEM
Sbjct:   299 DPEIDAFMKSIAISGQETSLVTDYVLKLLGLDICADTLVGDVMRRGISGGQRKRLTTGEM 358

Query:   338 MVGPALALFMDEISTGLDSSTTFQIVNCLRQNIHINSGTAVISLLQPAPETYDLFDDIIL 397
             +VGPA ALFMDEISTGLDSSTTFQI   +RQ +HI   T VISLLQPAPET++LFDDIIL
Sbjct:   359 LVGPATALFMDEISTGLDSSTTFQICKFMRQLVHIADVTMVISLLQPAPETFELFDDIIL 418

Query:   398 LSDGQIVYQGPRELVLEFFASMGFRCPKRKGVADFLQEVTSRKDQRQYWAHKEKPYRFVT 457
             LS+GQIVYQG R+ VLEFF  MGF+CP+RKG+ADFLQEVTS+KDQ QYW  +E PY +V+
Sbjct:   419 LSEGQIVYQGSRDNVLEFFEYMGFKCPERKGIADFLQEVTSKKDQEQYWNRREHPYSYVS 478

Query:   458 VQEFAEAFQSFHVGQKISDELRTPFDKSKSHRAALTTETYGVGKRELLKANISRELLLMK 517
             V +F+  F SFH GQ+++ E R P+DK+K+H AAL T+ YG+  ++L KA   RE LLMK
Sbjct:   479 VHDFSSGFNSFHAGQQLASEFRVPYDKAKTHPAALVTQKYGISNKDLFKACFDREWLLMK 538

Query:   518 RNSFVYIFKLIQIAFVAVVYMTLFLRTKMHKDTVTDGGIFAGATFFAITMVNFNGFSEIS 577
             RNSFVY+FK +QI  ++++ MT++ RT+MH  TV DG  F GA FF++  + FNG +E++
Sbjct:   539 RNSFVYVFKTVQITIMSLIAMTVYFRTEMHVGTVQDGQKFYGALFFSLINLMFNGMAELA 598

Query:   578 MTIAKLPVFYKQRDFRFFPPWAYAIPSWILKIPVSFLEVAVWVFLSYYVVGYDSNAGRFF 637
              T+ +LPVF+KQRDF F+PPWA+A+P ++LKIP+S +E  +W+ L+YY +G+  +A RFF
Sbjct:   599 FTVMRLPVFFKQRDFLFYPPWAFALPGFLLKIPLSLIESVIWIALTYYTIGFAPSAARFF 658

Query:   638 KQYALLLGVNQMASALFRFIAVTGRNMVVANTXXXXXXXXXXXXXXXXXXREDIKKWWKW 697
             +Q      VNQMA +LFRF+   GR  V+AN+                  ++DI  W  W
Sbjct:   659 RQLLAYFCVNQMALSLFRFLGALGRTEVIANSGGTLALLVVFVLGGFIISKDDIPSWLTW 718

Query:   698 AYWCSPLTYAQNAIVANEFLGHSWKKFTQDS---SETLGVQVLKSRGFFAHEYWYWXXXX 754
              Y+ SP+ Y Q A+V NEFL   W     D+   ++T+G  +LKSRGFF   YW+W    
Sbjct:   719 CYYTSPMMYGQTALVINEFLDERWGSPNNDTRINAKTVGEVLLKSRGFFTEPYWFWICIG 778

Query:   755 XXXXXXXXXXXAYTLALTFLDPFEKPRAVITEEIESNEQDDRIGGNVQLSTLGGSTDDIR 814
                         Y +AL +L+P    +A  T  +E  + D   G +   S  GGS  ++ 
Sbjct:   779 ALLGFTVLFNFCYIIALMYLNPLGNSKA--TTVVEEGK-DKHKGSH---SGTGGSVVELT 832

Query:   815 GXXXXXXXXXXXXXXXXRPKKKGMVLPFEPHSLTFDEVVYSVDMPEEMKVQGVLEDKLVL 874
                               PKK GMVLPF+P SL F+ V Y VDMP EMK QGV  D+L L
Sbjct:   833 STSSHG------------PKK-GMVLPFQPLSLAFNNVNYYVDMPAEMKAQGVEGDRLQL 879

Query:   875 LNGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGYITGNITISGYPKKQETFARIS 934
             L  V GAFRPGVLTAL+GVSGAGKTTLMDVLAGRKTGGY+ G+I ISGYPK Q TFAR+S
Sbjct:   880 LRDVGGAFRPGVLTALVGVSGAGKTTLMDVLAGRKTGGYVEGSINISGYPKNQATFARVS 939

Query:   935 GYCEQNDIHSPFVTIYESLLFSAWLRLSPEVDSETRKMFIDEVMELVELNPLRQSLVGLP 994
             GYCEQNDIHSP VT+YESL++SAWLRLS ++D++TR+MF++EVMELVEL PLR S+VGLP
Sbjct:   940 GYCEQNDIHSPHVTVYESLIYSAWLRLSADIDTKTREMFVEEVMELVELKPLRNSIVGLP 999

Query:   995 GVSGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTVVCT 1054
             GV GLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTVVCT
Sbjct:  1000 GVDGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTVVCT 1059

Query:  1055 IHQPSIDIFEAFDELFLMKRGGQEIYVGPLGRHSCHLISYFEAIPGVQKIKDGYNPATWM 1114
             IHQPSIDIFE+FDEL LMKRGGQ IY G LG HS  L+ YFEAI GV KIKDGYNPATWM
Sbjct:  1060 IHQPSIDIFESFDELLLMKRGGQVIYAGTLGHHSQKLVEYFEAIEGVPKIKDGYNPATWM 1119

Query:  1115 LEVSAASQELALGIDFTEHYKRSDLYRRNKALIEDLSRPPPGSKDLYFPTQFSQSSWIQF 1174
             L+V+  S E  + +DF + +  S + RRN+ LI++LS PPPGS DLYF T+++Q    Q 
Sbjct:  1120 LDVTTPSMESQMSVDFAQIFVNSSVNRRNQELIKELSTPPPGSNDLYFRTKYAQPFSTQT 1179

Query:  1175 VACLWKQHWSYWRNPPYTAVRFFFTAFIALLFGSLFWDLGGRTKRNQDLFNAMGSMFTAV 1234
              AC WK +WS WR P Y A+RF  T  I +LFG LFW  G + ++ QDL N  G+M+ AV
Sbjct:  1180 KACFWKMYWSNWRYPQYNAIRFLMTVVIGVLFGLLFWQTGTKIEKEQDLNNFFGAMYAAV 1239

Query:  1235 LFLGVQYCSSVQPIVSVERTVFYREKAAGMYAGIPWALAQVMIEIPYILVQSVVYGAIVY 1294
             LFLG    ++VQP V++ERTVFYREKAAGMY+ IP+A++QV +EI Y  +Q+ VY  I+Y
Sbjct:  1240 LFLGATNAATVQPAVAIERTVFYREKAAGMYSAIPYAISQVAVEIMYNTIQTGVYTLILY 1299

Query:  1295 AMIGFEWTAAKFFWYIXXXXXXXXXXXXXXXMAVALTPNHHIAAIVSTLFYGLWNVFSGF 1354
             +MIG++WT  KFFW+                M VALTPN+ IA I  + F   WN+FSGF
Sbjct:  1300 SMIGYDWTVVKFFWFYYYMLTCFVYFTLYGMMLVALTPNYQIAGICLSFFLSFWNLFSGF 1359

Query:  1355 XXXXXXXXXXXXXYYWANPIAWTLYGLVASQFGDMDDKKMDTGE---TVKQFLKDYFDFK 1411
                          YYWA+P+AWTLYG++ SQ GD D     TG    ++K  LK+ F F 
Sbjct:  1360 LIPRPQIPIWWRWYYWASPVAWTLYGIITSQVGDRDSIVHITGVGDMSLKTLLKNGFGFD 1419

Query:  1412 HDXXXXXXXXXXXXXXXXXXXXXXXIKMFNFQRR 1445
             +D                       IK  NFQRR
Sbjct:  1420 YDFLPVVAVVHIAWILIFLFAFAYGIKFLNFQRR 1453




GO:0000166 "nucleotide binding" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA
GO:0016020 "membrane" evidence=IEA
GO:0016887 "ATPase activity" evidence=IEA
GO:0017111 "nucleoside-triphosphatase activity" evidence=IEA
GO:0042626 "ATPase activity, coupled to transmembrane movement of substances" evidence=ISS
GO:0005886 "plasma membrane" evidence=IDA
TAIR|locus:2025931 PEN3 "PENETRATION 3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2039523 ABCG32 "ATP-binding cassette G32" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2196593 ABCG40 "ATP-binding cassette G40" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2019693 ABCG39 "ATP-binding cassette G39" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2037703 ABCG35 "ATP-binding cassette G35" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2094952 ABCG29 "ATP-binding cassette G29" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2045683 ABCG31 "ATP-binding cassette G31" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2049867 ABCG33 "ATP-binding cassette G33" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2084081 ABCG37 "ATP-binding cassette G37" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q2PCF1PDR2_NICPLNo assigned EC number0.58730.98060.9698N/Ano
Q0JLC5PDR3_ORYSJNo assigned EC number0.69690.98400.9759yesno
Q9M9E1AB40G_ARATHNo assigned EC number0.69060.98260.9978yesno
O24367TUR2_SPIPONo assigned EC number0.69450.98470.9875N/Ano
Q76CU2PDR1_TOBACNo assigned EC number0.72870.97780.9853N/Ano
Q949G3PDR1_NICPLNo assigned EC number0.71270.97850.9846N/Ano
A2WSH0PDR3_ORYSINo assigned EC number0.69620.98400.9759N/Ano
Q5W274PDR3_TOBACNo assigned EC number0.52870.97640.9751N/Ano

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
ABC
SubName- Full=Chromosome chr9 scaffold_7, whole genome shotgun sequence; (1433 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1445
PLN031401470 PLN03140, PLN03140, ABC transporter G family membe 0.0
TIGR009561394 TIGR00956, 3a01205, Pleiotropic Drug Resistance (P 0.0
cd03232192 cd03232, ABCG_PDR_domain2, Second domain of the pl 1e-100
TIGR00955617 TIGR00955, 3a01204, The Eye Pigment Precursor Tran 9e-98
TIGR00955617 TIGR00955, 3a01204, The Eye Pigment Precursor Tran 4e-74
cd03213194 cd03213, ABCG_EPDR, Eye pigment and drug resistanc 1e-72
cd03234226 cd03234, ABCG_White, White pigment protein homolog 8e-55
pfam01061210 pfam01061, ABC2_membrane, ABC-2 type transporter 3e-54
PLN03211659 PLN03211, PLN03211, ABC transporter G-25; Provisio 2e-46
pfam01061210 pfam01061, ABC2_membrane, ABC-2 type transporter 6e-45
COG1131293 COG1131, CcmA, ABC-type multidrug transport system 7e-44
cd03234226 cd03234, ABCG_White, White pigment protein homolog 4e-42
cd03233202 cd03233, ABCG_PDR_domain1, First domain of the ple 3e-39
COG1131293 COG1131, CcmA, ABC-type multidrug transport system 3e-38
cd03233202 cd03233, ABCG_PDR_domain1, First domain of the ple 4e-37
PLN03211659 PLN03211, PLN03211, ABC transporter G-25; Provisio 8e-34
cd03233202 cd03233, ABCG_PDR_domain1, First domain of the ple 2e-33
cd03263220 cd03263, ABC_subfamily_A, ATP-binding cassette dom 8e-32
cd03213194 cd03213, ABCG_EPDR, Eye pigment and drug resistanc 3e-30
cd03225211 cd03225, ABC_cobalt_CbiO_domain1, First domain of 1e-29
cd03264211 cd03264, ABC_drug_resistance_like, ABC-type multid 9e-29
pfam0837065 pfam08370, PDR_assoc, Plant PDR ABC transporter as 5e-27
cd03235213 cd03235, ABC_Metallic_Cations, ATP-binding cassett 3e-24
COG1120258 COG1120, FepC, ABC-type cobalamin/Fe3+-siderophore 2e-23
cd03263220 cd03263, ABC_subfamily_A, ATP-binding cassette dom 3e-23
cd03255218 cd03255, ABC_MJ0796_LolCDE_FtsE, ATP-binding casse 2e-22
cd03214180 cd03214, ABC_Iron-Siderophores_B12_Hemin, ATP-bind 3e-22
COG1120258 COG1120, FepC, ABC-type cobalamin/Fe3+-siderophore 5e-22
cd03225211 cd03225, ABC_cobalt_CbiO_domain1, First domain of 6e-22
cd03230173 cd03230, ABC_DR_subfamily_A, ATP-binding cassette 9e-22
cd03232192 cd03232, ABCG_PDR_domain2, Second domain of the pl 1e-21
cd03259213 cd03259, ABC_Carb_Solutes_like, ATP-binding casset 3e-21
cd03229178 cd03229, ABC_Class3, ATP-binding cassette domain o 3e-21
COG1121254 COG1121, ZnuC, ABC-type Mn/Zn transport systems, A 5e-21
cd03213194 cd03213, ABCG_EPDR, Eye pigment and drug resistanc 2e-20
cd03226205 cd03226, ABC_cobalt_CbiO_domain2, Second domain of 2e-20
COG1122235 COG1122, CbiO, ABC-type cobalt transport system, A 2e-20
COG4988559 COG4988, CydD, ABC-type transport system involved 5e-20
COG1136226 COG1136, SalX, ABC-type antimicrobial peptide tran 6e-20
TIGR01166190 TIGR01166, cbiO, cobalt transport protein ATP-bind 9e-20
cd00267157 cd00267, ABC_ATPase, ATP-binding cassette transpor 4e-19
TIGR01188302 TIGR01188, drrA, daunorubicin resistance ABC trans 6e-19
COG2274709 COG2274, SunT, ABC-type bacteriocin/lantibiotic ex 9e-19
cd03255218 cd03255, ABC_MJ0796_LolCDE_FtsE, ATP-binding casse 3e-18
COG1122235 COG1122, CbiO, ABC-type cobalt transport system, A 3e-18
cd03265220 cd03265, ABC_DrrA, Daunorubicin/doxorubicin resist 5e-18
TIGR02857529 TIGR02857, CydD, thiol reductant ABC exporter, Cyd 6e-18
COG1118345 COG1118, CysA, ABC-type sulfate/molybdate transpor 6e-18
cd03219236 cd03219, ABC_Mj1267_LivG_branched, ATP-binding cas 1e-17
cd03245220 cd03245, ABCC_bacteriocin_exporters, ATP-binding c 1e-17
cd03261235 cd03261, ABC_Org_Solvent_Resistant, ATP-binding ca 1e-17
cd03266218 cd03266, ABC_NatA_sodium_exporter, ATP-binding cas 2e-17
cd03292214 cd03292, ABC_FtsE_transporter, ATP-binding cassett 2e-17
TIGR02868530 TIGR02868, CydC, thiol reductant ABC exporter, Cyd 2e-17
cd03228171 cd03228, ABCC_MRP_Like, ATP-binding cassette domai 3e-17
cd03293220 cd03293, ABC_NrtD_SsuB_transporters, ATP-binding c 4e-17
TIGR02315243 TIGR02315, ABC_phnC, phosphonate ABC transporter, 4e-17
cd03261235 cd03261, ABC_Org_Solvent_Resistant, ATP-binding ca 5e-17
TIGR03864236 TIGR03864, PQQ_ABC_ATP, ABC transporter, ATP-bindi 5e-17
cd03256241 cd03256, ABC_PhnC_transporter, ATP-binding cassett 5e-17
COG4555245 COG4555, NatA, ABC-type Na+ transport system, ATPa 5e-17
cd03268208 cd03268, ABC_BcrA_bacitracin_resist, ATP-binding c 9e-17
cd03256241 cd03256, ABC_PhnC_transporter, ATP-binding cassett 1e-16
COG3842352 COG3842, PotA, ABC-type spermidine/putrescine tran 1e-16
COG3638258 COG3638, COG3638, ABC-type phosphate/phosphonate t 1e-16
COG1136226 COG1136, SalX, ABC-type antimicrobial peptide tran 2e-16
COG3839338 COG3839, MalK, ABC-type sugar transport systems, A 3e-16
TIGR00968237 TIGR00968, 3a0106s01, sulfate ABC transporter, ATP 3e-16
TIGR03608206 TIGR03608, L_ocin_972_ABC, putative bacteriocin ex 4e-16
cd03257228 cd03257, ABC_NikE_OppD_transporters, ATP-binding c 5e-16
PRK13539207 PRK13539, PRK13539, cytochrome c biogenesis protei 5e-16
cd03297214 cd03297, ABC_ModC_molybdenum_transporter, ATP-bind 6e-16
COG4555245 COG4555, NatA, ABC-type Na+ transport system, ATPa 9e-16
COG3839338 COG3839, MalK, ABC-type sugar transport systems, A 9e-16
COG1118345 COG1118, CysA, ABC-type sulfate/molybdate transpor 1e-15
cd03259213 cd03259, ABC_Carb_Solutes_like, ATP-binding casset 2e-15
TIGR03873256 TIGR03873, F420-0_ABC_ATP, proposed F420-0 ABC tra 2e-15
PRK13537306 PRK13537, PRK13537, nodulation ABC transporter Nod 2e-15
COG0411250 COG0411, LivG, ABC-type branched-chain amino acid 2e-15
PRK13536340 PRK13536, PRK13536, nodulation factor exporter sub 3e-15
COG1121254 COG1121, ZnuC, ABC-type Mn/Zn transport systems, A 4e-15
TIGR01978243 TIGR01978, sufC, FeS assembly ATPase SufC 4e-15
COG4559259 COG4559, COG4559, ABC-type hemin transport system, 4e-15
COG4133209 COG4133, CcmA, ABC-type transport system involved 4e-15
COG3638258 COG3638, COG3638, ABC-type phosphate/phosphonate t 6e-15
cd03224222 cd03224, ABC_TM1139_LivF_branched, ATP-binding cas 6e-15
cd03219236 cd03219, ABC_Mj1267_LivG_branched, ATP-binding cas 1e-14
COG3842352 COG3842, PotA, ABC-type spermidine/putrescine tran 1e-14
cd03257228 cd03257, ABC_NikE_OppD_transporters, ATP-binding c 1e-14
cd03260227 cd03260, ABC_PstB_phosphate_transporter, ATP-bindi 1e-14
cd03269210 cd03269, ABC_putative_ATPase, ATP-binding cassette 1e-14
cd03218232 cd03218, ABC_YhbG, ATP-binding cassette component 1e-14
cd03246173 cd03246, ABCC_Protease_Secretion, ATP-binding cass 1e-14
cd03296239 cd03296, ABC_CysA_sulfate_importer, ATP-binding ca 2e-14
COG1116248 COG1116, TauB, ABC-type nitrate/sulfonate/bicarbon 2e-14
COG4988559 COG4988, CydD, ABC-type transport system involved 4e-14
COG1123539 COG1123, COG1123, ATPase components of various ABC 4e-14
PRK13548258 PRK13548, hmuV, hemin importer ATP-binding subunit 6e-14
cd03235213 cd03235, ABC_Metallic_Cations, ATP-binding cassett 1e-13
cd03245220 cd03245, ABCC_bacteriocin_exporters, ATP-binding c 1e-13
COG0411250 COG0411, LivG, ABC-type branched-chain amino acid 1e-13
COG4559259 COG4559, COG4559, ABC-type hemin transport system, 1e-13
cd03296239 cd03296, ABC_CysA_sulfate_importer, ATP-binding ca 1e-13
TIGR03375694 TIGR03375, type_I_sec_LssB, type I secretion syste 1e-13
COG4674249 COG4674, COG4674, Uncharacterized ABC-type transpo 1e-13
COG0396251 COG0396, sufC, Cysteine desulfurase activator ATPa 1e-13
cd03254229 cd03254, ABCC_Glucan_exporter_like, ATP-binding ca 1e-13
COG4152300 COG4152, COG4152, ABC-type uncharacterized transpo 1e-13
cd03264211 cd03264, ABC_drug_resistance_like, ABC-type multid 2e-13
PRK13539207 PRK13539, PRK13539, cytochrome c biogenesis protei 2e-13
TIGR03873256 TIGR03873, F420-0_ABC_ATP, proposed F420-0 ABC tra 2e-13
COG0396251 COG0396, sufC, Cysteine desulfurase activator ATPa 2e-13
COG1127263 COG1127, Ttg2A, ABC-type transport system involved 2e-13
PRK10895241 PRK10895, PRK10895, lipopolysaccharide ABC transpo 2e-13
COG4604252 COG4604, CeuD, ABC-type enterochelin transport sys 2e-13
TIGR01288303 TIGR01288, nodI, ATP-binding ABC transporter famil 2e-13
COG1124252 COG1124, DppF, ABC-type dipeptide/oligopeptide/nic 2e-13
TIGR02315243 TIGR02315, ABC_phnC, phosphonate ABC transporter, 3e-13
TIGR01189198 TIGR01189, ccmA, heme ABC exporter, ATP-binding pr 3e-13
COG1129500 COG1129, MglA, ABC-type sugar transport system, AT 3e-13
cd03232192 cd03232, ABCG_PDR_domain2, Second domain of the pl 4e-13
TIGR02857529 TIGR02857, CydD, thiol reductant ABC exporter, Cyd 4e-13
cd03224222 cd03224, ABC_TM1139_LivF_branched, ATP-binding cas 4e-13
cd03230173 cd03230, ABC_DR_subfamily_A, ATP-binding cassette 5e-13
PRK13636283 PRK13636, cbiO, cobalt transporter ATP-binding sub 6e-13
PRK13548258 PRK13548, hmuV, hemin importer ATP-binding subunit 7e-13
cd03266218 cd03266, ABC_NatA_sodium_exporter, ATP-binding cas 8e-13
cd03293220 cd03293, ABC_NrtD_SsuB_transporters, ATP-binding c 9e-13
COG1127263 COG1127, Ttg2A, ABC-type transport system involved 9e-13
cd03252237 cd03252, ABCC_Hemolysin, ATP-binding cassette doma 9e-13
cd03228171 cd03228, ABCC_MRP_Like, ATP-binding cassette domai 1e-12
TIGR00968237 TIGR00968, 3a0106s01, sulfate ABC transporter, ATP 1e-12
cd03249238 cd03249, ABC_MTABC3_MDL1_MDL2, ATP-binding cassett 1e-12
TIGR03411242 TIGR03411, urea_trans_UrtD, urea ABC transporter, 1e-12
COG2274709 COG2274, SunT, ABC-type bacteriocin/lantibiotic ex 2e-12
cd03297214 cd03297, ABC_ModC_molybdenum_transporter, ATP-bind 2e-12
cd03253236 cd03253, ABCC_ATM1_transporter, ATP-binding casset 2e-12
cd03250204 cd03250, ABCC_MRP_domain1, ATP-binding cassette do 2e-12
TIGR02982220 TIGR02982, heterocyst_DevA, ABC exporter ATP-bindi 2e-12
TIGR012572272 TIGR01257, rim_protein, retinal-specific rim ABC t 2e-12
COG0410237 COG0410, LivF, ABC-type branched-chain amino acid 2e-12
COG4525259 COG4525, TauB, ABC-type taurine transport system, 2e-12
PRK11231255 PRK11231, fecE, iron-dicitrate transporter ATP-bin 3e-12
COG1137243 COG1137, YhbG, ABC-type (unclassified) transport s 3e-12
TIGR01842544 TIGR01842, type_I_sec_PrtD, type I secretion syste 3e-12
cd03301213 cd03301, ABC_MalK_N, The N-terminal ATPase domain 4e-12
TIGR03740223 TIGR03740, galliderm_ABC, gallidermin-class lantib 4e-12
TIGR02868530 TIGR02868, CydC, thiol reductant ABC exporter, Cyd 5e-12
COG1132567 COG1132, MdlB, ABC-type multidrug transport system 5e-12
PRK14239252 PRK14239, PRK14239, phosphate transporter ATP-bind 5e-12
PRK11231255 PRK11231, fecE, iron-dicitrate transporter ATP-bin 6e-12
PRK13638271 PRK13638, cbiO, cobalt transporter ATP-binding sub 6e-12
PRK15056272 PRK15056, PRK15056, manganese/iron transporter ATP 7e-12
cd03267236 cd03267, ABC_NatA_like, ATP-binding cassette domai 7e-12
cd03249238 cd03249, ABC_MTABC3_MDL1_MDL2, ATP-binding cassett 8e-12
cd03253236 cd03253, ABCC_ATM1_transporter, ATP-binding casset 9e-12
cd03299235 cd03299, ABC_ModC_like, ATP-binding cassette domai 9e-12
cd03226205 cd03226, ABC_cobalt_CbiO_domain2, Second domain of 1e-11
TIGR02982220 TIGR02982, heterocyst_DevA, ABC exporter ATP-bindi 1e-11
cd03300232 cd03300, ABC_PotA_N, ATP-binding cassette domain o 1e-11
PRK10584228 PRK10584, PRK10584, putative ABC transporter ATP-b 1e-11
TIGR03258362 TIGR03258, PhnT, 2-aminoethylphosphonate ABC trans 1e-11
cd00267157 cd00267, ABC_ATPase, ATP-binding cassette transpor 2e-11
TIGR03864236 TIGR03864, PQQ_ABC_ATP, ABC transporter, ATP-bindi 2e-11
cd03260227 cd03260, ABC_PstB_phosphate_transporter, ATP-bindi 2e-11
cd03269210 cd03269, ABC_putative_ATPase, ATP-binding cassette 2e-11
COG1123539 COG1123, COG1123, ATPase components of various ABC 2e-11
COG4604252 COG4604, CeuD, ABC-type enterochelin transport sys 2e-11
cd03300232 cd03300, ABC_PotA_N, ATP-binding cassette domain o 2e-11
COG4586325 COG4586, COG4586, ABC-type uncharacterized transpo 2e-11
COG1125309 COG1125, OpuBA, ABC-type proline/glycine betaine t 2e-11
COG1135339 COG1135, AbcC, ABC-type metal ion transport system 2e-11
cd03295242 cd03295, ABC_OpuCA_Osmoprotection, ATP-binding cas 2e-11
cd03265220 cd03265, ABC_DrrA, Daunorubicin/doxorubicin resist 3e-11
PRK13547272 PRK13547, hmuV, hemin importer ATP-binding subunit 3e-11
COG4618580 COG4618, ArpD, ABC-type protease/lipase transport 3e-11
cd03251234 cd03251, ABCC_MsbA, ATP-binding cassette domain of 3e-11
pfam00005119 pfam00005, ABC_tran, ABC transporter 3e-11
PRK09984262 PRK09984, PRK09984, phosphonate/organophosphate es 3e-11
TIGR03522301 TIGR03522, GldA_ABC_ATP, gliding motility-associat 3e-11
TIGR02673214 TIGR02673, FtsE, cell division ATP-binding protein 4e-11
COG1123539 COG1123, COG1123, ATPase components of various ABC 5e-11
COG1117253 COG1117, PstB, ABC-type phosphate transport system 5e-11
cd03299235 cd03299, ABC_ModC_like, ATP-binding cassette domai 6e-11
TIGR02211221 TIGR02211, LolD_lipo_ex, lipoprotein releasing sys 6e-11
cd03292214 cd03292, ABC_FtsE_transporter, ATP-binding cassett 7e-11
COG1135339 COG1135, AbcC, ABC-type metal ion transport system 7e-11
TIGR02142354 TIGR02142, modC_ABC, molybdenum ABC transporter, A 8e-11
PRK11264250 PRK11264, PRK11264, putative amino-acid ABC transp 8e-11
COG2884223 COG2884, FtsE, Predicted ATPase involved in cell d 9e-11
TIGR03265353 TIGR03265, PhnT2, putative 2-aminoethylphosphonate 9e-11
COG4181228 COG4181, COG4181, Predicted ABC-type transport sys 1e-10
COG4136213 COG4136, COG4136, ABC-type uncharacterized transpo 1e-10
PRK09700510 PRK09700, PRK09700, D-allose transporter ATP-bindi 1e-10
COG0488530 COG0488, Uup, ATPase components of ABC transporter 1e-10
PRK13652277 PRK13652, cbiO, cobalt transporter ATP-binding sub 1e-10
PRK13639275 PRK13639, cbiO, cobalt transporter ATP-binding sub 1e-10
cd03301213 cd03301, ABC_MalK_N, The N-terminal ATPase domain 2e-10
TIGR03258362 TIGR03258, PhnT, 2-aminoethylphosphonate ABC trans 2e-10
COG4181228 COG4181, COG4181, Predicted ABC-type transport sys 2e-10
PRK11248255 PRK11248, tauB, taurine transporter ATP-binding su 2e-10
COG0444316 COG0444, DppD, ABC-type dipeptide/oligopeptide/nic 2e-10
cd03258233 cd03258, ABC_MetN_methionine_transporter, ATP-bind 2e-10
COG4987573 COG4987, CydC, ABC-type transport system involved 2e-10
COG4138248 COG4138, BtuD, ABC-type cobalamin transport system 2e-10
TIGR03796710 TIGR03796, NHLM_micro_ABC1, NHLM bacteriocin syste 2e-10
PRK13640282 PRK13640, cbiO, cobalt transporter ATP-binding sub 2e-10
COG0410237 COG0410, LivF, ABC-type branched-chain amino acid 3e-10
TIGR03797686 TIGR03797, NHLM_micro_ABC2, NHLM bacteriocin syste 3e-10
COG3845501 COG3845, COG3845, ABC-type uncharacterized transpo 3e-10
PRK13631320 PRK13631, cbiO, cobalt transporter ATP-binding sub 3e-10
TIGR01187325 TIGR01187, potA, spermidine/putrescine ABC transpo 3e-10
COG1123539 COG1123, COG1123, ATPase components of various ABC 4e-10
cd03250204 cd03250, ABCC_MRP_domain1, ATP-binding cassette do 4e-10
TIGR02203571 TIGR02203, MsbA_lipidA, lipid A export permease/AT 4e-10
COG4107258 COG4107, PhnK, ABC-type phosphonate transport syst 4e-10
TIGR03410230 TIGR03410, urea_trans_UrtE, urea ABC transporter, 4e-10
PRK09452375 PRK09452, potA, putrescine/spermidine ABC transpor 4e-10
PRK14272252 PRK14272, PRK14272, phosphate ABC transporter ATP- 4e-10
cd03214180 cd03214, ABC_Iron-Siderophores_B12_Hemin, ATP-bind 5e-10
cd03231201 cd03231, ABC_CcmA_heme_exporter, Cytochrome c biog 5e-10
COG1119257 COG1119, ModF, ABC-type molybdenum transport syste 5e-10
TIGR01846694 TIGR01846, type_I_sec_HlyB, type I secretion syste 5e-10
TIGR01166190 TIGR01166, cbiO, cobalt transport protein ATP-bind 6e-10
PRK11288501 PRK11288, araG, L-arabinose transporter ATP-bindin 6e-10
PRK10575265 PRK10575, PRK10575, iron-hydroxamate transporter A 7e-10
COG1101263 COG1101, PhnK, ABC-type uncharacterized transport 8e-10
PRK09536402 PRK09536, btuD, corrinoid ABC transporter ATPase; 9e-10
TIGR01188302 TIGR01188, drrA, daunorubicin resistance ABC trans 1e-09
COG4525259 COG4525, TauB, ABC-type taurine transport system, 1e-09
COG4586325 COG4586, COG4586, ABC-type uncharacterized transpo 1e-09
COG1125309 COG1125, OpuBA, ABC-type proline/glycine betaine t 1e-09
cd03251234 cd03251, ABCC_MsbA, ATP-binding cassette domain of 1e-09
COG0444316 COG0444, DppD, ABC-type dipeptide/oligopeptide/nic 1e-09
COG3840231 COG3840, ThiQ, ABC-type thiamine transport system, 1e-09
TIGR01193708 TIGR01193, bacteriocin_ABC, ABC-type bacteriocin t 1e-09
COG4148352 COG4148, ModC, ABC-type molybdate transport system 1e-09
TIGR00972247 TIGR00972, 3a0107s01c2, phosphate ABC transporter, 1e-09
cd03217200 cd03217, ABC_FeS_Assembly, ABC-type transport syst 2e-09
COG1132567 COG1132, MdlB, ABC-type multidrug transport system 3e-09
COG1119257 COG1119, ModF, ABC-type molybdenum transport syste 3e-09
TIGR02323253 TIGR02323, CP_lyasePhnK, phosphonate C-P lyase sys 3e-09
cd03298211 cd03298, ABC_ThiQ_thiamine_transporter, ATP-bindin 3e-09
cd03254229 cd03254, ABCC_Glucan_exporter_like, ATP-binding ca 4e-09
TIGR03522301 TIGR03522, GldA_ABC_ATP, gliding motility-associat 4e-09
PRK13643288 PRK13643, cbiO, cobalt transporter ATP-binding sub 5e-09
PRK11174588 PRK11174, PRK11174, cysteine/glutathione ABC trans 5e-09
PRK14255252 PRK14255, PRK14255, phosphate ABC transporter ATP- 5e-09
TIGR01187325 TIGR01187, potA, spermidine/putrescine ABC transpo 6e-09
COG4133209 COG4133, CcmA, ABC-type transport system involved 7e-09
TIGR03375694 TIGR03375, type_I_sec_LssB, type I secretion syste 7e-09
COG0488530 COG0488, Uup, ATPase components of ABC transporter 8e-09
TIGR01978243 TIGR01978, sufC, FeS assembly ATPase SufC 1e-08
TIGR01189198 TIGR01189, ccmA, heme ABC exporter, ATP-binding pr 1e-08
COG4987573 COG4987, CydC, ABC-type transport system involved 1e-08
COG5265497 COG5265, ATM1, ABC-type transport system involved 1e-08
TIGR01277213 TIGR01277, thiQ, thiamine ABC transporter, ATP-bin 1e-08
COG1116248 COG1116, TauB, ABC-type nitrate/sulfonate/bicarbon 2e-08
PRK13547272 PRK13547, hmuV, hemin importer ATP-binding subunit 2e-08
TIGR03265353 TIGR03265, PhnT2, putative 2-aminoethylphosphonate 2e-08
cd03258233 cd03258, ABC_MetN_methionine_transporter, ATP-bind 2e-08
cd03248226 cd03248, ABCC_TAP, ATP-binding cassette domain of 2e-08
PRK13647274 PRK13647, cbiO, cobalt transporter ATP-binding sub 2e-08
COG1126240 COG1126, GlnQ, ABC-type polar amino acid transport 2e-08
cd03262213 cd03262, ABC_HisP_GlnQ, ATP-binding cassette domai 2e-08
COG4152300 COG4152, COG4152, ABC-type uncharacterized transpo 3e-08
cd03252237 cd03252, ABCC_Hemolysin, ATP-binding cassette doma 3e-08
COG1126240 COG1126, GlnQ, ABC-type polar amino acid transport 3e-08
PRK14247250 PRK14247, PRK14247, phosphate ABC transporter ATP- 3e-08
cd03244221 cd03244, ABCC_MRP_domain2, ATP-binding cassette do 3e-08
cd03268208 cd03268, ABC_BcrA_bacitracin_resist, ATP-binding c 4e-08
PRK13537306 PRK13537, PRK13537, nodulation ABC transporter Nod 4e-08
TIGR02673214 TIGR02673, FtsE, cell division ATP-binding protein 4e-08
PRK14253249 PRK14253, PRK14253, phosphate ABC transporter ATP- 4e-08
PRK13646286 PRK13646, cbiO, cobalt transporter ATP-binding sub 4e-08
TIGR01186363 TIGR01186, proV, glycine betaine/L-proline transpo 5e-08
PRK14241258 PRK14241, PRK14241, phosphate transporter ATP-bind 5e-08
COG4619223 COG4619, COG4619, ABC-type uncharacterized transpo 6e-08
cd03229178 cd03229, ABC_Class3, ATP-binding cassette domain o 7e-08
PRK11248255 PRK11248, tauB, taurine transporter ATP-binding su 7e-08
PRK13540200 PRK13540, PRK13540, cytochrome c biogenesis protei 8e-08
PRK10253265 PRK10253, PRK10253, iron-enterobactin transporter 8e-08
PRK13639275 PRK13639, cbiO, cobalt transporter ATP-binding sub 9e-08
cd03295242 cd03295, ABC_OpuCA_Osmoprotection, ATP-binding cas 1e-07
PRK09700510 PRK09700, PRK09700, D-allose transporter ATP-bindi 1e-07
TIGR03771223 TIGR03771, anch_rpt_ABC, anchored repeat-type ABC 1e-07
PRK10247225 PRK10247, PRK10247, putative ABC transporter ATP-b 1e-07
PRK14261253 PRK14261, PRK14261, phosphate ABC transporter ATP- 1e-07
PRK14235267 PRK14235, PRK14235, phosphate transporter ATP-bind 1e-07
TIGR02769265 TIGR02769, nickel_nikE, nickel import ATP-binding 1e-07
TIGR02769265 TIGR02769, nickel_nikE, nickel import ATP-binding 1e-07
PRK14245250 PRK14245, PRK14245, phosphate ABC transporter ATP- 1e-07
PRK11629233 PRK11629, lolD, lipoprotein transporter ATP-bindin 1e-07
PRK10982491 PRK10982, PRK10982, galactose/methyl galaxtoside t 1e-07
TIGR02204576 TIGR02204, MsbA_rel, ABC transporter, permease/ATP 1e-07
cd00267157 cd00267, ABC_ATPase, ATP-binding cassette transpor 2e-07
cd00267157 cd00267, ABC_ATPase, ATP-binding cassette transpor 2e-07
COG4136213 COG4136, COG4136, ABC-type uncharacterized transpo 2e-07
COG0488530 COG0488, Uup, ATPase components of ABC transporter 2e-07
TIGR02323253 TIGR02323, CP_lyasePhnK, phosphonate C-P lyase sys 2e-07
TIGR01184230 TIGR01184, ntrCD, nitrate transport ATP-binding su 2e-07
cd03238176 cd03238, ABC_UvrA, ATP-binding cassette domain of 2e-07
PRK10851353 PRK10851, PRK10851, sulfate/thiosulfate transporte 2e-07
PRK13641287 PRK13641, cbiO, cobalt transporter ATP-binding sub 2e-07
COG1124252 COG1124, DppF, ABC-type dipeptide/oligopeptide/nic 3e-07
PRK13636283 PRK13636, cbiO, cobalt transporter ATP-binding sub 3e-07
TIGR01842544 TIGR01842, type_I_sec_PrtD, type I secretion syste 3e-07
PRK14239252 PRK14239, PRK14239, phosphate transporter ATP-bind 3e-07
PRK14272252 PRK14272, PRK14272, phosphate ABC transporter ATP- 3e-07
COG0842286 COG0842, COG0842, ABC-type multidrug transport sys 3e-07
PRK14240250 PRK14240, PRK14240, phosphate transporter ATP-bind 3e-07
PRK14262250 PRK14262, PRK14262, phosphate ABC transporter ATP- 3e-07
PRK10762501 PRK10762, PRK10762, D-ribose transporter ATP bindi 3e-07
PRK09580248 PRK09580, sufC, cysteine desulfurase ATPase compon 3e-07
COG1117253 COG1117, PstB, ABC-type phosphate transport system 4e-07
TIGR03410230 TIGR03410, urea_trans_UrtE, urea ABC transporter, 4e-07
TIGR02770230 TIGR02770, nickel_nikD, nickel import ATP-binding 4e-07
TIGR02770230 TIGR02770, nickel_nikD, nickel import ATP-binding 4e-07
PRK13635279 PRK13635, cbiO, cobalt transporter ATP-binding sub 4e-07
TIGR01257 2272 TIGR01257, rim_protein, retinal-specific rim ABC t 5e-07
pfam00005119 pfam00005, ABC_tran, ABC transporter 5e-07
cd03298211 cd03298, ABC_ThiQ_thiamine_transporter, ATP-bindin 5e-07
PRK13643288 PRK13643, cbiO, cobalt transporter ATP-binding sub 5e-07
PRK14250241 PRK14250, PRK14250, phosphate ABC transporter ATP- 5e-07
TIGR00972247 TIGR00972, 3a0107s01c2, phosphate ABC transporter, 6e-07
PRK13651305 PRK13651, PRK13651, cobalt transporter ATP-binding 6e-07
PRK10419268 PRK10419, nikE, nickel transporter ATP-binding pro 6e-07
COG4619223 COG4619, COG4619, ABC-type uncharacterized transpo 7e-07
PRK14270251 PRK14270, PRK14270, phosphate ABC transporter ATP- 7e-07
cd03288257 cd03288, ABCC_SUR2, ATP-binding cassette domain 2 7e-07
PRK15134529 PRK15134, PRK15134, microcin C ABC transporter ATP 7e-07
TIGR01288303 TIGR01288, nodI, ATP-binding ABC transporter famil 8e-07
TIGR01184230 TIGR01184, ntrCD, nitrate transport ATP-binding su 8e-07
PRK10851353 PRK10851, PRK10851, sulfate/thiosulfate transporte 8e-07
COG4175386 COG4175, ProV, ABC-type proline/glycine betaine tr 8e-07
PRK09536402 PRK09536, btuD, corrinoid ABC transporter ATPase; 9e-07
PRK13536340 PRK13536, PRK13536, nodulation factor exporter sub 1e-06
COG3840231 COG3840, ThiQ, ABC-type thiamine transport system, 1e-06
cd03217200 cd03217, ABC_FeS_Assembly, ABC-type transport syst 1e-06
TIGR01277213 TIGR01277, thiQ, thiamine ABC transporter, ATP-bin 1e-06
COG4167267 COG4167, SapF, ABC-type antimicrobial peptide tran 1e-06
cd03216163 cd03216, ABC_Carb_Monos_I, First domain of the ATP 1e-06
cd03369207 cd03369, ABCC_NFT1, ATP-binding cassette domain 2 1e-06
PRK14271276 PRK14271, PRK14271, phosphate ABC transporter ATP- 1e-06
cd03247178 cd03247, ABCC_cytochrome_bd, ATP-binding cassette 1e-06
PRK11160574 PRK11160, PRK11160, cysteine/glutathione ABC trans 1e-06
TIGR02203571 TIGR02203, MsbA_lipidA, lipid A export permease/AT 2e-06
PRK09580248 PRK09580, sufC, cysteine desulfurase ATPase compon 2e-06
TIGR03005252 TIGR03005, ectoine_ehuA, ectoine/hydroxyectoine AB 2e-06
PRK13657588 PRK13657, PRK13657, cyclic beta-1,2-glucan ABC tra 2e-06
PRK13549506 PRK13549, PRK13549, xylose transporter ATP-binding 2e-06
PRK14273254 PRK14273, PRK14273, phosphate ABC transporter ATP- 2e-06
COG4161242 COG4161, ArtP, ABC-type arginine transport system, 2e-06
PRK13538204 PRK13538, PRK13538, cytochrome c biogenesis protei 2e-06
PRK11701258 PRK11701, phnK, phosphonate C-P lyase system prote 2e-06
COG4618580 COG4618, ArpD, ABC-type protease/lipase transport 3e-06
PRK09452375 PRK09452, potA, putrescine/spermidine ABC transpor 3e-06
TIGR03771223 TIGR03771, anch_rpt_ABC, anchored repeat-type ABC 3e-06
TIGR02204576 TIGR02204, MsbA_rel, ABC transporter, permease/ATP 3e-06
cd03216163 cd03216, ABC_Carb_Monos_I, First domain of the ATP 3e-06
PRK13538204 PRK13538, PRK13538, cytochrome c biogenesis protei 3e-06
COG1245591 COG1245, COG1245, Predicted ATPase, RNase L inhibi 3e-06
PRK14251251 PRK14251, PRK14251, phosphate ABC transporter ATP- 3e-06
PRK13644274 PRK13644, cbiO, cobalt transporter ATP-binding sub 3e-06
TIGR02633500 TIGR02633, xylG, D-xylose ABC transporter, ATP-bin 3e-06
cd03236255 cd03236, ABC_RNaseL_inhibitor_domain1, The ATP-bin 3e-06
PRK13638271 PRK13638, cbiO, cobalt transporter ATP-binding sub 4e-06
COG5265497 COG5265, ATM1, ABC-type transport system involved 4e-06
PRK14267253 PRK14267, PRK14267, phosphate ABC transporter ATP- 4e-06
COG4172534 COG4172, COG4172, ABC-type uncharacterized transpo 4e-06
PRK11300255 PRK11300, livG, leucine/isoleucine/valine transpor 4e-06
PRK14236272 PRK14236, PRK14236, phosphate transporter ATP-bind 4e-06
PRK14238271 PRK14238, PRK14238, phosphate transporter ATP-bind 4e-06
cd03294269 cd03294, ABC_Pro_Gly_Betaine, ATP-binding cassette 5e-06
PRK09493240 PRK09493, glnQ, glutamine ABC transporter ATP-bind 5e-06
CHL00131252 CHL00131, ycf16, sulfate ABC transporter protein; 5e-06
PRK11432351 PRK11432, fbpC, ferric transporter ATP-binding sub 5e-06
PRK14256252 PRK14256, PRK14256, phosphate ABC transporter ATP- 5e-06
TIGR02633500 TIGR02633, xylG, D-xylose ABC transporter, ATP-bin 6e-06
PRK13632271 PRK13632, cbiO, cobalt transporter ATP-binding sub 6e-06
PRK13635279 PRK13635, cbiO, cobalt transporter ATP-binding sub 7e-06
cd03294269 cd03294, ABC_Pro_Gly_Betaine, ATP-binding cassette 7e-06
pfam12698278 pfam12698, ABC2_membrane_3, ABC-2 family transport 7e-06
cd03231201 cd03231, ABC_CcmA_heme_exporter, Cytochrome c biog 8e-06
COG4175386 COG4175, ProV, ABC-type proline/glycine betaine tr 8e-06
COG4608268 COG4608, AppF, ABC-type oligopeptide transport sys 8e-06
cd03262213 cd03262, ABC_HisP_GlnQ, ATP-binding cassette domai 9e-06
COG4598256 COG4598, HisP, ABC-type histidine transport system 9e-06
PRK03695248 PRK03695, PRK03695, vitamin B12-transporter ATPase 9e-06
PRK13637287 PRK13637, cbiO, cobalt transporter ATP-binding sub 9e-06
COG4148352 COG4148, ModC, ABC-type molybdate transport system 1e-05
PRK03695248 PRK03695, PRK03695, vitamin B12-transporter ATPase 1e-05
PRK14259269 PRK14259, PRK14259, phosphate ABC transporter ATP- 1e-05
PRK14275286 PRK14275, PRK14275, phosphate ABC transporter ATP- 1e-05
PRK10619257 PRK10619, PRK10619, histidine/lysine/arginine/orni 1e-05
TIGR01193708 TIGR01193, bacteriocin_ABC, ABC-type bacteriocin t 2e-05
cd03217200 cd03217, ABC_FeS_Assembly, ABC-type transport syst 2e-05
PRK14255252 PRK14255, PRK14255, phosphate ABC transporter ATP- 2e-05
PRK14247250 PRK14247, PRK14247, phosphate ABC transporter ATP- 2e-05
TIGR01186363 TIGR01186, proV, glycine betaine/L-proline transpo 2e-05
PRK14270251 PRK14270, PRK14270, phosphate ABC transporter ATP- 2e-05
PRK11160574 PRK11160, PRK11160, cysteine/glutathione ABC trans 2e-05
PRK11432351 PRK11432, fbpC, ferric transporter ATP-binding sub 2e-05
PRK13543214 PRK13543, PRK13543, cytochrome c biogenesis protei 2e-05
PRK13543214 PRK13543, PRK13543, cytochrome c biogenesis protei 2e-05
TIGR02314343 TIGR02314, ABC_MetN, D-methionine ABC transporter, 2e-05
PRK11000369 PRK11000, PRK11000, maltose/maltodextrin transport 2e-05
PRK14242253 PRK14242, PRK14242, phosphate transporter ATP-bind 2e-05
TIGR00958711 TIGR00958, 3a01208, Conjugate Transporter-2 (CT2) 2e-05
PRK14237267 PRK14237, PRK14237, phosphate transporter ATP-bind 2e-05
cd03290218 cd03290, ABCC_SUR1_N, ATP-binding cassette domain 2e-05
TIGR03269520 TIGR03269, met_CoM_red_A2, methyl coenzyme M reduc 2e-05
TIGR02142354 TIGR02142, modC_ABC, molybdenum ABC transporter, A 3e-05
COG2884223 COG2884, FtsE, Predicted ATPase involved in cell d 3e-05
COG3845501 COG3845, COG3845, ABC-type uncharacterized transpo 3e-05
cd03247178 cd03247, ABCC_cytochrome_bd, ATP-binding cassette 3e-05
PRK09544251 PRK09544, znuC, high-affinity zinc transporter ATP 3e-05
COG1129500 COG1129, MglA, ABC-type sugar transport system, AT 4e-05
PRK10253265 PRK10253, PRK10253, iron-enterobactin transporter 4e-05
TIGR03269520 TIGR03269, met_CoM_red_A2, methyl coenzyme M reduc 4e-05
PRK13634290 PRK13634, cbiO, cobalt transporter ATP-binding sub 4e-05
PLN032321495 PLN03232, PLN03232, ABC transporter C family membe 4e-05
COG4178604 COG4178, COG4178, ABC-type uncharacterized transpo 4e-05
cd03246173 cd03246, ABCC_Protease_Secretion, ATP-binding cass 5e-05
cd03267236 cd03267, ABC_NatA_like, ATP-binding cassette domai 5e-05
PRK13651305 PRK13651, PRK13651, cobalt transporter ATP-binding 5e-05
COG1134249 COG1134, TagH, ABC-type polysaccharide/polyol phos 5e-05
TIGR01192585 TIGR01192, chvA, glucan exporter ATP-binding prote 5e-05
COG1129500 COG1129, MglA, ABC-type sugar transport system, AT 6e-05
TIGR03411242 TIGR03411, urea_trans_UrtD, urea ABC transporter, 6e-05
PRK14246257 PRK14246, PRK14246, phosphate ABC transporter ATP- 6e-05
PRK11174588 PRK11174, PRK11174, cysteine/glutathione ABC trans 7e-05
PRK10535648 PRK10535, PRK10535, macrolide transporter ATP-bind 7e-05
PRK11607377 PRK11607, potG, putrescine transporter ATP-binding 7e-05
PRK14249251 PRK14249, PRK14249, phosphate ABC transporter ATP- 7e-05
TIGR03608206 TIGR03608, L_ocin_972_ABC, putative bacteriocin ex 8e-05
CHL00131252 CHL00131, ycf16, sulfate ABC transporter protein; 8e-05
PRK13632271 PRK13632, cbiO, cobalt transporter ATP-binding sub 8e-05
PRK10771232 PRK10771, thiQ, thiamine transporter ATP-binding s 8e-05
cd03248226 cd03248, ABCC_TAP, ATP-binding cassette domain of 9e-05
TIGR03005252 TIGR03005, ectoine_ehuA, ectoine/hydroxyectoine AB 9e-05
PTZ00265 1466 PTZ00265, PTZ00265, multidrug resistance protein ( 9e-05
cd03227162 cd03227, ABC_Class2, ATP-binding cassette domain o 9e-05
PRK11614237 PRK11614, livF, leucine/isoleucine/valine transpor 9e-05
PRK10908222 PRK10908, PRK10908, cell division protein FtsE; Pr 9e-05
PRK11144352 PRK11144, modC, molybdate transporter ATP-binding 9e-05
TIGR012572272 TIGR01257, rim_protein, retinal-specific rim ABC t 1e-04
TIGR02211221 TIGR02211, LolD_lipo_ex, lipoprotein releasing sys 1e-04
COG4138248 COG4138, BtuD, ABC-type cobalamin transport system 1e-04
COG1101263 COG1101, PhnK, ABC-type uncharacterized transport 1e-04
PRK13647274 PRK13647, cbiO, cobalt transporter ATP-binding sub 1e-04
COG4608268 COG4608, AppF, ABC-type oligopeptide transport sys 1e-04
TIGR02314343 TIGR02314, ABC_MetN, D-methionine ABC transporter, 1e-04
cd03290218 cd03290, ABCC_SUR1_N, ATP-binding cassette domain 1e-04
PRK11607377 PRK11607, potG, putrescine transporter ATP-binding 1e-04
TIGR02324224 TIGR02324, CP_lyasePhnL, phosphonate C-P lyase sys 1e-04
smart00382148 smart00382, AAA, ATPases associated with a variety 1e-04
PRK14274259 PRK14274, PRK14274, phosphate ABC transporter ATP- 1e-04
PRK13648269 PRK13648, cbiO, cobalt transporter ATP-binding sub 1e-04
COG0488530 COG0488, Uup, ATPase components of ABC transporter 2e-04
TIGR03797686 TIGR03797, NHLM_micro_ABC2, NHLM bacteriocin syste 2e-04
PRK10575265 PRK10575, PRK10575, iron-hydroxamate transporter A 2e-04
PRK10247225 PRK10247, PRK10247, putative ABC transporter ATP-b 2e-04
PRK14256252 PRK14256, PRK14256, phosphate ABC transporter ATP- 2e-04
PRK13637287 PRK13637, cbiO, cobalt transporter ATP-binding sub 2e-04
PRK09544251 PRK09544, znuC, high-affinity zinc transporter ATP 2e-04
PLN032321495 PLN03232, PLN03232, ABC transporter C family membe 2e-04
PRK14246257 PRK14246, PRK14246, phosphate ABC transporter ATP- 2e-04
PRK10771232 PRK10771, thiQ, thiamine transporter ATP-binding s 2e-04
PTZ002651466 PTZ00265, PTZ00265, multidrug resistance protein ( 2e-04
PRK13649280 PRK13649, cbiO, cobalt transporter ATP-binding sub 2e-04
PRK14269246 PRK14269, PRK14269, phosphate ABC transporter ATP- 2e-04
PRK14243264 PRK14243, PRK14243, phosphate transporter ATP-bind 2e-04
PRK11308327 PRK11308, dppF, dipeptide transporter ATP-binding 2e-04
cd03221144 cd03221, ABCF_EF-3, ATP-binding cassette domain of 2e-04
PRK14266250 PRK14266, PRK14266, phosphate ABC transporter ATP- 2e-04
cd03220224 cd03220, ABC_KpsT_Wzt, ATP-binding cassette compon 2e-04
cd03220224 cd03220, ABC_KpsT_Wzt, ATP-binding cassette compon 2e-04
PRK15439510 PRK15439, PRK15439, autoinducer 2 ABC transporter 2e-04
PRK14264305 PRK14264, PRK14264, phosphate ABC transporter ATP- 2e-04
cd03229178 cd03229, ABC_Class3, ATP-binding cassette domain o 3e-04
cd03218232 cd03218, ABC_YhbG, ATP-binding cassette component 3e-04
PRK14240250 PRK14240, PRK14240, phosphate transporter ATP-bind 3e-04
PRK14259269 PRK14259, PRK14259, phosphate ABC transporter ATP- 3e-04
smart00382148 smart00382, AAA, ATPases associated with a variety 3e-04
COG4674249 COG4674, COG4674, Uncharacterized ABC-type transpo 4e-04
PRK09700510 PRK09700, PRK09700, D-allose transporter ATP-bindi 4e-04
cd03223166 cd03223, ABCD_peroxisomal_ALDP, ATP-binding casset 4e-04
PRK15112267 PRK15112, PRK15112, antimicrobial peptide ABC syst 4e-04
PRK13633280 PRK13633, PRK13633, cobalt transporter ATP-binding 4e-04
TIGR012572272 TIGR01257, rim_protein, retinal-specific rim ABC t 5e-04
TIGR03740223 TIGR03740, galliderm_ABC, gallidermin-class lantib 5e-04
TIGR01846694 TIGR01846, type_I_sec_HlyB, type I secretion syste 5e-04
PRK14251251 PRK14251, PRK14251, phosphate ABC transporter ATP- 5e-04
PRK14254285 PRK14254, PRK14254, phosphate ABC transporter ATP- 5e-04
PRK13645289 PRK13645, cbiO, cobalt transporter ATP-binding sub 5e-04
COG1137243 COG1137, YhbG, ABC-type (unclassified) transport s 6e-04
PRK14250241 PRK14250, PRK14250, phosphate ABC transporter ATP- 6e-04
PRK14274259 PRK14274, PRK14274, phosphate ABC transporter ATP- 7e-04
PRK11176582 PRK11176, PRK11176, lipid transporter ATP-binding/ 7e-04
PRK14252265 PRK14252, PRK14252, phosphate ABC transporter ATP- 7e-04
PRK11629233 PRK11629, lolD, lipoprotein transporter ATP-bindin 8e-04
PRK13642277 PRK13642, cbiO, cobalt transporter ATP-binding sub 8e-04
PRK10584228 PRK10584, PRK10584, putative ABC transporter ATP-b 9e-04
PRK14242253 PRK14242, PRK14242, phosphate transporter ATP-bind 9e-04
PRK11614237 PRK11614, livF, leucine/isoleucine/valine transpor 9e-04
cd03214180 cd03214, ABC_Iron-Siderophores_B12_Hemin, ATP-bind 0.001
PRK11264250 PRK11264, PRK11264, putative amino-acid ABC transp 0.001
TIGR03796710 TIGR03796, NHLM_micro_ABC1, NHLM bacteriocin syste 0.001
PRK13631320 PRK13631, cbiO, cobalt transporter ATP-binding sub 0.001
COG4107258 COG4107, PhnK, ABC-type phosphonate transport syst 0.001
PRK11288501 PRK11288, araG, L-arabinose transporter ATP-bindin 0.001
TIGR01192585 TIGR01192, chvA, glucan exporter ATP-binding prote 0.001
PRK10789569 PRK10789, PRK10789, putative multidrug transporter 0.001
cd03237246 cd03237, ABC_RNaseL_inhibitor_domain2, The ATP-bin 0.001
PRK11124242 PRK11124, artP, arginine transporter ATP-binding s 0.001
PRK13640282 PRK13640, cbiO, cobalt transporter ATP-binding sub 0.002
PRK14253249 PRK14253, PRK14253, phosphate ABC transporter ATP- 0.002
PRK14261253 PRK14261, PRK14261, phosphate ABC transporter ATP- 0.002
cd03238176 cd03238, ABC_UvrA, ATP-binding cassette domain of 0.002
COG0842286 COG0842, COG0842, ABC-type multidrug transport sys 0.002
PRK10419268 PRK10419, nikE, nickel transporter ATP-binding pro 0.002
COG4172534 COG4172, COG4172, ABC-type uncharacterized transpo 0.002
TIGR00958711 TIGR00958, 3a01208, Conjugate Transporter-2 (CT2) 0.002
TIGR03269520 TIGR03269, met_CoM_red_A2, methyl coenzyme M reduc 0.002
cd03237246 cd03237, ABC_RNaseL_inhibitor_domain2, The ATP-bin 0.002
PRK14257329 PRK14257, PRK14257, phosphate ABC transporter ATP- 0.002
PRK14258261 PRK14258, PRK14258, phosphate ABC transporter ATP- 0.002
PRK13650279 PRK13650, cbiO, cobalt transporter ATP-binding sub 0.002
cd03228171 cd03228, ABCC_MRP_Like, ATP-binding cassette domai 0.003
COG4107258 COG4107, PhnK, ABC-type phosphonate transport syst 0.003
cd03223166 cd03223, ABCD_peroxisomal_ALDP, ATP-binding casset 0.003
PRK14244251 PRK14244, PRK14244, phosphate ABC transporter ATP- 0.003
PTZ00243 1560 PTZ00243, PTZ00243, ABC transporter; Provisional 0.003
PRK14268258 PRK14268, PRK14268, phosphate ABC transporter ATP- 0.003
PRK14248268 PRK14248, PRK14248, phosphate ABC transporter ATP- 0.003
TIGR00957 1522 TIGR00957, MRP_assoc_pro, multi drug resistance-as 0.003
PRK10744260 PRK10744, pstB, phosphate transporter ATP-binding 0.003
TIGR03415382 TIGR03415, ABC_choXWV_ATP, choline ABC transporter 0.003
PRK11701258 PRK11701, phnK, phosphonate C-P lyase system prote 0.004
PRK13634290 PRK13634, cbiO, cobalt transporter ATP-binding sub 0.004
PRK10535648 PRK10535, PRK10535, macrolide transporter ATP-bind 0.004
PRK14266250 PRK14266, PRK14266, phosphate ABC transporter ATP- 0.004
PRK11650356 PRK11650, ugpC, glycerol-3-phosphate transporter A 0.004
pfam13481154 pfam13481, AAA_25, AAA domain 0.004
>gnl|CDD|215599 PLN03140, PLN03140, ABC transporter G family member; Provisional Back     alignment and domain information
 Score = 2114 bits (5478), Expect = 0.0
 Identities = 886/1462 (60%), Positives = 1104/1462 (75%), Gaps = 27/1462 (1%)

Query: 11   STSLRRSASRWNTNSIGAFS-------RSSREEDDEEALKWAALEKLPTYNRLRKGILTT 63
              S+ RS SR + N    FS       R+S  ++DEEALKWAA+EKLPTY+RLR  I+ +
Sbjct: 9    RRSISRSVSRSSRNMEDVFSGGSQSRRRTSSVDEDEEALKWAAIEKLPTYSRLRTSIMKS 68

Query: 64   --------SRGEANEVDVYNLGLQERQRLIDKLVKVTDVDNERFLLKLKNRIDRVGIDLP 115
                    ++    EVDV  L   +RQ+ ID + KV + DNE+FL K +NRIDRVGI LP
Sbjct: 69   FVENDVYGNQLLHKEVDVTKLDGNDRQKFIDMVFKVAEEDNEKFLKKFRNRIDRVGIKLP 128

Query: 116  KVEVRYEHLNVEAEAFLASNALPSFIKFYTNIFEDILNYLRIIPSKKRHLTILKDVSGVI 175
             VEVR+EHL VEA+ ++ S ALP+      NI E  L  L I  +KK  LTILKD SG+I
Sbjct: 129  TVEVRFEHLTVEADCYIGSRALPTLPNAARNIAESALGMLGINLAKKTKLTILKDASGII 188

Query: 176  KPGRLTLLLGPPSSGKTTLLLALAGKLDPTLKVSGTVTYNGHDMDEFVPQRTAAYISQHD 235
            KP R+TLLLGPPSSGKTTLLLALAGKLDP+LKVSG +TYNG+ ++EFVP++T+AYISQ+D
Sbjct: 189  KPSRMTLLLGPPSSGKTTLLLALAGKLDPSLKVSGEITYNGYRLNEFVPRKTSAYISQND 248

Query: 236  NHIGEMTVRETLAFSARCQGVGTRYEMLTELARREKAAGIKPDPDIDVYMKAIATEGQEA 295
             H+G MTV+ETL FSARCQGVGTRY++L+ELARREK AGI P+ ++D++MKA A EG ++
Sbjct: 249  VHVGVMTVKETLDFSARCQGVGTRYDLLSELARREKDAGIFPEAEVDLFMKATAMEGVKS 308

Query: 296  NVITDYYLKVLGLDVCADTMVGDEMIRGISGGQKKRVTTGEMMVGPALALFMDEISTGLD 355
            ++ITDY LK+LGLD+C DT+VGDEMIRGISGGQKKRVTTGEM+VGP   LFMDEISTGLD
Sbjct: 309  SLITDYTLKILGLDICKDTIVGDEMIRGISGGQKKRVTTGEMIVGPTKTLFMDEISTGLD 368

Query: 356  SSTTFQIVNCLRQNIHINSGTAVISLLQPAPETYDLFDDIILLSDGQIVYQGPRELVLEF 415
            SSTT+QIV CL+Q +H+   T ++SLLQPAPET+DLFDDIILLS+GQIVYQGPR+ +LEF
Sbjct: 369  SSTTYQIVKCLQQIVHLTEATVLMSLLQPAPETFDLFDDIILLSEGQIVYQGPRDHILEF 428

Query: 416  FASMGFRCPKRKGVADFLQEVTSRKDQRQYWAHKEKPYRFVTVQEFAEAFQSFHVGQKIS 475
            F S GF+CP+RKG ADFLQEVTS+KDQ QYWA + KPYR+++V EFAE F+SFHVG ++ 
Sbjct: 429  FESCGFKCPERKGTADFLQEVTSKKDQEQYWADRNKPYRYISVSEFAERFKSFHVGMQLE 488

Query: 476  DELRTPFDKSKSHRAALTTETYGVGKRELLKANISRELLLMKRNSFVYIFKLIQIAFVAV 535
            +EL  PFDKS+SH+AAL    Y V K ELLKA   +E LLMKRN+FVY+FK +QI  VA 
Sbjct: 489  NELSVPFDKSQSHKAALVFSKYSVPKMELLKACWDKEWLLMKRNAFVYVFKTVQIIIVAA 548

Query: 536  VYMTLFLRTKMHKDTVTDGGIFAGATFFAITMVNFNGFSEISMTIAKLPVFYKQRDFRFF 595
            +  T+FLRT+MH     DG ++ GA  F++ +  FNGF+E+++ I +LPVFYKQRD  F 
Sbjct: 549  IASTVFLRTEMHTRNEEDGALYIGALLFSMIINMFNGFAELALMIQRLPVFYKQRDLLFH 608

Query: 596  PPWAYAIPSWILKIPVSFLEVAVWVFLSYYVVGYDSNAGRFFKQYALLLGVNQMASALFR 655
            PPW + +P+++L IP+S +E  VWV ++YY +G+   A RFFKQ  L+  + QMA+ +FR
Sbjct: 609  PPWTFTLPTFLLGIPISIIESVVWVVITYYSIGFAPEASRFFKQLLLVFLIQQMAAGIFR 668

Query: 656  FIAVTGRNMVVANTFGSFALLVLLSLGGFILSREDIKKWWKWAYWCSPLTYAQNAIVANE 715
             IA   R M++ANT G+  LL++  LGGFIL + +I  WW+WAYW SPL+Y  NA+  NE
Sbjct: 669  LIASVCRTMIIANTGGALVLLLVFLLGGFILPKGEIPNWWEWAYWVSPLSYGFNALAVNE 728

Query: 716  FLGHSW-KKFTQDSSETLGVQVLKSRGFFAHEYWYWLGLGALFGFVLLLNFAYTLALTFL 774
                 W  K   D+S  LG  VL     F  + WYW+G+GAL GF +L N  +TLALT+L
Sbjct: 729  MFAPRWMNKMASDNSTRLGTAVLNIFDVFTDKNWYWIGVGALLGFTILFNVLFTLALTYL 788

Query: 775  DPFEKPRAVITEEIESNEQDDRIGGNVQLSTLGGSTDDIRGQQSSSQSLSL-------AE 827
            +P  K +A+I+EE     + +       LS+  G+       Q  S    L        E
Sbjct: 789  NPLGKKQAIISEETAEEMEGEEDSIPRSLSSADGNNTREVAIQRMSNPEGLSKNRDSSLE 848

Query: 828  AEASRPKKKGMVLPFEPHSLTFDEVVYSVDMPEEMKVQGVLEDKLVLLNGVSGAFRPGVL 887
            A      K+GMVLPF P +++FD+V Y VDMP EMK QGV ED+L LL  V+GAFRPGVL
Sbjct: 849  AANGVAPKRGMVLPFTPLAMSFDDVNYFVDMPAEMKEQGVTEDRLQLLREVTGAFRPGVL 908

Query: 888  TALMGVSGAGKTTLMDVLAGRKTGGYITGNITISGYPKKQETFARISGYCEQNDIHSPFV 947
            TALMGVSGAGKTTLMDVLAGRKTGGYI G+I ISG+PKKQETFARISGYCEQNDIHSP V
Sbjct: 909  TALMGVSGAGKTTLMDVLAGRKTGGYIEGDIRISGFPKKQETFARISGYCEQNDIHSPQV 968

Query: 948  TIYESLLFSAWLRLSPEVDSETRKMFIDEVMELVELNPLRQSLVGLPGVSGLSTEQRKRL 1007
            T+ ESL++SA+LRL  EV  E + MF+DEVMELVEL+ L+ ++VGLPGV+GLSTEQRKRL
Sbjct: 969  TVRESLIYSAFLRLPKEVSKEEKMMFVDEVMELVELDNLKDAIVGLPGVTGLSTEQRKRL 1028

Query: 1008 TIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFEAFD 1067
            TIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFEAFD
Sbjct: 1029 TIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFEAFD 1088

Query: 1068 ELFLMKRGGQEIYVGPLGRHSCHLISYFEAIPGVQKIKDGYNPATWMLEVSAASQELALG 1127
            EL LMKRGGQ IY GPLGR+S  +I YFEAIPGV KIK+ YNPATWMLEVS+ + E+ LG
Sbjct: 1089 ELLLMKRGGQVIYSGPLGRNSHKIIEYFEAIPGVPKIKEKYNPATWMLEVSSLAAEVKLG 1148

Query: 1128 IDFTEHYKRSDLYRRNKALIEDLSRPPPGSKDLYFPTQFSQSSWIQFVACLWKQHWSYWR 1187
            IDF EHYK S LY+RNKAL+++LS PPPG+ DLYF TQ+SQS+W QF +CLWKQ W+YWR
Sbjct: 1149 IDFAEHYKSSSLYQRNKALVKELSTPPPGASDLYFATQYSQSTWGQFKSCLWKQWWTYWR 1208

Query: 1188 NPPYTAVRFFFTAFIALLFGSLFWDLGGRTKRNQDLFNAMGSMFTAVLFLGVQYCSSVQP 1247
            +P Y  VRFFFT   AL+ G++FW +G +     DL   +G+M+ AVLF+G+  CS+VQP
Sbjct: 1209 SPDYNLVRFFFTLAAALMVGTIFWKVGTKRSNANDLTMVIGAMYAAVLFVGINNCSTVQP 1268

Query: 1248 IVSVERTVFYREKAAGMYAGIPWALAQVMIEIPYILVQSVVYGAIVYAMIGFEWTAAKFF 1307
            +V+VERTVFYRE+AAGMY+ +P+A+AQV+ EIPY+L+Q+  Y  IVYAM+ FEWTAAKFF
Sbjct: 1269 MVAVERTVFYRERAAGMYSALPYAIAQVVCEIPYVLIQTTYYTLIVYAMVAFEWTAAKFF 1328

Query: 1308 WYIFFMYFTLLFFTFYGMMAVALTPNHHIAAIVSTLFYGLWNVFSGFIIPRPRIPIWWRW 1367
            W+ F  +F+ L+FT+YGMM V+LTPN  +AAI +  FYGL+N+FSGF IPRP+IP WW W
Sbjct: 1329 WFYFISFFSFLYFTYYGMMTVSLTPNQQVAAIFAAAFYGLFNLFSGFFIPRPKIPKWWVW 1388

Query: 1368 YYWANPIAWTLYGLVASQFGDMDDK----KMDTGETVKQFLKDYFDFKHDFLGVVAAVLV 1423
            YYW  P+AWT+YGL+ SQ+GD++D           T+K +++D++ +  DF+G VAAVLV
Sbjct: 1389 YYWICPVAWTVYGLIVSQYGDVEDTIKVPGGAPDPTIKWYIQDHYGYDPDFMGPVAAVLV 1448

Query: 1424 VFAVLFGFLFALGIKMFNFQRR 1445
             F V F F+FA  I+  NFQ R
Sbjct: 1449 GFTVFFAFIFAFCIRTLNFQTR 1470


Length = 1470

>gnl|CDD|233208 TIGR00956, 3a01205, Pleiotropic Drug Resistance (PDR) Family protein Back     alignment and domain information
>gnl|CDD|213199 cd03232, ABCG_PDR_domain2, Second domain of the pleiotropic drug resistance-like (PDR) subfamily G of ATP-binding cassette transporters Back     alignment and domain information
>gnl|CDD|233207 TIGR00955, 3a01204, The Eye Pigment Precursor Transporter (EPP) Family protein Back     alignment and domain information
>gnl|CDD|233207 TIGR00955, 3a01204, The Eye Pigment Precursor Transporter (EPP) Family protein Back     alignment and domain information
>gnl|CDD|213180 cd03213, ABCG_EPDR, Eye pigment and drug resistance transporter subfamily G of the ATP-binding cassette superfamily Back     alignment and domain information
>gnl|CDD|213201 cd03234, ABCG_White, White pigment protein homolog of ABCG transporter subfamily Back     alignment and domain information
>gnl|CDD|216273 pfam01061, ABC2_membrane, ABC-2 type transporter Back     alignment and domain information
>gnl|CDD|215634 PLN03211, PLN03211, ABC transporter G-25; Provisional Back     alignment and domain information
>gnl|CDD|216273 pfam01061, ABC2_membrane, ABC-2 type transporter Back     alignment and domain information
>gnl|CDD|224054 COG1131, CcmA, ABC-type multidrug transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|213201 cd03234, ABCG_White, White pigment protein homolog of ABCG transporter subfamily Back     alignment and domain information
>gnl|CDD|213200 cd03233, ABCG_PDR_domain1, First domain of the pleiotropic drug resistance-like subfamily G of ATP-binding cassette transporters Back     alignment and domain information
>gnl|CDD|224054 COG1131, CcmA, ABC-type multidrug transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|213200 cd03233, ABCG_PDR_domain1, First domain of the pleiotropic drug resistance-like subfamily G of ATP-binding cassette transporters Back     alignment and domain information
>gnl|CDD|215634 PLN03211, PLN03211, ABC transporter G-25; Provisional Back     alignment and domain information
>gnl|CDD|213200 cd03233, ABCG_PDR_domain1, First domain of the pleiotropic drug resistance-like subfamily G of ATP-binding cassette transporters Back     alignment and domain information
>gnl|CDD|213230 cd03263, ABC_subfamily_A, ATP-binding cassette domain of the lipid transporters, subfamily A Back     alignment and domain information
>gnl|CDD|213180 cd03213, ABCG_EPDR, Eye pigment and drug resistance transporter subfamily G of the ATP-binding cassette superfamily Back     alignment and domain information
>gnl|CDD|213192 cd03225, ABC_cobalt_CbiO_domain1, First domain of the ATP-binding cassette component of cobalt transport system Back     alignment and domain information
>gnl|CDD|213231 cd03264, ABC_drug_resistance_like, ABC-type multidrug transport system, ATPase component Back     alignment and domain information
>gnl|CDD|219810 pfam08370, PDR_assoc, Plant PDR ABC transporter associated Back     alignment and domain information
>gnl|CDD|213202 cd03235, ABC_Metallic_Cations, ATP-binding cassette domain of the metal-type transporters Back     alignment and domain information
>gnl|CDD|224045 COG1120, FepC, ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|213230 cd03263, ABC_subfamily_A, ATP-binding cassette domain of the lipid transporters, subfamily A Back     alignment and domain information
>gnl|CDD|213222 cd03255, ABC_MJ0796_LolCDE_FtsE, ATP-binding cassette domain of the transporters involved in export of lipoprotein and macrolide, and cell division protein Back     alignment and domain information
>gnl|CDD|213181 cd03214, ABC_Iron-Siderophores_B12_Hemin, ATP-binding component of iron-siderophores, vitamin B12 and hemin transporters and related proteins Back     alignment and domain information
>gnl|CDD|224045 COG1120, FepC, ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|213192 cd03225, ABC_cobalt_CbiO_domain1, First domain of the ATP-binding cassette component of cobalt transport system Back     alignment and domain information
>gnl|CDD|213197 cd03230, ABC_DR_subfamily_A, ATP-binding cassette domain of the drug resistance transporter and related proteins, subfamily A Back     alignment and domain information
>gnl|CDD|213199 cd03232, ABCG_PDR_domain2, Second domain of the pleiotropic drug resistance-like (PDR) subfamily G of ATP-binding cassette transporters Back     alignment and domain information
>gnl|CDD|213226 cd03259, ABC_Carb_Solutes_like, ATP-binding cassette domain of the carbohydrate and solute transporters-like Back     alignment and domain information
>gnl|CDD|213196 cd03229, ABC_Class3, ATP-binding cassette domain of the binding protein-dependent transport systems Back     alignment and domain information
>gnl|CDD|224046 COG1121, ZnuC, ABC-type Mn/Zn transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|213180 cd03213, ABCG_EPDR, Eye pigment and drug resistance transporter subfamily G of the ATP-binding cassette superfamily Back     alignment and domain information
>gnl|CDD|213193 cd03226, ABC_cobalt_CbiO_domain2, Second domain of the ATP-binding cassette component of cobalt transport system Back     alignment and domain information
>gnl|CDD|224047 COG1122, CbiO, ABC-type cobalt transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|227321 COG4988, CydD, ABC-type transport system involved in cytochrome bd biosynthesis, ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|224059 COG1136, SalX, ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|130234 TIGR01166, cbiO, cobalt transport protein ATP-binding subunit Back     alignment and domain information
>gnl|CDD|213179 cd00267, ABC_ATPase, ATP-binding cassette transporter nucleotide-binding domain Back     alignment and domain information
>gnl|CDD|130256 TIGR01188, drrA, daunorubicin resistance ABC transporter ATP-binding subunit Back     alignment and domain information
>gnl|CDD|225183 COG2274, SunT, ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|213222 cd03255, ABC_MJ0796_LolCDE_FtsE, ATP-binding cassette domain of the transporters involved in export of lipoprotein and macrolide, and cell division protein Back     alignment and domain information
>gnl|CDD|224047 COG1122, CbiO, ABC-type cobalt transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|213232 cd03265, ABC_DrrA, Daunorubicin/doxorubicin resistance ATP-binding protein Back     alignment and domain information
>gnl|CDD|234033 TIGR02857, CydD, thiol reductant ABC exporter, CydD subunit Back     alignment and domain information
>gnl|CDD|224043 COG1118, CysA, ABC-type sulfate/molybdate transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|213186 cd03219, ABC_Mj1267_LivG_branched, ATP-binding cassette component of branched chain amino acids transport system Back     alignment and domain information
>gnl|CDD|213212 cd03245, ABCC_bacteriocin_exporters, ATP-binding cassette domain of bacteriocin exporters, subfamily C Back     alignment and domain information
>gnl|CDD|213228 cd03261, ABC_Org_Solvent_Resistant, ATP-binding cassette transport system involved in resistant to organic solvents Back     alignment and domain information
>gnl|CDD|213233 cd03266, ABC_NatA_sodium_exporter, ATP-binding cassette domain of the Na+ transporter Back     alignment and domain information
>gnl|CDD|213259 cd03292, ABC_FtsE_transporter, ATP-binding cassette domain of the cell division transporter Back     alignment and domain information
>gnl|CDD|234041 TIGR02868, CydC, thiol reductant ABC exporter, CydC subunit Back     alignment and domain information
>gnl|CDD|213195 cd03228, ABCC_MRP_Like, ATP-binding cassette domain of multidrug resistance protein-like transporters Back     alignment and domain information
>gnl|CDD|213260 cd03293, ABC_NrtD_SsuB_transporters, ATP-binding cassette domain of the nitrate and sulfonate transporters Back     alignment and domain information
>gnl|CDD|131368 TIGR02315, ABC_phnC, phosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|213228 cd03261, ABC_Org_Solvent_Resistant, ATP-binding cassette transport system involved in resistant to organic solvents Back     alignment and domain information
>gnl|CDD|188394 TIGR03864, PQQ_ABC_ATP, ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system Back     alignment and domain information
>gnl|CDD|213223 cd03256, ABC_PhnC_transporter, ATP-binding cassette domain of the binding protein-dependent phosphonate transport system Back     alignment and domain information
>gnl|CDD|226927 COG4555, NatA, ABC-type Na+ transport system, ATPase component [Energy production and conversion / Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|213235 cd03268, ABC_BcrA_bacitracin_resist, ATP-binding cassette domain of the bacitracin-resistance transporter Back     alignment and domain information
>gnl|CDD|213223 cd03256, ABC_PhnC_transporter, ATP-binding cassette domain of the binding protein-dependent phosphonate transport system Back     alignment and domain information
>gnl|CDD|226361 COG3842, PotA, ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|226164 COG3638, COG3638, ABC-type phosphate/phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|224059 COG1136, SalX, ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|226359 COG3839, MalK, ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|130041 TIGR00968, 3a0106s01, sulfate ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|188353 TIGR03608, L_ocin_972_ABC, putative bacteriocin export ABC transporter, lactococcin 972 group Back     alignment and domain information
>gnl|CDD|213224 cd03257, ABC_NikE_OppD_transporters, ATP-binding cassette domain of nickel/oligopeptides specific transporters Back     alignment and domain information
>gnl|CDD|237421 PRK13539, PRK13539, cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>gnl|CDD|213264 cd03297, ABC_ModC_molybdenum_transporter, ATP-binding cassette domain of the molybdenum transport system Back     alignment and domain information
>gnl|CDD|226927 COG4555, NatA, ABC-type Na+ transport system, ATPase component [Energy production and conversion / Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|226359 COG3839, MalK, ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|224043 COG1118, CysA, ABC-type sulfate/molybdate transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|213226 cd03259, ABC_Carb_Solutes_like, ATP-binding cassette domain of the carbohydrate and solute transporters-like Back     alignment and domain information
>gnl|CDD|163585 TIGR03873, F420-0_ABC_ATP, proposed F420-0 ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|237420 PRK13537, PRK13537, nodulation ABC transporter NodI; Provisional Back     alignment and domain information
>gnl|CDD|223488 COG0411, LivG, ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|237419 PRK13536, PRK13536, nodulation factor exporter subunit NodI; Provisional Back     alignment and domain information
>gnl|CDD|224046 COG1121, ZnuC, ABC-type Mn/Zn transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|233665 TIGR01978, sufC, FeS assembly ATPase SufC Back     alignment and domain information
>gnl|CDD|226929 COG4559, COG4559, ABC-type hemin transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|226617 COG4133, CcmA, ABC-type transport system involved in cytochrome c biogenesis, ATPase component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|226164 COG3638, COG3638, ABC-type phosphate/phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|213191 cd03224, ABC_TM1139_LivF_branched, ATP-binding cassette domain of branched-chain amino acid transporter Back     alignment and domain information
>gnl|CDD|213186 cd03219, ABC_Mj1267_LivG_branched, ATP-binding cassette component of branched chain amino acids transport system Back     alignment and domain information
>gnl|CDD|226361 COG3842, PotA, ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|213224 cd03257, ABC_NikE_OppD_transporters, ATP-binding cassette domain of nickel/oligopeptides specific transporters Back     alignment and domain information
>gnl|CDD|213227 cd03260, ABC_PstB_phosphate_transporter, ATP-binding cassette domain of the phosphate transport system Back     alignment and domain information
>gnl|CDD|213236 cd03269, ABC_putative_ATPase, ATP-binding cassette domain of an uncharacterized transporter Back     alignment and domain information
>gnl|CDD|213185 cd03218, ABC_YhbG, ATP-binding cassette component of YhbG transport system Back     alignment and domain information
>gnl|CDD|213213 cd03246, ABCC_Protease_Secretion, ATP-binding cassette domain of PrtD, subfamily C Back     alignment and domain information
>gnl|CDD|213263 cd03296, ABC_CysA_sulfate_importer, ATP-binding cassette domain of the sulfate transporter Back     alignment and domain information
>gnl|CDD|224041 COG1116, TauB, ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|227321 COG4988, CydD, ABC-type transport system involved in cytochrome bd biosynthesis, ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|224048 COG1123, COG1123, ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] Back     alignment and domain information
>gnl|CDD|237422 PRK13548, hmuV, hemin importer ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|213202 cd03235, ABC_Metallic_Cations, ATP-binding cassette domain of the metal-type transporters Back     alignment and domain information
>gnl|CDD|213212 cd03245, ABCC_bacteriocin_exporters, ATP-binding cassette domain of bacteriocin exporters, subfamily C Back     alignment and domain information
>gnl|CDD|223488 COG0411, LivG, ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|226929 COG4559, COG4559, ABC-type hemin transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|213263 cd03296, ABC_CysA_sulfate_importer, ATP-binding cassette domain of the sulfate transporter Back     alignment and domain information
>gnl|CDD|234189 TIGR03375, type_I_sec_LssB, type I secretion system ATPase, LssB family Back     alignment and domain information
>gnl|CDD|227019 COG4674, COG4674, Uncharacterized ABC-type transport system, ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|223473 COG0396, sufC, Cysteine desulfurase activator ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|213221 cd03254, ABCC_Glucan_exporter_like, ATP-binding cassette domain of glucan transporter and related proteins, subfamily C Back     alignment and domain information
>gnl|CDD|226631 COG4152, COG4152, ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|213231 cd03264, ABC_drug_resistance_like, ABC-type multidrug transport system, ATPase component Back     alignment and domain information
>gnl|CDD|237421 PRK13539, PRK13539, cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>gnl|CDD|163585 TIGR03873, F420-0_ABC_ATP, proposed F420-0 ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|223473 COG0396, sufC, Cysteine desulfurase activator ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|224052 COG1127, Ttg2A, ABC-type transport system involved in resistance to organic solvents, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>gnl|CDD|182817 PRK10895, PRK10895, lipopolysaccharide ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|226963 COG4604, CeuD, ABC-type enterochelin transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|130355 TIGR01288, nodI, ATP-binding ABC transporter family nodulation protein NodI Back     alignment and domain information
>gnl|CDD|224049 COG1124, DppF, ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|131368 TIGR02315, ABC_phnC, phosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|233305 TIGR01189, ccmA, heme ABC exporter, ATP-binding protein CcmA Back     alignment and domain information
>gnl|CDD|224053 COG1129, MglA, ABC-type sugar transport system, ATPase component [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|213199 cd03232, ABCG_PDR_domain2, Second domain of the pleiotropic drug resistance-like (PDR) subfamily G of ATP-binding cassette transporters Back     alignment and domain information
>gnl|CDD|234033 TIGR02857, CydD, thiol reductant ABC exporter, CydD subunit Back     alignment and domain information
>gnl|CDD|213191 cd03224, ABC_TM1139_LivF_branched, ATP-binding cassette domain of branched-chain amino acid transporter Back     alignment and domain information
>gnl|CDD|213197 cd03230, ABC_DR_subfamily_A, ATP-binding cassette domain of the drug resistance transporter and related proteins, subfamily A Back     alignment and domain information
>gnl|CDD|184196 PRK13636, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|237422 PRK13548, hmuV, hemin importer ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|213233 cd03266, ABC_NatA_sodium_exporter, ATP-binding cassette domain of the Na+ transporter Back     alignment and domain information
>gnl|CDD|213260 cd03293, ABC_NrtD_SsuB_transporters, ATP-binding cassette domain of the nitrate and sulfonate transporters Back     alignment and domain information
>gnl|CDD|224052 COG1127, Ttg2A, ABC-type transport system involved in resistance to organic solvents, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>gnl|CDD|213219 cd03252, ABCC_Hemolysin, ATP-binding cassette domain of hemolysin B, subfamily C Back     alignment and domain information
>gnl|CDD|213195 cd03228, ABCC_MRP_Like, ATP-binding cassette domain of multidrug resistance protein-like transporters Back     alignment and domain information
>gnl|CDD|130041 TIGR00968, 3a0106s01, sulfate ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|213216 cd03249, ABC_MTABC3_MDL1_MDL2, ATP-binding cassette domain of a mitochondrial protein MTABC3 and related proteins Back     alignment and domain information
>gnl|CDD|234200 TIGR03411, urea_trans_UrtD, urea ABC transporter, ATP-binding protein UrtD Back     alignment and domain information
>gnl|CDD|225183 COG2274, SunT, ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|213264 cd03297, ABC_ModC_molybdenum_transporter, ATP-binding cassette domain of the molybdenum transport system Back     alignment and domain information
>gnl|CDD|213220 cd03253, ABCC_ATM1_transporter, ATP-binding cassette domain of iron-sulfur clusters transporter, subfamily C Back     alignment and domain information
>gnl|CDD|213217 cd03250, ABCC_MRP_domain1, ATP-binding cassette domain 1 of multidrug resistance-associated protein, subfamily C Back     alignment and domain information
>gnl|CDD|132027 TIGR02982, heterocyst_DevA, ABC exporter ATP-binding subunit, DevA family Back     alignment and domain information
>gnl|CDD|130324 TIGR01257, rim_protein, retinal-specific rim ABC transporter Back     alignment and domain information
>gnl|CDD|223487 COG0410, LivF, ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|226905 COG4525, TauB, ABC-type taurine transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|183044 PRK11231, fecE, iron-dicitrate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|224060 COG1137, YhbG, ABC-type (unclassified) transport system, ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|200134 TIGR01842, type_I_sec_PrtD, type I secretion system ABC transporter, PrtD family Back     alignment and domain information
>gnl|CDD|213268 cd03301, ABC_MalK_N, The N-terminal ATPase domain of the maltose transporter, MalK Back     alignment and domain information
>gnl|CDD|163452 TIGR03740, galliderm_ABC, gallidermin-class lantibiotic protection ABC transporter, ATP-binding subunit Back     alignment and domain information
>gnl|CDD|234041 TIGR02868, CydC, thiol reductant ABC exporter, CydC subunit Back     alignment and domain information
>gnl|CDD|224055 COG1132, MdlB, ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|184585 PRK14239, PRK14239, phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|183044 PRK11231, fecE, iron-dicitrate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|184198 PRK13638, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|185016 PRK15056, PRK15056, manganese/iron transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|213234 cd03267, ABC_NatA_like, ATP-binding cassette domain of an uncharacterized transporter similar in sequence to NatA Back     alignment and domain information
>gnl|CDD|213216 cd03249, ABC_MTABC3_MDL1_MDL2, ATP-binding cassette domain of a mitochondrial protein MTABC3 and related proteins Back     alignment and domain information
>gnl|CDD|213220 cd03253, ABCC_ATM1_transporter, ATP-binding cassette domain of iron-sulfur clusters transporter, subfamily C Back     alignment and domain information
>gnl|CDD|213266 cd03299, ABC_ModC_like, ATP-binding cassette domain similar to the molybdate transporter Back     alignment and domain information
>gnl|CDD|213193 cd03226, ABC_cobalt_CbiO_domain2, Second domain of the ATP-binding cassette component of cobalt transport system Back     alignment and domain information
>gnl|CDD|132027 TIGR02982, heterocyst_DevA, ABC exporter ATP-binding subunit, DevA family Back     alignment and domain information
>gnl|CDD|213267 cd03300, ABC_PotA_N, ATP-binding cassette domain of the polyamine transporter Back     alignment and domain information
>gnl|CDD|182569 PRK10584, PRK10584, putative ABC transporter ATP-binding protein YbbA; Provisional Back     alignment and domain information
>gnl|CDD|132302 TIGR03258, PhnT, 2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT Back     alignment and domain information
>gnl|CDD|213179 cd00267, ABC_ATPase, ATP-binding cassette transporter nucleotide-binding domain Back     alignment and domain information
>gnl|CDD|188394 TIGR03864, PQQ_ABC_ATP, ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system Back     alignment and domain information
>gnl|CDD|213227 cd03260, ABC_PstB_phosphate_transporter, ATP-binding cassette domain of the phosphate transport system Back     alignment and domain information
>gnl|CDD|213236 cd03269, ABC_putative_ATPase, ATP-binding cassette domain of an uncharacterized transporter Back     alignment and domain information
>gnl|CDD|224048 COG1123, COG1123, ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] Back     alignment and domain information
>gnl|CDD|226963 COG4604, CeuD, ABC-type enterochelin transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|213267 cd03300, ABC_PotA_N, ATP-binding cassette domain of the polyamine transporter Back     alignment and domain information
>gnl|CDD|226952 COG4586, COG4586, ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|224050 COG1125, OpuBA, ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|224058 COG1135, AbcC, ABC-type metal ion transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|213262 cd03295, ABC_OpuCA_Osmoprotection, ATP-binding cassette domain of the osmoprotectant transporter Back     alignment and domain information
>gnl|CDD|213232 cd03265, ABC_DrrA, Daunorubicin/doxorubicin resistance ATP-binding protein Back     alignment and domain information
>gnl|CDD|184132 PRK13547, hmuV, hemin importer ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|226969 COG4618, ArpD, ABC-type protease/lipase transport system, ATPase and permease components [General function prediction only] Back     alignment and domain information
>gnl|CDD|213218 cd03251, ABCC_MsbA, ATP-binding cassette domain of the bacterial lipid flippase and related proteins, subfamily C Back     alignment and domain information
>gnl|CDD|215650 pfam00005, ABC_tran, ABC transporter Back     alignment and domain information
>gnl|CDD|182182 PRK09984, PRK09984, phosphonate/organophosphate ester transporter subunit; Provisional Back     alignment and domain information
>gnl|CDD|132561 TIGR03522, GldA_ABC_ATP, gliding motility-associated ABC transporter ATP-binding subunit GldA Back     alignment and domain information
>gnl|CDD|131721 TIGR02673, FtsE, cell division ATP-binding protein FtsE Back     alignment and domain information
>gnl|CDD|224048 COG1123, COG1123, ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] Back     alignment and domain information
>gnl|CDD|224042 COG1117, PstB, ABC-type phosphate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|213266 cd03299, ABC_ModC_like, ATP-binding cassette domain similar to the molybdate transporter Back     alignment and domain information
>gnl|CDD|131266 TIGR02211, LolD_lipo_ex, lipoprotein releasing system, ATP-binding protein Back     alignment and domain information
>gnl|CDD|213259 cd03292, ABC_FtsE_transporter, ATP-binding cassette domain of the cell division transporter Back     alignment and domain information
>gnl|CDD|224058 COG1135, AbcC, ABC-type metal ion transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|131197 TIGR02142, modC_ABC, molybdenum ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|183063 PRK11264, PRK11264, putative amino-acid ABC transporter ATP-binding protein YecC; Provisional Back     alignment and domain information
>gnl|CDD|225438 COG2884, FtsE, Predicted ATPase involved in cell division [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|234152 TIGR03265, PhnT2, putative 2-aminoethylphosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|226647 COG4181, COG4181, Predicted ABC-type transport system involved in lysophospholipase L1 biosynthesis, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>gnl|CDD|226620 COG4136, COG4136, ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|182036 PRK09700, PRK09700, D-allose transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|223562 COG0488, Uup, ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] Back     alignment and domain information
>gnl|CDD|172200 PRK13652, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|184199 PRK13639, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|213268 cd03301, ABC_MalK_N, The N-terminal ATPase domain of the maltose transporter, MalK Back     alignment and domain information
>gnl|CDD|132302 TIGR03258, PhnT, 2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT Back     alignment and domain information
>gnl|CDD|226647 COG4181, COG4181, Predicted ABC-type transport system involved in lysophospholipase L1 biosynthesis, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>gnl|CDD|183056 PRK11248, tauB, taurine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|223521 COG0444, DppD, ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|213225 cd03258, ABC_MetN_methionine_transporter, ATP-binding cassette domain of methionine transporter Back     alignment and domain information
>gnl|CDD|227320 COG4987, CydC, ABC-type transport system involved in cytochrome bd biosynthesis, fused ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|226622 COG4138, BtuD, ABC-type cobalamin transport system, ATPase component [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|163508 TIGR03796, NHLM_micro_ABC1, NHLM bacteriocin system ABC transporter, peptidase/ATP-binding protein Back     alignment and domain information
>gnl|CDD|184200 PRK13640, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|223487 COG0410, LivF, ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|234357 TIGR03797, NHLM_micro_ABC2, NHLM bacteriocin system ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|226364 COG3845, COG3845, ABC-type uncharacterized transport systems, ATPase components [General function prediction only] Back     alignment and domain information
>gnl|CDD|237451 PRK13631, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|162242 TIGR01187, potA, spermidine/putrescine ABC transporter ATP-binding subunit Back     alignment and domain information
>gnl|CDD|224048 COG1123, COG1123, ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] Back     alignment and domain information
>gnl|CDD|213217 cd03250, ABCC_MRP_domain1, ATP-binding cassette domain 1 of multidrug resistance-associated protein, subfamily C Back     alignment and domain information
>gnl|CDD|131258 TIGR02203, MsbA_lipidA, lipid A export permease/ATP-binding protein MsbA Back     alignment and domain information
>gnl|CDD|226592 COG4107, PhnK, ABC-type phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|234199 TIGR03410, urea_trans_UrtE, urea ABC transporter, ATP-binding protein UrtE Back     alignment and domain information
>gnl|CDD|236523 PRK09452, potA, putrescine/spermidine ABC transporter ATPase protein; Reviewed Back     alignment and domain information
>gnl|CDD|172760 PRK14272, PRK14272, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|213181 cd03214, ABC_Iron-Siderophores_B12_Hemin, ATP-binding component of iron-siderophores, vitamin B12 and hemin transporters and related proteins Back     alignment and domain information
>gnl|CDD|213198 cd03231, ABC_CcmA_heme_exporter, Cytochrome c biogenesis ATP-binding export protein Back     alignment and domain information
>gnl|CDD|224044 COG1119, ModF, ABC-type molybdenum transport system, ATPase component/photorepair protein PhrA [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|233596 TIGR01846, type_I_sec_HlyB, type I secretion system ABC transporter, HlyB family Back     alignment and domain information
>gnl|CDD|130234 TIGR01166, cbiO, cobalt transport protein ATP-binding subunit Back     alignment and domain information
>gnl|CDD|183077 PRK11288, araG, L-arabinose transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|182561 PRK10575, PRK10575, iron-hydroxamate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|224026 COG1101, PhnK, ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|236554 PRK09536, btuD, corrinoid ABC transporter ATPase; Reviewed Back     alignment and domain information
>gnl|CDD|130256 TIGR01188, drrA, daunorubicin resistance ABC transporter ATP-binding subunit Back     alignment and domain information
>gnl|CDD|226905 COG4525, TauB, ABC-type taurine transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|226952 COG4586, COG4586, ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|224050 COG1125, OpuBA, ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|213218 cd03251, ABCC_MsbA, ATP-binding cassette domain of the bacterial lipid flippase and related proteins, subfamily C Back     alignment and domain information
>gnl|CDD|223521 COG0444, DppD, ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|226360 COG3840, ThiQ, ABC-type thiamine transport system, ATPase component [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|130261 TIGR01193, bacteriocin_ABC, ABC-type bacteriocin transporter Back     alignment and domain information
>gnl|CDD|226628 COG4148, ModC, ABC-type molybdate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|188099 TIGR00972, 3a0107s01c2, phosphate ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|213184 cd03217, ABC_FeS_Assembly, ABC-type transport system involved in Fe-S cluster assembly, ATPase component Back     alignment and domain information
>gnl|CDD|224055 COG1132, MdlB, ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|224044 COG1119, ModF, ABC-type molybdenum transport system, ATPase component/photorepair protein PhrA [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|188208 TIGR02323, CP_lyasePhnK, phosphonate C-P lyase system protein PhnK Back     alignment and domain information
>gnl|CDD|213265 cd03298, ABC_ThiQ_thiamine_transporter, ATP-binding cassette domain of the thiamine transport system Back     alignment and domain information
>gnl|CDD|213221 cd03254, ABCC_Glucan_exporter_like, ATP-binding cassette domain of glucan transporter and related proteins, subfamily C Back     alignment and domain information
>gnl|CDD|132561 TIGR03522, GldA_ABC_ATP, gliding motility-associated ABC transporter ATP-binding subunit GldA Back     alignment and domain information
>gnl|CDD|184203 PRK13643, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|236870 PRK11174, PRK11174, cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed Back     alignment and domain information
>gnl|CDD|172743 PRK14255, PRK14255, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|162242 TIGR01187, potA, spermidine/putrescine ABC transporter ATP-binding subunit Back     alignment and domain information
>gnl|CDD|226617 COG4133, CcmA, ABC-type transport system involved in cytochrome c biogenesis, ATPase component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|234189 TIGR03375, type_I_sec_LssB, type I secretion system ATPase, LssB family Back     alignment and domain information
>gnl|CDD|223562 COG0488, Uup, ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] Back     alignment and domain information
>gnl|CDD|233665 TIGR01978, sufC, FeS assembly ATPase SufC Back     alignment and domain information
>gnl|CDD|233305 TIGR01189, ccmA, heme ABC exporter, ATP-binding protein CcmA Back     alignment and domain information
>gnl|CDD|227320 COG4987, CydC, ABC-type transport system involved in cytochrome bd biosynthesis, fused ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|227590 COG5265, ATM1, ABC-type transport system involved in Fe-S cluster assembly, permease and ATPase components [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|130344 TIGR01277, thiQ, thiamine ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|224041 COG1116, TauB, ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|184132 PRK13547, hmuV, hemin importer ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|234152 TIGR03265, PhnT2, putative 2-aminoethylphosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|213225 cd03258, ABC_MetN_methionine_transporter, ATP-binding cassette domain of methionine transporter Back     alignment and domain information
>gnl|CDD|213215 cd03248, ABCC_TAP, ATP-binding cassette domain of the Transporter Associated with Antigen Processing, subfamily C Back     alignment and domain information
>gnl|CDD|237457 PRK13647, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|224051 COG1126, GlnQ, ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|213229 cd03262, ABC_HisP_GlnQ, ATP-binding cassette domain of the histidine and glutamine transporters Back     alignment and domain information
>gnl|CDD|226631 COG4152, COG4152, ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|213219 cd03252, ABCC_Hemolysin, ATP-binding cassette domain of hemolysin B, subfamily C Back     alignment and domain information
>gnl|CDD|224051 COG1126, GlnQ, ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|172735 PRK14247, PRK14247, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|213211 cd03244, ABCC_MRP_domain2, ATP-binding cassette domain 2 of multidrug resistance-associated protein Back     alignment and domain information
>gnl|CDD|213235 cd03268, ABC_BcrA_bacitracin_resist, ATP-binding cassette domain of the bacitracin-resistance transporter Back     alignment and domain information
>gnl|CDD|237420 PRK13537, PRK13537, nodulation ABC transporter NodI; Provisional Back     alignment and domain information
>gnl|CDD|131721 TIGR02673, FtsE, cell division ATP-binding protein FtsE Back     alignment and domain information
>gnl|CDD|172741 PRK14253, PRK14253, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|184205 PRK13646, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|130254 TIGR01186, proV, glycine betaine/L-proline transport ATP binding subunit Back     alignment and domain information
>gnl|CDD|184587 PRK14241, PRK14241, phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|226970 COG4619, COG4619, ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|213196 cd03229, ABC_Class3, ATP-binding cassette domain of the binding protein-dependent transport systems Back     alignment and domain information
>gnl|CDD|183056 PRK11248, tauB, taurine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|184127 PRK13540, PRK13540, cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>gnl|CDD|182336 PRK10253, PRK10253, iron-enterobactin transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|184199 PRK13639, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|213262 cd03295, ABC_OpuCA_Osmoprotection, ATP-binding cassette domain of the osmoprotectant transporter Back     alignment and domain information
>gnl|CDD|182036 PRK09700, PRK09700, D-allose transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|163483 TIGR03771, anch_rpt_ABC, anchored repeat-type ABC transporter, ATP-binding subunit Back     alignment and domain information
>gnl|CDD|182331 PRK10247, PRK10247, putative ABC transporter ATP-binding protein YbbL; Provisional Back     alignment and domain information
>gnl|CDD|172749 PRK14261, PRK14261, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|237645 PRK14235, PRK14235, phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|131816 TIGR02769, nickel_nikE, nickel import ATP-binding protein NikE Back     alignment and domain information
>gnl|CDD|131816 TIGR02769, nickel_nikE, nickel import ATP-binding protein NikE Back     alignment and domain information
>gnl|CDD|172733 PRK14245, PRK14245, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|183244 PRK11629, lolD, lipoprotein transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|182880 PRK10982, PRK10982, galactose/methyl galaxtoside transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|131259 TIGR02204, MsbA_rel, ABC transporter, permease/ATP-binding protein Back     alignment and domain information
>gnl|CDD|213179 cd00267, ABC_ATPase, ATP-binding cassette transporter nucleotide-binding domain Back     alignment and domain information
>gnl|CDD|213179 cd00267, ABC_ATPase, ATP-binding cassette transporter nucleotide-binding domain Back     alignment and domain information
>gnl|CDD|226620 COG4136, COG4136, ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|223562 COG0488, Uup, ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] Back     alignment and domain information
>gnl|CDD|188208 TIGR02323, CP_lyasePhnK, phosphonate C-P lyase system protein PhnK Back     alignment and domain information
>gnl|CDD|130252 TIGR01184, ntrCD, nitrate transport ATP-binding subunits C and D Back     alignment and domain information
>gnl|CDD|213205 cd03238, ABC_UvrA, ATP-binding cassette domain of the excision repair protein UvrA Back     alignment and domain information
>gnl|CDD|182778 PRK10851, PRK10851, sulfate/thiosulfate transporter subunit; Provisional Back     alignment and domain information
>gnl|CDD|237456 PRK13641, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|224049 COG1124, DppF, ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|184196 PRK13636, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|200134 TIGR01842, type_I_sec_PrtD, type I secretion system ABC transporter, PrtD family Back     alignment and domain information
>gnl|CDD|184585 PRK14239, PRK14239, phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|172760 PRK14272, PRK14272, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|223912 COG0842, COG0842, ABC-type multidrug transport system, permease component [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|184586 PRK14240, PRK14240, phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|172750 PRK14262, PRK14262, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|236755 PRK10762, PRK10762, D-ribose transporter ATP binding protein; Provisional Back     alignment and domain information
>gnl|CDD|181965 PRK09580, sufC, cysteine desulfurase ATPase component; Reviewed Back     alignment and domain information
>gnl|CDD|224042 COG1117, PstB, ABC-type phosphate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|234199 TIGR03410, urea_trans_UrtE, urea ABC transporter, ATP-binding protein UrtE Back     alignment and domain information
>gnl|CDD|131817 TIGR02770, nickel_nikD, nickel import ATP-binding protein NikD Back     alignment and domain information
>gnl|CDD|131817 TIGR02770, nickel_nikD, nickel import ATP-binding protein NikD Back     alignment and domain information
>gnl|CDD|184195 PRK13635, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|130324 TIGR01257, rim_protein, retinal-specific rim ABC transporter Back     alignment and domain information
>gnl|CDD|215650 pfam00005, ABC_tran, ABC transporter Back     alignment and domain information
>gnl|CDD|213265 cd03298, ABC_ThiQ_thiamine_transporter, ATP-binding cassette domain of the thiamine transport system Back     alignment and domain information
>gnl|CDD|184203 PRK13643, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|237648 PRK14250, PRK14250, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|188099 TIGR00972, 3a0107s01c2, phosphate ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|184210 PRK13651, PRK13651, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|236689 PRK10419, nikE, nickel transporter ATP-binding protein NikE; Provisional Back     alignment and domain information
>gnl|CDD|226970 COG4619, COG4619, ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|184597 PRK14270, PRK14270, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|213255 cd03288, ABCC_SUR2, ATP-binding cassette domain 2 of the sulfonylurea receptor SUR Back     alignment and domain information
>gnl|CDD|237917 PRK15134, PRK15134, microcin C ABC transporter ATP-binding protein YejF; Provisional Back     alignment and domain information
>gnl|CDD|130355 TIGR01288, nodI, ATP-binding ABC transporter family nodulation protein NodI Back     alignment and domain information
>gnl|CDD|130252 TIGR01184, ntrCD, nitrate transport ATP-binding subunits C and D Back     alignment and domain information
>gnl|CDD|182778 PRK10851, PRK10851, sulfate/thiosulfate transporter subunit; Provisional Back     alignment and domain information
>gnl|CDD|226643 COG4175, ProV, ABC-type proline/glycine betaine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|236554 PRK09536, btuD, corrinoid ABC transporter ATPase; Reviewed Back     alignment and domain information
>gnl|CDD|237419 PRK13536, PRK13536, nodulation factor exporter subunit NodI; Provisional Back     alignment and domain information
>gnl|CDD|226360 COG3840, ThiQ, ABC-type thiamine transport system, ATPase component [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|213184 cd03217, ABC_FeS_Assembly, ABC-type transport system involved in Fe-S cluster assembly, ATPase component Back     alignment and domain information
>gnl|CDD|130344 TIGR01277, thiQ, thiamine ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|226637 COG4167, SapF, ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|213183 cd03216, ABC_Carb_Monos_I, First domain of the ATP-binding cassette component of monosaccharide transport system Back     alignment and domain information
>gnl|CDD|213269 cd03369, ABCC_NFT1, ATP-binding cassette domain 2 of NFT1, subfamily C Back     alignment and domain information
>gnl|CDD|172759 PRK14271, PRK14271, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|213214 cd03247, ABCC_cytochrome_bd, ATP-binding cassette domain of CydCD, subfamily C Back     alignment and domain information
>gnl|CDD|236865 PRK11160, PRK11160, cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed Back     alignment and domain information
>gnl|CDD|131258 TIGR02203, MsbA_lipidA, lipid A export permease/ATP-binding protein MsbA Back     alignment and domain information
>gnl|CDD|181965 PRK09580, sufC, cysteine desulfurase ATPase component; Reviewed Back     alignment and domain information
>gnl|CDD|132050 TIGR03005, ectoine_ehuA, ectoine/hydroxyectoine ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|184214 PRK13657, PRK13657, cyclic beta-1,2-glucan ABC transporter; Provisional Back     alignment and domain information
>gnl|CDD|184134 PRK13549, PRK13549, xylose transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|172761 PRK14273, PRK14273, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|226635 COG4161, ArtP, ABC-type arginine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|184125 PRK13538, PRK13538, cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>gnl|CDD|183280 PRK11701, phnK, phosphonate C-P lyase system protein PhnK; Provisional Back     alignment and domain information
>gnl|CDD|226969 COG4618, ArpD, ABC-type protease/lipase transport system, ATPase and permease components [General function prediction only] Back     alignment and domain information
>gnl|CDD|236523 PRK09452, potA, putrescine/spermidine ABC transporter ATPase protein; Reviewed Back     alignment and domain information
>gnl|CDD|163483 TIGR03771, anch_rpt_ABC, anchored repeat-type ABC transporter, ATP-binding subunit Back     alignment and domain information
>gnl|CDD|131259 TIGR02204, MsbA_rel, ABC transporter, permease/ATP-binding protein Back     alignment and domain information
>gnl|CDD|213183 cd03216, ABC_Carb_Monos_I, First domain of the ATP-binding cassette component of monosaccharide transport system Back     alignment and domain information
>gnl|CDD|184125 PRK13538, PRK13538, cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>gnl|CDD|224166 COG1245, COG1245, Predicted ATPase, RNase L inhibitor (RLI) homolog [General function prediction only] Back     alignment and domain information
>gnl|CDD|172739 PRK14251, PRK14251, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|106587 PRK13644, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|131681 TIGR02633, xylG, D-xylose ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|213203 cd03236, ABC_RNaseL_inhibitor_domain1, The ATP-binding cassette domain 1 of RNase L inhibitor Back     alignment and domain information
>gnl|CDD|184198 PRK13638, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|227590 COG5265, ATM1, ABC-type transport system involved in Fe-S cluster assembly, permease and ATPase components [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|184596 PRK14267, PRK14267, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|226641 COG4172, COG4172, ABC-type uncharacterized transport system, duplicated ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|183080 PRK11300, livG, leucine/isoleucine/valine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|184582 PRK14236, PRK14236, phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|184584 PRK14238, PRK14238, phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|213261 cd03294, ABC_Pro_Gly_Betaine, ATP-binding cassette domain of the osmoprotectant proline/glycine betaine uptake system Back     alignment and domain information
>gnl|CDD|181906 PRK09493, glnQ, glutamine ABC transporter ATP-binding protein; Reviewed Back     alignment and domain information
>gnl|CDD|214372 CHL00131, ycf16, sulfate ABC transporter protein; Validated Back     alignment and domain information
>gnl|CDD|183133 PRK11432, fbpC, ferric transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|172744 PRK14256, PRK14256, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|131681 TIGR02633, xylG, D-xylose ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|237452 PRK13632, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|184195 PRK13635, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|213261 cd03294, ABC_Pro_Gly_Betaine, ATP-binding cassette domain of the osmoprotectant proline/glycine betaine uptake system Back     alignment and domain information
>gnl|CDD|221721 pfam12698, ABC2_membrane_3, ABC-2 family transporter protein Back     alignment and domain information
>gnl|CDD|213198 cd03231, ABC_CcmA_heme_exporter, Cytochrome c biogenesis ATP-binding export protein Back     alignment and domain information
>gnl|CDD|226643 COG4175, ProV, ABC-type proline/glycine betaine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|226967 COG4608, AppF, ABC-type oligopeptide transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|213229 cd03262, ABC_HisP_GlnQ, ATP-binding cassette domain of the histidine and glutamine transporters Back     alignment and domain information
>gnl|CDD|226961 COG4598, HisP, ABC-type histidine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|235150 PRK03695, PRK03695, vitamin B12-transporter ATPase; Provisional Back     alignment and domain information
>gnl|CDD|237455 PRK13637, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|226628 COG4148, ModC, ABC-type molybdate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|235150 PRK03695, PRK03695, vitamin B12-transporter ATPase; Provisional Back     alignment and domain information
>gnl|CDD|172747 PRK14259, PRK14259, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|237652 PRK14275, PRK14275, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|182592 PRK10619, PRK10619, histidine/lysine/arginine/ornithine transporter subunit; Provisional Back     alignment and domain information
>gnl|CDD|130261 TIGR01193, bacteriocin_ABC, ABC-type bacteriocin transporter Back     alignment and domain information
>gnl|CDD|213184 cd03217, ABC_FeS_Assembly, ABC-type transport system involved in Fe-S cluster assembly, ATPase component Back     alignment and domain information
>gnl|CDD|172743 PRK14255, PRK14255, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|172735 PRK14247, PRK14247, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|130254 TIGR01186, proV, glycine betaine/L-proline transport ATP binding subunit Back     alignment and domain information
>gnl|CDD|184597 PRK14270, PRK14270, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|236865 PRK11160, PRK11160, cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed Back     alignment and domain information
>gnl|CDD|183133 PRK11432, fbpC, ferric transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|184129 PRK13543, PRK13543, cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>gnl|CDD|184129 PRK13543, PRK13543, cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>gnl|CDD|131367 TIGR02314, ABC_MetN, D-methionine ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|182893 PRK11000, PRK11000, maltose/maltodextrin transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|172730 PRK14242, PRK14242, phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|233209 TIGR00958, 3a01208, Conjugate Transporter-2 (CT2) Family protein Back     alignment and domain information
>gnl|CDD|237646 PRK14237, PRK14237, phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|213257 cd03290, ABCC_SUR1_N, ATP-binding cassette domain of the sulfonylurea receptor, subfamily C Back     alignment and domain information
>gnl|CDD|132313 TIGR03269, met_CoM_red_A2, methyl coenzyme M reductase system, component A2 Back     alignment and domain information
>gnl|CDD|131197 TIGR02142, modC_ABC, molybdenum ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|225438 COG2884, FtsE, Predicted ATPase involved in cell division [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|226364 COG3845, COG3845, ABC-type uncharacterized transport systems, ATPase components [General function prediction only] Back     alignment and domain information
>gnl|CDD|213214 cd03247, ABCC_cytochrome_bd, ATP-binding cassette domain of CydCD, subfamily C Back     alignment and domain information
>gnl|CDD|181939 PRK09544, znuC, high-affinity zinc transporter ATPase; Reviewed Back     alignment and domain information
>gnl|CDD|224053 COG1129, MglA, ABC-type sugar transport system, ATPase component [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|182336 PRK10253, PRK10253, iron-enterobactin transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|132313 TIGR03269, met_CoM_red_A2, methyl coenzyme M reductase system, component A2 Back     alignment and domain information
>gnl|CDD|237454 PRK13634, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|215640 PLN03232, PLN03232, ABC transporter C family member; Provisional Back     alignment and domain information
>gnl|CDD|226646 COG4178, COG4178, ABC-type uncharacterized transport system, permease and ATPase components [General function prediction only] Back     alignment and domain information
>gnl|CDD|213213 cd03246, ABCC_Protease_Secretion, ATP-binding cassette domain of PrtD, subfamily C Back     alignment and domain information
>gnl|CDD|213234 cd03267, ABC_NatA_like, ATP-binding cassette domain of an uncharacterized transporter similar in sequence to NatA Back     alignment and domain information
>gnl|CDD|184210 PRK13651, PRK13651, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|224057 COG1134, TagH, ABC-type polysaccharide/polyol phosphate transport system, ATPase component [Carbohydrate transport and metabolism / Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|130260 TIGR01192, chvA, glucan exporter ATP-binding protein Back     alignment and domain information
>gnl|CDD|224053 COG1129, MglA, ABC-type sugar transport system, ATPase component [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|234200 TIGR03411, urea_trans_UrtD, urea ABC transporter, ATP-binding protein UrtD Back     alignment and domain information
>gnl|CDD|172734 PRK14246, PRK14246, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|236870 PRK11174, PRK11174, cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed Back     alignment and domain information
>gnl|CDD|182528 PRK10535, PRK10535, macrolide transporter ATP-binding /permease protein; Provisional Back     alignment and domain information
>gnl|CDD|183226 PRK11607, potG, putrescine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|184590 PRK14249, PRK14249, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|188353 TIGR03608, L_ocin_972_ABC, putative bacteriocin export ABC transporter, lactococcin 972 group Back     alignment and domain information
>gnl|CDD|214372 CHL00131, ycf16, sulfate ABC transporter protein; Validated Back     alignment and domain information
>gnl|CDD|237452 PRK13632, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|182716 PRK10771, thiQ, thiamine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|213215 cd03248, ABCC_TAP, ATP-binding cassette domain of the Transporter Associated with Antigen Processing, subfamily C Back     alignment and domain information
>gnl|CDD|132050 TIGR03005, ectoine_ehuA, ectoine/hydroxyectoine ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|240339 PTZ00265, PTZ00265, multidrug resistance protein (mdr1); Provisional Back     alignment and domain information
>gnl|CDD|213194 cd03227, ABC_Class2, ATP-binding cassette domain of non-transporter proteins Back     alignment and domain information
>gnl|CDD|183231 PRK11614, livF, leucine/isoleucine/valine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|182829 PRK10908, PRK10908, cell division protein FtsE; Provisional Back     alignment and domain information
>gnl|CDD|182993 PRK11144, modC, molybdate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|130324 TIGR01257, rim_protein, retinal-specific rim ABC transporter Back     alignment and domain information
>gnl|CDD|131266 TIGR02211, LolD_lipo_ex, lipoprotein releasing system, ATP-binding protein Back     alignment and domain information
>gnl|CDD|226622 COG4138, BtuD, ABC-type cobalamin transport system, ATPase component [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|224026 COG1101, PhnK, ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|237457 PRK13647, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|226967 COG4608, AppF, ABC-type oligopeptide transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|131367 TIGR02314, ABC_MetN, D-methionine ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|213257 cd03290, ABCC_SUR1_N, ATP-binding cassette domain of the sulfonylurea receptor, subfamily C Back     alignment and domain information
>gnl|CDD|183226 PRK11607, potG, putrescine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|131377 TIGR02324, CP_lyasePhnL, phosphonate C-P lyase system protein PhnL Back     alignment and domain information
>gnl|CDD|214640 smart00382, AAA, ATPases associated with a variety of cellular activities Back     alignment and domain information
>gnl|CDD|172762 PRK14274, PRK14274, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|184207 PRK13648, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|223562 COG0488, Uup, ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] Back     alignment and domain information
>gnl|CDD|234357 TIGR03797, NHLM_micro_ABC2, NHLM bacteriocin system ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|182561 PRK10575, PRK10575, iron-hydroxamate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|182331 PRK10247, PRK10247, putative ABC transporter ATP-binding protein YbbL; Provisional Back     alignment and domain information
>gnl|CDD|172744 PRK14256, PRK14256, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|237455 PRK13637, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|181939 PRK09544, znuC, high-affinity zinc transporter ATPase; Reviewed Back     alignment and domain information
>gnl|CDD|215640 PLN03232, PLN03232, ABC transporter C family member; Provisional Back     alignment and domain information
>gnl|CDD|172734 PRK14246, PRK14246, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|182716 PRK10771, thiQ, thiamine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|240339 PTZ00265, PTZ00265, multidrug resistance protein (mdr1); Provisional Back     alignment and domain information
>gnl|CDD|184208 PRK13649, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|172757 PRK14269, PRK14269, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|184588 PRK14243, PRK14243, phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|236898 PRK11308, dppF, dipeptide transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|213188 cd03221, ABCF_EF-3, ATP-binding cassette domain of elongation factor 3, subfamily F Back     alignment and domain information
>gnl|CDD|237651 PRK14266, PRK14266, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|213187 cd03220, ABC_KpsT_Wzt, ATP-binding cassette component of polysaccharide transport system Back     alignment and domain information
>gnl|CDD|213187 cd03220, ABC_KpsT_Wzt, ATP-binding cassette component of polysaccharide transport system Back     alignment and domain information
>gnl|CDD|185336 PRK15439, PRK15439, autoinducer 2 ABC transporter ATP-binding protein LsrA; Provisional Back     alignment and domain information
>gnl|CDD|184594 PRK14264, PRK14264, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|213196 cd03229, ABC_Class3, ATP-binding cassette domain of the binding protein-dependent transport systems Back     alignment and domain information
>gnl|CDD|213185 cd03218, ABC_YhbG, ATP-binding cassette component of YhbG transport system Back     alignment and domain information
>gnl|CDD|184586 PRK14240, PRK14240, phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|172747 PRK14259, PRK14259, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|214640 smart00382, AAA, ATPases associated with a variety of cellular activities Back     alignment and domain information
>gnl|CDD|227019 COG4674, COG4674, Uncharacterized ABC-type transport system, ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|182036 PRK09700, PRK09700, D-allose transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|213190 cd03223, ABCD_peroxisomal_ALDP, ATP-binding cassette domain of peroxisomal transporter, subfamily D Back     alignment and domain information
>gnl|CDD|185067 PRK15112, PRK15112, antimicrobial peptide ABC system ATP-binding protein SapF; Provisional Back     alignment and domain information
>gnl|CDD|237453 PRK13633, PRK13633, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|130324 TIGR01257, rim_protein, retinal-specific rim ABC transporter Back     alignment and domain information
>gnl|CDD|163452 TIGR03740, galliderm_ABC, gallidermin-class lantibiotic protection ABC transporter, ATP-binding subunit Back     alignment and domain information
>gnl|CDD|233596 TIGR01846, type_I_sec_HlyB, type I secretion system ABC transporter, HlyB family Back     alignment and domain information
>gnl|CDD|172739 PRK14251, PRK14251, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|237649 PRK14254, PRK14254, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|184204 PRK13645, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|224060 COG1137, YhbG, ABC-type (unclassified) transport system, ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|237648 PRK14250, PRK14250, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|172762 PRK14274, PRK14274, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|183016 PRK11176, PRK11176, lipid transporter ATP-binding/permease protein; Provisional Back     alignment and domain information
>gnl|CDD|172740 PRK14252, PRK14252, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|183244 PRK11629, lolD, lipoprotein transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|184202 PRK13642, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|182569 PRK10584, PRK10584, putative ABC transporter ATP-binding protein YbbA; Provisional Back     alignment and domain information
>gnl|CDD|172730 PRK14242, PRK14242, phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|183231 PRK11614, livF, leucine/isoleucine/valine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|213181 cd03214, ABC_Iron-Siderophores_B12_Hemin, ATP-binding component of iron-siderophores, vitamin B12 and hemin transporters and related proteins Back     alignment and domain information
>gnl|CDD|183063 PRK11264, PRK11264, putative amino-acid ABC transporter ATP-binding protein YecC; Provisional Back     alignment and domain information
>gnl|CDD|163508 TIGR03796, NHLM_micro_ABC1, NHLM bacteriocin system ABC transporter, peptidase/ATP-binding protein Back     alignment and domain information
>gnl|CDD|237451 PRK13631, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|226592 COG4107, PhnK, ABC-type phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|183077 PRK11288, araG, L-arabinose transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|130260 TIGR01192, chvA, glucan exporter ATP-binding protein Back     alignment and domain information
>gnl|CDD|182732 PRK10789, PRK10789, putative multidrug transporter membrane\ATP-binding components; Provisional Back     alignment and domain information
>gnl|CDD|213204 cd03237, ABC_RNaseL_inhibitor_domain2, The ATP-binding cassette domain 2 of RNase L inhibitor Back     alignment and domain information
>gnl|CDD|182980 PRK11124, artP, arginine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|184200 PRK13640, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|172741 PRK14253, PRK14253, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|172749 PRK14261, PRK14261, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|213205 cd03238, ABC_UvrA, ATP-binding cassette domain of the excision repair protein UvrA Back     alignment and domain information
>gnl|CDD|223912 COG0842, COG0842, ABC-type multidrug transport system, permease component [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|236689 PRK10419, nikE, nickel transporter ATP-binding protein NikE; Provisional Back     alignment and domain information
>gnl|CDD|226641 COG4172, COG4172, ABC-type uncharacterized transport system, duplicated ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|233209 TIGR00958, 3a01208, Conjugate Transporter-2 (CT2) Family protein Back     alignment and domain information
>gnl|CDD|132313 TIGR03269, met_CoM_red_A2, methyl coenzyme M reductase system, component A2 Back     alignment and domain information
>gnl|CDD|213204 cd03237, ABC_RNaseL_inhibitor_domain2, The ATP-binding cassette domain 2 of RNase L inhibitor Back     alignment and domain information
>gnl|CDD|172745 PRK14257, PRK14257, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|184593 PRK14258, PRK14258, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|184209 PRK13650, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|213195 cd03228, ABCC_MRP_Like, ATP-binding cassette domain of multidrug resistance protein-like transporters Back     alignment and domain information
>gnl|CDD|226592 COG4107, PhnK, ABC-type phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|213190 cd03223, ABCD_peroxisomal_ALDP, ATP-binding cassette domain of peroxisomal transporter, subfamily D Back     alignment and domain information
>gnl|CDD|172732 PRK14244, PRK14244, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|240327 PTZ00243, PTZ00243, ABC transporter; Provisional Back     alignment and domain information
>gnl|CDD|172756 PRK14268, PRK14268, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|237647 PRK14248, PRK14248, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|188098 TIGR00957, MRP_assoc_pro, multi drug resistance-associated protein (MRP) Back     alignment and domain information
>gnl|CDD|182692 PRK10744, pstB, phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|188317 TIGR03415, ABC_choXWV_ATP, choline ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|183280 PRK11701, phnK, phosphonate C-P lyase system protein PhnK; Provisional Back     alignment and domain information
>gnl|CDD|237454 PRK13634, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|182528 PRK10535, PRK10535, macrolide transporter ATP-binding /permease protein; Provisional Back     alignment and domain information
>gnl|CDD|237651 PRK14266, PRK14266, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|236947 PRK11650, ugpC, glycerol-3-phosphate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|222165 pfam13481, AAA_25, AAA domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 1445
KOG00651391 consensus Pleiotropic drug resistance proteins (PD 100.0
PLN031401470 ABC transporter G family member; Provisional 100.0
TIGR009561394 3a01205 Pleiotropic Drug Resistance (PDR) Family p 100.0
TIGR00955617 3a01204 The Eye Pigment Precursor Transporter (EPP 100.0
KOG0061613 consensus Transporter, ABC superfamily (Breast can 100.0
PLN03211659 ABC transporter G-25; Provisional 100.0
TIGR00956 1394 3a01205 Pleiotropic Drug Resistance (PDR) Family p 100.0
PLN03140 1470 ABC transporter G family member; Provisional 100.0
KOG0065 1391 consensus Pleiotropic drug resistance proteins (PD 100.0
KOG0061613 consensus Transporter, ABC superfamily (Breast can 100.0
PLN03211659 ABC transporter G-25; Provisional 100.0
TIGR00955617 3a01204 The Eye Pigment Precursor Transporter (EPP 100.0
KOG00551228 consensus Multidrug/pheromone exporter, ABC superf 100.0
KOG00541381 consensus Multidrug resistance-associated protein/ 100.0
TIGR012572272 rim_protein retinal-specific rim ABC transporter. 100.0
PLN031301622 ABC transporter C family member; Provisional 100.0
PLN032321495 ABC transporter C family member; Provisional 100.0
PTZ002651466 multidrug resistance protein (mdr1); Provisional 100.0
TIGR009571522 MRP_assoc_pro multi drug resistance-associated pro 100.0
COG1123539 ATPase components of various ABC-type transport sy 100.0
PRK13549506 xylose transporter ATP-binding subunit; Provisiona 100.0
PRK09700510 D-allose transporter ATP-binding protein; Provisio 100.0
PRK10762501 D-ribose transporter ATP binding protein; Provisio 100.0
PRK10261623 glutathione transporter ATP-binding protein; Provi 100.0
TIGR012711490 CFTR_protein cystic fibrosis transmembrane conduct 100.0
PRK15134529 microcin C ABC transporter ATP-binding protein Yej 100.0
TIGR03269520 met_CoM_red_A2 methyl coenzyme M reductase system, 100.0
PRK15439510 autoinducer 2 ABC transporter ATP-binding protein 100.0
PTZ002431560 ABC transporter; Provisional 100.0
TIGR02633500 xylG D-xylose ABC transporter, ATP-binding protein 100.0
PRK11288501 araG L-arabinose transporter ATP-binding protein; 100.0
PRK10982491 galactose/methyl galaxtoside transporter ATP-bindi 100.0
PRK10938490 putative molybdenum transport ATP-binding protein 100.0
PRK11819556 putative ABC transporter ATP-binding protein; Revi 100.0
COG4172534 ABC-type uncharacterized transport system, duplica 100.0
PRK15064530 ABC transporter ATP-binding protein; Provisional 100.0
TIGR03719552 ABC_ABC_ChvD ATP-binding cassette protein, ChvD fa 100.0
PRK10636638 putative ABC transporter ATP-binding protein; Prov 100.0
PRK11147635 ABC transporter ATPase component; Reviewed 100.0
PRK13409590 putative ATPase RIL; Provisional 100.0
COG1129500 MglA ABC-type sugar transport system, ATPase compo 100.0
PLN03073718 ABC transporter F family; Provisional 100.0
COG0488530 Uup ATPase components of ABC transporters with dup 100.0
COG3845501 ABC-type uncharacterized transport systems, ATPase 100.0
COG1126240 GlnQ ABC-type polar amino acid transport system, A 100.0
COG1126240 GlnQ ABC-type polar amino acid transport system, A 100.0
KOG0927614 consensus Predicted transporter (ABC superfamily) 100.0
COG1135339 AbcC ABC-type metal ion transport system, ATPase c 100.0
COG1131293 CcmA ABC-type multidrug transport system, ATPase c 100.0
COG1125309 OpuBA ABC-type proline/glycine betaine transport s 100.0
KOG0058716 consensus Peptide exporter, ABC superfamily [Intra 100.0
COG1120258 FepC ABC-type cobalamin/Fe3+-siderophores transpor 100.0
COG1135339 AbcC ABC-type metal ion transport system, ATPase c 100.0
COG1121254 ZnuC ABC-type Mn/Zn transport systems, ATPase comp 100.0
COG1127263 Ttg2A ABC-type transport system involved in resist 100.0
TIGR01257 2272 rim_protein retinal-specific rim ABC transporter. 100.0
COG3839338 MalK ABC-type sugar transport systems, ATPase comp 100.0
COG1120258 FepC ABC-type cobalamin/Fe3+-siderophores transpor 100.0
COG3842352 PotA ABC-type spermidine/putrescine transport syst 100.0
COG1116248 TauB ABC-type nitrate/sulfonate/bicarbonate transp 100.0
COG1116248 TauB ABC-type nitrate/sulfonate/bicarbonate transp 100.0
COG1127263 Ttg2A ABC-type transport system involved in resist 100.0
COG1125309 OpuBA ABC-type proline/glycine betaine transport s 100.0
COG1136226 SalX ABC-type antimicrobial peptide transport syst 100.0
COG3638258 ABC-type phosphate/phosphonate transport system, A 100.0
COG1118345 CysA ABC-type sulfate/molybdate transport systems, 100.0
COG1131293 CcmA ABC-type multidrug transport system, ATPase c 100.0
COG1121254 ZnuC ABC-type Mn/Zn transport systems, ATPase comp 100.0
COG2274709 SunT ABC-type bacteriocin/lantibiotic exporters, c 100.0
COG1118345 CysA ABC-type sulfate/molybdate transport systems, 100.0
COG4555245 NatA ABC-type Na+ transport system, ATPase compone 100.0
COG1117253 PstB ABC-type phosphate transport system, ATPase c 100.0
COG3638258 ABC-type phosphate/phosphonate transport system, A 100.0
COG4555245 NatA ABC-type Na+ transport system, ATPase compone 100.0
COG2884223 FtsE Predicted ATPase involved in cell division [C 100.0
KOG0057591 consensus Mitochondrial Fe/S cluster exporter, ABC 100.0
COG3839338 MalK ABC-type sugar transport systems, ATPase comp 100.0
PRK13537306 nodulation ABC transporter NodI; Provisional 100.0
COG1117253 PstB ABC-type phosphate transport system, ATPase c 100.0
KOG0056790 consensus Heavy metal exporter HMT1, ABC superfami 100.0
TIGR02314343 ABC_MetN D-methionine ABC transporter, ATP-binding 100.0
COG1136226 SalX ABC-type antimicrobial peptide transport syst 100.0
KOG00551228 consensus Multidrug/pheromone exporter, ABC superf 100.0
TIGR03265353 PhnT2 putative 2-aminoethylphosphonate ABC transpo 100.0
PRK11650356 ugpC glycerol-3-phosphate transporter ATP-binding 100.0
PRK11432351 fbpC ferric transporter ATP-binding subunit; Provi 100.0
COG3842352 PotA ABC-type spermidine/putrescine transport syst 100.0
TIGR03258362 PhnT 2-aminoethylphosphonate ABC transport system, 100.0
TIGR02314343 ABC_MetN D-methionine ABC transporter, ATP-binding 100.0
PRK13537306 nodulation ABC transporter NodI; Provisional 100.0
cd03261235 ABC_Org_Solvent_Resistant ABC (ATP-binding cassett 100.0
COG1124252 DppF ABC-type dipeptide/oligopeptide/nickel transp 100.0
PRK09452375 potA putrescine/spermidine ABC transporter ATPase 100.0
TIGR03265353 PhnT2 putative 2-aminoethylphosphonate ABC transpo 100.0
PRK11650356 ugpC glycerol-3-phosphate transporter ATP-binding 100.0
COG1132567 MdlB ABC-type multidrug transport system, ATPase a 100.0
cd03261235 ABC_Org_Solvent_Resistant ABC (ATP-binding cassett 100.0
COG1122235 CbiO ABC-type cobalt transport system, ATPase comp 100.0
PRK11432351 fbpC ferric transporter ATP-binding subunit; Provi 100.0
PRK11174588 cysteine/glutathione ABC transporter membrane/ATP- 100.0
PRK13536340 nodulation factor exporter subunit NodI; Provision 100.0
TIGR01186363 proV glycine betaine/L-proline transport ATP bindi 100.0
PRK10851353 sulfate/thiosulfate transporter subunit; Provision 100.0
TIGR03258362 PhnT 2-aminoethylphosphonate ABC transport system, 100.0
COG2884223 FtsE Predicted ATPase involved in cell division [C 100.0
cd03259213 ABC_Carb_Solutes_like ABC Carbohydrate and Solute 100.0
COG3840231 ThiQ ABC-type thiamine transport system, ATPase co 100.0
PRK11607377 potG putrescine transporter ATP-binding subunit; P 100.0
COG0410237 LivF ABC-type branched-chain amino acid transport 100.0
COG1122235 CbiO ABC-type cobalt transport system, ATPase comp 100.0
TIGR01188302 drrA daunorubicin resistance ABC transporter ATP-b 100.0
COG3840231 ThiQ ABC-type thiamine transport system, ATPase co 100.0
PRK11000369 maltose/maltodextrin transporter ATP-binding prote 100.0
PRK10851353 sulfate/thiosulfate transporter subunit; Provision 100.0
COG2274709 SunT ABC-type bacteriocin/lantibiotic exporters, c 100.0
cd03269210 ABC_putative_ATPase This subfamily is involved in 100.0
PRK11153343 metN DL-methionine transporter ATP-binding subunit 100.0
TIGR00960216 3a0501s02 Type II (General) Secretory Pathway (IIS 100.0
cd03293220 ABC_NrtD_SsuB_transporters NrtD and SsuB are the A 100.0
TIGR01288303 nodI ATP-binding ABC transporter family nodulation 100.0
cd03265220 ABC_DrrA DrrA is the ATP-binding protein component 100.0
PRK13536340 nodulation factor exporter subunit NodI; Provision 100.0
PRK09452375 potA putrescine/spermidine ABC transporter ATPase 100.0
cd03301213 ABC_MalK_N The N-terminal ATPase domain of the mal 100.0
COG1137243 YhbG ABC-type (unclassified) transport system, ATP 100.0
COG0411250 LivG ABC-type branched-chain amino acid transport 100.0
cd03219236 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC trans 100.0
COG1124252 DppF ABC-type dipeptide/oligopeptide/nickel transp 100.0
PRK13637287 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
cd03259213 ABC_Carb_Solutes_like ABC Carbohydrate and Solute 100.0
PRK11153343 metN DL-methionine transporter ATP-binding subunit 100.0
COG4559259 ABC-type hemin transport system, ATPase component 100.0
cd03218232 ABC_YhbG The ABC transporters belonging to the Yhb 100.0
cd03296239 ABC_CysA_sulfate_importer Part of the ABC transpor 100.0
cd03266218 ABC_NatA_sodium_exporter NatA is the ATPase compon 100.0
PRK11607377 potG putrescine transporter ATP-binding subunit; P 100.0
PRK11000369 maltose/maltodextrin transporter ATP-binding prote 100.0
KOG0062582 consensus ATPase component of ABC transporters wit 100.0
cd03265220 ABC_DrrA DrrA is the ATP-binding protein component 100.0
TIGR01188302 drrA daunorubicin resistance ABC transporter ATP-b 100.0
PRK09536402 btuD corrinoid ABC transporter ATPase; Reviewed 100.0
TIGR01186363 proV glycine betaine/L-proline transport ATP bindi 100.0
COG4988559 CydD ABC-type transport system involved in cytochr 100.0
COG4987573 CydC ABC-type transport system involved in cytochr 100.0
cd03296239 ABC_CysA_sulfate_importer Part of the ABC transpor 100.0
TIGR03522301 GldA_ABC_ATP gliding motility-associated ABC trans 100.0
cd03268208 ABC_BcrA_bacitracin_resist The BcrA subfamily repr 100.0
cd03260227 ABC_PstB_phosphate_transporter Phosphate uptake is 100.0
cd03234226 ABCG_White The White subfamily represents ABC tran 100.0
TIGR01288303 nodI ATP-binding ABC transporter family nodulation 100.0
TIGR03797686 NHPM_micro_ABC2 NHPM bacteriocin system ABC transp 100.0
PRK13634290 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
cd03258233 ABC_MetN_methionine_transporter MetN (also known a 100.0
cd03219236 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC trans 100.0
cd03258233 ABC_MetN_methionine_transporter MetN (also known a 100.0
cd03255218 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of 100.0
cd03256241 ABC_PhnC_transporter ABC-type phosphate/phosphonat 100.0
PRK13643288 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK09493240 glnQ glutamine ABC transporter ATP-binding protein 100.0
cd03301213 ABC_MalK_N The N-terminal ATPase domain of the mal 100.0
cd03226205 ABC_cobalt_CbiO_domain2 Domain II of the ABC compo 100.0
PRK11629233 lolD lipoprotein transporter ATP-binding subunit; 100.0
PRK11264250 putative amino-acid ABC transporter ATP-binding pr 100.0
TIGR00960216 3a0501s02 Type II (General) Secretory Pathway (IIS 100.0
cd03263220 ABC_subfamily_A The ABCA subfamily mediates the tr 100.0
TIGR02673214 FtsE cell division ATP-binding protein FtsE. This 100.0
cd03218232 ABC_YhbG The ABC transporters belonging to the Yhb 100.0
PRK13637287 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
cd03293220 ABC_NrtD_SsuB_transporters NrtD and SsuB are the A 100.0
TIGR03522301 GldA_ABC_ATP gliding motility-associated ABC trans 100.0
cd03295242 ABC_OpuCA_Osmoprotection OpuCA is a the ATP bindin 100.0
TIGR03375694 type_I_sec_LssB type I secretion system ATPase, Ls 100.0
cd03292214 ABC_FtsE_transporter FtsE is a hydrophilic nucleot 100.0
cd03224222 ABC_TM1139_LivF_branched LivF (TM1139) is part of 100.0
PRK13650279 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
COG0410237 LivF ABC-type branched-chain amino acid transport 100.0
COG1137243 YhbG ABC-type (unclassified) transport system, ATP 100.0
cd03294269 ABC_Pro_Gly_Bertaine This family comprises the gly 100.0
PRK11831269 putative ABC transporter ATP-binding protein YrbF; 100.0
TIGR02315243 ABC_phnC phosphonate ABC transporter, ATP-binding 100.0
PRK13647274 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK11248255 tauB taurine transporter ATP-binding subunit; Prov 100.0
cd03263220 ABC_subfamily_A The ABCA subfamily mediates the tr 100.0
cd03224222 ABC_TM1139_LivF_branched LivF (TM1139) is part of 100.0
cd03256241 ABC_PhnC_transporter ABC-type phosphate/phosphonat 100.0
PRK11831269 putative ABC transporter ATP-binding protein YrbF; 100.0
PRK11176582 lipid transporter ATP-binding/permease protein; Pr 100.0
PRK13647274 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
cd03269210 ABC_putative_ATPase This subfamily is involved in 100.0
cd03294269 ABC_Pro_Gly_Bertaine This family comprises the gly 100.0
PRK13634290 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
cd03295242 ABC_OpuCA_Osmoprotection OpuCA is a the ATP bindin 100.0
cd03264211 ABC_drug_resistance_like ABC-type multidrug transp 100.0
cd03260227 ABC_PstB_phosphate_transporter Phosphate uptake is 100.0
TIGR03796710 NHPM_micro_ABC1 NHPM bacteriocin system ABC transp 100.0
PRK13631320 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK09536402 btuD corrinoid ABC transporter ATPase; Reviewed 100.0
PRK13651305 cobalt transporter ATP-binding subunit; Provisiona 100.0
cd03255218 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of 100.0
PRK11629233 lolD lipoprotein transporter ATP-binding subunit; 100.0
PRK10790592 putative multidrug transporter membrane\ATP-bindin 100.0
COG0411250 LivG ABC-type branched-chain amino acid transport 100.0
PRK10619257 histidine/lysine/arginine/ornithine transporter su 100.0
PRK10908222 cell division protein FtsE; Provisional 100.0
PRK11160574 cysteine/glutathione ABC transporter membrane/ATP- 100.0
TIGR01193708 bacteriocin_ABC ABC-type bacteriocin transporter. 100.0
PRK10895241 lipopolysaccharide ABC transporter ATP-binding pro 100.0
COG4618580 ArpD ABC-type protease/lipase transport system, AT 100.0
PRK13646286 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK13643288 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
cd03257228 ABC_NikE_OppD_transporters The ABC transporter sub 100.0
TIGR03864236 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, 100.0
PRK13651305 cobalt transporter ATP-binding subunit; Provisiona 100.0
COG4152300 ABC-type uncharacterized transport system, ATPase 100.0
cd03262213 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP- 100.0
TIGR02315243 ABC_phnC phosphonate ABC transporter, ATP-binding 100.0
PRK15079331 oligopeptide ABC transporter ATP-binding protein O 100.0
cd03235213 ABC_Metallic_Cations ABC component of the metal-ty 100.0
TIGR00972247 3a0107s01c2 phosphate ABC transporter, ATP-binding 100.0
PRK13631320 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK13636283 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
TIGR03740223 galliderm_ABC gallidermin-class lantibiotic protec 100.0
PTZ002651466 multidrug resistance protein (mdr1); Provisional 100.0
TIGR00958711 3a01208 Conjugate Transporter-2 (CT2) Family prote 100.0
TIGR03864236 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, 100.0
cd03268208 ABC_BcrA_bacitracin_resist The BcrA subfamily repr 100.0
cd03266218 ABC_NatA_sodium_exporter NatA is the ATPase compon 100.0
PRK13646286 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
COG4559259 ABC-type hemin transport system, ATPase component 100.0
PRK11247257 ssuB aliphatic sulfonates transport ATP-binding su 100.0
KOG0058716 consensus Peptide exporter, ABC superfamily [Intra 100.0
PRK13635279 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
TIGR02211221 LolD_lipo_ex lipoprotein releasing system, ATP-bin 100.0
PRK09493240 glnQ glutamine ABC transporter ATP-binding protein 100.0
cd03225211 ABC_cobalt_CbiO_domain1 Domain I of the ABC compon 100.0
cd03233202 ABC_PDR_domain1 The pleiotropic drug resistance (P 100.0
PRK11264250 putative amino-acid ABC transporter ATP-binding pr 100.0
PRK11614237 livF leucine/isoleucine/valine transporter ATP-bin 100.0
PRK13650279 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
TIGR03005252 ectoine_ehuA ectoine/hydroxyectoine ABC transporte 100.0
PRK14247250 phosphate ABC transporter ATP-binding protein; Pro 100.0
cd03226205 ABC_cobalt_CbiO_domain2 Domain II of the ABC compo 100.0
PRK10070400 glycine betaine transporter ATP-binding subunit; P 100.0
PRK09473330 oppD oligopeptide transporter ATP-binding componen 100.0
PRK15079331 oligopeptide ABC transporter ATP-binding protein O 100.0
cd03234226 ABCG_White The White subfamily represents ABC tran 100.0
cd03264211 ABC_drug_resistance_like ABC-type multidrug transp 100.0
PRK11300255 livG leucine/isoleucine/valine transporter ATP-bin 100.0
PRK14267253 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK11124242 artP arginine transporter ATP-binding subunit; Pro 100.0
PRK13636283 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK13641287 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK13644274 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
TIGR01978243 sufC FeS assembly ATPase SufC. SufC is part of the 100.0
PRK14273254 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK13652277 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK14268258 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK11248255 tauB taurine transporter ATP-binding subunit; Prov 100.0
cd03257228 ABC_NikE_OppD_transporters The ABC transporter sub 100.0
TIGR03415382 ABC_choXWV_ATP choline ABC transporter, ATP-bindin 100.0
PRK13548258 hmuV hemin importer ATP-binding subunit; Provision 100.0
TIGR03411242 urea_trans_UrtD urea ABC transporter, ATP-binding 100.0
cd03298211 ABC_ThiQ_thiamine_transporter ABC-type thiamine tr 100.0
PRK10895241 lipopolysaccharide ABC transporter ATP-binding pro 100.0
PRK11308327 dppF dipeptide transporter ATP-binding subunit; Pr 100.0
PRK11247257 ssuB aliphatic sulfonates transport ATP-binding su 100.0
TIGR02211221 LolD_lipo_ex lipoprotein releasing system, ATP-bin 100.0
TIGR03410230 urea_trans_UrtE urea ABC transporter, ATP-binding 100.0
PRK11231255 fecE iron-dicitrate transporter ATP-binding subuni 100.0
PRK13641287 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK14241258 phosphate transporter ATP-binding protein; Provisi 100.0
PRK14245250 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK13632271 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
COG4175386 ProV ABC-type proline/glycine betaine transport sy 100.0
PRK13635279 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK13633280 cobalt transporter ATP-binding subunit; Provisiona 100.0
cd03292214 ABC_FtsE_transporter FtsE is a hydrophilic nucleot 100.0
cd03233202 ABC_PDR_domain1 The pleiotropic drug resistance (P 100.0
PRK10253265 iron-enterobactin transporter ATP-binding protein; 100.0
TIGR03005252 ectoine_ehuA ectoine/hydroxyectoine ABC transporte 100.0
PRK10744260 pstB phosphate transporter ATP-binding protein; Pr 100.0
PRK10070400 glycine betaine transporter ATP-binding subunit; P 100.0
COG4525259 TauB ABC-type taurine transport system, ATPase com 100.0
PRK13638271 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
cd03232192 ABC_PDR_domain2 The pleiotropic drug resistance-li 100.0
PRK14242253 phosphate transporter ATP-binding protein; Provisi 100.0
PRK11614237 livF leucine/isoleucine/valine transporter ATP-bin 100.0
TIGR02673214 FtsE cell division ATP-binding protein FtsE. This 100.0
PRK11022326 dppD dipeptide transporter ATP-binding subunit; Pr 100.0
TIGR00972247 3a0107s01c2 phosphate ABC transporter, ATP-binding 100.0
TIGR02769265 nickel_nikE nickel import ATP-binding protein NikE 100.0
PRK10575265 iron-hydroxamate transporter ATP-binding subunit; 100.0
cd03267236 ABC_NatA_like Similar in sequence to NatA, this is 100.0
PRK13652277 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK13548258 hmuV hemin importer ATP-binding subunit; Provision 100.0
PRK09984262 phosphonate/organophosphate ester transporter subu 100.0
PRK13644274 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
COG5265497 ATM1 ABC-type transport system involved in Fe-S cl 100.0
PRK13649280 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
COG0444316 DppD ABC-type dipeptide/oligopeptide/nickel transp 100.0
TIGR01184230 ntrCD nitrate transport ATP-binding subunits C and 100.0
PRK10584228 putative ABC transporter ATP-binding protein YbbA; 100.0
TIGR03410230 urea_trans_UrtE urea ABC transporter, ATP-binding 100.0
cd03300232 ABC_PotA_N PotA is an ABC-type transporter and the 100.0
TIGR03873256 F420-0_ABC_ATP proposed F420-0 ABC transporter, AT 100.0
PRK13648269 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK13639275 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK14235267 phosphate transporter ATP-binding protein; Provisi 100.0
TIGR03411242 urea_trans_UrtD urea ABC transporter, ATP-binding 100.0
PRK14273254 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK11300255 livG leucine/isoleucine/valine transporter ATP-bin 100.0
COG4988559 CydD ABC-type transport system involved in cytochr 100.0
PRK14237267 phosphate transporter ATP-binding protein; Provisi 100.0
PRK13649280 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK14250241 phosphate ABC transporter ATP-binding protein; Pro 100.0
TIGR01842544 type_I_sec_PrtD type I secretion system ABC transp 100.0
PRK14256252 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK10619257 histidine/lysine/arginine/ornithine transporter su 100.0
PRK10908222 cell division protein FtsE; Provisional 100.0
TIGR02769265 nickel_nikE nickel import ATP-binding protein NikE 100.0
TIGR03415382 ABC_choXWV_ATP choline ABC transporter, ATP-bindin 100.0
TIGR01277213 thiQ thiamine ABC transporter, ATP-binding protein 100.0
PRK14269246 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK14268258 phosphate ABC transporter ATP-binding protein; Pro 100.0
TIGR00968237 3a0106s01 sulfate ABC transporter, ATP-binding pro 100.0
PRK10584228 putative ABC transporter ATP-binding protein YbbA; 100.0
cd03300232 ABC_PotA_N PotA is an ABC-type transporter and the 100.0
PRK13638271 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
TIGR03797686 NHPM_micro_ABC2 NHPM bacteriocin system ABC transp 100.0
PRK14247250 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK13640282 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK11022326 dppD dipeptide transporter ATP-binding subunit; Pr 100.0
PRK11124242 artP arginine transporter ATP-binding subunit; Pro 100.0
PRK14257329 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK13632271 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK13639275 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK14242253 phosphate transporter ATP-binding protein; Provisi 100.0
PRK11308327 dppF dipeptide transporter ATP-binding subunit; Pr 100.0
cd03267236 ABC_NatA_like Similar in sequence to NatA, this is 100.0
TIGR01846694 type_I_sec_HlyB type I secretion system ABC transp 100.0
TIGR01978243 sufC FeS assembly ATPase SufC. SufC is part of the 100.0
KOG0057591 consensus Mitochondrial Fe/S cluster exporter, ABC 100.0
PRK13549506 xylose transporter ATP-binding subunit; Provisiona 100.0
PRK09473330 oppD oligopeptide transporter ATP-binding componen 100.0
PRK13547272 hmuV hemin importer ATP-binding subunit; Provision 100.0
KOG0066807 consensus eIF2-interacting protein ABC50 (ABC supe 100.0
PRK13645289 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK13648269 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
COG4181228 Predicted ABC-type transport system involved in ly 100.0
PRK13633280 cobalt transporter ATP-binding subunit; Provisiona 100.0
PRK14250241 phosphate ABC transporter ATP-binding protein; Pro 100.0
TIGR03608206 L_ocin_972_ABC putative bacteriocin export ABC tra 100.0
PRK13645289 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK13657588 cyclic beta-1,2-glucan ABC transporter; Provisiona 100.0
cd03298211 ABC_ThiQ_thiamine_transporter ABC-type thiamine tr 100.0
TIGR03740223 galliderm_ABC gallidermin-class lantibiotic protec 100.0
PRK10575265 iron-hydroxamate transporter ATP-binding subunit; 100.0
PRK10789569 putative multidrug transporter membrane\ATP-bindin 100.0
PRK14259269 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK14267253 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK10253265 iron-enterobactin transporter ATP-binding protein; 100.0
PRK10771232 thiQ thiamine transporter ATP-binding subunit; Pro 100.0
PRK13640282 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK10771232 thiQ thiamine transporter ATP-binding subunit; Pro 100.0
PRK14239252 phosphate transporter ATP-binding protein; Provisi 100.0
cd03299235 ABC_ModC_like Archeal protein closely related to M 100.0
TIGR00968237 3a0106s01 sulfate ABC transporter, ATP-binding pro 100.0
cd03299235 ABC_ModC_like Archeal protein closely related to M 100.0
cd03225211 ABC_cobalt_CbiO_domain1 Domain I of the ABC compon 100.0
PRK14270251 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK15093330 antimicrobial peptide ABC transporter ATP-binding 100.0
PRK14274259 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK14244251 phosphate ABC transporter ATP-binding protein; Pro 100.0
COG1245591 Predicted ATPase, RNase L inhibitor (RLI) homolog 100.0
TIGR02203571 MsbA_lipidA lipid A export permease/ATP-binding pr 100.0
PLN031301622 ABC transporter C family member; Provisional 100.0
PRK15093330 antimicrobial peptide ABC transporter ATP-binding 100.0
cd03213194 ABCG_EPDR ABCG transporters are involved in eye pi 100.0
PRK14240250 phosphate transporter ATP-binding protein; Provisi 100.0
PRK14262250 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK11231255 fecE iron-dicitrate transporter ATP-binding subuni 100.0
PRK15112267 antimicrobial peptide ABC system ATP-binding prote 100.0
TIGR03873256 F420-0_ABC_ATP proposed F420-0 ABC transporter, AT 100.0
PRK09984262 phosphonate/organophosphate ester transporter subu 100.0
PRK15112267 antimicrobial peptide ABC system ATP-binding prote 100.0
PRK10744260 pstB phosphate transporter ATP-binding protein; Pr 100.0
PRK14253249 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK11144352 modC molybdate transporter ATP-binding protein; Pr 100.0
TIGR01277213 thiQ thiamine ABC transporter, ATP-binding protein 100.0
PRK13642277 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK11144352 modC molybdate transporter ATP-binding protein; Pr 100.0
PRK14257329 phosphate ABC transporter ATP-binding protein; Pro 100.0
TIGR02142354 modC_ABC molybdenum ABC transporter, ATP-binding p 100.0
PRK14235267 phosphate transporter ATP-binding protein; Provisi 100.0
cd03297214 ABC_ModC_molybdenum_transporter ModC is an ABC-typ 100.0
TIGR03796710 NHPM_micro_ABC1 NHPM bacteriocin system ABC transp 100.0
COG4525259 TauB ABC-type taurine transport system, ATPase com 100.0
TIGR01192585 chvA glucan exporter ATP-binding protein. This mod 100.0
TIGR02142354 modC_ABC molybdenum ABC transporter, ATP-binding p 100.0
cd03262213 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP- 100.0
PRK14260259 phosphate ABC transporter ATP-binding protein; Pro 100.0
TIGR02770230 nickel_nikD nickel import ATP-binding protein NikD 100.0
PRK14258261 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK14237267 phosphate transporter ATP-binding protein; Provisi 100.0
PRK14236272 phosphate transporter ATP-binding protein; Provisi 100.0
TIGR01184230 ntrCD nitrate transport ATP-binding subunits C and 100.0
TIGR02770230 nickel_nikD nickel import ATP-binding protein NikD 100.0
PRK14272252 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK14241258 phosphate transporter ATP-binding protein; Provisi 100.0
PRK14245250 phosphate ABC transporter ATP-binding protein; Pro 100.0
PLN032321495 ABC transporter C family member; Provisional 100.0
TIGR01193708 bacteriocin_ABC ABC-type bacteriocin transporter. 100.0
PRK10762501 D-ribose transporter ATP binding protein; Provisio 100.0
PRK14270251 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK10418254 nikD nickel transporter ATP-binding protein NikD; 100.0
TIGR02982220 heterocyst_DevA ABC exporter ATP-binding subunit, 100.0
PRK14269246 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK11701258 phnK phosphonate C-P lyase system protein PhnK; Pr 100.0
PRK13642277 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK11701258 phnK phosphonate C-P lyase system protein PhnK; Pr 100.0
PRK14256252 phosphate ABC transporter ATP-binding protein; Pro 100.0
COG0444316 DppD ABC-type dipeptide/oligopeptide/nickel transp 100.0
PRK10418254 nikD nickel transporter ATP-binding protein NikD; 100.0
PRK14249251 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK14261253 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK14263261 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK09700510 D-allose transporter ATP-binding protein; Provisio 100.0
PRK00349943 uvrA excinuclease ABC subunit A; Reviewed 100.0
PRK00635 1809 excinuclease ABC subunit A; Provisional 100.0
PRK14239252 phosphate transporter ATP-binding protein; Provisi 100.0
PRK14274259 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK11174588 cysteine/glutathione ABC transporter membrane/ATP- 100.0
PRK14275286 phosphate ABC transporter ATP-binding protein; Pro 100.0
cd03235213 ABC_Metallic_Cations ABC component of the metal-ty 100.0
PRK14271276 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK14248268 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK13543214 cytochrome c biogenesis protein CcmA; Provisional 100.0
PRK14262250 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK14251251 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK14255252 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK14259269 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK15056272 manganese/iron transporter ATP-binding protein; Pr 100.0
PRK13538204 cytochrome c biogenesis protein CcmA; Provisional 100.0
TIGR02204576 MsbA_rel ABC transporter, permease/ATP-binding pro 100.0
PRK14240250 phosphate transporter ATP-binding protein; Provisi 100.0
cd03231201 ABC_CcmA_heme_exporter CcmA, the ATP-binding compo 100.0
PRK13547272 hmuV hemin importer ATP-binding subunit; Provision 100.0
TIGR02633500 xylG D-xylose ABC transporter, ATP-binding protein 100.0
PRK14248268 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK10419268 nikE nickel transporter ATP-binding protein NikE; 100.0
PRK14265274 phosphate ABC transporter ATP-binding protein; Pro 100.0
cd03220224 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transpo 100.0
cd03252237 ABCC_Hemolysin The ABC-transporter hemolysin B is 100.0
COG4181228 Predicted ABC-type transport system involved in ly 100.0
PRK14254285 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK15439510 autoinducer 2 ABC transporter ATP-binding protein 100.0
PRK14272252 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK14271276 phosphate ABC transporter ATP-binding protein; Pro 100.0
TIGR01846694 type_I_sec_HlyB type I secretion system ABC transp 100.0
cd03213194 ABCG_EPDR ABCG transporters are involved in eye pi 100.0
PRK14238271 phosphate transporter ATP-binding protein; Provisi 100.0
cd03252237 ABCC_Hemolysin The ABC-transporter hemolysin B is 100.0
PRK14236272 phosphate transporter ATP-binding protein; Provisi 100.0
TIGR02868529 CydC thiol reductant ABC exporter, CydC subunit. T 100.0
TIGR009571522 MRP_assoc_pro multi drug resistance-associated pro 100.0
PRK11288501 araG L-arabinose transporter ATP-binding protein; 100.0
PRK14249251 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK14251251 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK14253249 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK14275286 phosphate ABC transporter ATP-binding protein; Pro 100.0
CHL00131252 ycf16 sulfate ABC transporter protein; Validated 100.0
PRK14244251 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK14243264 phosphate transporter ATP-binding protein; Provisi 100.0
PRK14261253 phosphate ABC transporter ATP-binding protein; Pro 100.0
TIGR02323253 CP_lyasePhnK phosphonate C-P lyase system protein 100.0
cd03289275 ABCC_CFTR2 The CFTR subfamily domain 2. The cystic 100.0
cd03289275 ABCC_CFTR2 The CFTR subfamily domain 2. The cystic 100.0
PRK14258261 phosphate ABC transporter ATP-binding protein; Pro 100.0
cd03297214 ABC_ModC_molybdenum_transporter ModC is an ABC-typ 100.0
PRK10247225 putative ABC transporter ATP-binding protein YbbL; 100.0
PRK10982491 galactose/methyl galaxtoside transporter ATP-bindi 100.0
cd03230173 ABC_DR_subfamily_A This family of ATP-binding prot 100.0
COG1132567 MdlB ABC-type multidrug transport system, ATPase a 100.0
TIGR01166190 cbiO cobalt transport protein ATP-binding subunit. 100.0
PRK03695248 vitamin B12-transporter ATPase; Provisional 100.0
TIGR02323253 CP_lyasePhnK phosphonate C-P lyase system protein 100.0
PRK14266250 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK10419268 nikE nickel transporter ATP-binding protein NikE; 100.0
PRK11176582 lipid transporter ATP-binding/permease protein; Pr 100.0
PRK14260259 phosphate ABC transporter ATP-binding protein; Pro 100.0
COG4987573 CydC ABC-type transport system involved in cytochr 100.0
PRK14246257 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK14255252 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK10790592 putative multidrug transporter membrane\ATP-bindin 100.0
PRK10247225 putative ABC transporter ATP-binding protein YbbL; 100.0
TIGR02982220 heterocyst_DevA ABC exporter ATP-binding subunit, 100.0
PRK14265274 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK13539207 cytochrome c biogenesis protein CcmA; Provisional 100.0
PRK14238271 phosphate transporter ATP-binding protein; Provisi 100.0
cd03245220 ABCC_bacteriocin_exporters ABC-type bacteriocin ex 100.0
>KOG0065 consensus Pleiotropic drug resistance proteins (PDR1-15), ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
Probab=100.00  E-value=6.8e-256  Score=2360.59  Aligned_cols=1340  Identities=53%  Similarity=0.924  Sum_probs=1257.5

Q ss_pred             cchhHhhhHHHHhhCCChhhhhhcccccC-CCCcccccccccChHhhHHHHHHhhhccccchHHHHHHHHHHHhhcCCCC
Q 000523           36 EDDEEALKWAALEKLPTYNRLRKGILTTS-RGEANEVDVYNLGLQERQRLIDKLVKVTDVDNERFLLKLKNRIDRVGIDL  114 (1445)
Q Consensus        36 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  114 (1445)
                      +||||+|||||+|||||++|   +++.+. ++   ++|+.+++..++..+.++..+..++|+++++.+++++.+++  ++
T Consensus        12 ~~~e~~~~~a~~~~~pt~~~---~~~~~~~~~---~~d~~~~~~~~~~~~~~~~~~~~~~d~~~~l~~~r~~~~~~--~~   83 (1391)
T KOG0065|consen   12 DEDEEALRWAAIERLPTFDR---SLLRSIFES---EVDVTKLDPDDDPKFIEKSSKHWEQDNEKLLEKLRERIDRV--EL   83 (1391)
T ss_pred             chhHHHHHHHHHhcCccccc---hhhhhhccC---cccccCCCcccchhHHHHhHHHHhhhHHHHHHHHHhhcCcc--cC
Confidence            45999999999999999999   555432 22   79999999999999999999999999999999999999998  88


Q ss_pred             CcceEEEeeeEEEEEEecCCCcCCChhHHHHHHHHHHHhhhhhcCCccccceeeecceeEEeCCeEEEEEcCCCCCHHHH
Q 000523          115 PKVEVRYEHLNVEAEAFLASNALPSFIKFYTNIFEDILNYLRIIPSKKRHLTILKDVSGVIKPGRLTLLLGPPSSGKTTL  194 (1445)
Q Consensus       115 ~~~~v~~~~l~~~~~~~~~~~~~~t~~~~~~~~~~~~~~~~~~~~~~~~~~~iL~~vs~~i~~G~~~~llGp~GsGKSTL  194 (1445)
                      |.++++++++.+++++..|    ||+.|...+.++.++...+..  ++.+.+||+|+|+.++||||++++||||||||||
T Consensus        84 p~~~~~~~~~gv~a~~~~~----~t~~n~~~~~~~~~~~~~~~~--~~~~~~il~~~sg~~~pg~m~lvLG~pgsG~ttl  157 (1391)
T KOG0065|consen   84 PTIEVRFSALGVEADVTYG----PTLVNILSNPLESILRMLGKR--KKKKIQILKDISGIIKPGEMTLVLGPPGSGKTTL  157 (1391)
T ss_pred             CceEEEeeecccccccccc----hhhhhhhhhHHHHHhhhcccc--ccccceeecCcceeEcCCceEEEecCCCCchHHH
Confidence            9999999999999998766    999999999999888766543  5566789999999999999999999999999999


Q ss_pred             HHHHhCCCCCCCCceeEEEEcCccCCCcCccceEEEEcCCCCCCCCCCHHHHHHHhHHhcCCCchhhhhHHHHHHHHHcC
Q 000523          195 LLALAGKLDPTLKVSGTVTYNGHDMDEFVPQRTAAYISQHDNHIGEMTVRETLAFSARCQGVGTRYEMLTELARREKAAG  274 (1445)
Q Consensus       195 L~~L~G~~~~~~~~~G~V~~~G~~~~~~~~~~~~~yv~Q~d~~~~~lTV~E~l~f~~~~~~~~~~~~~~~~~~~~~~~~~  274 (1445)
                      |++|+|.++...+..|+|+|||++.+++.+++.++|++|+|.|+|+|||||+|+|+++|++++.|++   +..|++++. 
T Consensus       158 lkal~g~~~~~~~~~~~isy~G~~~~e~~~~~~~aY~~e~DvH~p~lTVreTldFa~rck~~~~r~~---~~~R~e~~~-  233 (1391)
T KOG0065|consen  158 LKALAGKLDNFLKSSGEITYNGHDLKEFVPKKTVAYNSEQDVHFPELTVRETLDFAARCKGPGSRYD---EVSRREKLA-  233 (1391)
T ss_pred             HHHHhCCCcccccCCCceeECCCcccccccCceEEeccccccccceeEEeehhhHHHhccCCccccc---cccHHHHHH-
Confidence            9999999998878889999999999999999999999999999999999999999999999998887   445555431 


Q ss_pred             CCCCCCHHHHHHHHhhhhhhHhHHHHHHHHHcCCcccccccccccccccCChhhhhHHHHHHHHhcCCccceeecCCCCC
Q 000523          275 IKPDPDIDVYMKAIATEGQEANVITDYYLKVLGLDVCADTMVGDEMIRGISGGQKKRVTTGEMMVGPALALFMDEISTGL  354 (1445)
Q Consensus       275 ~~pd~d~~~~~~~~~~~~~~~~~~~~~~l~~lgL~~~~dt~vg~~~~~~LSGGqrqRvsia~aL~~~p~vllLDEptsgL  354 (1445)
                                            .++|++++++||++|+||+|||+++||+||||||||+||+++++++++++|||+|+||
T Consensus       234 ----------------------~~~d~~lkilGL~~~~dT~VGnd~~RGvSGGerKRvsi~E~~v~~~~~~~~De~t~GL  291 (1391)
T KOG0065|consen  234 ----------------------AMTDYLLKILGLDHCADTLVGNDMVRGVSGGERKRVSIGEMLVGPASILFWDEITRGL  291 (1391)
T ss_pred             ----------------------HHHHHHHHHhCchhhccceecccccccccCcccceeeeeeeeecCcceeeeecccccc
Confidence                                  2689999999999999999999999999999999999999999999999999999999


Q ss_pred             CHHHHHHHHHHHHHHHHhcCCeEEEEEecCchhHHhhcCeEEEecCCeEEEecChhHHHHHHHhcCCCCCCCCChhHHHH
Q 000523          355 DSSTTFQIVNCLRQNIHINSGTAVISLLQPAPETYDLFDDIILLSDGQIVYQGPRELVLEFFASMGFRCPKRKGVADFLQ  434 (1445)
Q Consensus       355 D~~t~~~i~~~L~~~~~~~~~t~vi~i~q~~~~~~~~~D~iilL~~G~iv~~G~~~~~~~~f~~lG~~cp~~~~~adfl~  434 (1445)
                      |++|+.+++++||+++|..+.|.+++++||+++++++||+|++|++|+++|+||++++++||+++||.||+++++|||++
T Consensus       292 DSsTal~iik~lr~~a~~~~~t~~vsi~Q~s~~~~~lFD~v~lL~eG~~iy~Gp~d~~~~yFe~~Gf~cP~r~~~ADfLt  371 (1391)
T KOG0065|consen  292 DSSTAFQIIKALRQLAHITGATALVSILQPSPEIYDLFDDVILLSEGYQIYQGPRDEVLPYFEDMGFKCPPRKGTADFLT  371 (1391)
T ss_pred             cHHHHHHHHHHHHHHHhhhcceEEEEeccCChHHHHhhhheeeeeccceEEeccHHHHHHHHHhcCccCCCccCHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             hhcCchhhhhhhhccCCCCccCCHHHHHHHHHhchhhhhhHHhhcCCcccccccccccccccccCcHHHHHHHHHHHHHH
Q 000523          435 EVTSRKDQRQYWAHKEKPYRFVTVQEFAEAFQSFHVGQKISDELRTPFDKSKSHRAALTTETYGVGKRELLKANISRELL  514 (1445)
Q Consensus       435 ev~s~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~R~~~  514 (1445)
                      ++++++++.|+|..++.++.+.++.|+.+.|.+++.++++..+++.+.++.+.++.++..++|.++.|+|+++|+.|+++
T Consensus       372 ~vts~k~~~~~~~~~~~~~~~~~~~ef~~~~~~s~~~~~l~~~l~~~~~~~k~~~~al~s~~y~v~~~~qvk~c~~R~f~  451 (1391)
T KOG0065|consen  372 EVTSKKDQEQYWNKRSKPYPYTSVSEFAEYFLNSEDYAKLKKELSKPYDKSKKHKAALVSSKYSVPYWEQVKACTIREFL  451 (1391)
T ss_pred             HhhcCccccccccccCCCcccCCHHHHHHHHhcchhhHHHHHHhcchhhhhhccchhhcCCceeccHHHHHHHHHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HhhcchHHHHHHHHHHHHHHHHHHHHHhcccCCCccccccchhhHHHHHHHHHHHHhHHHHHHHHhhhchhHHHhhhcCC
Q 000523          515 LMKRNSFVYIFKLIQIAFVAVVYMTLFLRTKMHKDTVTDGGIFAGATFFAITMVNFNGFSEISMTIAKLPVFYKQRDFRF  594 (1445)
Q Consensus       515 ~~~r~~~~~~~~~~~~~i~ali~gt~f~~~~~~~~~~~~~~~~~g~lff~~~~~~~~~~~~l~~~~~~~~vf~kqr~~~~  594 (1445)
                      +++||.+++++++++.+++++++|++|+++.+  ++..++..+.|++||++++.+|+++++++++++++|||+|||+..|
T Consensus       452 l~k~n~~~~~~~~~~~~i~ali~gslF~~~~~--~t~~~~~~~~~~lffsll~~~f~~laEi~~~~~~~pv~~Khr~~~f  529 (1391)
T KOG0065|consen  452 LMKRNYFYYVFKTVQLVIQALITGSLFYRTPM--STTSGGYSRGGALFFALLFNLFNGLAEIALTFQRLPVFYKHRDLSF  529 (1391)
T ss_pred             HHhCCceEEEhHHHHHHHHHHHHhhheeeccC--cccccchhhhhHHHHHHHHHHHHhHHHHHHHHhhcchHHHhhcccc
Confidence            99999999999999999999999999999885  5566788899999999999999999999999999999999999999


Q ss_pred             cCchhHHHHHHHHhccHHHHHHHHHHHHHHHhcCCCCchHHHHHHHHHHHHHHHHHHHHHHHHHHhcchhHHHHHHHHHH
Q 000523          595 FPPWAYAIPSWILKIPVSFLEVAVWVFLSYYVVGYDSNAGRFFKQYALLLGVNQMASALFRFIAVTGRNMVVANTFGSFA  674 (1445)
Q Consensus       595 y~~~ay~la~~i~~iP~~~~~~~i~~~i~Y~~~g~~~~~~rff~~~~~~~~~~~~~~~l~~~ia~~~~~~~vA~~~~~~~  674 (1445)
                      |++|++.++++++++|++++++++|.+|+||++|+.++++|||.+|+++++.+++++++|++++++++++.+|+.+|++.
T Consensus       530 Y~p~A~al~s~l~~~P~~~i~~~vf~iI~Yfl~gl~~~A~rFF~~fL~lf~~~~~~s~lFr~ia~l~~t~~~An~~g~~~  609 (1391)
T KOG0065|consen  530 YPPWAEALASTLLKIPSSFIESVVFVIITYFLIGLKRNAGRFFIQFLFLFLCQFCMSGLFRFIASLSRTLSIANLIGGIL  609 (1391)
T ss_pred             cChHHHHHHHHHHhCcHHHHHHHHHHHHHHHHhcCCcchHHHHHHHHHHHHHHHHHHHHHHHHHHhcchHHHHhhHhHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHhhcccCccchhHHHHHHHHHcHHHHHHHHHHHHHhcCCccccc------------ccC---CccccHHHHHhh
Q 000523          675 LLVLLSLGGFILSREDIKKWWKWAYWCSPLTYAQNAIVANEFLGHSWKKF------------TQD---SSETLGVQVLKS  739 (1445)
Q Consensus       675 ~l~~~l~~Gf~i~~~~ip~~~~W~~~isP~~y~~~al~~nef~~~~~~~~------------~~~---~~~~~G~~~L~~  739 (1445)
                      ++++.+++||+|+..+||+||+|++|++|++|+++++++|||++.+|.|.            ...   ...++|..+++.
T Consensus       610 ~L~i~m~~Gf~Ip~~~m~~W~~Wi~yinPl~Y~fesl~~NEF~~~~~~c~p~gp~y~n~~~~~~~c~~~~~~~G~~~v~g  689 (1391)
T KOG0065|consen  610 LLVLFMYGGFVIPKKDMPPWFRWIAYINPLMYAFESLMSNEFHGRRWPCSPSGPAYDNISIENKVCAATGATLGNDYVSG  689 (1391)
T ss_pred             HHHHHHHcceeeeccccchHHHHHHHHCHHHHHHHHHHHhhhhcccCCCCCCCCcccccccccccchhhccccCceEEec
Confidence            99999999999999999999999999999999999999999999999997            111   235678899998


Q ss_pred             cCcc-----ccchhHHHHHHHHHHHHHHHHHHHHHHHHhcCCCCCCCcceeccccccccccccCCccccccCCCCCCccc
Q 000523          740 RGFF-----AHEYWYWLGLGALFGFVLLLNFAYTLALTFLDPFEKPRAVITEEIESNEQDDRIGGNVQLSTLGGSTDDIR  814 (1445)
Q Consensus       740 ~g~~-----~~~~~~w~~~g~l~~~~~~~~~~~~l~L~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  814 (1445)
                      +++.     ...+|+|+++|+++||.++|++++++++.|+++..+.+..+..+...+........         ...  .
T Consensus       690 ~~~l~~~~~y~~~~~Wr~~gillgf~v~f~~~~~ia~~yl~p~~~~~~~l~~~~~~~~~~~~~~~---------~~~--~  758 (1391)
T KOG0065|consen  690 RDYLKVQYQYEYKWYWRNFGILLGFTVFFNFVFLIALEYLKPLKKSGAILVFKKGKEKKKVKSAG---------SSS--E  758 (1391)
T ss_pred             ccccccccccccceeEeehhHHHHHHHHHHHHHHHHHHhcCccccccceeeeccchhhhcchhcc---------ccc--c
Confidence            8887     77889999999999999999999999999999998888877655443321110000         000  0


Q ss_pred             cccccchhhhhhhhhcCCCCCCCCcccCCCceeEEecceeeeecchhhhhccccCCceEEeecceEEeeCCcEEEEEcCC
Q 000523          815 GQQSSSQSLSLAEAEASRPKKKGMVLPFEPHSLTFDEVVYSVDMPEEMKVQGVLEDKLVLLNGVSGAFRPGVLTALMGVS  894 (1445)
Q Consensus       815 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~iL~~vs~~i~~Ge~~al~G~s  894 (1445)
                              .+ ...+....++++++.|+.|..++++||.|.+++|-+++.+|   +++++|+||||.++||.++||||+|
T Consensus       759 --------~~-~~~~s~~~~~~~~~~~~~~~~~~~~~V~~w~dl~~~~~~qG---~~~qLL~~V~G~~kPG~LTALMG~S  826 (1391)
T KOG0065|consen  759 --------IE-KLDDSSHQEKNKMVLPFTPLSLTFKDVFYWVDLPYEMPIQG---GTRQLLNNVSGAFKPGVLTALMGES  826 (1391)
T ss_pred             --------cc-ccccccccccccccCCCccccccccceEEEEeCCccccccc---cceEhhhcCceEecCCceeehhcCC
Confidence                    00 00001111356788899999999999999999999888877   6788999999999999999999999


Q ss_pred             CCChHHHHHhHhCCCCCCeEEEEEEEcCccCCcccccceEEEeccCCCCCCCCCHHHHHHHHHHhcCCCCCCHHHHHHHH
Q 000523          895 GAGKTTLMDVLAGRKTGGYITGNITISGYPKKQETFARISGYCEQNDIHSPFVTIYESLLFSAWLRLSPEVDSETRKMFI  974 (1445)
Q Consensus       895 GaGKSTLl~~L~g~~~~~~~~G~i~i~g~~~~~~~~~~~~gyv~Q~d~~~~~lTv~E~l~f~~~lr~~~~~~~~~~~~~v  974 (1445)
                      |||||||||+||||+++|.++|+|.|||+|.++.+|+|.+|||+|+|+|.+.+||+|+|.|+|+||++.+++.+++.++|
T Consensus       827 GAGKTTLLdvLA~R~t~G~I~Gdi~i~G~p~~q~tF~R~~GYvqQ~DiH~~~~TVrESL~fSA~LRlp~~v~~~ek~~yV  906 (1391)
T KOG0065|consen  827 GAGKTTLLDVLAGRKTGGYIEGDILISGFPKDQETFARVSGYVEQQDIHSPELTVRESLRFSAALRLPKEVSDEEKYEYV  906 (1391)
T ss_pred             CCchHHHHHHHhcCcccceEEeEEEECCeeCchhhhccccceeecccccCcccchHHHHHHHHHHcCCCcCCHHHHHHHH
Confidence            99999999999999999999999999999999899999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHcCCcccccccccCCCCCcCCHHHHHHHHHHHHHhhCC-CEEEEeCCCCCCCHHHHHHHHHHHHHHHhCCCEEEE
Q 000523          975 DEVMELVELNPLRQSLVGLPGVSGLSTEQRKRLTIAVELVANP-SIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTVVC 1053 (1445)
Q Consensus       975 ~~~l~~l~L~~~~~~~vg~~~~~~LSgGqrqRl~iA~~L~~~p-~illLDEPTsgLD~~~~~~i~~~l~~~~~~g~tvi~ 1053 (1445)
                      |+|++.+||.+++|.+||.+| +|||++|||||+||+||++|| .||||||||||||+++|..|++++|+++++|+||||
T Consensus       907 e~Vi~lleL~~~~daiVG~~G-~GLs~eQRKrLTIgVELvA~P~~ilFLDEPTSGLDsqaA~~i~~~lrkla~tGqtIlC  985 (1391)
T KOG0065|consen  907 EEVIELLELKEYADALVGLPG-SGLSTEQRKRLTIGVELVANPSSILFLDEPTSGLDSQAAAIVMRFLRKLADTGQTILC  985 (1391)
T ss_pred             HHHHHHhCchhhhhhhccCCC-CCCCHHHhceeeEEEEEecCCceeEEecCCCCCccHHHHHHHHHHHHHHHhcCCeEEE
Confidence            999999999999999999999 999999999999999999999 899999999999999999999999999999999999


Q ss_pred             EecCccHHHHHhhceEeEEecCcEEEEEcCCCCchhhHHHHHHhCCCcccCCCCCCccceEEEeccchhhhhhcccHHHH
Q 000523         1054 TIHQPSIDIFEAFDELFLMKRGGQEIYVGPLGRHSCHLISYFEAIPGVQKIKDGYNPATWMLEVSAASQELALGIDFTEH 1133 (1445)
Q Consensus      1054 ~~Hqps~~i~~~fD~v~~l~~gG~~~y~G~~~~~~~~~~~yF~~~~g~~~~~~~~npad~~l~v~~~~~~~~~~~d~~~~ 1133 (1445)
                      |+||||.++|+.||++++|++||++||+||+|++|+++++|||++||++ |++..|||||||||++.+.+...+.||++.
T Consensus       986 TIHQPS~~ife~FD~LLLLkrGGqtVY~G~lG~~s~~li~YFes~~~~~-~~~~~NPA~~mLevi~~~~~~~~~~D~a~~ 1064 (1391)
T KOG0065|consen  986 TIHQPSIDIFEAFDELLLLKRGGQTVYFGPLGENSSKLIEYFESIGGVK-CISDENPAEWMLEVIGAGAEASLSVDFAEI 1064 (1391)
T ss_pred             EecCCcHHHHHHHhHHHHHhcCCeEEEecCcccccHHHHHHHHhcCCcc-CCCCCChHHHHHhhcccccccccCccHHHH
Confidence            9999999999999999999999999999999999999999999999985 666669999999999998888888999999


Q ss_pred             HhhcHHHHHHHHHHHhhCCCCCC-CCCCCCCCccCCcHHHHHHHHHHHHHHHhhcChhHHHHHHHHHHHHHHHHHHhhcc
Q 000523         1134 YKRSDLYRRNKALIEDLSRPPPG-SKDLYFPTQFSQSSWIQFVACLWKQHWSYWRNPPYTAVRFFFTAFIALLFGSLFWD 1212 (1445)
Q Consensus      1134 ~~~S~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~Q~~~l~~R~~~~~~R~~~~~~~r~~~~~~~~l~~G~~f~~ 1212 (1445)
                      |++|++|++++++++++++++++ +.+..++++|++|+|.|++.|+|||+++|||+|+|+++|++++++.||++|++||+
T Consensus      1065 w~~S~e~k~~~e~v~~l~~~~~~~~~~~~~~~~fa~s~~~Q~k~~l~Rq~~syWRsp~y~~ar~~~~i~~gl~iGf~F~~ 1144 (1391)
T KOG0065|consen 1065 WKNSEEYKRNKELVKELSQPPPGFSTDLEFKTRFAQSLWYQFKLCLWRQFLSYWRSPDYLMARFALTIVAGLFIGFTFWK 1144 (1391)
T ss_pred             HhccHHHHHHHHHHHHHhcCCccCCcccccccccchhHHHHHHHHHHHHHHHHhCCcHHHHHHHHHHHHHHHhheeeeee
Confidence            99999999999999999999998 88888999999999999999999999999999999999999999999999999999


Q ss_pred             CCCCCCCHhhHHHHHhHHHHHHHHHHHHhhhhcchhhhhhhhHHHhhhcCCCCChHHHHHHHHHHHHHHHHHHHhhhhhh
Q 000523         1213 LGGRTKRNQDLFNAMGSMFTAVLFLGVQYCSSVQPIVSVERTVFYREKAAGMYAGIPWALAQVMIEIPYILVQSVVYGAI 1292 (1445)
Q Consensus      1213 ~~~~~~~~~~~~~~~g~lf~~~~~~~~~~~~~~~~~~~~er~v~~rE~~~g~Y~~~~y~~a~~l~eiP~~~~~~~~~~~i 1292 (1445)
                      +|+   ++||++|.+|++|+++++.+.+++..++|.+..||.++|||+++||||+.||++||+++|+||.++++++|++|
T Consensus      1145 ~g~---~~q~lqn~m~a~yma~v~~~~~~~~~~~~~v~~e~~y~~RE~~s~mYs~~~~~~aq~~vEiP~~l~~stl~~~~ 1221 (1391)
T KOG0065|consen 1145 VGH---NVQGLQNAMGAAYMATVFSGPNNNQLQQPAVATERLYEYRERASNMYSWTPFALAQVLVEIPYNLLQSTLFFLI 1221 (1391)
T ss_pred             cCC---cHHHHHHHHHHHHHHHHHhhhhhhhhhhhHHhhhhhheeeecccCcccHHHHHHHHHHHHHHHHHHHHHHhhee
Confidence            994   68999999999999999999999988999999999999999999999999999999999999999999999999


Q ss_pred             eecccCcccchhHHHHHHHHHHHHHHHHHHHHHHHHHhcCCHHHHHHHHHHHHHHHHHhcccccCCCCccchhhhhhccc
Q 000523         1293 VYAMIGFEWTAAKFFWYIFFMYFTLLFFTFYGMMAVALTPNHHIAAIVSTLFYGLWNVFSGFIIPRPRIPIWWRWYYWAN 1372 (1445)
Q Consensus      1293 ~Y~~~g~~~~~~~f~~f~~~~~~~~~~~~~~g~~~~~~~p~~~~A~~~~~~~~~~~~lf~Gf~i~~~~ip~~~~W~~~~s 1372 (1445)
                      +|+|+||++++.+|+||++++++..+|++++|||+.+++||.++|+++++++++++++||||++|++.||.||+|+||+|
T Consensus      1222 ~Y~~iGF~~~a~~~~~f~~~~~~f~lYf~~~Gmm~~s~tPn~~~Aav~~s~~~s~~~~F~G~l~p~~~iP~fW~wmy~ls 1301 (1391)
T KOG0065|consen 1222 TYYPIGFYWTASKFFWFLLFMFIFFLYFTTLGMMLVSLTPNLQTAAVIASLFFSFWNLFSGFLQPRSLIPKFWIWMYYLS 1301 (1391)
T ss_pred             eeeeccchhhHHHHHHHHHHHHHHHHHHHHHHHHHHHhCCChhHHHHHHHHHHHHHHHhcccccccccccceeeeeeecC
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHHHhCCCccccc---------CCCCcHHHHHHhhcC----CccCchhHHHHHHHHHHHHHHHHHHHHHHh
Q 000523         1373 PIAWTLYGLVASQFGDMDDKKM---------DTGETVKQFLKDYFD----FKHDFLGVVAAVLVVFAVLFGFLFALGIKM 1439 (1445)
Q Consensus      1373 p~~y~~~~l~~~~~~~~~~~~~---------~~g~~~~~~~~~~~g----~~~~~~~~~~~il~~~~~~f~~~~~~~l~~ 1439 (1445)
                      |++|.++|++..++||.+..|.         ++|+|+++|++++||    |.++.......+..+|.+++.+++.+++|+
T Consensus      1302 P~ty~l~gli~~~~~d~~v~c~~~e~~~~~pp~g~tcge~m~~~~~~~~Gy~~n~~a~~~c~~c~y~v~~~~l~~f~~~y 1381 (1391)
T KOG0065|consen 1302 PVTYTLEGLISSQLGDVEVTCEDSEMNYFDPPSGQTCGEFMEDFFGEGTGYLHNPLATTACVYCAYTVADAFLAAFNIKY 1381 (1391)
T ss_pred             cHHHHHHHHHHHHhCCCceeeecCCccccCCCCCcCHHHHHHHHhccCcceeccCcceeEEEEeeeehHHHHHHHHHHHH
Confidence            9999999999999999988773         246799999999999    999999888888999999999999999999


Q ss_pred             hcccCC
Q 000523         1440 FNFQRR 1445 (1445)
Q Consensus      1440 ~~~~~r 1445 (1445)
                      .|||||
T Consensus      1382 ~~~wrn 1387 (1391)
T KOG0065|consen 1382 LNFWRN 1387 (1391)
T ss_pred             HHHHHh
Confidence            999987



>PLN03140 ABC transporter G family member; Provisional Back     alignment and domain information
>TIGR00956 3a01205 Pleiotropic Drug Resistance (PDR) Family protein Back     alignment and domain information
>TIGR00955 3a01204 The Eye Pigment Precursor Transporter (EPP) Family protein Back     alignment and domain information
>KOG0061 consensus Transporter, ABC superfamily (Breast cancer resistance protein) [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PLN03211 ABC transporter G-25; Provisional Back     alignment and domain information
>TIGR00956 3a01205 Pleiotropic Drug Resistance (PDR) Family protein Back     alignment and domain information
>PLN03140 ABC transporter G family member; Provisional Back     alignment and domain information
>KOG0065 consensus Pleiotropic drug resistance proteins (PDR1-15), ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>KOG0061 consensus Transporter, ABC superfamily (Breast cancer resistance protein) [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PLN03211 ABC transporter G-25; Provisional Back     alignment and domain information
>TIGR00955 3a01204 The Eye Pigment Precursor Transporter (EPP) Family protein Back     alignment and domain information
>KOG0055 consensus Multidrug/pheromone exporter, ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>KOG0054 consensus Multidrug resistance-associated protein/mitoxantrone resistance protein, ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>TIGR01257 rim_protein retinal-specific rim ABC transporter Back     alignment and domain information
>PLN03130 ABC transporter C family member; Provisional Back     alignment and domain information
>PLN03232 ABC transporter C family member; Provisional Back     alignment and domain information
>PTZ00265 multidrug resistance protein (mdr1); Provisional Back     alignment and domain information
>TIGR00957 MRP_assoc_pro multi drug resistance-associated protein (MRP) Back     alignment and domain information
>COG1123 ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] Back     alignment and domain information
>PRK13549 xylose transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK09700 D-allose transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10762 D-ribose transporter ATP binding protein; Provisional Back     alignment and domain information
>PRK10261 glutathione transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR01271 CFTR_protein cystic fibrosis transmembrane conductor regulator (CFTR) Back     alignment and domain information
>PRK15134 microcin C ABC transporter ATP-binding protein YejF; Provisional Back     alignment and domain information
>TIGR03269 met_CoM_red_A2 methyl coenzyme M reductase system, component A2 Back     alignment and domain information
>PRK15439 autoinducer 2 ABC transporter ATP-binding protein LsrA; Provisional Back     alignment and domain information
>PTZ00243 ABC transporter; Provisional Back     alignment and domain information
>TIGR02633 xylG D-xylose ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK11288 araG L-arabinose transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10982 galactose/methyl galaxtoside transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10938 putative molybdenum transport ATP-binding protein ModF; Provisional Back     alignment and domain information
>PRK11819 putative ABC transporter ATP-binding protein; Reviewed Back     alignment and domain information
>COG4172 ABC-type uncharacterized transport system, duplicated ATPase component [General function prediction only] Back     alignment and domain information
>PRK15064 ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR03719 ABC_ABC_ChvD ATP-binding cassette protein, ChvD family Back     alignment and domain information
>PRK10636 putative ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11147 ABC transporter ATPase component; Reviewed Back     alignment and domain information
>PRK13409 putative ATPase RIL; Provisional Back     alignment and domain information
>COG1129 MglA ABC-type sugar transport system, ATPase component [Carbohydrate transport and metabolism] Back     alignment and domain information
>PLN03073 ABC transporter F family; Provisional Back     alignment and domain information
>COG0488 Uup ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] Back     alignment and domain information
>COG3845 ABC-type uncharacterized transport systems, ATPase components [General function prediction only] Back     alignment and domain information
>COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>KOG0927 consensus Predicted transporter (ABC superfamily) [General function prediction only] Back     alignment and domain information
>COG1135 AbcC ABC-type metal ion transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG1131 CcmA ABC-type multidrug transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>COG1125 OpuBA ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>KOG0058 consensus Peptide exporter, ABC superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG1120 FepC ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>COG1135 AbcC ABC-type metal ion transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG1121 ZnuC ABC-type Mn/Zn transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG1127 Ttg2A ABC-type transport system involved in resistance to organic solvents, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>TIGR01257 rim_protein retinal-specific rim ABC transporter Back     alignment and domain information
>COG3839 MalK ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG1120 FepC ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>COG3842 PotA ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>COG1116 TauB ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG1116 TauB ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG1127 Ttg2A ABC-type transport system involved in resistance to organic solvents, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>COG1125 OpuBA ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>COG1136 SalX ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>COG3638 ABC-type phosphate/phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG1118 CysA ABC-type sulfate/molybdate transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG1131 CcmA ABC-type multidrug transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>COG1121 ZnuC ABC-type Mn/Zn transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG2274 SunT ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain [Defense mechanisms] Back     alignment and domain information
>COG1118 CysA ABC-type sulfate/molybdate transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG4555 NatA ABC-type Na+ transport system, ATPase component [Energy production and conversion / Inorganic ion transport and metabolism] Back     alignment and domain information
>COG1117 PstB ABC-type phosphate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG3638 ABC-type phosphate/phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG4555 NatA ABC-type Na+ transport system, ATPase component [Energy production and conversion / Inorganic ion transport and metabolism] Back     alignment and domain information
>COG2884 FtsE Predicted ATPase involved in cell division [Cell division and chromosome partitioning] Back     alignment and domain information
>KOG0057 consensus Mitochondrial Fe/S cluster exporter, ABC superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG3839 MalK ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK13537 nodulation ABC transporter NodI; Provisional Back     alignment and domain information
>COG1117 PstB ABC-type phosphate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG0056 consensus Heavy metal exporter HMT1, ABC superfamily [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR02314 ABC_MetN D-methionine ABC transporter, ATP-binding protein Back     alignment and domain information
>COG1136 SalX ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>KOG0055 consensus Multidrug/pheromone exporter, ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>TIGR03265 PhnT2 putative 2-aminoethylphosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK11650 ugpC glycerol-3-phosphate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11432 fbpC ferric transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG3842 PotA ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR03258 PhnT 2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT Back     alignment and domain information
>TIGR02314 ABC_MetN D-methionine ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK13537 nodulation ABC transporter NodI; Provisional Back     alignment and domain information
>cd03261 ABC_Org_Solvent_Resistant ABC (ATP-binding cassette) transport system involved in resistant to organic solvents; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>COG1124 DppF ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK09452 potA putrescine/spermidine ABC transporter ATPase protein; Reviewed Back     alignment and domain information
>TIGR03265 PhnT2 putative 2-aminoethylphosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK11650 ugpC glycerol-3-phosphate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG1132 MdlB ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms] Back     alignment and domain information
>cd03261 ABC_Org_Solvent_Resistant ABC (ATP-binding cassette) transport system involved in resistant to organic solvents; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>COG1122 CbiO ABC-type cobalt transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK11432 fbpC ferric transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11174 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed Back     alignment and domain information
>PRK13536 nodulation factor exporter subunit NodI; Provisional Back     alignment and domain information
>TIGR01186 proV glycine betaine/L-proline transport ATP binding subunit Back     alignment and domain information
>PRK10851 sulfate/thiosulfate transporter subunit; Provisional Back     alignment and domain information
>TIGR03258 PhnT 2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT Back     alignment and domain information
>COG2884 FtsE Predicted ATPase involved in cell division [Cell division and chromosome partitioning] Back     alignment and domain information
>cd03259 ABC_Carb_Solutes_like ABC Carbohydrate and Solute Transporters-like subgroup Back     alignment and domain information
>COG3840 ThiQ ABC-type thiamine transport system, ATPase component [Coenzyme metabolism] Back     alignment and domain information
>PRK11607 potG putrescine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG0410 LivF ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>COG1122 CbiO ABC-type cobalt transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR01188 drrA daunorubicin resistance ABC transporter ATP-binding subunit Back     alignment and domain information
>COG3840 ThiQ ABC-type thiamine transport system, ATPase component [Coenzyme metabolism] Back     alignment and domain information
>PRK11000 maltose/maltodextrin transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10851 sulfate/thiosulfate transporter subunit; Provisional Back     alignment and domain information
>COG2274 SunT ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain [Defense mechanisms] Back     alignment and domain information
>cd03269 ABC_putative_ATPase This subfamily is involved in drug resistance, nodulation, lipid transport, and bacteriocin and lantibiotic immunity Back     alignment and domain information
>PRK11153 metN DL-methionine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR00960 3a0501s02 Type II (General) Secretory Pathway (IISP) Family protein Back     alignment and domain information
>cd03293 ABC_NrtD_SsuB_transporters NrtD and SsuB are the ATP-binding subunits of the bacterial ABC-type nitrate and sulfonate transport systems, respectively Back     alignment and domain information
>TIGR01288 nodI ATP-binding ABC transporter family nodulation protein NodI Back     alignment and domain information
>cd03265 ABC_DrrA DrrA is the ATP-binding protein component of a bacterial exporter complex that confers resistance to the antibiotics daunorubicin and doxorubicin Back     alignment and domain information
>PRK13536 nodulation factor exporter subunit NodI; Provisional Back     alignment and domain information
>PRK09452 potA putrescine/spermidine ABC transporter ATPase protein; Reviewed Back     alignment and domain information
>cd03301 ABC_MalK_N The N-terminal ATPase domain of the maltose transporter, MalK Back     alignment and domain information
>COG1137 YhbG ABC-type (unclassified) transport system, ATPase component [General function prediction only] Back     alignment and domain information
>COG0411 LivG ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>cd03219 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC transporter subfamily is involved in the transport of the hydrophobic amino acids leucine, isoleucine and valine Back     alignment and domain information
>COG1124 DppF ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK13637 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03259 ABC_Carb_Solutes_like ABC Carbohydrate and Solute Transporters-like subgroup Back     alignment and domain information
>PRK11153 metN DL-methionine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG4559 ABC-type hemin transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd03218 ABC_YhbG The ABC transporters belonging to the YhbG family are similar to members of the Mj1267_LivG family, which is involved in the transport of branched-chain amino acids Back     alignment and domain information
>cd03296 ABC_CysA_sulfate_importer Part of the ABC transporter complex cysAWTP involved in sulfate import Back     alignment and domain information
>cd03266 ABC_NatA_sodium_exporter NatA is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled proton or K+ uptake Back     alignment and domain information
>PRK11607 potG putrescine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11000 maltose/maltodextrin transporter ATP-binding protein; Provisional Back     alignment and domain information
>KOG0062 consensus ATPase component of ABC transporters with duplicated ATPase domains/Translation elongation factor EF-3b [Amino acid transport and metabolism; Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd03265 ABC_DrrA DrrA is the ATP-binding protein component of a bacterial exporter complex that confers resistance to the antibiotics daunorubicin and doxorubicin Back     alignment and domain information
>TIGR01188 drrA daunorubicin resistance ABC transporter ATP-binding subunit Back     alignment and domain information
>PRK09536 btuD corrinoid ABC transporter ATPase; Reviewed Back     alignment and domain information
>TIGR01186 proV glycine betaine/L-proline transport ATP binding subunit Back     alignment and domain information
>COG4988 CydD ABC-type transport system involved in cytochrome bd biosynthesis, ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG4987 CydC ABC-type transport system involved in cytochrome bd biosynthesis, fused ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd03296 ABC_CysA_sulfate_importer Part of the ABC transporter complex cysAWTP involved in sulfate import Back     alignment and domain information
>TIGR03522 GldA_ABC_ATP gliding motility-associated ABC transporter ATP-binding subunit GldA Back     alignment and domain information
>cd03268 ABC_BcrA_bacitracin_resist The BcrA subfamily represents ABC transporters involved in peptide antibiotic resistance Back     alignment and domain information
>cd03260 ABC_PstB_phosphate_transporter Phosphate uptake is of fundamental importance in the cell physiology of bacteria because phosphate is required as a nutrient Back     alignment and domain information
>cd03234 ABCG_White The White subfamily represents ABC transporters homologous to the Drosophila white gene, which acts as a dimeric importer for eye pigment precursors Back     alignment and domain information
>TIGR01288 nodI ATP-binding ABC transporter family nodulation protein NodI Back     alignment and domain information
>TIGR03797 NHPM_micro_ABC2 NHPM bacteriocin system ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK13634 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03258 ABC_MetN_methionine_transporter MetN (also known as YusC) is an ABC-type transporter encoded by metN of the metNPQ operon in Bacillus subtilis that is involved in methionine transport Back     alignment and domain information
>cd03219 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC transporter subfamily is involved in the transport of the hydrophobic amino acids leucine, isoleucine and valine Back     alignment and domain information
>cd03258 ABC_MetN_methionine_transporter MetN (also known as YusC) is an ABC-type transporter encoded by metN of the metNPQ operon in Bacillus subtilis that is involved in methionine transport Back     alignment and domain information
>cd03255 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of liporoteins from the cytoplasmic membrane (LolCDE) Back     alignment and domain information
>cd03256 ABC_PhnC_transporter ABC-type phosphate/phosphonate transport system Back     alignment and domain information
>PRK13643 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK09493 glnQ glutamine ABC transporter ATP-binding protein; Reviewed Back     alignment and domain information
>cd03301 ABC_MalK_N The N-terminal ATPase domain of the maltose transporter, MalK Back     alignment and domain information
>cd03226 ABC_cobalt_CbiO_domain2 Domain II of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota Back     alignment and domain information
>PRK11629 lolD lipoprotein transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11264 putative amino-acid ABC transporter ATP-binding protein YecC; Provisional Back     alignment and domain information
>TIGR00960 3a0501s02 Type II (General) Secretory Pathway (IISP) Family protein Back     alignment and domain information
>cd03263 ABC_subfamily_A The ABCA subfamily mediates the transport of a variety of lipid compounds Back     alignment and domain information
>TIGR02673 FtsE cell division ATP-binding protein FtsE Back     alignment and domain information
>cd03218 ABC_YhbG The ABC transporters belonging to the YhbG family are similar to members of the Mj1267_LivG family, which is involved in the transport of branched-chain amino acids Back     alignment and domain information
>PRK13637 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03293 ABC_NrtD_SsuB_transporters NrtD and SsuB are the ATP-binding subunits of the bacterial ABC-type nitrate and sulfonate transport systems, respectively Back     alignment and domain information
>TIGR03522 GldA_ABC_ATP gliding motility-associated ABC transporter ATP-binding subunit GldA Back     alignment and domain information
>cd03295 ABC_OpuCA_Osmoprotection OpuCA is a the ATP binding component of a bacterial solute transporter that serves a protective role to cells growing in a hyperosmolar environment Back     alignment and domain information
>TIGR03375 type_I_sec_LssB type I secretion system ATPase, LssB family Back     alignment and domain information
>cd03292 ABC_FtsE_transporter FtsE is a hydrophilic nucleotide-binding protein that binds FtsX to form a heterodimeric ATP-binding cassette (ABC)-type transporter that associates with the bacterial inner membrane Back     alignment and domain information
>cd03224 ABC_TM1139_LivF_branched LivF (TM1139) is part of the LIV-I bacterial ABC-type two-component transport system that imports neutral, branched-chain amino acids Back     alignment and domain information
>PRK13650 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG0410 LivF ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>COG1137 YhbG ABC-type (unclassified) transport system, ATPase component [General function prediction only] Back     alignment and domain information
>cd03294 ABC_Pro_Gly_Bertaine This family comprises the glycine betaine/L-proline ATP binding subunit in bacteria and its equivalents in archaea Back     alignment and domain information
>PRK11831 putative ABC transporter ATP-binding protein YrbF; Provisional Back     alignment and domain information
>TIGR02315 ABC_phnC phosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK13647 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11248 tauB taurine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03263 ABC_subfamily_A The ABCA subfamily mediates the transport of a variety of lipid compounds Back     alignment and domain information
>cd03224 ABC_TM1139_LivF_branched LivF (TM1139) is part of the LIV-I bacterial ABC-type two-component transport system that imports neutral, branched-chain amino acids Back     alignment and domain information
>cd03256 ABC_PhnC_transporter ABC-type phosphate/phosphonate transport system Back     alignment and domain information
>PRK11831 putative ABC transporter ATP-binding protein YrbF; Provisional Back     alignment and domain information
>PRK11176 lipid transporter ATP-binding/permease protein; Provisional Back     alignment and domain information
>PRK13647 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03269 ABC_putative_ATPase This subfamily is involved in drug resistance, nodulation, lipid transport, and bacteriocin and lantibiotic immunity Back     alignment and domain information
>cd03294 ABC_Pro_Gly_Bertaine This family comprises the glycine betaine/L-proline ATP binding subunit in bacteria and its equivalents in archaea Back     alignment and domain information
>PRK13634 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03295 ABC_OpuCA_Osmoprotection OpuCA is a the ATP binding component of a bacterial solute transporter that serves a protective role to cells growing in a hyperosmolar environment Back     alignment and domain information
>cd03264 ABC_drug_resistance_like ABC-type multidrug transport system, ATPase component Back     alignment and domain information
>cd03260 ABC_PstB_phosphate_transporter Phosphate uptake is of fundamental importance in the cell physiology of bacteria because phosphate is required as a nutrient Back     alignment and domain information
>TIGR03796 NHPM_micro_ABC1 NHPM bacteriocin system ABC transporter, peptidase/ATP-binding protein Back     alignment and domain information
>PRK13631 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK09536 btuD corrinoid ABC transporter ATPase; Reviewed Back     alignment and domain information
>PRK13651 cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03255 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of liporoteins from the cytoplasmic membrane (LolCDE) Back     alignment and domain information
>PRK11629 lolD lipoprotein transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK10790 putative multidrug transporter membrane\ATP-binding components; Provisional Back     alignment and domain information
>COG0411 LivG ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>PRK10619 histidine/lysine/arginine/ornithine transporter subunit; Provisional Back     alignment and domain information
>PRK10908 cell division protein FtsE; Provisional Back     alignment and domain information
>PRK11160 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed Back     alignment and domain information
>TIGR01193 bacteriocin_ABC ABC-type bacteriocin transporter Back     alignment and domain information
>PRK10895 lipopolysaccharide ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG4618 ArpD ABC-type protease/lipase transport system, ATPase and permease components [General function prediction only] Back     alignment and domain information
>PRK13646 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13643 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03257 ABC_NikE_OppD_transporters The ABC transporter subfamily specific for the transport of dipeptides, oligopeptides (OppD), and nickel (NikDE) Back     alignment and domain information
>TIGR03864 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system Back     alignment and domain information
>PRK13651 cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG4152 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>cd03262 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP-binding components of the bacterial periplasmic histidine and glutamine permeases, repectively Back     alignment and domain information
>TIGR02315 ABC_phnC phosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK15079 oligopeptide ABC transporter ATP-binding protein OppF; Provisional Back     alignment and domain information
>cd03235 ABC_Metallic_Cations ABC component of the metal-type transporters Back     alignment and domain information
>TIGR00972 3a0107s01c2 phosphate ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK13631 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13636 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR03740 galliderm_ABC gallidermin-class lantibiotic protection ABC transporter, ATP-binding subunit Back     alignment and domain information
>PTZ00265 multidrug resistance protein (mdr1); Provisional Back     alignment and domain information
>TIGR00958 3a01208 Conjugate Transporter-2 (CT2) Family protein Back     alignment and domain information
>TIGR03864 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system Back     alignment and domain information
>cd03268 ABC_BcrA_bacitracin_resist The BcrA subfamily represents ABC transporters involved in peptide antibiotic resistance Back     alignment and domain information
>cd03266 ABC_NatA_sodium_exporter NatA is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled proton or K+ uptake Back     alignment and domain information
>PRK13646 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG4559 ABC-type hemin transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK11247 ssuB aliphatic sulfonates transport ATP-binding subunit; Provisional Back     alignment and domain information
>KOG0058 consensus Peptide exporter, ABC superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK13635 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR02211 LolD_lipo_ex lipoprotein releasing system, ATP-binding protein Back     alignment and domain information
>PRK09493 glnQ glutamine ABC transporter ATP-binding protein; Reviewed Back     alignment and domain information
>cd03225 ABC_cobalt_CbiO_domain1 Domain I of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota Back     alignment and domain information
>cd03233 ABC_PDR_domain1 The pleiotropic drug resistance (PDR) family of ATP-binding cassette (ABC) transporters Back     alignment and domain information
>PRK11264 putative amino-acid ABC transporter ATP-binding protein YecC; Provisional Back     alignment and domain information
>PRK11614 livF leucine/isoleucine/valine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13650 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR03005 ectoine_ehuA ectoine/hydroxyectoine ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK14247 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03226 ABC_cobalt_CbiO_domain2 Domain II of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota Back     alignment and domain information
>PRK10070 glycine betaine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK09473 oppD oligopeptide transporter ATP-binding component; Provisional Back     alignment and domain information
>PRK15079 oligopeptide ABC transporter ATP-binding protein OppF; Provisional Back     alignment and domain information
>cd03234 ABCG_White The White subfamily represents ABC transporters homologous to the Drosophila white gene, which acts as a dimeric importer for eye pigment precursors Back     alignment and domain information
>cd03264 ABC_drug_resistance_like ABC-type multidrug transport system, ATPase component Back     alignment and domain information
>PRK11300 livG leucine/isoleucine/valine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14267 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11124 artP arginine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13636 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13641 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13644 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR01978 sufC FeS assembly ATPase SufC Back     alignment and domain information
>PRK14273 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13652 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14268 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11248 tauB taurine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03257 ABC_NikE_OppD_transporters The ABC transporter subfamily specific for the transport of dipeptides, oligopeptides (OppD), and nickel (NikDE) Back     alignment and domain information
>TIGR03415 ABC_choXWV_ATP choline ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK13548 hmuV hemin importer ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR03411 urea_trans_UrtD urea ABC transporter, ATP-binding protein UrtD Back     alignment and domain information
>cd03298 ABC_ThiQ_thiamine_transporter ABC-type thiamine tranport system; part of the binding-protein-dependent transport system tbpA-thiPQ for thiamine and TPP Back     alignment and domain information
>PRK10895 lipopolysaccharide ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11308 dppF dipeptide transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11247 ssuB aliphatic sulfonates transport ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR02211 LolD_lipo_ex lipoprotein releasing system, ATP-binding protein Back     alignment and domain information
>TIGR03410 urea_trans_UrtE urea ABC transporter, ATP-binding protein UrtE Back     alignment and domain information
>PRK11231 fecE iron-dicitrate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13641 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14241 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14245 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13632 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG4175 ProV ABC-type proline/glycine betaine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>PRK13635 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13633 cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03292 ABC_FtsE_transporter FtsE is a hydrophilic nucleotide-binding protein that binds FtsX to form a heterodimeric ATP-binding cassette (ABC)-type transporter that associates with the bacterial inner membrane Back     alignment and domain information
>cd03233 ABC_PDR_domain1 The pleiotropic drug resistance (PDR) family of ATP-binding cassette (ABC) transporters Back     alignment and domain information
>PRK10253 iron-enterobactin transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR03005 ectoine_ehuA ectoine/hydroxyectoine ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK10744 pstB phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10070 glycine betaine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG4525 TauB ABC-type taurine transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK13638 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03232 ABC_PDR_domain2 The pleiotropic drug resistance-like (PDR) family of ATP-binding cassette (ABC) transporters Back     alignment and domain information
>PRK14242 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11614 livF leucine/isoleucine/valine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR02673 FtsE cell division ATP-binding protein FtsE Back     alignment and domain information
>PRK11022 dppD dipeptide transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR00972 3a0107s01c2 phosphate ABC transporter, ATP-binding protein Back     alignment and domain information
>TIGR02769 nickel_nikE nickel import ATP-binding protein NikE Back     alignment and domain information
>PRK10575 iron-hydroxamate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03267 ABC_NatA_like Similar in sequence to NatA, this is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled to proton or K+ uptake Back     alignment and domain information
>PRK13652 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13548 hmuV hemin importer ATP-binding subunit; Provisional Back     alignment and domain information
>PRK09984 phosphonate/organophosphate ester transporter subunit; Provisional Back     alignment and domain information
>PRK13644 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG5265 ATM1 ABC-type transport system involved in Fe-S cluster assembly, permease and ATPase components [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK13649 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG0444 DppD ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR01184 ntrCD nitrate transport ATP-binding subunits C and D Back     alignment and domain information
>PRK10584 putative ABC transporter ATP-binding protein YbbA; Provisional Back     alignment and domain information
>TIGR03410 urea_trans_UrtE urea ABC transporter, ATP-binding protein UrtE Back     alignment and domain information
>cd03300 ABC_PotA_N PotA is an ABC-type transporter and the ATPase component of the spermidine/putrescine-preferential uptake system consisting of PotA, -B, -C, and -D Back     alignment and domain information
>TIGR03873 F420-0_ABC_ATP proposed F420-0 ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK13648 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13639 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14235 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR03411 urea_trans_UrtD urea ABC transporter, ATP-binding protein UrtD Back     alignment and domain information
>PRK14273 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11300 livG leucine/isoleucine/valine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG4988 CydD ABC-type transport system involved in cytochrome bd biosynthesis, ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14237 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13649 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14250 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR01842 type_I_sec_PrtD type I secretion system ABC transporter, PrtD family Back     alignment and domain information
>PRK14256 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10619 histidine/lysine/arginine/ornithine transporter subunit; Provisional Back     alignment and domain information
>PRK10908 cell division protein FtsE; Provisional Back     alignment and domain information
>TIGR02769 nickel_nikE nickel import ATP-binding protein NikE Back     alignment and domain information
>TIGR03415 ABC_choXWV_ATP choline ABC transporter, ATP-binding protein Back     alignment and domain information
>TIGR01277 thiQ thiamine ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK14269 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14268 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR00968 3a0106s01 sulfate ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK10584 putative ABC transporter ATP-binding protein YbbA; Provisional Back     alignment and domain information
>cd03300 ABC_PotA_N PotA is an ABC-type transporter and the ATPase component of the spermidine/putrescine-preferential uptake system consisting of PotA, -B, -C, and -D Back     alignment and domain information
>PRK13638 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR03797 NHPM_micro_ABC2 NHPM bacteriocin system ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK14247 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13640 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11022 dppD dipeptide transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11124 artP arginine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14257 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13632 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13639 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14242 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11308 dppF dipeptide transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03267 ABC_NatA_like Similar in sequence to NatA, this is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled to proton or K+ uptake Back     alignment and domain information
>TIGR01846 type_I_sec_HlyB type I secretion system ABC transporter, HlyB family Back     alignment and domain information
>TIGR01978 sufC FeS assembly ATPase SufC Back     alignment and domain information
>KOG0057 consensus Mitochondrial Fe/S cluster exporter, ABC superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK13549 xylose transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK09473 oppD oligopeptide transporter ATP-binding component; Provisional Back     alignment and domain information
>PRK13547 hmuV hemin importer ATP-binding subunit; Provisional Back     alignment and domain information
>KOG0066 consensus eIF2-interacting protein ABC50 (ABC superfamily) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK13645 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13648 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG4181 Predicted ABC-type transport system involved in lysophospholipase L1 biosynthesis, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PRK13633 cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14250 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR03608 L_ocin_972_ABC putative bacteriocin export ABC transporter, lactococcin 972 group Back     alignment and domain information
>PRK13645 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13657 cyclic beta-1,2-glucan ABC transporter; Provisional Back     alignment and domain information
>cd03298 ABC_ThiQ_thiamine_transporter ABC-type thiamine tranport system; part of the binding-protein-dependent transport system tbpA-thiPQ for thiamine and TPP Back     alignment and domain information
>TIGR03740 galliderm_ABC gallidermin-class lantibiotic protection ABC transporter, ATP-binding subunit Back     alignment and domain information
>PRK10575 iron-hydroxamate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK10789 putative multidrug transporter membrane\ATP-binding components; Provisional Back     alignment and domain information
>PRK14259 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14267 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10253 iron-enterobactin transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10771 thiQ thiamine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13640 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK10771 thiQ thiamine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14239 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03299 ABC_ModC_like Archeal protein closely related to ModC Back     alignment and domain information
>TIGR00968 3a0106s01 sulfate ABC transporter, ATP-binding protein Back     alignment and domain information
>cd03299 ABC_ModC_like Archeal protein closely related to ModC Back     alignment and domain information
>cd03225 ABC_cobalt_CbiO_domain1 Domain I of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota Back     alignment and domain information
>PRK14270 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK15093 antimicrobial peptide ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14274 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14244 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG1245 Predicted ATPase, RNase L inhibitor (RLI) homolog [General function prediction only] Back     alignment and domain information
>TIGR02203 MsbA_lipidA lipid A export permease/ATP-binding protein MsbA Back     alignment and domain information
>PLN03130 ABC transporter C family member; Provisional Back     alignment and domain information
>PRK15093 antimicrobial peptide ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03213 ABCG_EPDR ABCG transporters are involved in eye pigment (EP) precursor transport, regulation of lipid-trafficking mechanisms, and pleiotropic drug resistance (DR) Back     alignment and domain information
>PRK14240 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14262 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11231 fecE iron-dicitrate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK15112 antimicrobial peptide ABC system ATP-binding protein SapF; Provisional Back     alignment and domain information
>TIGR03873 F420-0_ABC_ATP proposed F420-0 ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK09984 phosphonate/organophosphate ester transporter subunit; Provisional Back     alignment and domain information
>PRK15112 antimicrobial peptide ABC system ATP-binding protein SapF; Provisional Back     alignment and domain information
>PRK10744 pstB phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14253 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11144 modC molybdate transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR01277 thiQ thiamine ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK13642 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11144 modC molybdate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14257 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR02142 modC_ABC molybdenum ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK14235 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03297 ABC_ModC_molybdenum_transporter ModC is an ABC-type transporter and the ATPase component of a molybdate transport system that also includes the periplasmic binding protein ModA and the membrane protein ModB Back     alignment and domain information
>TIGR03796 NHPM_micro_ABC1 NHPM bacteriocin system ABC transporter, peptidase/ATP-binding protein Back     alignment and domain information
>COG4525 TauB ABC-type taurine transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR01192 chvA glucan exporter ATP-binding protein Back     alignment and domain information
>TIGR02142 modC_ABC molybdenum ABC transporter, ATP-binding protein Back     alignment and domain information
>cd03262 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP-binding components of the bacterial periplasmic histidine and glutamine permeases, repectively Back     alignment and domain information
>PRK14260 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR02770 nickel_nikD nickel import ATP-binding protein NikD Back     alignment and domain information
>PRK14258 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14237 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14236 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR01184 ntrCD nitrate transport ATP-binding subunits C and D Back     alignment and domain information
>TIGR02770 nickel_nikD nickel import ATP-binding protein NikD Back     alignment and domain information
>PRK14272 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14241 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14245 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PLN03232 ABC transporter C family member; Provisional Back     alignment and domain information
>TIGR01193 bacteriocin_ABC ABC-type bacteriocin transporter Back     alignment and domain information
>PRK10762 D-ribose transporter ATP binding protein; Provisional Back     alignment and domain information
>PRK14270 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10418 nikD nickel transporter ATP-binding protein NikD; Provisional Back     alignment and domain information
>TIGR02982 heterocyst_DevA ABC exporter ATP-binding subunit, DevA family Back     alignment and domain information
>PRK14269 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11701 phnK phosphonate C-P lyase system protein PhnK; Provisional Back     alignment and domain information
>PRK13642 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11701 phnK phosphonate C-P lyase system protein PhnK; Provisional Back     alignment and domain information
>PRK14256 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG0444 DppD ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK10418 nikD nickel transporter ATP-binding protein NikD; Provisional Back     alignment and domain information
>PRK14249 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14261 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14263 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK09700 D-allose transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK00349 uvrA excinuclease ABC subunit A; Reviewed Back     alignment and domain information
>PRK00635 excinuclease ABC subunit A; Provisional Back     alignment and domain information
>PRK14239 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14274 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11174 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed Back     alignment and domain information
>PRK14275 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03235 ABC_Metallic_Cations ABC component of the metal-type transporters Back     alignment and domain information
>PRK14271 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14248 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13543 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>PRK14262 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14251 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14255 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14259 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK15056 manganese/iron transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13538 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>TIGR02204 MsbA_rel ABC transporter, permease/ATP-binding protein Back     alignment and domain information
>PRK14240 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03231 ABC_CcmA_heme_exporter CcmA, the ATP-binding component of the bacterial CcmAB transporter Back     alignment and domain information
>PRK13547 hmuV hemin importer ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR02633 xylG D-xylose ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK14248 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10419 nikE nickel transporter ATP-binding protein NikE; Provisional Back     alignment and domain information
>PRK14265 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03220 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transporter subfamily is involved in extracellular polysaccharide export Back     alignment and domain information
>cd03252 ABCC_Hemolysin The ABC-transporter hemolysin B is a central component of the secretion machinery that translocates the toxin, hemolysin A, in a Sec-independent fashion across both membranes of E Back     alignment and domain information
>COG4181 Predicted ABC-type transport system involved in lysophospholipase L1 biosynthesis, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PRK14254 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK15439 autoinducer 2 ABC transporter ATP-binding protein LsrA; Provisional Back     alignment and domain information
>PRK14272 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14271 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR01846 type_I_sec_HlyB type I secretion system ABC transporter, HlyB family Back     alignment and domain information
>cd03213 ABCG_EPDR ABCG transporters are involved in eye pigment (EP) precursor transport, regulation of lipid-trafficking mechanisms, and pleiotropic drug resistance (DR) Back     alignment and domain information
>PRK14238 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03252 ABCC_Hemolysin The ABC-transporter hemolysin B is a central component of the secretion machinery that translocates the toxin, hemolysin A, in a Sec-independent fashion across both membranes of E Back     alignment and domain information
>PRK14236 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR02868 CydC thiol reductant ABC exporter, CydC subunit Back     alignment and domain information
>TIGR00957 MRP_assoc_pro multi drug resistance-associated protein (MRP) Back     alignment and domain information
>PRK11288 araG L-arabinose transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14249 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14251 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14253 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14275 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>CHL00131 ycf16 sulfate ABC transporter protein; Validated Back     alignment and domain information
>PRK14244 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14243 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14261 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR02323 CP_lyasePhnK phosphonate C-P lyase system protein PhnK Back     alignment and domain information
>cd03289 ABCC_CFTR2 The CFTR subfamily domain 2 Back     alignment and domain information
>cd03289 ABCC_CFTR2 The CFTR subfamily domain 2 Back     alignment and domain information
>PRK14258 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03297 ABC_ModC_molybdenum_transporter ModC is an ABC-type transporter and the ATPase component of a molybdate transport system that also includes the periplasmic binding protein ModA and the membrane protein ModB Back     alignment and domain information
>PRK10247 putative ABC transporter ATP-binding protein YbbL; Provisional Back     alignment and domain information
>PRK10982 galactose/methyl galaxtoside transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03230 ABC_DR_subfamily_A This family of ATP-binding proteins belongs to a multisubunit transporter involved in drug resistance (BcrA and DrrA), nodulation, lipid transport, and lantibiotic immunity Back     alignment and domain information
>COG1132 MdlB ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms] Back     alignment and domain information
>TIGR01166 cbiO cobalt transport protein ATP-binding subunit Back     alignment and domain information
>PRK03695 vitamin B12-transporter ATPase; Provisional Back     alignment and domain information
>TIGR02323 CP_lyasePhnK phosphonate C-P lyase system protein PhnK Back     alignment and domain information
>PRK14266 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10419 nikE nickel transporter ATP-binding protein NikE; Provisional Back     alignment and domain information
>PRK11176 lipid transporter ATP-binding/permease protein; Provisional Back     alignment and domain information
>PRK14260 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG4987 CydC ABC-type transport system involved in cytochrome bd biosynthesis, fused ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14246 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14255 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10790 putative multidrug transporter membrane\ATP-binding components; Provisional Back     alignment and domain information
>PRK10247 putative ABC transporter ATP-binding protein YbbL; Provisional Back     alignment and domain information
>TIGR02982 heterocyst_DevA ABC exporter ATP-binding subunit, DevA family Back     alignment and domain information
>PRK14265 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13539 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>PRK14238 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03245 ABCC_bacteriocin_exporters ABC-type bacteriocin exporters Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1445
1oxx_K353 Crystal Structure Of Glcv, The Abc-Atpase Of The Gl 9e-11
1oxs_C353 Crystal Structure Of Glcv, The Abc-Atpase Of The Gl 1e-10
2pmk_A243 Crystal Structures Of An Isolated Abc-Atpase In Com 3e-10
2it1_A362 Structure Of Ph0203 Protein From Pyrococcus Horikos 4e-10
1mt0_A241 Atp-Binding Domain Of Haemolysin B From Escherichia 4e-10
2ff7_A247 The Abc-Atpase Of The Abc-Transporter Hlyb In The A 4e-10
4hlu_D268 Structure Of The Ecfa-a' Heterodimer Bound To Adp L 5e-10
3b5j_A243 Crystal Structures Of The S504a Mutant Of An Isolat 7e-10
3gfo_A275 Structure Of Cbio1 From Clostridium Perfringens: Pa 9e-10
1v43_A372 Crystal Structure Of Atpase Subunit Of Abc Sugar Tr 9e-10
2ffb_A247 The Crystal Structure Of The Hlyb-Nbd E631q Mutant 9e-10
1vci_A373 Crystal Structure Of The Atp-binding Cassette Of Mu 1e-09
2yyz_A359 Crystal Structure Of Sugar Abc Transporter, Atp-Bin 2e-09
1xef_A241 Crystal Structure Of The AtpMG2+ BOUND COMPOSITE DI 6e-09
2ffa_A247 Crystal Structure Of Abc-Atpase H662a Of The Abc-Tr 6e-09
1l2t_A235 Dimeric Structure Of Mj0796, A Bacterial Abc Transp 1e-08
1z47_A355 Structure Of The Atpase Subunit Cysa Of The Putativ 2e-08
3tif_A235 Dimeric Structure Of A Post-Hydrolysis State Of The 3e-08
3g5u_A 1284 Structure Of P-Glycoprotein Reveals A Molecular Bas 4e-08
3g60_A 1284 Structure Of P-Glycoprotein Reveals A Molecular Bas 4e-08
1mv5_A243 Crystal Structure Of Lmra Atp-Binding Domain Length 5e-08
3c41_J242 Abc Protein Artp In Complex With Amp-PnpMG2+ Length 1e-07
4f4c_A 1321 The Crystal Structure Of The Multi-Drug Transporter 1e-07
4ayt_A595 Structure Of The Human Mitochondrial Abc Transporte 2e-07
4ayw_A619 Structure Of The Human Mitochondrial Abc Transporte 2e-07
2olj_A263 Abc Protein Artp In Complex With AdpMG2+ Length = 2 2e-07
1q12_A381 Crystal Structure Of The Atp-bound E. Coli Malk Len 3e-07
1q1b_A381 Crystal Structure Of E. Coli Malk In The Nucleotide 3e-07
2d3w_A248 Crystal Structure Of Escherichia Coli Sufc, An Atpa 7e-07
2r6g_A381 The Crystal Structure Of The E. Coli Maltose Transp 7e-07
1g29_1372 Malk Length = 372 9e-07
2zu0_C267 Crystal Structure Of Sufc-Sufd Complex Involved In 9e-07
2ixf_A271 Crystal Structure Of The Atpase Domain Of Tap1 With 2e-06
2d62_A375 Crystal Structure Of Multiple Sugar Binding Transpo 2e-06
1f3o_A235 Crystal Structure Of Mj0796 Atp-Binding Cassette Le 2e-06
2d2e_A250 Crystal Structure Of Atypical Cytoplasmic Abc-Atpas 4e-06
4dbl_C249 Crystal Structure Of E159q Mutant Of Btucdf Length 4e-06
2hyd_A578 Multidrug Abc Transporter Sav1866 Length = 578 5e-06
4fi3_C249 Structure Of Vitamin B12 Transporter Btucd-F In A N 6e-06
3b5x_A582 Crystal Structure Of Msba From Vibrio Cholerae Leng 7e-06
1vpl_A256 Crystal Structure Of Abc Transporter Atp-binding Pr 8e-06
1l7v_C249 Bacterial Abc Transporter Involved In B12 Uptake Le 8e-06
2qi9_C249 Abc-Transporter Btucd In Complex With Its Periplasm 1e-05
2ghi_A260 Crystal Structure Of Plasmodium Yoelii Multidrug Re 1e-05
3qf4_A587 Crystal Structure Of A Heterodimeric Abc Transporte 1e-05
1gaj_A257 Crystal Structure Of A Nucleotide-Free Atp-Binding 1e-05
2nq2_C253 An Inward-Facing Conformation Of A Putative Metal-C 1e-05
1g9x_A257 Characterization Of The Twinning Structure Of Mj126 1e-05
1yqt_A538 Rnase-L Inhibitor Length = 538 1e-05
2pcj_A224 Crystal Structure Of Abc Transporter (Aq_297) From 2e-05
1g6h_A257 Crystal Structure Of The Adp Conformation Of Mj1267 2e-05
3tuj_C366 Inward Facing Conformations Of The Metni Methionine 2e-05
1jj7_A260 Crystal Structure Of The C-Terminal Atpase Domain O 3e-05
2ixe_A271 Crystal Structure Of The Atpase Domain Of Tap1 With 3e-05
1b0u_A262 Atp-Binding Subunit Of The Histidine Permease From 3e-05
2ixg_A271 Crystal Structure Of The Atpase Domain Of Tap1 With 4e-05
3ozx_A538 Crystal Structure Of Abce1 Of Sulfolubus Solfataric 5e-05
3ozx_A538 Crystal Structure Of Abce1 Of Sulfolubus Solfataric 8e-04
3fvq_A359 Crystal Structure Of The Nucleotide Binding Domain 6e-05
1ji0_A240 Crystal Structure Analysis Of The Abc Transporter F 7e-05
2yz2_A266 Crystal Structure Of The Abc Transporter In The Cob 9e-05
4hlu_A268 Structure Of The Ecfa-a' Heterodimer Bound To Adp L 1e-04
3d31_A348 Modbc From Methanosarcina Acetivorans Length = 348 1e-04
3dhw_C343 Crystal Structure Of Methionine Importer Metni Leng 2e-04
3nh6_A306 Nucleotide Binding Domain Of Human Abcb6 (Apo Struc 2e-04
3b5y_A582 Crystal Structure Of Msba From Salmonella Typhimuri 2e-04
2onk_A240 Abc Transporter Modbc In Complex With Its Binding P 2e-04
2ihy_A279 Structure Of The Staphylococcus Aureus Putative Atp 2e-04
3b5w_A582 Crystal Structure Of Eschericia Coli Msba Length = 2e-04
3tui_C366 Inward Facing Conformations Of The Metni Methionine 3e-04
3bk7_A607 Structure Of The Complete Abce1RNAASE-L Inhibitor P 3e-04
4g1u_C266 X-Ray Structure Of The Bacterial Heme Transporter H 4e-04
3j15_B593 Model Of Ribosome-Bound Archaeal Pelota And Abce1 L 5e-04
>pdb|1OXX|K Chain K, Crystal Structure Of Glcv, The Abc-Atpase Of The Glucose Abc Transporter From Sulfolobus Solfataricus Length = 353 Back     alignment and structure

Iteration: 1

Score = 66.6 bits (161), Expect = 9e-11, Method: Compositional matrix adjust. Identities = 75/273 (27%), Positives = 130/273 (47%), Gaps = 28/273 (10%) Query: 871 KLVLLNGVSGAFRPGVLTALMGVSGAGKTTLMDVLAG---RKTGG-YITGNITISGYPKK 926 K+V L+ V+ G ++G SGAGKTT M ++AG TG Y + S Sbjct: 17 KVVALDNVNINIENGERFGILGPSGAGKTTFMRIIAGLDVPSTGELYFDDRLVASNGKLI 76 Query: 927 QETFARISGYCEQNDIHSPFVTIYESLLFS-AWLRLSPEVDSETRKMFIDEVMELVELNP 985 R G Q P +T +E++ F +++S E E RK ++EV ++++++ Sbjct: 77 VPPEDRKIGMVFQTWALYPNLTAFENIAFPLTNMKMSKE---EIRKR-VEEVAKILDIH- 131 Query: 986 LRQSLVGLPGVSGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDAR---AAAIVMRTVR 1042 L P LS Q++R+ +A LV +PS++ +DEP S LDAR +A +++ V+ Sbjct: 132 --HVLNHFP--RELSGAQQQRVALARALVKDPSLLLLDEPFSNLDARMRDSARALVKEVQ 187 Query: 1043 NTVDTGRTVVCTIHQPSIDIFEAFDELFLMKRGG-------QEIYVGPLGRHSCHLISYF 1095 + + G T++ H P+ DIF D + ++ +G +++Y P+ LI Sbjct: 188 SRL--GVTLLVVSHDPA-DIFAIADRVGVLVKGKLVQVGKPEDLYDNPVSIQVASLIGEI 244 Query: 1096 EAIPGVQKIKDGYNPATWMLEVSAASQELALGI 1128 + G + +G + VS +S +GI Sbjct: 245 NELEG-KVTNEGVVIGSLRFPVSVSSDRAIIGI 276
>pdb|1OXS|C Chain C, Crystal Structure Of Glcv, The Abc-Atpase Of The Glucose Abc Transporter From Sulfolobus Solfataricus Length = 353 Back     alignment and structure
>pdb|2PMK|A Chain A, Crystal Structures Of An Isolated Abc-Atpase In Complex With Tnp-Adp Length = 243 Back     alignment and structure
>pdb|2IT1|A Chain A, Structure Of Ph0203 Protein From Pyrococcus Horikoshii Length = 362 Back     alignment and structure
>pdb|1MT0|A Chain A, Atp-Binding Domain Of Haemolysin B From Escherichia Coli Length = 241 Back     alignment and structure
>pdb|2FF7|A Chain A, The Abc-Atpase Of The Abc-Transporter Hlyb In The Adp Bound State Length = 247 Back     alignment and structure
>pdb|4HLU|D Chain D, Structure Of The Ecfa-a' Heterodimer Bound To Adp Length = 268 Back     alignment and structure
>pdb|3B5J|A Chain A, Crystal Structures Of The S504a Mutant Of An Isolated Abc-atpase In Complex With Tnp-adp Length = 243 Back     alignment and structure
>pdb|3GFO|A Chain A, Structure Of Cbio1 From Clostridium Perfringens: Part Of The Abc Transporter Complex Cbionq Length = 275 Back     alignment and structure
>pdb|1V43|A Chain A, Crystal Structure Of Atpase Subunit Of Abc Sugar Transporter Length = 372 Back     alignment and structure
>pdb|2FFB|A Chain A, The Crystal Structure Of The Hlyb-Nbd E631q Mutant In Complex With Adp Length = 247 Back     alignment and structure
>pdb|1VCI|A Chain A, Crystal Structure Of The Atp-binding Cassette Of Multisugar Transporter From Pyrococcus Horikoshii Ot3 Complexed With Atp Length = 373 Back     alignment and structure
>pdb|2YYZ|A Chain A, Crystal Structure Of Sugar Abc Transporter, Atp-Binding Protein Length = 359 Back     alignment and structure
>pdb|1XEF|A Chain A, Crystal Structure Of The AtpMG2+ BOUND COMPOSITE DIMER OF HLYB-Nbd Length = 241 Back     alignment and structure
>pdb|2FFA|A Chain A, Crystal Structure Of Abc-Atpase H662a Of The Abc-Transporter Hlyb In Complex With Adp Length = 247 Back     alignment and structure
>pdb|1L2T|A Chain A, Dimeric Structure Of Mj0796, A Bacterial Abc Transporter Cassette Length = 235 Back     alignment and structure
>pdb|1Z47|A Chain A, Structure Of The Atpase Subunit Cysa Of The Putative Sulfate Atp-Binding Cassette (Abc) Transporter From Alicyclobacillus Acidocaldarius Length = 355 Back     alignment and structure
>pdb|3TIF|A Chain A, Dimeric Structure Of A Post-Hydrolysis State Of The Atp-Binding Cassette Mj0796 Bound To Adp And Pi Length = 235 Back     alignment and structure
>pdb|3G5U|A Chain A, Structure Of P-Glycoprotein Reveals A Molecular Basis For Poly-Specific Drug Binding Length = 1284 Back     alignment and structure
>pdb|3G60|A Chain A, Structure Of P-Glycoprotein Reveals A Molecular Basis For Poly-Specific Drug Binding Length = 1284 Back     alignment and structure
>pdb|1MV5|A Chain A, Crystal Structure Of Lmra Atp-Binding Domain Length = 243 Back     alignment and structure
>pdb|3C41|J Chain J, Abc Protein Artp In Complex With Amp-PnpMG2+ Length = 242 Back     alignment and structure
>pdb|4F4C|A Chain A, The Crystal Structure Of The Multi-Drug Transporter Length = 1321 Back     alignment and structure
>pdb|4AYT|A Chain A, Structure Of The Human Mitochondrial Abc Transporter, Abcb10 Length = 595 Back     alignment and structure
>pdb|4AYW|A Chain A, Structure Of The Human Mitochondrial Abc Transporter, Abcb10 (plate Form) Length = 619 Back     alignment and structure
>pdb|2OLJ|A Chain A, Abc Protein Artp In Complex With AdpMG2+ Length = 263 Back     alignment and structure
>pdb|1Q12|A Chain A, Crystal Structure Of The Atp-bound E. Coli Malk Length = 381 Back     alignment and structure
>pdb|1Q1B|A Chain A, Crystal Structure Of E. Coli Malk In The Nucleotide-Free Form Length = 381 Back     alignment and structure
>pdb|2D3W|A Chain A, Crystal Structure Of Escherichia Coli Sufc, An Atpase Compenent Of The Suf Iron-Sulfur Cluster Assembly Machinery Length = 248 Back     alignment and structure
>pdb|2R6G|A Chain A, The Crystal Structure Of The E. Coli Maltose Transporter Length = 381 Back     alignment and structure
>pdb|1G29|1 Chain 1, Malk Length = 372 Back     alignment and structure
>pdb|2ZU0|C Chain C, Crystal Structure Of Sufc-Sufd Complex Involved In The Iron- Sulfur Cluster Biosynthesis Length = 267 Back     alignment and structure
>pdb|2IXF|A Chain A, Crystal Structure Of The Atpase Domain Of Tap1 With Atp (D645q, Q678h Mutant) Length = 271 Back     alignment and structure
>pdb|2D62|A Chain A, Crystal Structure Of Multiple Sugar Binding Transport Atp- Binding Protein Length = 375 Back     alignment and structure
>pdb|1F3O|A Chain A, Crystal Structure Of Mj0796 Atp-Binding Cassette Length = 235 Back     alignment and structure
>pdb|2D2E|A Chain A, Crystal Structure Of Atypical Cytoplasmic Abc-Atpase Sufc From Thermus Thermophilus Hb8 Length = 250 Back     alignment and structure
>pdb|4DBL|C Chain C, Crystal Structure Of E159q Mutant Of Btucdf Length = 249 Back     alignment and structure
>pdb|2HYD|A Chain A, Multidrug Abc Transporter Sav1866 Length = 578 Back     alignment and structure
>pdb|4FI3|C Chain C, Structure Of Vitamin B12 Transporter Btucd-F In A Nucleotide-Bound State Length = 249 Back     alignment and structure
>pdb|3B5X|A Chain A, Crystal Structure Of Msba From Vibrio Cholerae Length = 582 Back     alignment and structure
>pdb|1VPL|A Chain A, Crystal Structure Of Abc Transporter Atp-binding Protein (tm0544) From Thermotoga Maritima At 2.10 A Resolution Length = 256 Back     alignment and structure
>pdb|1L7V|C Chain C, Bacterial Abc Transporter Involved In B12 Uptake Length = 249 Back     alignment and structure
>pdb|2QI9|C Chain C, Abc-Transporter Btucd In Complex With Its Periplasmic Binding Protein Btuf Length = 249 Back     alignment and structure
>pdb|2GHI|A Chain A, Crystal Structure Of Plasmodium Yoelii Multidrug Resistance Protein 2 Length = 260 Back     alignment and structure
>pdb|3QF4|A Chain A, Crystal Structure Of A Heterodimeric Abc Transporter In Its Inward- Facing Conformation Length = 587 Back     alignment and structure
>pdb|1GAJ|A Chain A, Crystal Structure Of A Nucleotide-Free Atp-Binding Cassette From An Abc Transporter Length = 257 Back     alignment and structure
>pdb|2NQ2|C Chain C, An Inward-Facing Conformation Of A Putative Metal-Chelate Type Abc Transporter. Length = 253 Back     alignment and structure
>pdb|1G9X|A Chain A, Characterization Of The Twinning Structure Of Mj1267, An Atp-Binding Cassette Of An Abc Transporter Length = 257 Back     alignment and structure
>pdb|1YQT|A Chain A, Rnase-L Inhibitor Length = 538 Back     alignment and structure
>pdb|2PCJ|A Chain A, Crystal Structure Of Abc Transporter (Aq_297) From Aquifex Aeolicus Vf5 Length = 224 Back     alignment and structure
>pdb|1G6H|A Chain A, Crystal Structure Of The Adp Conformation Of Mj1267, An Atp- Binding Cassette Of An Abc Transporter Length = 257 Back     alignment and structure
>pdb|3TUJ|C Chain C, Inward Facing Conformations Of The Metni Methionine Abc Transporter: Dm Crystal Form Length = 366 Back     alignment and structure
>pdb|1JJ7|A Chain A, Crystal Structure Of The C-Terminal Atpase Domain Of Human Tap1 Length = 260 Back     alignment and structure
>pdb|2IXE|A Chain A, Crystal Structure Of The Atpase Domain Of Tap1 With Atp (d645n Mutant) Length = 271 Back     alignment and structure
>pdb|1B0U|A Chain A, Atp-Binding Subunit Of The Histidine Permease From Salmonella Typhimurium Length = 262 Back     alignment and structure
>pdb|2IXG|A Chain A, Crystal Structure Of The Atpase Domain Of Tap1 With Atp (S621a, G622v, D645n Mutant) Length = 271 Back     alignment and structure
>pdb|3OZX|A Chain A, Crystal Structure Of Abce1 Of Sulfolubus Solfataricus (-Fes Domain) Length = 538 Back     alignment and structure
>pdb|3OZX|A Chain A, Crystal Structure Of Abce1 Of Sulfolubus Solfataricus (-Fes Domain) Length = 538 Back     alignment and structure
>pdb|3FVQ|A Chain A, Crystal Structure Of The Nucleotide Binding Domain Fbpc Complexed With Atp Length = 359 Back     alignment and structure
>pdb|1JI0|A Chain A, Crystal Structure Analysis Of The Abc Transporter From Thermotoga Maritima Length = 240 Back     alignment and structure
>pdb|2YZ2|A Chain A, Crystal Structure Of The Abc Transporter In The Cobalt Transport System Length = 266 Back     alignment and structure
>pdb|4HLU|A Chain A, Structure Of The Ecfa-a' Heterodimer Bound To Adp Length = 268 Back     alignment and structure
>pdb|3D31|A Chain A, Modbc From Methanosarcina Acetivorans Length = 348 Back     alignment and structure
>pdb|3DHW|C Chain C, Crystal Structure Of Methionine Importer Metni Length = 343 Back     alignment and structure
>pdb|3NH6|A Chain A, Nucleotide Binding Domain Of Human Abcb6 (Apo Structure) Length = 306 Back     alignment and structure
>pdb|3B5Y|A Chain A, Crystal Structure Of Msba From Salmonella Typhimurium With Amppnp Length = 582 Back     alignment and structure
>pdb|2ONK|A Chain A, Abc Transporter Modbc In Complex With Its Binding Protein Moda Length = 240 Back     alignment and structure
>pdb|2IHY|A Chain A, Structure Of The Staphylococcus Aureus Putative Atpase Subunit Of An Atp-Binding Cassette (Abc) Transporter Length = 279 Back     alignment and structure
>pdb|3B5W|A Chain A, Crystal Structure Of Eschericia Coli Msba Length = 582 Back     alignment and structure
>pdb|3TUI|C Chain C, Inward Facing Conformations Of The Metni Methionine Abc Transporter: Cy5 Native Crystal Form Length = 366 Back     alignment and structure
>pdb|3BK7|A Chain A, Structure Of The Complete Abce1RNAASE-L Inhibitor Protein From Pyrococcus Abysii Length = 607 Back     alignment and structure
>pdb|4G1U|C Chain C, X-Ray Structure Of The Bacterial Heme Transporter Hmuuv From Yersinia Pestis Length = 266 Back     alignment and structure
>pdb|3J15|B Chain B, Model Of Ribosome-Bound Archaeal Pelota And Abce1 Length = 593 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1445
1vpl_A256 ABC transporter, ATP-binding protein; TM0544, stru 9e-26
1vpl_A256 ABC transporter, ATP-binding protein; TM0544, stru 2e-16
1sgw_A214 Putative ABC transporter; structural genomics, P p 8e-23
1sgw_A214 Putative ABC transporter; structural genomics, P p 4e-17
2nq2_C253 Hypothetical ABC transporter ATP-binding protein H 9e-23
2nq2_C253 Hypothetical ABC transporter ATP-binding protein H 2e-16
2qi9_C249 Vitamin B12 import ATP-binding protein BTUD; inner 3e-22
2qi9_C249 Vitamin B12 import ATP-binding protein BTUD; inner 1e-18
3j16_B608 RLI1P; ribosome recycling, translation, eukarya, r 4e-20
3j16_B608 RLI1P; ribosome recycling, translation, eukarya, r 4e-14
3j16_B608 RLI1P; ribosome recycling, translation, eukarya, r 2e-10
3j16_B608 RLI1P; ribosome recycling, translation, eukarya, r 6e-10
3bk7_A607 ABC transporter ATP-binding protein; ABC ATPase, i 1e-19
3bk7_A607 ABC transporter ATP-binding protein; ABC ATPase, i 2e-13
3bk7_A607 ABC transporter ATP-binding protein; ABC ATPase, i 3e-13
3bk7_A607 ABC transporter ATP-binding protein; ABC ATPase, i 6e-09
2ihy_A279 ABC transporter, ATP-binding protein; ATPase, ABC 1e-19
2ihy_A279 ABC transporter, ATP-binding protein; ATPase, ABC 2e-18
3gfo_A275 Cobalt import ATP-binding protein CBIO 1; structur 2e-18
3gfo_A275 Cobalt import ATP-binding protein CBIO 1; structur 3e-15
2pjz_A263 Hypothetical protein ST1066; ATP binding protein, 2e-18
2pjz_A263 Hypothetical protein ST1066; ATP binding protein, 8e-14
1yqt_A538 RNAse L inhibitor; ATP-binding cassette, ribosome 2e-18
1yqt_A538 RNAse L inhibitor; ATP-binding cassette, ribosome 9e-13
1yqt_A538 RNAse L inhibitor; ATP-binding cassette, ribosome 9e-11
1yqt_A538 RNAse L inhibitor; ATP-binding cassette, ribosome 1e-07
3ozx_A538 RNAse L inhibitor; ATP binding cassette protein, h 2e-17
3ozx_A538 RNAse L inhibitor; ATP binding cassette protein, h 7e-12
3ozx_A538 RNAse L inhibitor; ATP binding cassette protein, h 7e-11
3ozx_A538 RNAse L inhibitor; ATP binding cassette protein, h 2e-10
2yz2_A266 Putative ABC transporter ATP-binding protein TM_0; 1e-16
2yz2_A266 Putative ABC transporter ATP-binding protein TM_0; 2e-15
1vt4_I1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-14
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-13
1vt4_I1221 APAF-1 related killer DARK; drosophila apoptosome, 8e-13
1vt4_I1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-11
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-10
1vt4_I1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-08
1g6h_A257 High-affinity branched-chain amino acid transport 4e-13
1g6h_A257 High-affinity branched-chain amino acid transport 6e-12
2pcj_A224 ABC transporter, lipoprotein-releasing system ATP- 4e-13
2pcj_A224 ABC transporter, lipoprotein-releasing system ATP- 6e-07
3tif_A235 Uncharacterized ABC transporter ATP-binding prote; 5e-13
3tif_A235 Uncharacterized ABC transporter ATP-binding prote; 5e-07
2zu0_C267 Probable ATP-dependent transporter SUFC; iron-sulf 4e-11
2zu0_C267 Probable ATP-dependent transporter SUFC; iron-sulf 9e-05
2d2e_A250 SUFC protein; ABC-ATPase, SUF protein, 310-helix, 2e-10
2d2e_A250 SUFC protein; ABC-ATPase, SUF protein, 310-helix, 9e-06
2ff7_A247 Alpha-hemolysin translocation ATP-binding protein 4e-10
2ff7_A247 Alpha-hemolysin translocation ATP-binding protein 9e-06
2iw3_A986 Elongation factor 3A; acetylation, ATP-binding, pr 4e-10
2iw3_A986 Elongation factor 3A; acetylation, ATP-binding, pr 5e-05
2iw3_A986 Elongation factor 3A; acetylation, ATP-binding, pr 8e-04
2ghi_A260 Transport protein; multidrug resistance protein, M 7e-10
2ghi_A260 Transport protein; multidrug resistance protein, M 5e-04
3nh6_A306 ATP-binding cassette SUB-family B member 6, mitoc; 7e-10
3g5u_A 1284 MCG1178, multidrug resistance protein 1A; P-glycop 9e-10
3g5u_A1284 MCG1178, multidrug resistance protein 1A; P-glycop 3e-07
2cbz_A237 Multidrug resistance-associated protein 1; ABC pro 1e-09
2cbz_A237 Multidrug resistance-associated protein 1; ABC pro 3e-06
1mv5_A243 LMRA, multidrug resistance ABC transporter ATP-bin 2e-09
1mv5_A243 LMRA, multidrug resistance ABC transporter ATP-bin 9e-08
3fvq_A359 Fe(3+) IONS import ATP-binding protein FBPC; nucle 1e-08
3fvq_A359 Fe(3+) IONS import ATP-binding protein FBPC; nucle 8e-07
1ji0_A240 ABC transporter; ATP binding protein, structural g 1e-08
1ji0_A240 ABC transporter; ATP binding protein, structural g 6e-06
2onk_A240 Molybdate/tungstate ABC transporter, ATP-binding p 1e-08
2onk_A240 Molybdate/tungstate ABC transporter, ATP-binding p 5e-05
2ixe_A271 Antigen peptide transporter 1; ABC ATPase, hydrola 1e-08
2ixe_A271 Antigen peptide transporter 1; ABC ATPase, hydrola 2e-05
1z47_A355 CYSA, putative ABC-transporter ATP-binding protein 2e-08
1z47_A355 CYSA, putative ABC-transporter ATP-binding protein 8e-07
2pze_A229 Cystic fibrosis transmembrane conductance regulat; 2e-08
2pze_A229 Cystic fibrosis transmembrane conductance regulat; 3e-06
3tui_C366 Methionine import ATP-binding protein METN; ABC-tr 2e-08
3tui_C366 Methionine import ATP-binding protein METN; ABC-tr 7e-07
3gd7_A390 Fusion complex of cystic fibrosis transmembrane co 1e-07
2bbs_A290 Cystic fibrosis transmembrane conductance regulato 1e-07
2bbs_A290 Cystic fibrosis transmembrane conductance regulato 1e-06
3d31_A348 Sulfate/molybdate ABC transporter, ATP-binding pro 5e-07
3d31_A348 Sulfate/molybdate ABC transporter, ATP-binding pro 7e-06
1oxx_K353 GLCV, glucose, ABC transporter, ATP binding protei 7e-07
1oxx_K353 GLCV, glucose, ABC transporter, ATP binding protei 1e-05
4a82_A578 Cystic fibrosis transmembrane conductance regulat; 9e-07
3b5x_A582 Lipid A export ATP-binding/permease protein MSBA; 2e-06
3qkt_A339 DNA double-strand break repair RAD50 ATPase; RECA- 2e-06
2yl4_A595 ATP-binding cassette SUB-family B member 10, mitoc 2e-06
2yl4_A595 ATP-binding cassette SUB-family B member 10, mitoc 4e-04
3b60_A582 Lipid A export ATP-binding/permease protein MSBA; 3e-06
2it1_A362 362AA long hypothetical maltose/maltodextrin trans 3e-05
2it1_A362 362AA long hypothetical maltose/maltodextrin trans 4e-04
1v43_A372 Sugar-binding transport ATP-binding protein; ATPas 2e-04
2yyz_A359 Sugar ABC transporter, ATP-binding protein; sugar 2e-04
1f2t_B148 RAD50 ABC-ATPase; DNA double-strand break repair, 4e-04
>1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12 Length = 256 Back     alignment and structure
 Score =  106 bits (268), Expect = 9e-26
 Identities = 46/186 (24%), Positives = 78/186 (41%), Gaps = 16/186 (8%)

Query: 875  LNGVSGAFRPGVLTALMGVSGAGKTTLMDVLAG--RKTGGYITGNITISGY-PKKQETFA 931
            L G+S     G +  L+G +GAGKTT + +++   + + G     +T+ G    ++    
Sbjct: 31   LKGISFEIEEGEIFGLIGPNGAGKTTTLRIISTLIKPSSG----IVTVFGKNVVEEPHEV 86

Query: 932  RIS-GYCEQNDIHSPFVTIYESLLFSAWLRLSPEVDSETRKMFIDEVMELVELNPLRQSL 990
            R    Y  +       +   E L F A    S   + E     ++   E+  L    +  
Sbjct: 87   RKLISYLPEEAGAYRNMQGIEYLRFVAGFYASSSSEIEEM---VERATEIAGLGEKIKDR 143

Query: 991  VGLPGVSGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRT 1050
            V        S    ++L IA  L+ NP +  +DEPTSGLD   A  V + ++     G T
Sbjct: 144  VS-----TYSKGMVRKLLIARALMVNPRLAILDEPTSGLDVLNAREVRKILKQASQEGLT 198

Query: 1051 VVCTIH 1056
            ++ + H
Sbjct: 199  ILVSSH 204


>1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12 Length = 256 Back     alignment and structure
>1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12 Length = 214 Back     alignment and structure
>1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12 Length = 214 Back     alignment and structure
>2nq2_C Hypothetical ABC transporter ATP-binding protein HI1470; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae} Length = 253 Back     alignment and structure
>2nq2_C Hypothetical ABC transporter ATP-binding protein HI1470; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae} Length = 253 Back     alignment and structure
>2qi9_C Vitamin B12 import ATP-binding protein BTUD; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_C* 4dbl_C Length = 249 Back     alignment and structure
>2qi9_C Vitamin B12 import ATP-binding protein BTUD; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_C* 4dbl_C Length = 249 Back     alignment and structure
>3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; NMR {Saccharomyces cerevisiae} Length = 608 Back     alignment and structure
>3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; NMR {Saccharomyces cerevisiae} Length = 608 Back     alignment and structure
>3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; NMR {Saccharomyces cerevisiae} Length = 608 Back     alignment and structure
>3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; NMR {Saccharomyces cerevisiae} Length = 608 Back     alignment and structure
>3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* Length = 607 Back     alignment and structure
>3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* Length = 607 Back     alignment and structure
>3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* Length = 607 Back     alignment and structure
>3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* Length = 607 Back     alignment and structure
>2ihy_A ABC transporter, ATP-binding protein; ATPase, ABC cassette, hydrolase; HET: MSE; 1.90A {Staphylococcus aureus} Length = 279 Back     alignment and structure
>2ihy_A ABC transporter, ATP-binding protein; ATPase, ABC cassette, hydrolase; HET: MSE; 1.90A {Staphylococcus aureus} Length = 279 Back     alignment and structure
>3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124} Length = 275 Back     alignment and structure
>3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124} Length = 275 Back     alignment and structure
>2pjz_A Hypothetical protein ST1066; ATP binding protein, structural genomics, NPPSFA; 1.90A {Sulfolobus tokodaii} Length = 263 Back     alignment and structure
>2pjz_A Hypothetical protein ST1066; ATP binding protein, structural genomics, NPPSFA; 1.90A {Sulfolobus tokodaii} Length = 263 Back     alignment and structure
>1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} Length = 538 Back     alignment and structure
>1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} Length = 538 Back     alignment and structure
>1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} Length = 538 Back     alignment and structure
>1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} Length = 538 Back     alignment and structure
>3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} Length = 538 Back     alignment and structure
>3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} Length = 538 Back     alignment and structure
>3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} Length = 538 Back     alignment and structure
>3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} Length = 538 Back     alignment and structure
>2yz2_A Putative ABC transporter ATP-binding protein TM_0; cobalt transport, TM02 hydrolase, inner membrane, membrane, nucleotide-binding; 2.30A {Thermotoga maritima} Length = 266 Back     alignment and structure
>2yz2_A Putative ABC transporter ATP-binding protein TM_0; cobalt transport, TM02 hydrolase, inner membrane, membrane, nucleotide-binding; 2.30A {Thermotoga maritima} Length = 266 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1g6h_A High-affinity branched-chain amino acid transport ATP-binding protein; beta-core domain; HET: ADP; 1.60A {Methanocaldococcus jannaschii} SCOP: c.37.1.12 PDB: 1gaj_A 1g9x_A* Length = 257 Back     alignment and structure
>1g6h_A High-affinity branched-chain amino acid transport ATP-binding protein; beta-core domain; HET: ADP; 1.60A {Methanocaldococcus jannaschii} SCOP: c.37.1.12 PDB: 1gaj_A 1g9x_A* Length = 257 Back     alignment and structure
>2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein; structural genomics; 1.70A {Aquifex aeolicus} PDB: 2pcl_A Length = 224 Back     alignment and structure
>2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein; structural genomics; 1.70A {Aquifex aeolicus} PDB: 2pcl_A Length = 224 Back     alignment and structure
>3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A* Length = 235 Back     alignment and structure
>3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A* Length = 235 Back     alignment and structure
>2zu0_C Probable ATP-dependent transporter SUFC; iron-sulfur cluster, ABC-ATPase, ATP-binding, cytoplasm, nucleotide-binding; HET: MES; 2.20A {Escherichia coli} PDB: 2d3w_A Length = 267 Back     alignment and structure
>2zu0_C Probable ATP-dependent transporter SUFC; iron-sulfur cluster, ABC-ATPase, ATP-binding, cytoplasm, nucleotide-binding; HET: MES; 2.20A {Escherichia coli} PDB: 2d3w_A Length = 267 Back     alignment and structure
>2d2e_A SUFC protein; ABC-ATPase, SUF protein, 310-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics, binding; 1.70A {Thermus thermophilus} PDB: 2d2f_A* Length = 250 Back     alignment and structure
>2d2e_A SUFC protein; ABC-ATPase, SUF protein, 310-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics, binding; 1.70A {Thermus thermophilus} PDB: 2d2f_A* Length = 250 Back     alignment and structure
>2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A* Length = 247 Back     alignment and structure
>2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A* Length = 247 Back     alignment and structure
>2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A Length = 986 Back     alignment and structure
>2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A Length = 986 Back     alignment and structure
>2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A Length = 986 Back     alignment and structure
>2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str} Length = 260 Back     alignment and structure
>2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str} Length = 260 Back     alignment and structure
>3nh6_A ATP-binding cassette SUB-family B member 6, mitoc; ABC-transporter, ABCB6, nucleotide binding domain, heme BIOS transport protein; 2.00A {Homo sapiens} PDB: 3nh9_A* 3nha_A* 3nhb_A* Length = 306 Back     alignment and structure
>3g5u_A MCG1178, multidrug resistance protein 1A; P-glycoprotein, PGP, cyclic peptide, membrane protein; 3.80A {Mus musculus} PDB: 3g61_A* 3g60_A* Length = 1284 Back     alignment and structure
>3g5u_A MCG1178, multidrug resistance protein 1A; P-glycoprotein, PGP, cyclic peptide, membrane protein; 3.80A {Mus musculus} PDB: 3g61_A* 3g60_A* Length = 1284 Back     alignment and structure
>2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens} Length = 237 Back     alignment and structure
>2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens} Length = 237 Back     alignment and structure
>1mv5_A LMRA, multidrug resistance ABC transporter ATP-binding and permease protein; asymmetric dimer, tetramer, P-glycoprotein; HET: ATP ADP; 3.10A {Lactococcus lactis} SCOP: c.37.1.12 Length = 243 Back     alignment and structure
>1mv5_A LMRA, multidrug resistance ABC transporter ATP-binding and permease protein; asymmetric dimer, tetramer, P-glycoprotein; HET: ATP ADP; 3.10A {Lactococcus lactis} SCOP: c.37.1.12 Length = 243 Back     alignment and structure
>3fvq_A Fe(3+) IONS import ATP-binding protein FBPC; nucleotide binding domain, ABC motor domain, ferric iron transport, cell inner membrane; HET: ATP; 1.90A {Neisseria gonorrhoeae} Length = 359 Back     alignment and structure
>3fvq_A Fe(3+) IONS import ATP-binding protein FBPC; nucleotide binding domain, ABC motor domain, ferric iron transport, cell inner membrane; HET: ATP; 1.90A {Neisseria gonorrhoeae} Length = 359 Back     alignment and structure
>1ji0_A ABC transporter; ATP binding protein, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: ATP; 2.00A {Thermotoga maritima} SCOP: c.37.1.12 Length = 240 Back     alignment and structure
>1ji0_A ABC transporter; ATP binding protein, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: ATP; 2.00A {Thermotoga maritima} SCOP: c.37.1.12 Length = 240 Back     alignment and structure
>2onk_A Molybdate/tungstate ABC transporter, ATP-binding protein; membrane protein; 3.10A {Archaeoglobus fulgidus} SCOP: c.37.1.12 Length = 240 Back     alignment and structure
>2onk_A Molybdate/tungstate ABC transporter, ATP-binding protein; membrane protein; 3.10A {Archaeoglobus fulgidus} SCOP: c.37.1.12 Length = 240 Back     alignment and structure
>2ixe_A Antigen peptide transporter 1; ABC ATPase, hydrolase; HET: ATP; 2.0A {Rattus norvegicus} PDB: 2ixg_A* 2ixf_A* 1jj7_A* Length = 271 Back     alignment and structure
>2ixe_A Antigen peptide transporter 1; ABC ATPase, hydrolase; HET: ATP; 2.0A {Rattus norvegicus} PDB: 2ixg_A* 2ixf_A* 1jj7_A* Length = 271 Back     alignment and structure
>1z47_A CYSA, putative ABC-transporter ATP-binding protein; alpha/beta motif, beta sandwich, ligand binding protein; 1.90A {Alicyclobacillus acidocaldarius} Length = 355 Back     alignment and structure
>1z47_A CYSA, putative ABC-transporter ATP-binding protein; alpha/beta motif, beta sandwich, ligand binding protein; 1.90A {Alicyclobacillus acidocaldarius} Length = 355 Back     alignment and structure
>2pze_A Cystic fibrosis transmembrane conductance regulat; NBD, ABC transporter, CFTR, hydrolase; HET: ATP; 1.70A {Homo sapiens} PDB: 2pzg_A* 2pzf_A* 1ckx_A 1cky_A 1ckw_A 1ckz_A Length = 229 Back     alignment and structure
>2pze_A Cystic fibrosis transmembrane conductance regulat; NBD, ABC transporter, CFTR, hydrolase; HET: ATP; 1.70A {Homo sapiens} PDB: 2pzg_A* 2pzf_A* 1ckx_A 1cky_A 1ckw_A 1ckz_A Length = 229 Back     alignment and structure
>3tui_C Methionine import ATP-binding protein METN; ABC-transporter, type I ABC type importer, methionine uptake transporter, membrane protein; HET: ADP; 2.90A {Escherichia coli} PDB: 3tuj_C 3tuz_C* 3dhw_C Length = 366 Back     alignment and structure
>3tui_C Methionine import ATP-binding protein METN; ABC-transporter, type I ABC type importer, methionine uptake transporter, membrane protein; HET: ADP; 2.90A {Escherichia coli} PDB: 3tuj_C 3tuz_C* 3dhw_C Length = 366 Back     alignment and structure
>3gd7_A Fusion complex of cystic fibrosis transmembrane conductance regulator, residues 1193-1427...; CFTR, ABC transporter, nucleotide binding domain, NBD; HET: B44; 2.70A {Homo sapiens} Length = 390 Back     alignment and structure
>2bbs_A Cystic fibrosis transmembrane conductance regulator; ATP binding cassette, transport protein; HET: ATP; 2.05A {Homo sapiens} PDB: 2bbt_A* 1xmi_A* 1xmj_A* 2bbo_A* 3si7_A* 1r0w_A 1q3h_A 1r0x_A* 1r0y_A* 1r0z_A* 1r10_A* 1xf9_A* 1xfa_A* Length = 290 Back     alignment and structure
>2bbs_A Cystic fibrosis transmembrane conductance regulator; ATP binding cassette, transport protein; HET: ATP; 2.05A {Homo sapiens} PDB: 2bbt_A* 1xmi_A* 1xmj_A* 2bbo_A* 3si7_A* 1r0w_A 1q3h_A 1r0x_A* 1r0y_A* 1r0z_A* 1r10_A* 1xf9_A* 1xfa_A* Length = 290 Back     alignment and structure
>3d31_A Sulfate/molybdate ABC transporter, ATP-binding protein; ATP-binding, nucleotide-binding, membrane, transmembrane, transport protein; 3.00A {Methanosarcina acetivorans} SCOP: b.40.6.3 c.37.1.12 Length = 348 Back     alignment and structure
>3d31_A Sulfate/molybdate ABC transporter, ATP-binding protein; ATP-binding, nucleotide-binding, membrane, transmembrane, transport protein; 3.00A {Methanosarcina acetivorans} SCOP: b.40.6.3 c.37.1.12 Length = 348 Back     alignment and structure
>1oxx_K GLCV, glucose, ABC transporter, ATP binding protein; ABC-ATPase, ATP-binding cassette, ATPase, transport protein; 1.45A {Sulfolobus solfataricus} SCOP: b.40.6.3 c.37.1.12 PDB: 1oxs_C 1oxt_A 1oxu_A* 1oxv_A* Length = 353 Back     alignment and structure
>1oxx_K GLCV, glucose, ABC transporter, ATP binding protein; ABC-ATPase, ATP-binding cassette, ATPase, transport protein; 1.45A {Sulfolobus solfataricus} SCOP: b.40.6.3 c.37.1.12 PDB: 1oxs_C 1oxt_A 1oxu_A* 1oxv_A* Length = 353 Back     alignment and structure
>4a82_A Cystic fibrosis transmembrane conductance regulat; CFTR, ION channel, transport protein, casse protein; 2.00A {Homo sapiens} PDB: 2onj_A* 2hyd_A Length = 578 Back     alignment and structure
>3b5x_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; 5.50A {Vibrio cholerae} Length = 582 Back     alignment and structure
>3qkt_A DNA double-strand break repair RAD50 ATPase; RECA-like fold, coiled-coils, ATP binding, DNA bindi MRE11, replication; HET: DNA ANP; 1.90A {Pyrococcus furiosus} PDB: 3qku_A* 1ii8_A 3qks_B* 3qkr_B* 1ii8_B Length = 339 Back     alignment and structure
>3b60_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; HET: ANP; 3.70A {Salmonella typhimurium} SCOP: c.37.1.12 f.37.1.1 PDB: 3b5y_A* 3b5z_A* 3b5w_A Length = 582 Back     alignment and structure
>2it1_A 362AA long hypothetical maltose/maltodextrin transport ATP-binding protein; structural genomics, NPPSFA; 1.94A {Pyrococcus horikoshii} Length = 362 Back     alignment and structure
>2it1_A 362AA long hypothetical maltose/maltodextrin transport ATP-binding protein; structural genomics, NPPSFA; 1.94A {Pyrococcus horikoshii} Length = 362 Back     alignment and structure
>1v43_A Sugar-binding transport ATP-binding protein; ATPase, active transport, sugar uptake and regulation, transport protein; 2.20A {Pyrococcus horikoshii} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 1vci_A* Length = 372 Back     alignment and structure
>2yyz_A Sugar ABC transporter, ATP-binding protein; sugar transport, alpha and beta proteins (A/B) TM0421, structural genomics, NPPSFA; 2.11A {Thermotoga maritima} Length = 359 Back     alignment and structure
>1f2t_B RAD50 ABC-ATPase; DNA double-strand break repair, replication; 1.60A {Pyrococcus furiosus} SCOP: c.37.1.12 PDB: 1f2u_B* 1us8_B* Length = 148 Back     alignment and structure

Structure Templates Detected by HHsearch ?

No hit with probability above 80.00


Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 1445
d1v43a3239 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N 7e-29
d1v43a3239 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N 1e-26
d1l2ta_230 c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jann 3e-28
d1l2ta_230 c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jann 2e-22
d1g6ha_254 c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jann 2e-27
d1g6ha_254 c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jann 2e-25
d1ji0a_240 c.37.1.12 (A:) Branched chain aminoacid ABC transp 5e-27
d1ji0a_240 c.37.1.12 (A:) Branched chain aminoacid ABC transp 2e-18
d2hyda1255 c.37.1.12 (A:324-578) Putative multidrug export AT 3e-25
d2hyda1255 c.37.1.12 (A:324-578) Putative multidrug export AT 6e-21
d3dhwc1240 c.37.1.12 (C:1-240) Methionine import ATP-binding 7e-25
d3dhwc1240 c.37.1.12 (C:1-240) Methionine import ATP-binding 1e-24
d1b0ua_258 c.37.1.12 (A:) ATP-binding subunit of the histidin 9e-25
d1b0ua_258 c.37.1.12 (A:) ATP-binding subunit of the histidin 7e-22
d1vpla_238 c.37.1.12 (A:) Putative ABC transporter TM0544 {Th 2e-24
d1vpla_238 c.37.1.12 (A:) Putative ABC transporter TM0544 {Th 5e-22
d1sgwa_200 c.37.1.12 (A:) Putative ABC transporter PF0895 {Py 2e-24
d1sgwa_200 c.37.1.12 (A:) Putative ABC transporter PF0895 {Py 2e-18
d1r0wa_281 c.37.1.12 (A:) Cystic fibrosis transmembrane condu 7e-24
d1r0wa_281 c.37.1.12 (A:) Cystic fibrosis transmembrane condu 3e-23
d1jj7a_251 c.37.1.12 (A:) Peptide transporter Tap1, C-termina 8e-23
d1jj7a_251 c.37.1.12 (A:) Peptide transporter Tap1, C-termina 1e-20
d3b60a1253 c.37.1.12 (A:329-581) Multidrug resistance ABC tra 1e-22
d3b60a1253 c.37.1.12 (A:329-581) Multidrug resistance ABC tra 2e-20
d1l7vc_231 c.37.1.12 (C:) ABC transporter involved in vitamin 2e-22
d1l7vc_231 c.37.1.12 (C:) ABC transporter involved in vitamin 5e-19
d2pmka1241 c.37.1.12 (A:467-707) Haemolysin B ATP-binding pro 8e-22
d2pmka1241 c.37.1.12 (A:467-707) Haemolysin B ATP-binding pro 1e-19
d2awna2232 c.37.1.12 (A:4-235) Maltose transport protein MalK 3e-21
d2awna2232 c.37.1.12 (A:4-235) Maltose transport protein MalK 2e-20
d1mv5a_242 c.37.1.12 (A:) Multidrug resistance ABC transporte 7e-21
d1mv5a_242 c.37.1.12 (A:) Multidrug resistance ABC transporte 2e-19
d3d31a2229 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transpor 1e-19
d3d31a2229 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transpor 5e-15
d1g2912240 c.37.1.12 (1:1-240) Maltose transport protein MalK 2e-19
d1g2912240 c.37.1.12 (1:1-240) Maltose transport protein MalK 5e-18
d1oxxk2242 c.37.1.12 (K:1-242) Glucose transport protein GlcV 2e-19
d1oxxk2242 c.37.1.12 (K:1-242) Glucose transport protein GlcV 6e-19
d2onka1240 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP 2e-15
d2onka1240 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP 1e-13
g1ii8.1369 c.37.1.12 (A:,B:) Rad50 {Archaeon Pyrococcus furio 2e-07
g1f2t.1292 c.37.1.12 (A:,B:) Rad50 {Archaeon Pyrococcus furio 4e-07
g1f2t.1292 c.37.1.12 (A:,B:) Rad50 {Archaeon Pyrococcus furio 2e-04
g1f2t.1292 c.37.1.12 (A:,B:) Rad50 {Archaeon Pyrococcus furio 0.001
d1ye8a1178 c.37.1.11 (A:1-178) Hypothetical kinase-like prote 1e-06
d1ye8a1178 c.37.1.11 (A:1-178) Hypothetical kinase-like prote 2e-05
d1svma_362 c.37.1.20 (A:) Papillomavirus large T antigen heli 7e-05
d1w1wa_427 c.37.1.12 (A:) Smc head domain {Baker's yeast (Sac 1e-04
d1n0wa_242 c.37.1.11 (A:) DNA repair protein Rad51, catalytic 1e-04
d1np6a_170 c.37.1.10 (A:) Molybdopterin-guanine dinucleotide 6e-04
d2i1qa2258 c.37.1.11 (A:65-322) DNA repair protein Rad51, cat 0.002
d1szpa2251 c.37.1.11 (A:145-395) DNA repair protein Rad51, ca 0.003
d1nlfa_274 c.37.1.11 (A:) Hexameric replicative helicase repA 0.004
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Length = 239 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: ABC transporter ATPase domain-like
domain: Hypothetical protein PH0022, N-terminal domain
species: Pyrococcus horikoshii [TaxId: 53953]
 Score =  114 bits (287), Expect = 7e-29
 Identities = 56/271 (20%), Positives = 98/271 (36%), Gaps = 54/271 (19%)

Query: 165 LTILKDVSGVIKPGRLTLLLGPPSSGKTTLLLALAGKLDPTLKVSGTVTYNGHDMDEFVP 224
            T +  ++  IK G   +LLGP   GKTT L  +AG  +PT    G + +   D+    P
Sbjct: 19  FTAVNKLNLTIKDGEFLVLLGPSGCGKTTTLRMIAGLEEPT---EGRIYFGDRDVTYLPP 75

Query: 225 -QRTAAYISQHDNHIGEMTVRETLAFSARCQGVGTRYEMLTELARREKAAGIKPDPDIDV 283
             R  + + Q       MTV E +AF  + +                             
Sbjct: 76  KDRNISMVFQSYAVWPHMTVYENIAFPLKIKKFP-------------------------- 109

Query: 284 YMKAIATEGQEANVITDYYLKVLGLDVCADTMVGDEMIRGISGGQKKRVTTGEMMVGPAL 343
                     E +    +  ++L ++   +          +SGGQ++RV     +V    
Sbjct: 110 --------KDEIDKRVRWAAELLQIEELLNRYPAQ-----LSGGQRQRVAVARAIVVEPD 156

Query: 344 ALFMDEISTGLDSSTTFQIVNCLRQNIHINSGTAVISLLQPAPETYDLFDDIILLSDGQI 403
            L MDE  + LD+     +   +++ +        I +     E   + D I +++ GQ+
Sbjct: 157 VLLMDEPLSNLDAKLRVAMRAEIKK-LQQKLKVTTIYVTHDQVEAMTMGDRIAVMNRGQL 215

Query: 404 VYQG-PRELVLEFFASMGFRCPKRKGVADFL 433
           +  G P E+         +  P    VA F+
Sbjct: 216 LQIGSPTEV---------YLRPNSVFVATFI 237


>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Length = 239 Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 230 Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 230 Back     information, alignment and structure
>d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 254 Back     information, alignment and structure
>d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 254 Back     information, alignment and structure
>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Length = 240 Back     information, alignment and structure
>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Length = 240 Back     information, alignment and structure
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Length = 255 Back     information, alignment and structure
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Length = 255 Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Length = 240 Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Length = 240 Back     information, alignment and structure
>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Length = 258 Back     information, alignment and structure
>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Length = 258 Back     information, alignment and structure
>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Length = 238 Back     information, alignment and structure
>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Length = 238 Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Length = 200 Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Length = 200 Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 281 Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 281 Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Length = 251 Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Length = 251 Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Length = 253 Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Length = 253 Back     information, alignment and structure
>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} Length = 231 Back     information, alignment and structure
>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} Length = 231 Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Length = 241 Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Length = 241 Back     information, alignment and structure
>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 232 Back     information, alignment and structure
>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 232 Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Length = 242 Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Length = 242 Back     information, alignment and structure
>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Length = 229 Back     information, alignment and structure
>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Length = 229 Back     information, alignment and structure
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Length = 240 Back     information, alignment and structure
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Length = 240 Back     information, alignment and structure
>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Length = 242 Back     information, alignment and structure
>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Length = 242 Back     information, alignment and structure
>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Length = 240 Back     information, alignment and structure
>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Length = 240 Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Length = 178 Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Length = 178 Back     information, alignment and structure
>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Length = 362 Back     information, alignment and structure
>d1w1wa_ c.37.1.12 (A:) Smc head domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 427 Back     information, alignment and structure
>d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Length = 170 Back     information, alignment and structure
>d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} Length = 258 Back     information, alignment and structure
>d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 251 Back     information, alignment and structure
>d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} Length = 274 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query1445
d2awna2232 Maltose transport protein MalK, N-terminal domain 100.0
d1v43a3239 Hypothetical protein PH0022, N-terminal domain {Py 100.0
d1g2912240 Maltose transport protein MalK, N-terminal domain 100.0
d1oxxk2242 Glucose transport protein GlcV, N-terminal domain 100.0
d1g2912240 Maltose transport protein MalK, N-terminal domain 100.0
d1v43a3239 Hypothetical protein PH0022, N-terminal domain {Py 100.0
d3d31a2229 Sulfate/molybdate ABC transporter, ATP-binding pro 100.0
d2pmka1241 Haemolysin B ATP-binding protein {Escherichia coli 100.0
d2awna2232 Maltose transport protein MalK, N-terminal domain 100.0
d3dhwc1240 Methionine import ATP-binding protein MetN {Escher 100.0
d1l2ta_230 MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 100.0
d1jj7a_251 Peptide transporter Tap1, C-terminal ABC domain {H 100.0
d1oxxk2242 Glucose transport protein GlcV, N-terminal domain 100.0
d3dhwc1240 Methionine import ATP-binding protein MetN {Escher 100.0
d2hyda1255 Putative multidrug export ATP-binding/permease pro 100.0
d1vpla_238 Putative ABC transporter TM0544 {Thermotoga mariti 100.0
d1l2ta_230 MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 100.0
d3b60a1253 Multidrug resistance ABC transporter MsbA, C-termi 100.0
d3d31a2229 Sulfate/molybdate ABC transporter, ATP-binding pro 100.0
d1b0ua_258 ATP-binding subunit of the histidine permease {Sal 100.0
d1mv5a_242 Multidrug resistance ABC transporter LmrA, C-termi 100.0
d1ji0a_240 Branched chain aminoacid ABC transporter {Thermoto 100.0
d1vpla_238 Putative ABC transporter TM0544 {Thermotoga mariti 100.0
d1ji0a_240 Branched chain aminoacid ABC transporter {Thermoto 100.0
d1g6ha_254 MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 100.0
d1g6ha_254 MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 100.0
d1b0ua_258 ATP-binding subunit of the histidine permease {Sal 100.0
d2onka1240 Molybdate/tungstate import ATP-binding protein Wtp 100.0
d2onka1240 Molybdate/tungstate import ATP-binding protein Wtp 100.0
d2pmka1241 Haemolysin B ATP-binding protein {Escherichia coli 100.0
d1jj7a_251 Peptide transporter Tap1, C-terminal ABC domain {H 100.0
d2hyda1255 Putative multidrug export ATP-binding/permease pro 100.0
d1mv5a_242 Multidrug resistance ABC transporter LmrA, C-termi 100.0
d3b60a1253 Multidrug resistance ABC transporter MsbA, C-termi 100.0
d1r0wa_281 Cystic fibrosis transmembrane conductance regulato 100.0
d1r0wa_281 Cystic fibrosis transmembrane conductance regulato 100.0
d1l7vc_231 ABC transporter involved in vitamin B12 uptake, Bt 100.0
d1l7vc_231 ABC transporter involved in vitamin B12 uptake, Bt 100.0
d1sgwa_200 Putative ABC transporter PF0895 {Pyrococcus furios 100.0
d1sgwa_200 Putative ABC transporter PF0895 {Pyrococcus furios 100.0
g1f2t.1292 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 99.81
g1f2t.1292 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 99.71
g1ii8.1369 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 99.62
g1ii8.1369 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 99.46
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 99.35
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 99.28
d1e69a_308 Smc head domain {Thermotoga maritima [TaxId: 2336] 99.12
d1e69a_308 Smc head domain {Thermotoga maritima [TaxId: 2336] 98.88
d1w1wa_427 Smc head domain {Baker's yeast (Saccharomyces cere 98.87
g1xew.1329 Smc head domain {Pyrococcus furiosus [TaxId: 2261] 98.8
d1w1wa_427 Smc head domain {Baker's yeast (Saccharomyces cere 98.43
g1xew.1329 Smc head domain {Pyrococcus furiosus [TaxId: 2261] 98.35
d1ewqa2224 DNA repair protein MutS, the C-terminal domain {Th 97.85
d1wb9a2234 DNA repair protein MutS, the C-terminal domain {Es 97.8
d1cr2a_277 Gene 4 protein (g4p, DNA primase), helicase domain 97.67
d1cr2a_277 Gene 4 protein (g4p, DNA primase), helicase domain 97.66
d1ewqa2224 DNA repair protein MutS, the C-terminal domain {Th 97.51
d1tf7a2242 Circadian clock protein KaiC {Synechococcus sp. st 97.48
d1nlfa_274 Hexameric replicative helicase repA {Escherichia c 97.31
d1u0la2225 Probable GTPase EngC (YjeQ), C-terminal domain {Th 97.3
d1wb9a2234 DNA repair protein MutS, the C-terminal domain {Es 97.22
d1zp6a1176 Hypothetical protein Atu3015 {Agrobacterium tumefa 97.13
d1u0la2225 Probable GTPase EngC (YjeQ), C-terminal domain {Th 97.0
d1np6a_170 Molybdopterin-guanine dinucleotide biosynthesis pr 96.95
d1znwa1182 Guanylate kinase {Mycobacterium tuberculosis [TaxI 96.93
d1nlfa_274 Hexameric replicative helicase repA {Escherichia c 96.83
d1g6oa_323 Hexameric traffic ATPase, HP0525 {Helicobacter pyl 96.82
d1t9ha2231 Probable GTPase EngC (YjeQ), C-terminal domain {Ba 96.82
d1knqa_171 Gluconate kinase {Escherichia coli [TaxId: 562]} 96.74
d1znwa1182 Guanylate kinase {Mycobacterium tuberculosis [TaxI 96.69
d1m8pa3183 ATP sulfurylase C-terminal domain {Fungus (Penicil 96.69
d1xjca_165 Molybdopterin-guanine dinucleotide biosynthesis pr 96.68
d1n0wa_242 DNA repair protein Rad51, catalytic domain {Human 96.63
d1p9ra_401 Extracellular secretion NTPase EpsE {Vibrio choler 96.61
d1lw7a2192 Transcriptional regulator NadR, ribosylnicotinamid 96.6
d2bdta1176 Hypothetical protein BH3686 {Bacillus halodurans [ 96.58
d1s96a_205 Guanylate kinase {Escherichia coli [TaxId: 562]} 96.57
d1gvnb_273 Plasmid maintenance system epsilon/zeta, toxin zet 96.57
d1y63a_174 Probable kinase LmjF30.1890 {Leishmania major [Tax 96.53
d1lv7a_256 AAA domain of cell division protein FtsH {Escheric 96.48
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 96.47
d2i3ba1189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 96.47
d1qhxa_178 Chloramphenicol phosphotransferase {Streptomyces v 96.46
d1ak2a1190 Adenylate kinase {Cow (Bos taurus), mitochondrial 96.43
d1yrba1244 ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss 96.42
d1t9ha2231 Probable GTPase EngC (YjeQ), C-terminal domain {Ba 96.41
d2i1qa2258 DNA repair protein Rad51, catalytic domain {Archae 96.39
d1svia_195 Probable GTPase EngB {Bacillus subtilis [TaxId: 14 96.39
d1zp6a1176 Hypothetical protein Atu3015 {Agrobacterium tumefa 96.38
d1rkba_173 Adenylate kinase {Human (Homo sapiens), isoenzyme 96.37
d1np6a_170 Molybdopterin-guanine dinucleotide biosynthesis pr 96.36
d1qf9a_194 UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 96.34
d3adka_194 Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} 96.31
d1s96a_205 Guanylate kinase {Escherichia coli [TaxId: 562]} 96.3
d1svia_195 Probable GTPase EngB {Bacillus subtilis [TaxId: 14 96.26
d1tf7a1242 Circadian clock protein KaiC {Synechococcus sp. st 96.25
d1g41a_443 HslU {Haemophilus influenzae [TaxId: 727]} 96.24
d1ukza_196 Uridylate kinase {Baker's yeast (Saccharomyces cer 96.22
d1szpa2251 DNA repair protein Rad51, catalytic domain {Baker' 96.2
d1khta_190 Adenylate kinase {Archaeon Methanococcus voltae [T 96.16
d1ixza_247 AAA domain of cell division protein FtsH {Thermus 96.14
d1yj5a2172 5' polynucleotide kinase-3' phosphatase, C-termina 96.13
d1mkya2186 Probable GTPase Der, N-terminal and middle domains 96.12
d2p67a1327 LAO/AO transport system kinase ArgK {Escherichia c 96.08
d1teva_194 UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] 96.05
d1zina1182 Adenylate kinase {Bacillus stearothermophilus [Tax 96.04
d1x6va3195 Adenosine-5'phosphosulfate kinase (APS kinase) {Hu 96.02
d1ofha_309 HslU {Haemophilus influenzae [TaxId: 727]} 96.02
d1knqa_171 Gluconate kinase {Escherichia coli [TaxId: 562]} 96.01
d1qhla_222 Cell division protein MukB {Escherichia coli [TaxI 95.99
d1zaka1189 Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} 95.98
d1pzna2254 DNA repair protein Rad51, catalytic domain {Archae 95.96
d1qhla_222 Cell division protein MukB {Escherichia coli [TaxI 95.92
d1m8pa3183 ATP sulfurylase C-terminal domain {Fungus (Penicil 95.91
d1rz3a_198 Hypothetical protein rbstp0775 {Bacillus stearothe 95.88
d1y63a_174 Probable kinase LmjF30.1890 {Leishmania major [Tax 95.87
d1tf7a1242 Circadian clock protein KaiC {Synechococcus sp. st 95.85
d2cxxa1184 GTP-binding protein engB {Pyrococcus horikoshii [T 95.85
d1sq5a_308 Pantothenate kinase PanK {Escherichia coli [TaxId: 95.84
d1mkya1171 Probable GTPase Der, N-terminal and middle domains 95.83
d1xjca_165 Molybdopterin-guanine dinucleotide biosynthesis pr 95.82
d1s3ga1182 Adenylate kinase {Bacillus globisporus [TaxId: 145 95.82
d1nrjb_209 Signal recognition particle receptor beta-subunit 95.79
d1kaga_169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 95.78
d2ak3a1189 Adenylate kinase {Cow (Bos taurus), mitochondrial 95.77
d1kgda_178 Guanylate kinase-like domain of Cask {Human (Homo 95.76
d2qm8a1323 Metallochaperone MeaB {Methylobacterium extorquens 95.74
d1bifa1213 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata 95.7
d1gkya_186 Guanylate kinase {Baker's yeast (Saccharomyces cer 95.69
d2cdna1181 Adenylate kinase {Mycobacterium tuberculosis [TaxI 95.68
d2cxxa1184 GTP-binding protein engB {Pyrococcus horikoshii [T 95.68
d1v5wa_258 Meiotic recombination protein DMC1/LIM15 homolog { 95.67
d1sxja2253 Replication factor C1 {Baker's yeast (Saccharomyce 95.67
d1lnza2185 Obg GTP-binding protein middle domain {Bacillus su 95.66
d1e4va1179 Adenylate kinase {Escherichia coli [TaxId: 562]} 95.65
d1akya1180 Adenylate kinase {Baker's yeast (Saccharomyces cer 95.63
d1h65a_257 Chloroplast protein translocon GTPase Toc34 {Garde 95.63
d1lnza2185 Obg GTP-binding protein middle domain {Bacillus su 95.62
d1yrba1244 ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss 95.6
d1q3ta_223 CMP kinase {Streptococcus pneumoniae [TaxId: 1313] 95.6
d2gj8a1161 Probable tRNA modification GTPase TrmE (MnmE), G d 95.59
d1mkya2186 Probable GTPase Der, N-terminal and middle domains 95.58
d1ckea_225 CMP kinase {Escherichia coli [TaxId: 562]} 95.58
d1rz3a_198 Hypothetical protein rbstp0775 {Bacillus stearothe 95.52
d1lvga_190 Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 95.51
d1lv7a_256 AAA domain of cell division protein FtsH {Escheric 95.5
d1lw7a2192 Transcriptional regulator NadR, ribosylnicotinamid 95.49
d1tq4a_400 Interferon-inducible GTPase {Mouse (Mus musculus) 95.49
d1viaa_161 Shikimate kinase (AroK) {Campylobacter jejuni [Tax 95.45
d1gkya_186 Guanylate kinase {Baker's yeast (Saccharomyces cer 95.42
d1r7ra3265 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 95.42
d1tq4a_400 Interferon-inducible GTPase {Mouse (Mus musculus) 95.42
d1kgda_178 Guanylate kinase-like domain of Cask {Human (Homo 95.41
d2gj8a1161 Probable tRNA modification GTPase TrmE (MnmE), G d 95.38
d1e6ca_170 Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax 95.38
d1uj2a_213 Uridine-cytidine kinase 2 {Human (Homo sapiens) [T 95.38
d1d2na_246 Hexamerization domain of N-ethylmalemide-sensitive 95.37
d1h65a_257 Chloroplast protein translocon GTPase Toc34 {Garde 95.35
d1wf3a1178 GTPase Era, N-terminal domain {Thermus thermophilu 95.35
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 95.34
d1mkya1171 Probable GTPase Der, N-terminal and middle domains 95.34
d1egaa1179 GTPase Era, N-terminal domain {Escherichia coli [T 95.32
d1ixza_247 AAA domain of cell division protein FtsH {Thermus 95.32
d1in4a2238 Holliday junction helicase RuvB {Thermotoga mariti 95.32
d1nrjb_209 Signal recognition particle receptor beta-subunit 95.31
d2fh5b1207 Signal recognition particle receptor beta-subunit 95.31
d1n0wa_242 DNA repair protein Rad51, catalytic domain {Human 95.3
d1e32a2258 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 95.3
d1u94a1263 RecA protein, ATPase-domain {Escherichia coli [Tax 95.3
d1egaa1179 GTPase Era, N-terminal domain {Escherichia coli [T 95.28
d1nksa_194 Adenylate kinase {Archaeon Sulfolobus acidocaldari 95.27
d1udxa2180 Obg GTP-binding protein middle domain {Thermus the 95.27
d1tf7a2242 Circadian clock protein KaiC {Synechococcus sp. st 95.24
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 95.24
d1ixsb2239 Holliday junction helicase RuvB {Thermus thermophi 95.19
d1g6oa_323 Hexameric traffic ATPase, HP0525 {Helicobacter pyl 95.16
d1qhxa_178 Chloramphenicol phosphotransferase {Streptomyces v 95.16
d1lvga_190 Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 95.16
d1f6ba_186 SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 95.15
d1wf3a1178 GTPase Era, N-terminal domain {Thermus thermophilu 95.15
d2iyva1165 Shikimate kinase (AroK) {Mycobacterium tuberculosi 95.14
d1p9ra_401 Extracellular secretion NTPase EpsE {Vibrio choler 95.13
d1fnna2276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 95.09
d2bdta1176 Hypothetical protein BH3686 {Bacillus halodurans [ 95.09
d1wb1a4179 Elongation factor SelB, N-terminal domain {Methano 95.07
d1udxa2180 Obg GTP-binding protein middle domain {Thermus the 95.07
d1uj2a_213 Uridine-cytidine kinase 2 {Human (Homo sapiens) [T 95.06
d2fnaa2283 Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ 95.05
d1puia_188 Probable GTPase EngB {Escherichia coli [TaxId: 562 95.0
d1rkba_173 Adenylate kinase {Human (Homo sapiens), isoenzyme 94.99
d1ksha_165 ADP-ribosylation factor {Mouse (Mus musculus), ARL 94.97
d1sq5a_308 Pantothenate kinase PanK {Escherichia coli [TaxId: 94.96
d1f6ba_186 SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 94.94
d1m7ga_208 Adenosine-5'phosphosulfate kinase (APS kinase) {Fu 94.92
d1r8sa_160 ADP-ribosylation factor {Human (Homo sapiens), ARF 94.9
d1knxa2177 HPr kinase HprK C-terminal domain {Mycoplasma pneu 94.87
d1g8pa_333 ATPase subunit of magnesium chelatase, BchI {Rhodo 94.77
d1qf9a_194 UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 94.77
d1nn5a_209 Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 94.75
d2qtvb1166 SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta 94.74
d1x6va3195 Adenosine-5'phosphosulfate kinase (APS kinase) {Hu 94.73
d1puia_188 Probable GTPase EngB {Escherichia coli [TaxId: 562 94.68
d1zj6a1177 ADP-ribosylation factor {Human (Homo sapiens), ARL 94.64
d1ak2a1190 Adenylate kinase {Cow (Bos taurus), mitochondrial 94.63
d2i3ba1189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 94.61
d1okkd2207 GTPase domain of the signal recognition particle r 94.6
d1p5zb_241 Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 94.57
d1svma_362 Papillomavirus large T antigen helicase domain {Si 94.53
d1upta_169 ADP-ribosylation factor {Human (Homo sapiens), ARL 94.52
d1sxjd2237 Replication factor C2 {Baker's yeast (Saccharomyce 94.47
d1khta_190 Adenylate kinase {Archaeon Methanococcus voltae [T 94.46
d2p67a1327 LAO/AO transport system kinase ArgK {Escherichia c 94.46
d1ko7a2169 HPr kinase HprK C-terminal domain {Staphylococcus 94.45
d2vp4a1197 Deoxyribonucleoside kinase {Fruit fly (Drosophila 94.44
d1g7sa4227 Initiation factor IF2/eIF5b, N-terminal (G) domain 94.31
d1ukza_196 Uridylate kinase {Baker's yeast (Saccharomyces cer 94.3
d1ls1a2207 GTPase domain of the signal sequence recognition p 94.3
d4tmka_210 Thymidylate kinase {Escherichia coli [TaxId: 562]} 94.27
d1wb1a4179 Elongation factor SelB, N-terminal domain {Methano 94.26
d1kkma_176 HPr kinase HprK C-terminal domain {Lactobacillus c 94.25
d2qtvb1166 SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta 94.24
d1uf9a_191 Dephospho-CoA kinase {Thermus thermophilus [TaxId: 94.23
d1q3ta_223 CMP kinase {Streptococcus pneumoniae [TaxId: 1313] 94.16
d1a7ja_288 Phosphoribulokinase {Rhodobacter sphaeroides [TaxI 94.15
d1sxjb2224 Replication factor C4 {Baker's yeast (Saccharomyce 94.15
d1r8sa_160 ADP-ribosylation factor {Human (Homo sapiens), ARF 94.11
d1sxjc2227 Replication factor C3 {Baker's yeast (Saccharomyce 94.09
d1ni3a1296 YchF GTP-binding protein N-terminal domain {Fissio 94.09
d1zaka1189 Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} 94.04
d1viaa_161 Shikimate kinase (AroK) {Campylobacter jejuni [Tax 94.04
d1ls1a2207 GTPase domain of the signal sequence recognition p 94.03
d2fh5b1207 Signal recognition particle receptor beta-subunit 94.02
d1yj5a2172 5' polynucleotide kinase-3' phosphatase, C-termina 94.0
d1upta_169 ADP-ribosylation factor {Human (Homo sapiens), ARL 94.0
d1kaga_169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 93.95
d1ksha_165 ADP-ribosylation factor {Mouse (Mus musculus), ARL 93.94
d2qm8a1323 Metallochaperone MeaB {Methylobacterium extorquens 93.91
d1w5sa2287 CDC6-like protein APE0152, N-terminal domain {Aero 93.9
d2i1qa2258 DNA repair protein Rad51, catalytic domain {Archae 93.89
d1bifa1213 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata 93.88
d3adka_194 Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} 93.88
d1knxa2177 HPr kinase HprK C-terminal domain {Mycoplasma pneu 93.88
d1szpa2251 DNA repair protein Rad51, catalytic domain {Baker' 93.87
d2vp4a1197 Deoxyribonucleoside kinase {Fruit fly (Drosophila 93.85
d1m7ga_208 Adenosine-5'phosphosulfate kinase (APS kinase) {Fu 93.85
d1gvnb_273 Plasmid maintenance system epsilon/zeta, toxin zet 93.83
d1r6bx3315 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 93.83
d1odfa_286 Hypothetical protein Ygr205W {Baker's yeast (Sacch 93.81
d1fzqa_176 ADP-ribosylation factor {Mouse (Mus musculus), ARL 93.78
d1nn5a_209 Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 93.75
d1w44a_321 NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} 93.74
d1sxje2252 Replication factor C5 {Baker's yeast (Saccharomyce 93.73
d1e6ca_170 Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax 93.62
d1teva_194 UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] 93.6
d1kk1a3195 Initiation factor eIF2 gamma subunit, N-terminal ( 93.6
d1jwyb_306 Dynamin G domain {Dictyostelium discoideum [TaxId: 93.6
d1vmaa2213 GTPase domain of the signal recognition particle r 93.59
d1zj6a1177 ADP-ribosylation factor {Human (Homo sapiens), ARL 93.56
d1zd9a1164 ADP-ribosylation factor {Human (Homo sapiens), ARL 93.51
d1j8yf2211 GTPase domain of the signal sequence recognition p 93.51
d1kkma_176 HPr kinase HprK C-terminal domain {Lactobacillus c 93.49
d1tmka_214 Thymidylate kinase {Baker's yeast (Saccharomyces c 93.49
d1ofha_309 HslU {Haemophilus influenzae [TaxId: 727]} 93.48
d1wxqa1319 GTP-binding protein PH0525 {Pyrococcus horikoshii 93.39
d2f7sa1186 Rab27b {Human (Homo sapiens) [TaxId: 9606]} 93.33
d1p5zb_241 Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 93.3
d1okkd2207 GTPase domain of the signal recognition particle r 93.26
d2iyva1165 Shikimate kinase (AroK) {Mycobacterium tuberculosi 93.23
d1jjva_205 Dephospho-CoA kinase {Haemophilus influenzae [TaxI 93.22
d1mo6a1269 RecA protein, ATPase-domain {Mycobacterium tubercu 93.22
d3raba_169 Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} 93.2
d2qy9a2211 GTPase domain of the signal recognition particle r 93.2
d2f7sa1186 Rab27b {Human (Homo sapiens) [TaxId: 9606]} 93.19
d1a7ja_288 Phosphoribulokinase {Rhodobacter sphaeroides [TaxI 93.15
d1zina1182 Adenylate kinase {Bacillus stearothermophilus [Tax 93.12
d1uf9a_191 Dephospho-CoA kinase {Thermus thermophilus [TaxId: 93.1
d1xzpa2160 TrmE GTPase domain {Thermotoga maritima [TaxId: 23 93.07
d1ky3a_175 Rab-related protein ypt7p {Baker's yeast (Saccharo 93.05
d1g7sa4227 Initiation factor IF2/eIF5b, N-terminal (G) domain 93.01
d1xp8a1268 RecA protein, ATPase-domain {Deinococcus radiodura 93.01
d1nksa_194 Adenylate kinase {Archaeon Sulfolobus acidocaldari 92.99
d2gjsa1168 Rad {Human (Homo sapiens) [TaxId: 9606]} 92.98
d1vhta_208 Dephospho-CoA kinase {Escherichia coli [TaxId: 562 92.96
d2akab1299 Dynamin G domain {Rat (Rattus norvegicus) [TaxId: 92.84
d2f9la1175 Rab11b {Human (Homo sapiens) [TaxId: 9606]} 92.84
d1wmsa_174 Rab9a {Human (Homo sapiens) [TaxId: 9606]} 92.83
d1pzna2254 DNA repair protein Rad51, catalytic domain {Archae 92.81
d1s3ga1182 Adenylate kinase {Bacillus globisporus [TaxId: 145 92.71
d1jala1278 YchF GTP-binding protein N-terminal domain {Haemop 92.69
d1z2aa1164 Rab23 {Mouse (Mus musculus) [TaxId: 10090]} 92.69
d1xzpa2160 TrmE GTPase domain {Thermotoga maritima [TaxId: 23 92.67
d1htwa_158 Hypothetical protein HI0065 {Haemophilus influenza 92.66
d1fzqa_176 ADP-ribosylation factor {Mouse (Mus musculus), ARL 92.62
d2fnaa2283 Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ 92.62
d1v5wa_258 Meiotic recombination protein DMC1/LIM15 homolog { 92.61
d1ctqa_166 cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 92.57
d2a5ja1173 Rab2b {Human (Homo sapiens) [TaxId: 9606]} 92.5
d1f5na2277 Interferon-induced guanylate-binding protein 1 (GB 92.49
d1zd9a1164 ADP-ribosylation factor {Human (Homo sapiens), ARL 92.48
d1ckea_225 CMP kinase {Escherichia coli [TaxId: 562]} 92.47
d1f5na2277 Interferon-induced guanylate-binding protein 1 (GB 92.46
d1tmka_214 Thymidylate kinase {Baker's yeast (Saccharomyces c 92.46
d2qn6a3205 Initiation factor eIF2 gamma subunit, N-terminal ( 92.43
d1nija1222 Hypothetical protein YjiA, N-terminal domain {Esch 92.41
d2g3ya1172 GTP-binding protein GEM {Human (Homo sapiens) [Tax 92.39
d1gsia_208 Thymidylate kinase {Mycobacterium tuberculosis [Ta 92.39
d1e4va1179 Adenylate kinase {Escherichia coli [TaxId: 562]} 92.37
d3raba_169 Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} 92.35
d2erxa1171 di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 92.34
d1sxja2253 Replication factor C1 {Baker's yeast (Saccharomyce 92.31
d2bcgy1194 GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisi 92.23
d2ak3a1189 Adenylate kinase {Cow (Bos taurus), mitochondrial 92.2
d1moza_182 ADP-ribosylation factor {Baker's yeast (Saccharomy 92.14
d2cdna1181 Adenylate kinase {Mycobacterium tuberculosis [TaxI 92.13
d1wxqa1319 GTP-binding protein PH0525 {Pyrococcus horikoshii 92.13
d1vmaa2213 GTPase domain of the signal recognition particle r 92.09
d1vg8a_184 Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} 92.09
d2ew1a1171 Rab30 {Human (Homo sapiens) [TaxId: 9606]} 92.08
d1odfa_286 Hypothetical protein Ygr205W {Baker's yeast (Sacch 92.06
d2erya1171 r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 92.03
d1g16a_166 Rab-related protein Sec4 {Baker's yeast (Saccharom 92.02
d1kaoa_167 Rap2a {Human (Homo sapiens) [TaxId: 9606]} 92.0
d1jwyb_306 Dynamin G domain {Dictyostelium discoideum [TaxId: 92.0
d1x3sa1177 Rab18 {Human (Homo sapiens) [TaxId: 9606]} 91.98
d2dy1a2267 Elongation factor G (EF-G), N-terminal (G) domain 91.97
d1ky3a_175 Rab-related protein ypt7p {Baker's yeast (Saccharo 91.95
d4tmka_210 Thymidylate kinase {Escherichia coli [TaxId: 562]} 91.94
d2bv3a2276 Elongation factor G (EF-G), N-terminal (G) domain 91.85
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 91.84
d2akab1299 Dynamin G domain {Rat (Rattus norvegicus) [TaxId: 91.84
d1z0fa1166 Rab14 {Human (Homo sapiens) [TaxId: 9606]} 91.8
d1j8yf2211 GTPase domain of the signal sequence recognition p 91.77
d1ko7a2169 HPr kinase HprK C-terminal domain {Staphylococcus 91.75
d1e0sa_173 ADP-ribosylation factor {Human (Homo sapiens), ARF 91.75
d1ctqa_166 cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 91.69
d1xtqa1167 GTP-binding protein RheB {Human (Homo sapiens) [Ta 91.68
d2bmea1174 Rab4a {Human (Homo sapiens) [TaxId: 9606]} 91.65
d1l8qa2213 Chromosomal replication initiation factor DnaA {Aq 91.58
d1z2aa1164 Rab23 {Mouse (Mus musculus) [TaxId: 10090]} 91.56
d2fu5c1173 Rab8a {Mouse (Mus musculus) [TaxId: 10090]} 91.52
d1akya1180 Adenylate kinase {Baker's yeast (Saccharomyces cer 91.46
d1u94a1263 RecA protein, ATPase-domain {Escherichia coli [Tax 91.45
d1jjva_205 Dephospho-CoA kinase {Haemophilus influenzae [TaxI 91.38
d2f9la1175 Rab11b {Human (Homo sapiens) [TaxId: 9606]} 91.36
d1moza_182 ADP-ribosylation factor {Baker's yeast (Saccharomy 91.35
d2gjsa1168 Rad {Human (Homo sapiens) [TaxId: 9606]} 91.34
d1w36d1359 Exodeoxyribonuclease V alpha chain (RecD) {Escheri 91.31
d2qy9a2211 GTPase domain of the signal recognition particle r 91.29
d1xpua3289 Transcription termination factor Rho, ATPase domai 91.28
d2erxa1171 di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 91.26
d1z06a1165 Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} 91.26
d1pjra1318 DEXX box DNA helicase {Bacillus stearothermophilus 91.26
d1vg8a_184 Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} 91.22
d2c78a3204 Elongation factor Tu (EF-Tu), N-terminal (G) domai 91.21
d1xpua3289 Transcription termination factor Rho, ATPase domai 91.1
d1xtqa1167 GTP-binding protein RheB {Human (Homo sapiens) [Ta 91.09
d1e9ra_433 Bacterial conjugative coupling protein TrwB {Esche 91.09
d1uaaa1306 DEXX box DNA helicase {Escherichia coli, RepD [Tax 91.08
d1in4a2238 Holliday junction helicase RuvB {Thermotoga mariti 91.07
d1yzqa1164 Rab6 {Human (Homo sapiens) [TaxId: 9606]} 91.06
d1r6bx3315 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 91.02
d1htwa_158 Hypothetical protein HI0065 {Haemophilus influenza 90.95
d1mh1a_183 Rac {Human (Homo sapiens) [TaxId: 9606]} 90.9
d1g16a_166 Rab-related protein Sec4 {Baker's yeast (Saccharom 90.84
d1g41a_443 HslU {Haemophilus influenzae [TaxId: 727]} 90.83
d1kmqa_177 RhoA {Human (Homo sapiens) [TaxId: 9606]} 90.81
d2g3ya1172 GTP-binding protein GEM {Human (Homo sapiens) [Tax 90.75
d1azta2221 Transducin (alpha subunit) {Cow (Bos taurus) [TaxI 90.73
d2bmja1175 Centaurin gamma 1, G domain {Human (Homo sapiens) 90.73
d1r6bx2268 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 90.71
d1z08a1167 Rab21 {Human (Homo sapiens) [TaxId: 9606]} 90.69
d2atva1168 Ras-like estrogen-regulated growth inhibitor, RERG 90.64
d2ew1a1171 Rab30 {Human (Homo sapiens) [TaxId: 9606]} 90.64
d2a5ja1173 Rab2b {Human (Homo sapiens) [TaxId: 9606]} 90.62
d1kaoa_167 Rap2a {Human (Homo sapiens) [TaxId: 9606]} 90.62
d2fn4a1173 r-Ras {Human (Homo sapiens) [TaxId: 9606]} 90.62
d1i2ma_170 Ran {Human (Homo sapiens) [TaxId: 9606]} 90.61
d1wmsa_174 Rab9a {Human (Homo sapiens) [TaxId: 9606]} 90.58
d2bcgy1194 GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisi 90.57
d1gsia_208 Thymidylate kinase {Mycobacterium tuberculosis [Ta 90.45
d1z0ja1167 Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} 90.43
d2ocpa1241 Deoxyguanosine kinase {Human (Homo sapiens) [TaxId 90.42
d1x3sa1177 Rab18 {Human (Homo sapiens) [TaxId: 9606]} 90.41
d1vhta_208 Dephospho-CoA kinase {Escherichia coli [TaxId: 562 90.38
d2g6ba1170 Rab26 {Human (Homo sapiens) [TaxId: 9606]} 90.36
d2erya1171 r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 90.31
d1r7ra3265 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 90.31
d1ek0a_170 Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [T 90.27
d1kk1a3195 Initiation factor eIF2 gamma subunit, N-terminal ( 90.25
d1z0fa1166 Rab14 {Human (Homo sapiens) [TaxId: 9606]} 90.22
d1i2ma_170 Ran {Human (Homo sapiens) [TaxId: 9606]} 90.21
d1u8za_168 Ras-related protein RalA {Cotton-top tamarin (Sagu 90.17
d1z06a1165 Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} 90.16
d1zcba2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 90.15
d1d2ea3196 Elongation factor Tu (EF-Tu), N-terminal (G) domai 90.15
d1qvra3315 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 90.13
d1r2qa_170 Rab5a {Human (Homo sapiens) [TaxId: 9606]} 90.11
d1deka_241 Deoxynucleoside monophosphate kinase {Bacteriophag 90.11
d1d2na_246 Hexamerization domain of N-ethylmalemide-sensitive 90.09
d1mh1a_183 Rac {Human (Homo sapiens) [TaxId: 9606]} 90.0
d1ixsb2239 Holliday junction helicase RuvB {Thermus thermophi 89.89
d1sxjd2237 Replication factor C2 {Baker's yeast (Saccharomyce 89.85
d2dy1a2267 Elongation factor G (EF-G), N-terminal (G) domain 89.83
d1ni3a1296 YchF GTP-binding protein N-terminal domain {Fissio 89.82
d1x1ra1169 Ras-related protein M-Ras (XRas) {Mouse (Mus muscu 89.8
d1fnna2276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 89.71
d1e0sa_173 ADP-ribosylation factor {Human (Homo sapiens), ARF 89.67
d2atxa1185 RhoQ {Human (Homo sapiens) [TaxId: 9606]} 89.63
d2a5yb3277 CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI 89.62
d2fu5c1173 Rab8a {Mouse (Mus musculus) [TaxId: 10090]} 89.58
d1yzqa1164 Rab6 {Human (Homo sapiens) [TaxId: 9606]} 89.51
d1njfa_239 delta prime subunit of DNA polymerase III, N-domai 89.51
d2bv3a2276 Elongation factor G (EF-G), N-terminal (G) domain 89.5
d1a5ta2207 delta prime subunit of DNA polymerase III, N-domai 89.41
d1kmqa_177 RhoA {Human (Homo sapiens) [TaxId: 9606]} 89.37
d1z0ja1167 Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} 89.37
d2bmea1174 Rab4a {Human (Homo sapiens) [TaxId: 9606]} 89.32
d1azta2221 Transducin (alpha subunit) {Cow (Bos taurus) [TaxI 89.24
d1e32a2258 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 89.18
d2ngra_191 CDC42 {Human (Homo sapiens) [TaxId: 9606]} 89.11
d1z08a1167 Rab21 {Human (Homo sapiens) [TaxId: 9606]} 89.08
d2fn4a1173 r-Ras {Human (Homo sapiens) [TaxId: 9606]} 88.94
d1zcba2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 88.85
d1um8a_364 ClpX {Helicobacter pylori [TaxId: 210]} 88.85
d1u8za_168 Ras-related protein RalA {Cotton-top tamarin (Sagu 88.67
d2atxa1185 RhoQ {Human (Homo sapiens) [TaxId: 9606]} 88.63
d1ek0a_170 Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [T 88.63
d2qn6a3205 Initiation factor eIF2 gamma subunit, N-terminal ( 88.62
d1m7ba_179 RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} 88.48
d1sxjb2224 Replication factor C4 {Baker's yeast (Saccharomyce 88.47
d1c1ya_167 Rap1A {Human (Homo sapiens) [TaxId: 9606]} 88.43
d1jala1278 YchF GTP-binding protein N-terminal domain {Haemop 88.27
d1x1ra1169 Ras-related protein M-Ras (XRas) {Mouse (Mus muscu 88.26
d2g6ba1170 Rab26 {Human (Homo sapiens) [TaxId: 9606]} 88.25
d1xp8a1268 RecA protein, ATPase-domain {Deinococcus radiodura 87.99
d1r2qa_170 Rab5a {Human (Homo sapiens) [TaxId: 9606]} 87.89
d2atva1168 Ras-like estrogen-regulated growth inhibitor, RERG 87.88
d1jbka_195 ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} 87.86
d1puja_273 Probable GTPase YlqF {Bacillus subtilis [TaxId: 14 87.69
d2bmja1175 Centaurin gamma 1, G domain {Human (Homo sapiens) 87.36
d1mo6a1269 RecA protein, ATPase-domain {Mycobacterium tubercu 87.27
d2c78a3204 Elongation factor Tu (EF-Tu), N-terminal (G) domai 87.26
d1p6xa_333 Thymidine kinase {Equine herpesvirus type 4 [TaxId 87.25
d2ngra_191 CDC42 {Human (Homo sapiens) [TaxId: 9606]} 87.15
d1sxjc2227 Replication factor C3 {Baker's yeast (Saccharomyce 87.12
d1sxje2252 Replication factor C5 {Baker's yeast (Saccharomyce 86.74
d1nija1222 Hypothetical protein YjiA, N-terminal domain {Esch 86.71
d1w5sa2287 CDC6-like protein APE0152, N-terminal domain {Aero 86.68
d1m7ba_179 RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} 86.67
d2jdid3276 Central domain of beta subunit of F1 ATP synthase 86.65
d1c1ya_167 Rap1A {Human (Homo sapiens) [TaxId: 9606]} 86.6
d1zunb3222 Sulfate adenylate transferase subunit cysN/C, EF-T 86.54
d1qvra2387 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 86.39
d2jdid3276 Central domain of beta subunit of F1 ATP synthase 86.15
d2ocpa1241 Deoxyguanosine kinase {Human (Homo sapiens) [TaxId 85.83
d1n0ua2341 Elongation factor 2 (eEF-2), N-terminal (G) domain 85.82
d2bcjq2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 85.71
d1puja_273 Probable GTPase YlqF {Bacillus subtilis [TaxId: 14 85.65
d1e2ka_329 Thymidine kinase {Herpes simplex virus type 1, dif 85.52
d1l8qa2213 Chromosomal replication initiation factor DnaA {Aq 85.12
d1qvra3315 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 85.09
d1svma_362 Papillomavirus large T antigen helicase domain {Si 84.99
d1jnya3224 Elongation factor eEF-1alpha, N-terminal (G) domai 84.29
d1tuea_205 Replication protein E1 helicase domain {Human papi 83.9
d1osna_331 Thymidine kinase {Varicella-zoster virus [TaxId: 1 83.81
d1svsa1195 Transducin (alpha subunit) {Rat (Rattus norvegicus 83.58
d1r5ba3245 Eukaryotic peptide chain release factor ERF2, G do 83.36
d1deka_241 Deoxynucleoside monophosphate kinase {Bacteriophag 83.27
d1u0ja_267 Rep 40 protein helicase domain {Adeno-associated v 83.26
d2bcjq2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 82.98
d2bmfa2305 Dengue virus helicase {Dengue virus type 2 [TaxId: 82.55
d1w44a_321 NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} 82.52
d1um8a_364 ClpX {Helicobacter pylori [TaxId: 210]} 82.52
d1d2ea3196 Elongation factor Tu (EF-Tu), N-terminal (G) domai 82.37
g1qhh.1623 DEXX box DNA helicase {Bacillus stearothermophilus 82.26
d1e2ka_329 Thymidine kinase {Herpes simplex virus type 1, dif 82.03
d1f60a3239 Elongation factor eEF-1alpha, N-terminal (G) domai 81.63
d1j3ba1318 Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxalo 81.19
d1r6bx2268 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 80.87
d1n0ua2341 Elongation factor 2 (eEF-2), N-terminal (G) domain 80.78
d2olra1313 Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxalo 80.39
d1g8pa_333 ATPase subunit of magnesium chelatase, BchI {Rhodo 80.31
>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: ABC transporter ATPase domain-like
domain: Maltose transport protein MalK, N-terminal domain
species: Escherichia coli [TaxId: 562]
Probab=100.00  E-value=0  Score=335.19  Aligned_cols=206  Identities=24%  Similarity=0.346  Sum_probs=139.6

Q ss_pred             EEEECCEEEEECCEEEEEECCCCCCHHHHHHHHHCCCCCCCCCEEEEEECCCCCCCCCC-CCEEEEECCCCCCCCCCCHH
Q ss_conf             46414146784892999985999977999999948989999811299996833798675-63189983788879999999
Q 000523          166 TILKDVSGVIKPGRLTLLLGPPSSGKTTLLLALAGKLDPTLKVSGTVTYNGHDMDEFVP-QRTAAYISQHDNHIGEMTVR  244 (1445)
Q Consensus       166 ~iL~~vs~~i~pG~~~~ilGp~GsGKSTLL~~LaG~~~~~~~~~G~v~~nG~~~~~~~~-~~~~~yv~Q~d~~~~~lTVr  244 (1445)
                      ++|+|+|+.+++||+++|+||||||||||+++|+|.++|+   +|+|.+||.++.+..+ ++.++||+|++.+++.+||+
T Consensus        14 ~~l~~isl~i~~Gei~~liGpsGsGKSTLl~~i~Gl~~p~---sG~I~i~g~~i~~~~~~~r~ig~v~Q~~~l~~~~tv~   90 (232)
T d2awna2          14 VVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETIT---SGDLFIGEKRMNDTPPAERGVGMVFQSYALYPHLSVA   90 (232)
T ss_dssp             EEEEEEEEEECTTCEEEEECCTTSSHHHHHHHHHTSSCCS---EEEEEESSSCCTTSCGGGTCEEEECSSCCC-------
T ss_pred             EEEEEEEEEECCCCEEEEECCCCCHHHHHHHHHHCCCCCC---CCEEEECCEECCCCCHHHCEEEEECCCCCCCCCHHHH
T ss_conf             9981117788699899999899982999999996587888---8889999997788864443222343342026433378


Q ss_pred             HHHHHHHHHCCCCCHHHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCC
Q ss_conf             99997677117874145659989999871999999978999998633344769999999990995435543346446667
Q 000523          245 ETLAFSARCQGVGTRYEMLTELARREKAAGIKPDPDIDVYMKAIATEGQEANVITDYYLKVLGLDVCADTMVGDEMIRGI  324 (1445)
Q Consensus       245 Etl~f~~~~~g~~~~~~~~~~~~~~~~~~~~~pd~d~d~~~ka~~~~~~~~~~~~d~il~~lgL~~~~dt~VG~~~~~gl  324 (1445)
                      ||+.|+.++++...                                  ++...+++.+++.++|++..|..+.     .|
T Consensus        91 eni~~~~~~~~~~~----------------------------------~~~~~~v~~~l~~~~l~~~~~~~~~-----~L  131 (232)
T d2awna2          91 ENMSFGLKLAGAKK----------------------------------EVINQRVNQVAEVLQLAHLLDRKPK-----AL  131 (232)
T ss_dssp             ------------------------------------------------CHHHHHHHHHHHHC------------------
T ss_pred             HHHHHHHHHCCCCH----------------------------------HHHHHHHHHHHHHCCCHHHHHCCHH-----HC
T ss_conf             89789998759988----------------------------------9999999999975788656648965-----69


Q ss_pred             CHHHHHHHHHHHHHHCCCCCCEEECCCCCCCHHHHHHHHHHHHHHHHHCCCEEEEEEECCCHHHHHHCCEEEEECCCEEE
Q ss_conf             74345689999997349852422269989998989999999999877039869999806910488305819995597399
Q 000523          325 SGGQKKRVTTGEMMVGPALALFMDEISTGLDSSTTFQIVNCLRQNIHINSGTAVISLLQPAPETYDLFDDIILLSDGQIV  404 (1445)
Q Consensus       325 SGGqrkRvsia~~l~~~~~vl~lDEptsgLDs~t~~~i~~~L~~~~~~~~~t~iisl~Q~~~~~~~~fD~i~lL~~G~iv  404 (1445)
                      ||||||||+||++|+.+|++++|||||+|||+.++.++++.|+++.+..+.|+++ ++|...++..++|+|++|.+|+++
T Consensus       132 SGGqkQRvaiAraL~~~P~illlDEPts~LD~~~~~~i~~~l~~l~~~~g~tii~-vTHd~~~a~~~~dri~vm~~G~iv  210 (232)
T d2awna2         132 SGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRLGRTMIY-VTHDQVEAMTLADKIVVLDAGRVA  210 (232)
T ss_dssp             --------CHHHHHHTCCSEEEEESTTTTSCHHHHHHHHHHHHHHHHHSCCEEEE-EESCHHHHHHHCSEEEEEETTEEE
T ss_pred             CHHHHHHHHHHHHHHCCCCEEEECCCCCCCCHHHHHHHHHHHHHHHHHCCCEEEE-EECCHHHHHHHCCEEEEEECCEEE
T ss_conf             9999999999999703998899758887889889989999999998742987999-948999999969999999799999


Q ss_pred             EECCHHHHHH
Q ss_conf             8439567999
Q 000523          405 YQGPRELVLE  414 (1445)
Q Consensus       405 y~G~~~~~~~  414 (1445)
                      ..|+.+++.+
T Consensus       211 ~~G~~~el~~  220 (232)
T d2awna2         211 QVGKPLELYH  220 (232)
T ss_dssp             EEECHHHHHH
T ss_pred             EEECHHHHHH
T ss_conf             9808999973



>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Back     information, alignment and structure
>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Back     information, alignment and structure
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Back     information, alignment and structure
>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Back     information, alignment and structure
>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Back     information, alignment and structure
>d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1e69a_ c.37.1.12 (A:) Smc head domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1e69a_ c.37.1.12 (A:) Smc head domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1w1wa_ c.37.1.12 (A:) Smc head domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1w1wa_ c.37.1.12 (A:) Smc head domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ewqa2 c.37.1.12 (A:542-765) DNA repair protein MutS, the C-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1wb9a2 c.37.1.12 (A:567-800) DNA repair protein MutS, the C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} Back     information, alignment and structure
>d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} Back     information, alignment and structure
>d1ewqa2 c.37.1.12 (A:542-765) DNA repair protein MutS, the C-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1wb9a2 c.37.1.12 (A:567-800) DNA repair protein MutS, the C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} Back     information, alignment and structure
>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qhla_ c.37.1.12 (A:) Cell division protein MukB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1qhla_ c.37.1.12 (A:) Cell division protein MukB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} Back     information, alignment and structure
>d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1tq4a_ c.37.1.8 (A:) Interferon-inducible GTPase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1tq4a_ c.37.1.8 (A:) Interferon-inducible GTPase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1wb1a4 c.37.1.8 (A:1-179) Elongation factor SelB, N-terminal domain {Methanococcus maripaludis [TaxId: 39152]} Back     information, alignment and structure
>d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} Back     information, alignment and structure
>d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} Back     information, alignment and structure
>d1knxa2 c.91.1.2 (A:133-309) HPr kinase HprK C-terminal domain {Mycoplasma pneumoniae [TaxId: 2104]} Back     information, alignment and structure
>d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} Back     information, alignment and structure
>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} Back     information, alignment and structure
>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1p5zb_ c.37.1.1 (B:) Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Back     information, alignment and structure
>d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ko7a2 c.91.1.2 (A:130-298) HPr kinase HprK C-terminal domain {Staphylococcus xylosus [TaxId: 1288]} Back     information, alignment and structure
>d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1g7sa4 c.37.1.8 (A:1-227) Initiation factor IF2/eIF5b, N-terminal (G) domain {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wb1a4 c.37.1.8 (A:1-179) Elongation factor SelB, N-terminal domain {Methanococcus maripaludis [TaxId: 39152]} Back     information, alignment and structure
>d1kkma_ c.91.1.2 (A:) HPr kinase HprK C-terminal domain {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ni3a1 c.37.1.8 (A:11-306) YchF GTP-binding protein N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} Back     information, alignment and structure
>d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1knxa2 c.91.1.2 (A:133-309) HPr kinase HprK C-terminal domain {Mycoplasma pneumoniae [TaxId: 2104]} Back     information, alignment and structure
>d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} Back     information, alignment and structure
>d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kk1a3 c.37.1.8 (A:6-200) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Archaeon Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1jwyb_ c.37.1.8 (B:) Dynamin G domain {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} Back     information, alignment and structure
>d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d1kkma_ c.91.1.2 (A:) HPr kinase HprK C-terminal domain {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d1tmka_ c.37.1.1 (A:) Thymidylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1wxqa1 c.37.1.8 (A:1-319) GTP-binding protein PH0525 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p5zb_ c.37.1.1 (B:) Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1jjva_ c.37.1.1 (A:) Dephospho-CoA kinase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1g7sa4 c.37.1.8 (A:1-227) Initiation factor IF2/eIF5b, N-terminal (G) domain {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vhta_ c.37.1.1 (A:) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2akab1 c.37.1.8 (B:6-304) Dynamin G domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} Back     information, alignment and structure
>d1jala1 c.37.1.8 (A:1-278) YchF GTP-binding protein N-terminal domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1htwa_ c.37.1.18 (A:) Hypothetical protein HI0065 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f5na2 c.37.1.8 (A:7-283) Interferon-induced guanylate-binding protein 1 (GBP1), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} Back     information, alignment and structure
>d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1f5na2 c.37.1.8 (A:7-283) Interferon-induced guanylate-binding protein 1 (GBP1), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tmka_ c.37.1.1 (A:) Thymidylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2qn6a3 c.37.1.8 (A:2-206) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1nija1 c.37.1.10 (A:2-223) Hypothetical protein YjiA, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} Back     information, alignment and structure
>d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1wxqa1 c.37.1.8 (A:1-319) GTP-binding protein PH0525 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jwyb_ c.37.1.8 (B:) Dynamin G domain {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dy1a2 c.37.1.8 (A:8-274) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus, EF-G-2 [TaxId: 274]} Back     information, alignment and structure
>d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bv3a2 c.37.1.8 (A:7-282) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2akab1 c.37.1.8 (B:6-304) Dynamin G domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d1ko7a2 c.91.1.2 (A:130-298) HPr kinase HprK C-terminal domain {Staphylococcus xylosus [TaxId: 1288]} Back     information, alignment and structure
>d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} Back     information, alignment and structure
>d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jjva_ c.37.1.1 (A:) Dephospho-CoA kinase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} Back     information, alignment and structure
>d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xpua3 c.37.1.11 (A:129-417) Transcription termination factor Rho, ATPase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} Back     information, alignment and structure
>d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2c78a3 c.37.1.8 (A:9-212) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1xpua3 c.37.1.11 (A:129-417) Transcription termination factor Rho, ATPase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e9ra_ c.37.1.11 (A:) Bacterial conjugative coupling protein TrwB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1htwa_ c.37.1.18 (A:) Hypothetical protein HI0065 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1azta2 c.37.1.8 (A:35-65,A:202-391) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2bmja1 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i2ma_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ocpa1 c.37.1.1 (A:37-277) Deoxyguanosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vhta_ c.37.1.1 (A:) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1kk1a3 c.37.1.8 (A:6-200) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Archaeon Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i2ma_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} Back     information, alignment and structure
>d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1d2ea3 c.37.1.8 (A:55-250) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Cow (Bos taurus), mitochondrial [TaxId: 9913]} Back     information, alignment and structure
>d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1deka_ c.37.1.1 (A:) Deoxynucleoside monophosphate kinase {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2dy1a2 c.37.1.8 (A:8-274) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus, EF-G-2 [TaxId: 274]} Back     information, alignment and structure
>d1ni3a1 c.37.1.8 (A:11-306) YchF GTP-binding protein N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} Back     information, alignment and structure
>d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bv3a2 c.37.1.8 (A:7-282) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1azta2 c.37.1.8 (A:35-65,A:202-391) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} Back     information, alignment and structure
>d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2qn6a3 c.37.1.8 (A:2-206) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jala1 c.37.1.8 (A:1-278) YchF GTP-binding protein N-terminal domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1puja_ c.37.1.8 (A:) Probable GTPase YlqF {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2bmja1 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2c78a3 c.37.1.8 (A:9-212) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1p6xa_ c.37.1.1 (A:) Thymidine kinase {Equine herpesvirus type 4 [TaxId: 10331]} Back     information, alignment and structure
>d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nija1 c.37.1.10 (A:2-223) Hypothetical protein YjiA, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2jdid3 c.37.1.11 (D:82-357) Central domain of beta subunit of F1 ATP synthase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zunb3 c.37.1.8 (B:16-237) Sulfate adenylate transferase subunit cysN/C, EF-Tu domain G-like domain {Pseudomonas syringae pv. tomato [TaxId: 323]} Back     information, alignment and structure
>d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2jdid3 c.37.1.11 (D:82-357) Central domain of beta subunit of F1 ATP synthase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2ocpa1 c.37.1.1 (A:37-277) Deoxyguanosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n0ua2 c.37.1.8 (A:3-343) Elongation factor 2 (eEF-2), N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2bcjq2 c.37.1.8 (Q:38-66,Q:184-354) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1puja_ c.37.1.8 (A:) Probable GTPase YlqF {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1e2ka_ c.37.1.1 (A:) Thymidine kinase {Herpes simplex virus type 1, different strains [TaxId: 10298]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Back     information, alignment and structure
>d1jnya3 c.37.1.8 (A:4-227) Elongation factor eEF-1alpha, N-terminal (G) domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1tuea_ c.37.1.20 (A:) Replication protein E1 helicase domain {Human papillomavirus type 18 [TaxId: 333761]} Back     information, alignment and structure
>d1osna_ c.37.1.1 (A:) Thymidine kinase {Varicella-zoster virus [TaxId: 10335]} Back     information, alignment and structure
>d1svsa1 c.37.1.8 (A:32-60,A:182-347) Transducin (alpha subunit) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1r5ba3 c.37.1.8 (A:215-459) Eukaryotic peptide chain release factor ERF2, G domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1deka_ c.37.1.1 (A:) Deoxynucleoside monophosphate kinase {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1u0ja_ c.37.1.20 (A:) Rep 40 protein helicase domain {Adeno-associated virus 2, AAV2 [TaxId: 10804]} Back     information, alignment and structure
>d2bcjq2 c.37.1.8 (Q:38-66,Q:184-354) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Back     information, alignment and structure
>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Back     information, alignment and structure
>d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1d2ea3 c.37.1.8 (A:55-250) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Cow (Bos taurus), mitochondrial [TaxId: 9913]} Back     information, alignment and structure
>d1e2ka_ c.37.1.1 (A:) Thymidine kinase {Herpes simplex virus type 1, different strains [TaxId: 10298]} Back     information, alignment and structure
>d1f60a3 c.37.1.8 (A:2-240) Elongation factor eEF-1alpha, N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1j3ba1 c.91.1.1 (A:212-529) Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1n0ua2 c.37.1.8 (A:3-343) Elongation factor 2 (eEF-2), N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2olra1 c.91.1.1 (A:228-540) Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} Back     information, alignment and structure