Citrus Sinensis ID: 000612

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------1000------1010------1020------1030------1040------1050------1060------1070------1080------1090------1100------1110------1120------1130------1140------1150------1160------1170------1180------1190------1200------1210------1220------1230------1240------1250------1260------1270------1280------1290------1300------1310------1320------1330------1340------1350------1360------1370------1380------1390-
MEGTHDIFMASTSLRRSASRWNTNSIGAFSRSSREEDDEEALKWAALEKLPTYNRLRKGILTTSRGEANEVDVYNLGLQERQRLIDKLVKVTDVDNERFLLKLKNRIDRVGIDLPKVEVRYEHLNVEAEAFLASNALPSFIKFYTNIFEDILNYLRIIPSKKRHLTILKDVSGVIKPGRLTLLLGPPSSGKTTLLLALAGKLDPTLKVSGTVTYNGHDMDEFVPQRTAAYISQHDNHIGEMTVRETLAFSARCQGVGTRYEMLTELARREKAAGIKPDPDIDVYMKAIATEGQEANVITDYYLKVLGLDVCADTMVGDEMIRGISGGQKKRVTTGEMMVGPALALFMDEISTGLDSSTTFQIVNCLRQNIHINSGTAVISLLQPAPETYDLFDDIILLSDGQIVYQGPRELVLEFFASMGFRCPKRKGVADFLQEVTSRKDQRQYWAHKEKPYRFVTVQEFAEAFQSFHVGQKISDELRTPFDKSKSHRAALTTETYGVGKRELLKANISRELLLMKRNSFVYIFKLIQIAFVAVVYMTLFLRTKMHKDTVTDGGIFAGATFFAITMVNFNGFSEISMTIAKLPVFYKQRDFRFFPPWAYAIPSWILKIPVSFLEVAVWVFLSYYVVGYDSNAGRFFKQYALLLGVNQMASALFRFIAVTGRNMVVANTFGSFALLVLLSLGGFILSREDIKKWWKWAYWCSPLTYAQNAIVANEFLGHSWKKFTQDSSETLGVQVLKSRGFFAHEYWYWLGLGALFGFVLLLNFAYTLALTFLDPFEKPRAVITEEIESNEQDDRIGGNVQLSTLGGSSNHNTRSGSTDDIRGQQSSSQSLSLAEAEASRPKKKGMVLPFEPHSLTFDEVVYSVDMPEEMKVQGVLEDKLVLLNGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGYITGNITISGYPKKQETFARISGYCEQNDIHSPFVTIYESLLFSAWLRLSPEVDSETRKMFIDEVMELVELNPLRQSLVGLPGVSGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFEAFDELFLMKRGGQEIYVGPLGRHSCHLISYFEAIPGVQKIKDGYNPATWMLEVSAASQELALGIDFTEHYKRSDLYRRNKALIEDLSRPPPGSKDLYFPTQFSQSSWIQFVACLWKQHWSYWRNPPYTAVRFFFTAFIALLFGSLFWDLGGRTKRNQDLFNAMGSMFTAVLFLGVQYCSSVQPIVSVERTVFYREKAAGMYAGIPWALAQVMIEIPYILVQSVVYGAIVYAMIGFEWTAAKFFWYIFFMYFTLLFFTFYGMMAVALTPNHHIAAIVSTLFYGLWNVFSGFIIPRPVSLVFPFLFQMLDFFFRLNNFCY
ccccccHHHccccccccccccccccccccccccccHHHHHHHHHHHHHccccHHHHcccccccccccccccccccccHHHHHHHHccccccccccHHHHHHHHHHHHHHccccccccEEEEEccEEEEEEEccccccccHHHHHHHHHHHHHHHHcccccccccccccccccEEEEccEEEEEEccccccHHHHHHHHHccccccccEEEEEEEccccccccccccEEEEEcccccccccccHHHHHHHHHHHcccccccHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccHHHHHHHHcccccccEEcccccHHHHHHHHHHHHHHHHHHHccccEEEEEcccccHHHHHcccEEEEcccEEEEEccHHHHHHHHHcccccccccccccccccccccccccEEcccccccccccccHHHHHHHHHccHHHHHHHHHHccccccccccccccccccccccHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHEccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHcHHHHHHHHHHHcccccccccccccccccccccEEEEccccccccccHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHccccccccccccccEEccccccccccccccccccccccccccccHHHHHHHHcccccccccccccccEEEEccEEEEEcccccccccccccccccccccccEEEEcccEEEccccccccHHHHHHHHHccccccEEEEEEEEccccccccccccccHHHHcccccccccHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHcccccccccccccccccccHHHHcHHHHHHHHcccccccEEccccccccHHHHHHHHHHHHHHHHcccEEEEEcccccHHHHHHHHHHHcccccccEEEEcccccccHHHHHHHHccccccccccccccHHHHHHHccccccccccccHHHHHcccHHHHHHHHHHHHccccccccccccccccccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHccccccEEEEcHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHEEEEEEcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHcccccccccccccccccccccEEEEEccccc
ccccHHHHHHHccccccccccccccccccccccccccHHHHHHHHHHHccccHHHHHHHHHcccccccEEEEHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccEEEEEEEEEEEEEEEEEcccccccHHHHHHHHHHHHHHHHHccccccccEEEEccccccEcccEEEEEEccccccHHHHHHHHccccccccEEEEEEEEccccccccccHHHEEEEEHccccccccEEHHHHHHHHHHcccccHHHHHHHHHHHHHHccccccccHHEEEEEEccccccHHHHHHHHHHHHccHHHHHHccccccccccccccccEEEEEEEEEccccEEEcccccccccHHHHHHHHHHHHHHHHHcccEEEEEEccccHHHHHHHHHHHHHHcccEEEEccHHHHHHHHHHcccccccccccccEEEEccccHHHHHcccccccccEEEcHHHHHHHHHHcHHHHHHHHHHHcccccccccccccccccccccHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHcccccccEEEEEccEHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHcccEEccccccHHEEEEEEHcHHHHHHHHHHHHHccccccccccccccccHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccEEEEccHHHHHcccccccEEEEEccccccccccccccccccccccccccccEcccccccccccccEEEccccEEEEEccEEEEEccHHHHHHccccHcHEEEEccccccccccEEEEEEccccccHHHHHHHHcccccccEEEEEEEEcccccccccHHHEEEEEEccccccccEEEEEHHHHHHHHcccccccHHHHHHHHHHHHHHHcccHHHHHHcccccccccccccccEEEEEHHEcccccEEEEccccccccHHHHHHHHHHHHHHHccccEEEEEEccccHHHHHHHHHHHHHHcccEEEEEcccccccHHHHHHHHcccccccccccccccHHHHHcccHHHHHHHcccHHHHHHHcHHHHHHHHHHHHHcccccccccccccccccccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHcccccccEEEEEEccEEHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHcccEEcccccccEEEEEEEEccHEEcccccc
MEGTHDIFMASTSLRRSasrwntnsigafsrssreedDEEALKWAALEklptynrlrKGILttsrgeanevdvynLGLQERQRLIDKLVKVTDVDNERFLLKLKNRIDrvgidlpkVEVRYEHLNVEAEAFlasnalpsfIKFYTNIFEDILNYLRiipskkrhLTILKdvsgvikpgrltlllgppssgkTTLLLALAgkldptlkvsgtvtynghdmdefvpqRTAAYISQHDNHIGEMTVRETLAFSARCQGVGTRYEMLTELARREkaagikpdpdiDVYMKAIATEGQEANVITDYYLKVLgldvcadtmvgdemirgisggqkkrvttgemmvgPALALFMDEistgldssttFQIVNCLRQNIHINSGTAVISllqpapetydlfddiillsdgqivyqgPRELVLEFFAsmgfrcpkrkgVADFLQEVTSRKDQRqywahkekpyrfVTVQEFAEAFQSFHvgqkisdelrtpfdkskshraalttetygvgKRELLKANISRELLLMKRNSFVYIFKLIQIAFVAVVYMTLFLRTkmhkdtvtdggifaGATFFAITMVNFNGFSEISMTIAKlpvfykqrdfrffppwayaipswilkiPVSFLEVAVWVFLSYYVVgydsnagrFFKQYALLLGVNQMASALFRFIAVTGRNMVVANTFGSFALLVLLSLGGFILSREDIKKWWKWaywcspltyAQNAIVANEFLGHSWKKFTQDSSETLGVQVLKSRGFFAHEYWYWLGLGALFGFVLLLNFAYTLAltfldpfekpraVITEEIesneqddriggnvqlstlggssnhntrsgstddirgqqsssqSLSLAEAEasrpkkkgmvlpfephsltfdevvysvdmpeemkvQGVLEDKLVLLngvsgafrpGVLTALMgvsgagktTLMDVLAgrktggyitgnitisgypkkqeTFARISGyceqndihspFVTIYESLLFSAWLrlspevdseTRKMFIDEVMELVElnplrqslvglpgvsglsteQRKRLTIAVELVanpsiifmdeptsgldARAAAIVMRTVRNTVDTGRTVVCtihqpsidiFEAFDELFLMKrggqeiyvgplgrhschlisyfeaipgvqkikdgynpaTWMLEVSAASQELALGidftehykrsdlYRRNKALiedlsrpppgskdlyfptqfsqsSWIQFVACLWKQHwsywrnppytAVRFFFTAFIALLFGSLfwdlggrtkRNQDLFNAMGSMFTAVLFLGVQycssvqpivsveRTVFYREKAAGMYAGIPWALAQVMIEIPYILVQSVVYGAIVYAMIGFEWTAAKFFWYIFFMYFTLLFFTFYGMMAVALTPNHHIAAIVSTLFYGLWnvfsgfiiprpvslvfPFLFQMLDFFFRLNNFCY
megthdifmastslrrsasrwntnsigafsrssreeddEEALKWAaleklptynrlrkgilttsrgeanevdvynlglqerqrLIDKlvkvtdvdnerfllklknridrvgidlPKVEVRYEHLNVEAEAFLASNALPSFIKFYTNIFEDILNYLRIIPSKKRHLTILKDvsgvikpgrltlllgppssGKTTLLLALAGKLDPTLKVSGTVTYNGHDMDEFVPQRTAAYISQHDNHIGEMTVRETLAFSARCQGVGTRYEMLTELARRekaagikpdpdiDVYMKAIATEGQEANVITDYYLKVLGLDVCADTMVGDEmirgisggqkkrvttGEMMVGPALALFMDEISTGLDSSTTFQIVNCLRQNIHINSGTAVISLLQPAPETYDLFDDIILLSDGQIVYQGPRELVLEFFASMGFRCPKRKGVADFLQEvtsrkdqrqywaHKEKPYRFVTVQEFAEAFQSFHVGQKISDElrtpfdkskshraalttetygvgkrellKANISRELLLMKRNSFVYIFKLIQIAFVAVVYMTLFLRTKMHKDTVTDGGIFAGATFFAITMVNFNGFSEISMTIAKLPVFYKQRDFRFFPPWAYAIPSWILKIPVSFLEVAVWVFLSYYVVGYDSNAGRFFKQYALLLGVNQMASALFRFIAVTGRNMVVANTFGSFALLVLLSLGGFILSREDIKKWWKWAYWCSPLTYAQNAIVANEFLGHSWKKFTQDSSETLGVQVLKSRGFFAHEYWYWLGLGALFGFVLLLNFAYTLALTFLDPFEKPRAVITEEiesneqddrigGNVQLStlggssnhntrsgstddirgqqSSSQSLSLAEAEasrpkkkgmvlpfephslTFDEVVYSVDMPEEMKVQGVLEDKLVLLNGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGrktggyitgnitisgypKKQETFARISGYCEQNDIHSPFVTIYESLLFSAWLRLSPEVDSETRKMFIDEVMELVELNPLRQSLVGLpgvsglsteqRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFEAFDELFLMKRGGQEIYVGPLGRHSCHLISYFEAIPGVQKIKDGYNPATWMLEVSAASQELALGIDFTEHYKRSDLYRRNKALiedlsrpppgskDLYFPTQFSQSSWIQFVACLWKQHWSYWRNPPYTAVRFFFTAFIALLFGSLFWDLGGRTKRNQDLFNAMGSMFTAVLFLGVQYCSSVQPIVSVERTVFYREKAAGMYAGIPWALAQVMIEIPYILVQSVVYGAIVYAMIGFEWTAAKFFWYIFFMYFTLLFFTFYGMMAVALTPNHHIAAIVSTLFYGLWNVFSGFIIPRPVSLVFPFLFQMLDFFFRLNNFCY
MEGTHDIFMASTSLRRSASRWNTNSIGAFsrssreeddeeALKWAALEKLPTYNRLRKGILTTSRGEANEVDVYNLGLQERQRLIDKLVKVTDVDNERFLLKLKNRIDRVGIDLPKVEVRYEHLNVEAEAFLASNALPSFIKFYTNIFEDILNYLRIIPSKKRHLTILKDVSGVIKPGRLTLLLGPPssgkttlllalagklDPTLKVSGTVTYNGHDMDEFVPQRTAAYISQHDNHIGEMTVRETLAFSARCQGVGTRYEMLTELARREKAAGIKPDPDIDVYMKAIATEGQEANVITDYYLKVLGLDVCADTMVGDEMIRGISGGQKKRVTTGEMMVGPALALFMDEISTGLDSSTTFQIVNCLRQNIHINSGTAVISLLQPAPETYDLFDDIILLSDGQIVYQGPRELVLEFFASMGFRCPKRKGVADFLQEVTSRKDQRQYWAHKEKPYRFVTVQEFAEAFQSFHVGQKISDELRTPFDKSKSHRAALTTETYGVGKRELLKANISRELLLMKRNSFVYIFKLIQIAFVAVVYMTLFLRTKMHKDTVTDGGIFAGATFFAITMVNFNGFSEISMTIAKLPVFYKQRDFRFFPPWAYAIPSWILKIPVSFLEVAVWVFLSYYVVGYDSNAGRFFKQYALLLGVNQMASALFRFIAVTGRNMVVANTfgsfallvllslggfilsREDIKKWWKWAYWCSPLTYAQNAIVANEFLGHSWKKFTQDSSETLGVQVLKSRGFFAHEYWYWlglgalfgfvlllnfAYTLALTFLDPFEKPRAVITEEIESNEQDDRIGGNVQLSTLGGSSNHNTRSGSTDDIRGqqsssqslslaeaeasRPKKKGMVLPFEPHSLTFDEVVYSVDMPEEMKVQGVLEDKLVLLNGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGYITGNITISGYPKKQETFARISGYCEQNDIHSPFVTIYESLLFSAWLRLSPEVDSETRKMFIDEVMELVELNPLRQSLVGLPGVSGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFEAFDELFLMKRGGQEIYVGPLGRHSCHLISYFEAIPGVQKIKDGYNPATWMLEVSAASQELALGIDFTEHYKRSDLYRRNKALIEDLSRPPPGSKDLYFPTQFSQSSWIQFVACLWKQHWSYWRNPPYTAVRFFFTAFIALLFGSLFWDLGGRTKRNQDLFNAMGSMFTAVLFLGVQYCSSVQPIVSVERTVFYREKAAGMYAGIPWALAQVMIEIPYILVQSVVYGAIVYAMIGFEWTAAKFFWYIffmyftllfftfygmMAVALTPNHHIAAIVSTLFYGLWNVFSGFIIPRPVSLVfpflfqmldfffrlNNFCY
*****************************************LKWAALEKLPTYNRLRKGILTTSRGEANEVDVYNLGLQERQRLIDKLVKVTDVDNERFLLKLKNRIDRVGIDLPKVEVRYEHLNVEAEAFLASNALPSFIKFYTNIFEDILNYLRIIPSKKRHLTILKDVSGVIKPGRLTLLLGPPSSGKTTLLLALAGKLDPTLKVSGTVTYNGHDMDEFVPQRTAAYISQHDNHIGEMTVRETLAFSARCQGVGTRYEMLTELARREKAAGIKPDPDIDVYMKAIATEGQEANVITDYYLKVLGLDVCADTMVGDEMIRGISGGQKKRVTTGEMMVGPALALFMDEISTGLDSSTTFQIVNCLRQNIHINSGTAVISLLQPAPETYDLFDDIILLSDGQIVYQGPRELVLEFFASMGFRCPKRKGVADFLQEVTSRKDQRQYWAHKEKPYRFVTVQEFAEAFQSFHVGQKI****************ALTTETYGVGKRELLKANISRELLLMKRNSFVYIFKLIQIAFVAVVYMTLFLRTKMHKDTVTDGGIFAGATFFAITMVNFNGFSEISMTIAKLPVFYKQRDFRFFPPWAYAIPSWILKIPVSFLEVAVWVFLSYYVVGYDSNAGRFFKQYALLLGVNQMASALFRFIAVTGRNMVVANTFGSFALLVLLSLGGFILSREDIKKWWKWAYWCSPLTYAQNAIVANEFLGHSWKKFTQDSSETLGVQVLKSRGFFAHEYWYWLGLGALFGFVLLLNFAYTLALTFLDPFEKPRAVI****************************************************************LPFEPHSLTFDEVVYSVDMPEEMKVQGVLEDKLVLLNGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGYITGNITISGYPKKQETFARISGYCEQNDIHSPFVTIYESLLFSAWLRLSPEVDSETRKMFIDEVMELVELNPLRQSLVGLPGVSGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFEAFDELFLMKRGGQEIYVGPLGRHSCHLISYFEAIPGVQKIKDGYNPATWMLEVSAASQELALGIDFTEHYKRSDLYRRNKALI***********DLYFPTQFSQSSWIQFVACLWKQHWSYWRNPPYTAVRFFFTAFIALLFGSLFWDLGGRTKRNQDLFNAMGSMFTAVLFLGVQYCSSVQPIVSVERTVFYREKAAGMYAGIPWALAQVMIEIPYILVQSVVYGAIVYAMIGFEWTAAKFFWYIFFMYFTLLFFTFYGMMAVALTPNHHIAAIVSTLFYGLWNVFSGFIIPRPVSLVFPFLFQMLDFFFRLNNFC*
**********************************************************************************************DNERFLLKLK************VEVRYEHLNVEAEAFLASNALPSFIKFYTNIFEDILNY***********TILKDVSGVIKPGRLTLLLGPPSSGKTTLLLALAGKLDPTLKVSGTVTYNGHDMDEFVPQRTAAYISQHDNHIGEMTVRETLAFSARCQGVGTRYEM************IKPDPDIDVYMKAIATEGQEANVITDYYLKVLGLDVCADTMVGDEMIRGISGGQKKRVTTGEMMVGPALALFMDEISTGLDSSTTFQIVNCLRQNIHINSGTAVISLLQPAPETYDLFDDIILLSDGQIVYQGPRELVLEFFASMGFRCPKRKGVADFLQEVTSRKDQRQYWAHKEKPYRFVTVQEFAEAFQSFHVGQKIS*************************KRELLKANISRELLLMKRNSFVYIFKLIQIAFVAVVYMTLFLRTKMHKDTVTDGGIFAGATFFAITMVNFNGFSEISMTIAKLPVFYKQRDFRFFPPWAYAIPSWILKIPVSFLEVAVWVFLSYYVVGYDSNAGRFFKQYALLLGVNQMASALFRFIAVTGRNMVVANTFGSFALLVLLSLGGFILSREDIKKWWKWAYWCSPLTYAQNAIVANEFLGHSWKKFTQDSSETLGVQVLKSRGFFAHEYWYWLGLGALFGFVLLLNFAYTLALTFLDPFEKPRAV*******************************************************************FEPHSLTFDEVVYSVDMPEEMKV*GVLEDKLVLLNGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGYITGNITISGYPKKQETFARISGYCEQNDIHSPFVTIYESLLFSAWLRLSPEVDSETRKMFIDEVMELVELNPLRQSLVGLPGVSGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFEAFDELFLMKRGGQEIYVGPLGRHSCHLISYFEAIPGVQKIKDGYNPATWMLEVSAASQELALGIDFTEHYKRSDLYRR************************SQSSWIQFVACLWKQHWSYWRNPPYTAVRFFFTAFIALLFGSLFWDLGGRTKRNQDLFNAMGSMFTAVLFLGVQYCSSVQPIVSVERTVFYREKAAGMYAGIPWALAQVMIEIPYILVQSVVYGAIVYAMIGFEWTAAKFFWYIFFMYFTLLFFTFYGMMAVALTPNHHIAAIVSTLFYGLWNVFSGFIIPRPVSLVFPFLFQMLDFFFRLNNFCY
MEGTHDIFMASTSLRRSASRWNTNSIGA*************LKWAALEKLPTYNRLRKGILTTSRGEANEVDVYNLGLQERQRLIDKLVKVTDVDNERFLLKLKNRIDRVGIDLPKVEVRYEHLNVEAEAFLASNALPSFIKFYTNIFEDILNYLRIIPSKKRHLTILKDVSGVIKPGRLTLLLGPPSSGKTTLLLALAGKLDPTLKVSGTVTYNGHDMDEFVPQRTAAYISQHDNHIGEMTVRETLAFSARCQGVGTRYEMLTELARREKAAGIKPDPDIDVYMKAIATEGQEANVITDYYLKVLGLDVCADTMVGDEMIRGISGGQKKRVTTGEMMVGPALALFMDEISTGLDSSTTFQIVNCLRQNIHINSGTAVISLLQPAPETYDLFDDIILLSDGQIVYQGPRELVLEFFASMGFRCPKRKGVADFLQEVTSRKDQRQYWAHKEKPYRFVTVQEFAEAFQSFHVGQKISDELRTPFDKSKSHRAALTTETYGVGKRELLKANISRELLLMKRNSFVYIFKLIQIAFVAVVYMTLFLRTKMHKDTVTDGGIFAGATFFAITMVNFNGFSEISMTIAKLPVFYKQRDFRFFPPWAYAIPSWILKIPVSFLEVAVWVFLSYYVVGYDSNAGRFFKQYALLLGVNQMASALFRFIAVTGRNMVVANTFGSFALLVLLSLGGFILSREDIKKWWKWAYWCSPLTYAQNAIVANEFLGHSWKKFTQDSSETLGVQVLKSRGFFAHEYWYWLGLGALFGFVLLLNFAYTLALTFLDPFEKPRAVITEEIESNEQDDRIGGNVQLSTLGG***********************************KKGMVLPFEPHSLTFDEVVYSVDMPEEMKVQGVLEDKLVLLNGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGYITGNITISGYPKKQETFARISGYCEQNDIHSPFVTIYESLLFSAWLRLSPEVDSETRKMFIDEVMELVELNPLRQSLVGLPGVSGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFEAFDELFLMKRGGQEIYVGPLGRHSCHLISYFEAIPGVQKIKDGYNPATWMLEVSAASQELALGIDFTEHYKRSDLYRRNKALIEDLSRPPPGSKDLYFPTQFSQSSWIQFVACLWKQHWSYWRNPPYTAVRFFFTAFIALLFGSLFWDLGGRTKRNQDLFNAMGSMFTAVLFLGVQYCSSVQPIVSVERTVFYREKAAGMYAGIPWALAQVMIEIPYILVQSVVYGAIVYAMIGFEWTAAKFFWYIFFMYFTLLFFTFYGMMAVALTPNHHIAAIVSTLFYGLWNVFSGFIIPRPVSLVFPFLFQMLDFFFRLNNFCY
************************************DDEEALKWAALEKLPTYNRLRKGILTTSRGEANEVDVYNLGLQERQRLIDKLVKVTDVDNERFLLKLKNRIDRVGIDLPKVEVRYEHLNVEAEAFLASNALPSFIKFYTNIFEDILNYLRIIPSKKRHLTILKDVSGVIKPGRLTLLLGPPSSGKTTLLLALAGKLDPTLKVSGTVTYNGHDMDEFVPQRTAAYISQHDNHIGEMTVRETLAFSARCQGVGTRYEMLTELARREKAAGIKPDPDIDVYMKAIATEGQEANVITDYYLKVLGLDVCADTMVGDEMIRGISGGQKKRVTTGEMMVGPALALFMDEISTGLDSSTTFQIVNCLRQNIHINSGTAVISLLQPAPETYDLFDDIILLSDGQIVYQGPRELVLEFFASMGFRCPKRKGVADFLQEVTSRKDQRQYWAHKEKPYRFVTVQEFAEAFQSFHVGQKISDELRTPFDKSKSHRAALTTETYGVGKRELLKANISRELLLMKRNSFVYIFKLIQIAFVAVVYMTLFLRTKMHKDTVTDGGIFAGATFFAITMVNFNGFSEISMTIAKLPVFYKQRDFRFFPPWAYAIPSWILKIPVSFLEVAVWVFLSYYVVGYDSNAGRFFKQYALLLGVNQMASALFRFIAVTGRNMVVANTFGSFALLVLLSLGGFILSREDIKKWWKWAYWCSPLTYAQNAIVANEFLGHSWKKFTQDSSETLGVQVLKSRGFFAHEYWYWLGLGALFGFVLLLNFAYTLALTFLDPFEKPRAVITEEIESNEQ***************************************************KGMVLPFEPHSLTFDEVVYSVDMPEEMKVQGVLEDKLVLLNGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGYITGNITISGYPKKQETFARISGYCEQNDIHSPFVTIYESLLFSAWLRLSPEVDSETRKMFIDEVMELVELNPLRQSLVGLPGVSGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFEAFDELFLMKRGGQEIYVGPLGRHSCHLISYFEAIPGVQKIKDGYNPATWMLEVSAASQELALGIDFTEHYKRSDLYRRNKALIEDLSRPPPGSKDLYFPTQFSQSSWIQFVACLWKQHWSYWRNPPYTAVRFFFTAFIALLFGSLFWDLGGRTKRNQDLFNAMGSMFTAVLFLGVQYCSSVQPIVSVERTVFYREKAAGMYAGIPWALAQVMIEIPYILVQSVVYGAIVYAMIGFEWTAAKFFWYIFFMYFTLLFFTFYGMMAVALTPNHHIAAIVSTLFYGLWNVFSGFIIPRPVSLVFPFLFQMLDFFFRLNNFCY
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooHHHHHHHHHHHHHHHHHHHHHiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHoooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHoooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHiiiHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEGTHDIFMASTSLRRSASRWNTNSIGAFSRSSREEDDEEALKWAALEKLPTYNRLRKGILTTSRGEANEVDVYNLGLQERQRLIDKLVKVTDVDNERFLLKLKNRIDRVGIDLPKVEVRYEHLNVEAEAFLASNALPSFIKFYTNIFEDILNYLRIIPSKKRHLTILKDVSGVIKPGRLTLLLGPPSSGKTTLLLALAGKLDPTLKVSGTVTYNGHDMDEFVPQRTAAYISQHDNHIGEMTVRETLAFSARCQGVGTRYEMLTELARREKAAGIKPDPDIDVYMKAIATEGQEANVITDYYLKVLGLDVCADTMVGDEMIRGISGGQKKRVTTGEMMVGPALALFMDEISTGLDSSTTFQIVNCLRQNIHINSGTAVISLLQPAPETYDLFDDIILLSDGQIVYQGPRELVLEFFASMGFRCPKRKGVADFLQEVTSRKDQRQYWAHKEKPYRFVTVQEFAEAFQSFHVGQKISDELRTPFDKSKSHRAALTTETYGVGKRELLKANISRELLLMKRNSFVYIFKLIQIAFVAVVYMTLFLRTKMHKDTVTDGGIFAGATFFAITMVNFNGFSEISMTIAKLPVFYKQRDFRFFPPWAYAIPSWILKIPVSFLEVAVWVFLSYYVVGYDSNAGRFFKQYALLLGVNQMASALFRFIAVTGRNMVVANTFGSFALLVLLSLGGFILSREDIKKWWKWAYWCSPLTYAQNAIVANEFLGHSWKKFTQDSSETLGVQVLKSRGFFAHEYWYWLGLGALFGFVLLLNFAYTLALTFLDPFEKPRAVITEEIESNEQDDRIGGNVQLSTLGGSSNHNTRSGSTDDIRGQQSSSQSLSLAEAEASRPKKKGMVLPFEPHSLTFDEVVYSVDMPEEMKVQGVLEDKLVLLNGVSGAFRPGVLTALMGVSGAGKTTLMDVLAGRKTGGYITGNITISGYPKKQETFARISGYCEQNDIHSPFVTIYESLLFSAWLRLSPEVDSETRKMFIDEVMELVELNPLRQSLVGLPGVSGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFEAFDELFLMKRGGQEIYVGPLGRHSCHLISYFEAIPGVQKIKDGYNPATWMLEVSAASQELALGIDFTEHYKRSDLYRRNKALIEDLSRPPPGSKDLYFPTQFSQSSWIQFVACLWKQHWSYWRNPPYTAVRFFFTAFIALLFGSLFWDLGGRTKRNQDLFNAMGSMFTAVLFLGVQYCSSVQPIVSVERTVFYREKAAGMYAGIPWALAQVMIEIPYILVQSVVYGAIVYAMIGFEWTAAKFFWYIFFMYFTLLFFTFYGMMAVALTPNHHIAAIVSTLFYGLWNVFSGFIIPRPVSLVFPFLFQMLDFFFRLNNFCY
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query1391 2.2.26 [Sep-21-2011]
Q76CU21434 Pleiotropic drug resistan N/A no 0.954 0.926 0.722 0.0
Q9M9E11423 ABC transporter G family yes no 0.959 0.937 0.695 0.0
Q0JLC51457 Pleiotropic drug resistan yes no 0.961 0.917 0.698 0.0
Q949G31436 Pleiotropic drug resistan N/A no 0.954 0.924 0.705 0.0
A2WSH01457 Pleiotropic drug resistan N/A no 0.961 0.917 0.698 0.0
Q8GU891450 Pleiotropic drug resistan no no 0.965 0.926 0.685 0.0
Q8GU881444 Putative pleiotropic drug no no 0.963 0.927 0.688 0.0
O243671441 Pleiotropic drug resistan N/A no 0.961 0.927 0.693 0.0
Q8GU921464 Probable pleiotropic drug no no 0.962 0.914 0.694 0.0
Q7PC801468 Probable pleiotropic drug no no 0.953 0.903 0.691 0.0
>sp|Q76CU2|PDR1_TOBAC Pleiotropic drug resistance protein 1 OS=Nicotiana tabacum GN=PDR1 PE=2 SV=1 Back     alignment and function desciption
 Score = 2075 bits (5376), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 981/1357 (72%), Positives = 1137/1357 (83%), Gaps = 29/1357 (2%)

Query: 13   SLR-RSASRWNTNSIGAFSRSSREEDDEEALKWAALEKLPTYNRLRKGILTTSRGEANEV 71
            SLR  S S W  N +  FSRSSR+EDDEEALKWAALEKLPT++RLRKG+L  S+G A EV
Sbjct: 21   SLRANSNSIWRNNGVEIFSRSSRDEDDEEALKWAALEKLPTFDRLRKGLLFGSQGAAAEV 80

Query: 72   DVYNLGLQERQRLIDKLVKVTDVDNERFLLKLKNRIDRVGIDLPKVEVRYEHLNVEAEAF 131
            D+ +LG QER+ L+++LVKV D DNE+FLLKLKNRIDRVGIDLP +EVRYEHLN++A+A+
Sbjct: 81   DINDLGFQERKNLLERLVKVADEDNEKFLLKLKNRIDRVGIDLPTIEVRYEHLNIDADAY 140

Query: 132  LASNALPSFIKFYTNIFEDILNYLRIIPSKKRHLTILKDVSGVIKPGRLTLLLGPPSSGK 191
            + S +LP+F+ F TN  E +LN L I+ S+KR LTILKD+SG+IKP R+TLLLGPPSSGK
Sbjct: 141  VGSRSLPTFMNFMTNFVETLLNSLHILSSRKRQLTILKDISGIIKPCRMTLLLGPPSSGK 200

Query: 192  TTLLLALAGKLDPTLKVSGTVTYNGHDMDEFVPQRTAAYISQHDNHIGEMTVRETLAFSA 251
            TTLLLALAGKLDP LKV+G V+YNGH++ EFVPQRTAAYISQHD HIGEMTVRETL FSA
Sbjct: 201  TTLLLALAGKLDPALKVTGKVSYNGHELHEFVPQRTAAYISQHDLHIGEMTVRETLEFSA 260

Query: 252  RCQGVGTRYEMLTELARREKAAGIKPDPDIDVYMKAIATEGQEANVITDYYLKVLGLDVC 311
            RCQGVG+R+EML EL+RREKAA IKPD DID+YMKA ATEGQEANV+TDY LK+LGLD+C
Sbjct: 261  RCQGVGSRFEMLAELSRREKAANIKPDADIDIYMKAAATEGQEANVVTDYVLKILGLDIC 320

Query: 312  ADTMVGDEMIRGISGGQKKRVTTGEMMVGPALALFMDEISTGLDSSTTFQIVNCLRQNIH 371
            ADTMVGD+MIRGISGGQKKRVTTGEM+VGP+ ALFMDEISTGLDSSTT+ IVN LRQ++ 
Sbjct: 321  ADTMVGDDMIRGISGGQKKRVTTGEMLVGPSKALFMDEISTGLDSSTTYSIVNSLRQSVQ 380

Query: 372  INSGTAVISLLQPAPETYDLFDDIILLSDGQIVYQGPRELVLEFFASMGFRCPKRKGVAD 431
            I  GTAVISLLQPAPETY+LFDDIILLSDG IVYQGPR+ VLEFF SMGF+CP+RKGVAD
Sbjct: 381  ILKGTAVISLLQPAPETYNLFDDIILLSDGYIVYQGPRDDVLEFFESMGFKCPQRKGVAD 440

Query: 432  FLQEVTSRKDQRQYWAHKEKPYRFVTVQEFAEAFQSFHVGQKISDELRTPFDKSKSHRAA 491
            FLQEVTS+KDQ+QYW+ + +PYRF+T +EFAEA+QSFHVG+K+ DEL TPFDK+K H AA
Sbjct: 441  FLQEVTSKKDQQQYWSKRNEPYRFITSKEFAEAYQSFHVGRKLGDELATPFDKTKCHPAA 500

Query: 492  LTTETYGVGKRELLKANISRELLLMKRNSFVYIFKLIQIAFVAVVYMTLFLRTKMHKDTV 551
            LT E YG+GK+ELLK    RELLLMKRNSFVY+FK  Q+  +A++ MTLF RT+M +DT 
Sbjct: 501  LTNEKYGIGKKELLKVCTERELLLMKRNSFVYMFKFSQLTIMALITMTLFFRTEMPRDTT 560

Query: 552  TDGGIFAGATFFAITMVNFNGFSEISMTIAKLPVFYKQRDFRFFPPWAYAIPSWILKIPV 611
             DGGI+AGA FF + M+ FNG SE++MTI KLPVFYKQRD  FFP WAYAIPSWILKIPV
Sbjct: 561  DDGGIYAGALFFVVIMIMFNGMSELAMTIFKLPVFYKQRDLLFFPSWAYAIPSWILKIPV 620

Query: 612  SFLEVAVWVFLSYYVVGYDSNAGRFFKQYALLLGVNQMASALFRFIAVTGRNMVVANTFG 671
            + +EV +WV L+YYV+G+D N  RF KQ+ LL+ VNQMAS +FRFI   GR M VA+TFG
Sbjct: 621  TLVEVGLWVILTYYVIGFDPNITRFLKQFLLLIVVNQMASGMFRFIGAVGRTMGVASTFG 680

Query: 672  SFALLVLLSLGGFILSREDIKKWWKWAYWCSPLTYAQNAIVANEFLGHSWKKFTQDSSET 731
            SFALL+  +LGGF+LSR+D+K WW W YW SP+ Y+ N+I+ NEF G  W       +ET
Sbjct: 681  SFALLLQFALGGFVLSRDDVKSWWIWGYWISPMMYSVNSILVNEFDGKKWNHIVPGGNET 740

Query: 732  LGVQVLKSRGFFAHEYWYWLGLGALFGFVLLLNFAYTLALTFLDPFEKPRAVITEEIESN 791
            LG  V+KSRGFF   YWYW+G+GAL GF ++ NF Y+LAL +L+PF+KP+AV+ E+ E+ 
Sbjct: 741  LGSTVVKSRGFFPEAYWYWIGVGALVGFTVVFNFCYSLALAYLNPFDKPQAVLPEDGENA 800

Query: 792  EQDDRIGGNVQLSTLGGSSNHNTRSGSTDDIRGQQSSSQSLSLAEAEASRPKKKGMVLPF 851
            E              G  S+  T +   D I   Q++               KKGMVLPF
Sbjct: 801  EN-------------GEVSSQITSTDGGDSISESQNN---------------KKGMVLPF 832

Query: 852  EPHSLTFDEVVYSVDMPEEMKVQGVLEDKLVLLNGVSGAFRPGVLTALMGVSGAGKTTLM 911
            EPHS+TFD+VVYSVDMP+EMK QG  ED+LVLL GVSGAFRPGVLTALMGVSGAGKTTLM
Sbjct: 833  EPHSITFDDVVYSVDMPQEMKEQGAGEDRLVLLKGVSGAFRPGVLTALMGVSGAGKTTLM 892

Query: 912  DVLAGRKTGGYITGNITISGYPKKQETFARISGYCEQNDIHSPFVTIYESLLFSAWLRLS 971
            DVLAGRKTGGYI G I ISGYPKKQETFARISGYCEQNDIHSP+VT+YESL++SAWLRL 
Sbjct: 893  DVLAGRKTGGYIDGEIKISGYPKKQETFARISGYCEQNDIHSPYVTVYESLVYSAWLRLP 952

Query: 972  PEVDSETRKMFIDEVMELVELNPLRQSLVGLPGVSGLSTEQRKRLTIAVELVANPSIIFM 1031
             +VD +TRKMF+DEVMELVEL PLR +LVGLPGV+GLSTEQRKRLTIAVELVANPSIIFM
Sbjct: 953  QDVDEKTRKMFVDEVMELVELGPLRSALVGLPGVNGLSTEQRKRLTIAVELVANPSIIFM 1012

Query: 1032 DEPTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFEAFDELFLMKRGGQEIYVG 1091
            DEPTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFEAFDELFLMKRGGQEIYVG
Sbjct: 1013 DEPTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFEAFDELFLMKRGGQEIYVG 1072

Query: 1092 PLGRHSCHLISYFEAIPGVQKIKDGYNPATWMLEVSAASQELALGIDFTEHYKRSDLYRR 1151
            PLGRHSCHLI YFE+ PGV KIK+GYNPATWMLEV+A++QE+ LGIDFTE YK SDLYRR
Sbjct: 1073 PLGRHSCHLIKYFESNPGVAKIKEGYNPATWMLEVTASAQEMMLGIDFTEVYKNSDLYRR 1132

Query: 1152 NKALIEDLSRPPPGSKDLYFPTQFSQSSWIQFVACLWKQHWSYWRNPPYTAVRFFFTAFI 1211
            NKALI +L  P PGSKDL+F TQ+SQS W Q VACLWKQHWSYWRNP YTAVRF FT FI
Sbjct: 1133 NKALISELGVPRPGSKDLHFETQYSQSFWTQCVACLWKQHWSYWRNPAYTAVRFIFTTFI 1192

Query: 1212 ALLFGSLFWDLGGRTKRNQDLFNAMGSMFTAVLFLGVQYCSSVQPIVSVERTVFYREKAA 1271
            AL+FG++FWDLG +  ++QDL NAMGSM+ AVLFLGVQ  SSVQP+V++ERTVFYRE+AA
Sbjct: 1193 ALIFGTMFWDLGTKVSKSQDLLNAMGSMYAAVLFLGVQNASSVQPVVAIERTVFYRERAA 1252

Query: 1272 GMYAGIPWALAQVMIEIPYILVQSVVYGAIVYAMIGFEWTAAKFFWYIFFMYFTLLFFTF 1331
            GMY+ IP+A  QV IEIPYI VQSV YG IVYAMIGFEW   KFFWY+F M+FTLL+FTF
Sbjct: 1253 GMYSAIPYAFGQVSIEIPYIFVQSVFYGIIVYAMIGFEWDVGKFFWYLFIMFFTLLYFTF 1312

Query: 1332 YGMMAVALTPNHHIAAIVSTLFYGLWNVFSGFIIPRP 1368
            YGMM VA+TPN ++A+IV+  FYG+WN+FSGFIIPRP
Sbjct: 1313 YGMMGVAVTPNQNVASIVAAFFYGVWNLFSGFIIPRP 1349
May be a general defense protein.
Nicotiana tabacum (taxid: 4097)
>sp|Q9M9E1|AB40G_ARATH ABC transporter G family member 40 OS=Arabidopsis thaliana GN=ABCG40 PE=1 SV=1 Back     alignment and function description
>sp|Q0JLC5|PDR3_ORYSJ Pleiotropic drug resistance protein 3 OS=Oryza sativa subsp. japonica GN=PDR3 PE=2 SV=1 Back     alignment and function description
>sp|Q949G3|PDR1_NICPL Pleiotropic drug resistance protein 1 OS=Nicotiana plumbaginifolia GN=PDR1 PE=1 SV=1 Back     alignment and function description
>sp|A2WSH0|PDR3_ORYSI Pleiotropic drug resistance protein 3 OS=Oryza sativa subsp. indica GN=PDR3 PE=2 SV=1 Back     alignment and function description
>sp|Q8GU89|PDR4_ORYSJ Pleiotropic drug resistance protein 4 OS=Oryza sativa subsp. japonica GN=PDR4 PE=2 SV=1 Back     alignment and function description
>sp|Q8GU88|PDR7_ORYSJ Putative pleiotropic drug resistance protein 7 OS=Oryza sativa subsp. japonica GN=PDR7 PE=3 SV=1 Back     alignment and function description
>sp|O24367|TUR2_SPIPO Pleiotropic drug resistance protein TUR2 OS=Spirodela polyrrhiza GN=TUR2 PE=1 SV=1 Back     alignment and function description
>sp|Q8GU92|PDR2_ORYSJ Probable pleiotropic drug resistance protein 2 OS=Oryza sativa subsp. japonica GN=PDR2 PE=3 SV=1 Back     alignment and function description
>sp|Q7PC80|PDR1_ORYSJ Probable pleiotropic drug resistance protein 1 OS=Oryza sativa subsp. japonica GN=PDR1 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1391
3565558251427 PREDICTED: pleiotropic drug resistance p 0.961 0.936 0.740 0.0
2555433311429 ATP-binding cassette transporter, putati 0.964 0.938 0.738 0.0
3594826421429 PREDICTED: pleiotropic drug resistance p 0.963 0.937 0.732 0.0
297743362 3142 unnamed protein product [Vitis vinifera] 0.977 0.432 0.743 0.0
297743343 1642 unnamed protein product [Vitis vinifera] 0.952 0.806 0.735 0.0
3594829911445 PREDICTED: pleiotropic drug resistance p 0.971 0.934 0.742 0.0
3594829931430 PREDICTED: pleiotropic drug resistance p 0.965 0.939 0.745 0.0
3574550751427 Pleiotropic drug resistance protein [Med 0.962 0.938 0.728 0.0
3594829891426 PREDICTED: pleiotropic drug resistance p 0.962 0.938 0.744 0.0
3565194091426 PREDICTED: pleiotropic drug resistance p 0.961 0.937 0.722 0.0
>gi|356555825|ref|XP_003546230.1| PREDICTED: pleiotropic drug resistance protein 1-like [Glycine max] Back     alignment and taxonomy information
 Score = 2135 bits (5533), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1015/1371 (74%), Positives = 1170/1371 (85%), Gaps = 34/1371 (2%)

Query: 1    MEGTHDIFMASTSLR-RSASRWNTNSIGAFSRSSREEDDEEALKWAALEKLPTYNRLRKG 59
            MEG+ DI+ AS SLR RS++ W  + + AFSRSSREEDDEEALKWAALEKLPTYNRLRKG
Sbjct: 1    MEGS-DIYRASNSLRSRSSTVWRNSGVEAFSRSSREEDDEEALKWAALEKLPTYNRLRKG 59

Query: 60   ILTTSRGEANEVDVYNLGLQERQRLIDKLVKVTDVDNERFLLKLKNRIDRVGIDLPKVEV 119
            +LT S G ANE+DV +LG+QERQ+L+++LVKV + DNERFLLKLK RIDRVG+D+P +EV
Sbjct: 60   LLTASHGVANEIDVSDLGIQERQKLLERLVKVAEEDNERFLLKLKERIDRVGLDIPTIEV 119

Query: 120  RYEHLNVEAEAFLASNALPSFIKFYTNIFEDILNYLRIIPSKKRHLTILKDVSGVIKPGR 179
            RYEHLN+EAEAF+ S ALPSFI   TN+ E   N L +  SKK+H+TILKDVSG+IKP R
Sbjct: 120  RYEHLNIEAEAFVGSRALPSFINSVTNVVEGFFNLLHVSTSKKKHVTILKDVSGIIKPRR 179

Query: 180  LTLLLGPPSSGKTTLLLALAGKLDPTLKVSGTVTYNGHDMDEFVPQRTAAYISQHDNHIG 239
            +TLLLGPPSSGKTTLLLAL+GKLD TLKVSG VTYNGH+++EFVPQRTAAYISQHD HIG
Sbjct: 180  MTLLLGPPSSGKTTLLLALSGKLDKTLKVSGRVTYNGHELNEFVPQRTAAYISQHDLHIG 239

Query: 240  EMTVRETLAFSARCQGVGTRYEMLTELARREKAAGIKPDPDIDVYMKAIATEGQEANVIT 299
            EMTVRETLAFSARCQGVG+RY+ML+EL+RREKAA IKPDPD+DVYMKA ATEGQE+N++T
Sbjct: 240  EMTVRETLAFSARCQGVGSRYDMLSELSRREKAANIKPDPDLDVYMKATATEGQESNIVT 299

Query: 300  DYYLKVLGLDVCADTMVGDEMIRGISGGQKKRVTTGEMMVGPALALFMDEISTGLDSSTT 359
            DY LK+LGLD+CADTMVGDEM+RGISGGQ+KRVTTGEM+VGPA ALFMDEISTGLDSSTT
Sbjct: 300  DYTLKILGLDICADTMVGDEMLRGISGGQRKRVTTGEMLVGPANALFMDEISTGLDSSTT 359

Query: 360  FQIVNCLRQNIHINSGTAVISLLQPAPETYDLFDDIILLSDGQIVYQGPRELVLEFFASM 419
            FQIV+ LR  +HI +GTAVISLLQPAPETYDLFDDIIL+SDGQ+VY GPRE VL+FF SM
Sbjct: 360  FQIVSSLRHYVHILNGTAVISLLQPAPETYDLFDDIILISDGQVVYHGPREYVLDFFESM 419

Query: 420  GFRCPKRKGVADFLQEVTSRKDQRQYWAHKEKPYRFVTVQEFAEAFQSFHVGQKISDELR 479
            GFRCP+RKGVADFLQEVTS+KDQ QYW  +++PYRFVTV +FAEAFQSFH+G K+ +EL 
Sbjct: 420  GFRCPERKGVADFLQEVTSKKDQAQYWVRRDQPYRFVTVTQFAEAFQSFHIGGKLGEELT 479

Query: 480  TPFDKSKSHRAALTTETYGVGKRELLKANISRELLLMKRNSFVYIFKLIQIAFVAVVYMT 539
             PFD++KSH AALTT+ YG+ K+ELLKAN SRE LLMKRNSFVY+FKL Q+  +A+V MT
Sbjct: 480  VPFDRTKSHPAALTTKKYGINKKELLKANFSREYLLMKRNSFVYLFKLSQLFIMALVAMT 539

Query: 540  LFLRTKMHKDTVTDGGIFAGATFFAITMVNFNGFSEISMTIAKLPVFYKQRDFRFFPPWA 599
            LFLRT+MH + + D G++AGA FF +  V FNG +EISMTIAKLPVFYKQR+  F+P WA
Sbjct: 540  LFLRTEMHHENMDDAGVYAGAVFFMLITVMFNGLAEISMTIAKLPVFYKQRNLLFYPSWA 599

Query: 600  YAIPSWILKIPVSFLEVAVWVFLSYYVVGYDSNAGRFFKQYALLLGVNQMASALFRFIAV 659
            YAIPSWILKIPV+ +EVAVWVFL+YYV+G+D N GRFFKQY +LL V+QMAS LFR IA 
Sbjct: 600  YAIPSWILKIPVTIVEVAVWVFLTYYVIGFDPNVGRFFKQYLVLLIVSQMASGLFRTIAA 659

Query: 660  TGRNMVVANTFGSFALLVLLSLGGFILSREDIKKWWKWAYWCSPLTYAQNAIVANEFLGH 719
             GRNM+VANTFG+FA++ +++LGGFILS+ DIK WW W YW SPL Y QNA++ NEFL +
Sbjct: 660  LGRNMIVANTFGAFAIITVVALGGFILSKRDIKSWWIWGYWISPLMYGQNALMVNEFLSN 719

Query: 720  SWKKFTQDSSETLGVQVLKSRGFFAHEYWYWLGLGALFGFVLLLNFAYTLALTFLDPFEK 779
            SW     +++  LGV+ L+SR FF   YWYWLGLGAL GFV L N  + LAL FL PF+K
Sbjct: 720  SW----HNATHNLGVEYLESRAFFTDSYWYWLGLGALVGFVFLFNVMFGLALEFLGPFDK 775

Query: 780  PRAVITEEIESNEQDDRIGGNVQLSTLGGSSNHNTRSGSTDDIR--GQQSSSQSLSLAEA 837
            P+A ITE+  SNE                        G+  DI   G +SS +  SL   
Sbjct: 776  PQATITEDESSNE------------------------GTLADIELPGIESSGRGDSL--V 809

Query: 838  EASRPKKKGMVLPFEPHSLTFDEVVYSVDMPEEMKVQGVLEDKLVLLNGVSGAFRPGVLT 897
            E+S  KKKGMVLPFEPHS+TFDEVVYSVDMP+EMK QGV ED+LVLL GVSGAFRPGVLT
Sbjct: 810  ESSHGKKKGMVLPFEPHSITFDEVVYSVDMPQEMKEQGVQEDRLVLLKGVSGAFRPGVLT 869

Query: 898  ALMGVSGAGKTTLMDVLAGRKTGGYITGNITISGYPKKQETFARISGYCEQNDIHSPFVT 957
            ALMGVSGAGKTTLMDVLAGRKTGGYI G+I ISGYPKKQETFARISGYCEQNDIHSP VT
Sbjct: 870  ALMGVSGAGKTTLMDVLAGRKTGGYIDGSIKISGYPKKQETFARISGYCEQNDIHSPHVT 929

Query: 958  IYESLLFSAWLRLSPEVDSETRKMFIDEVMELVELNPLRQSLVGLPGVSGLSTEQRKRLT 1017
            +YESLL+SAWLRL   VDS+TRKMFI+EVMELVELNP+R SLVGLPGVSGLSTEQRKRLT
Sbjct: 930  VYESLLYSAWLRLPSSVDSKTRKMFIEEVMELVELNPVRNSLVGLPGVSGLSTEQRKRLT 989

Query: 1018 IAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFEAFDE 1077
            IAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFEAFDE
Sbjct: 990  IAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFEAFDE 1049

Query: 1078 LFLMKRGGQEIYVGPLGRHSCHLISYFEAIPGVQKIKDGYNPATWMLEVSAASQELALGI 1137
            LFLMKRGGQEIYVGPLGRHS HLI YFE+I GV KIKDGYNPATWMLEV+A +QEL+LG+
Sbjct: 1050 LFLMKRGGQEIYVGPLGRHSSHLIKYFESIEGVSKIKDGYNPATWMLEVTATAQELSLGV 1109

Query: 1138 DFTEHYKRSDLYRRNKALIEDLSRPPPGSKDLYFPTQFSQSSWIQFVACLWKQHWSYWRN 1197
            DFT+ YK SDLYRRNK LI++L +P PGSKDL+FPTQ+SQS  +Q  ACLWKQ WSYWRN
Sbjct: 1110 DFTDLYKNSDLYRRNKQLIQELGQPAPGSKDLHFPTQYSQSFLVQCQACLWKQRWSYWRN 1169

Query: 1198 PPYTAVRFFFTAFIALLFGSLFWDLGGRTKRNQDLFNAMGSMFTAVLFLGVQYCSSVQPI 1257
            PPYTAVRFFFT FIAL+FG++FWDLGG+     DL NA+GSM+TAVLFLGVQ  SSVQP+
Sbjct: 1170 PPYTAVRFFFTTFIALMFGTIFWDLGGKHSTRGDLLNAIGSMYTAVLFLGVQNASSVQPV 1229

Query: 1258 VSVERTVFYREKAAGMYAGIPWALAQVMIEIPYILVQSVVYGAIVYAMIGFEWTAAKFFW 1317
            V++ERTVFYREKAAGMY+ +P+A AQ+++E+PY+ VQ+V YG IVYAMIGFEWTA KFFW
Sbjct: 1230 VAIERTVFYREKAAGMYSALPYAFAQILVELPYVFVQAVTYGVIVYAMIGFEWTAEKFFW 1289

Query: 1318 YIFFMYFTLLFFTFYGMMAVALTPNHHIAAIVSTLFYGLWNVFSGFIIPRP 1368
            Y+FFMYFTLL++TFYGMM V LTPNHHIA+IV+  FY +WN+FSGF++ RP
Sbjct: 1290 YLFFMYFTLLYYTFYGMMTVGLTPNHHIASIVAAAFYAVWNLFSGFVVTRP 1340

Source: Glycine max

Species: Glycine max

Genus: Glycine

Family: Fabaceae

Order: Fabales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|255543331|ref|XP_002512728.1| ATP-binding cassette transporter, putative [Ricinus communis] gi|223547739|gb|EEF49231.1| ATP-binding cassette transporter, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|359482642|ref|XP_002285020.2| PREDICTED: pleiotropic drug resistance protein 1-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|297743362|emb|CBI36229.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|297743343|emb|CBI36210.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|359482991|ref|XP_003632876.1| PREDICTED: pleiotropic drug resistance protein 1 isoform 3 [Vitis vinifera] Back     alignment and taxonomy information
>gi|359482993|ref|XP_002285178.2| PREDICTED: pleiotropic drug resistance protein 1 isoform 1 [Vitis vinifera] Back     alignment and taxonomy information
>gi|357455075|ref|XP_003597818.1| Pleiotropic drug resistance protein [Medicago truncatula] gi|355486866|gb|AES68069.1| Pleiotropic drug resistance protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|359482989|ref|XP_003632875.1| PREDICTED: pleiotropic drug resistance protein 1 isoform 2 [Vitis vinifera] Back     alignment and taxonomy information
>gi|356519409|ref|XP_003528365.1| PREDICTED: pleiotropic drug resistance protein 1-like [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1391
TAIR|locus:20259311469 PEN3 "PENETRATION 3" [Arabidop 0.967 0.916 0.554 0.0
TAIR|locus:21965931423 ABCG40 "ATP-binding cassette G 0.569 0.556 0.602 0.0
TAIR|locus:20196931454 ABCG39 "ATP-binding cassette G 0.557 0.533 0.515 0.0
TAIR|locus:20448931453 ABCG34 "ATP-binding cassette G 0.557 0.534 0.522 0.0
TAIR|locus:20377031442 ABCG35 "ATP-binding cassette G 0.544 0.525 0.536 0.0
TAIR|locus:20395231420 ABCG32 "ATP-binding cassette G 0.555 0.544 0.487 0.0
TAIR|locus:20949521416 ABCG29 "ATP-binding cassette G 0.540 0.531 0.515 0.0
TAIR|locus:20456831426 ABCG31 "ATP-binding cassette G 0.539 0.525 0.470 0.0
TAIR|locus:20498671413 ABCG33 "ATP-binding cassette G 0.534 0.525 0.471 0.0
TAIR|locus:20840811450 ABCG37 "ATP-binding cassette G 0.531 0.510 0.482 0.0
TAIR|locus:2025931 PEN3 "PENETRATION 3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 3941 (1392.4 bits), Expect = 0., P = 0.
 Identities = 760/1370 (55%), Positives = 974/1370 (71%)

Query:    13 SLRRSASRWNTNSIGAFXXXXXXXXXXX----ALKWAALEKLPTYNRLRKGILTT----- 63
             S+ RS SR + N    F               ALKWAA+EKLPTY+RLR  ++       
Sbjct:    20 SISRSVSRASRNIEDIFSSGSRRTQSVNDDEEALKWAAIEKLPTYSRLRTTLMNAVVEDD 79

Query:    64 ---SRGEANEVDVYNLGLQERQRLIDKLVKVTDVDNERFLLKLKNRIDRVGIDLPKVEVR 120
                ++  + EVDV  L  ++RQ+ ID + KV + DNER L KL+NRIDRVGI LP VEVR
Sbjct:    80 VYGNQLMSKEVDVTKLDGEDRQKFIDMVFKVAEQDNERILTKLRNRIDRVGIKLPTVEVR 139

Query:   121 YEHLNVEAEAFLASNALPSFIKFYTNIFEDILNYLRIIPSKKRHLTILKDVSGVIKPGRL 180
             YEHL ++A+ +  + +LP+ +    N+ E  L  + I  +KK  LTILKD+SGVIKPGR+
Sbjct:   140 YEHLTIKADCYTGNRSLPTLLNVVRNMGESALGMIGIQFAKKAQLTILKDISGVIKPGRM 199

Query:   181 TLLLGPPXXXXXXXXXXXXXXXDPTLKVSGTVTYNGHDMDEFVPQRTAAYISQHDNHIGE 240
             TLLLGPP               D +L+VSG +TYNG+ +DEFVP++T+AYISQ+D H+G 
Sbjct:   200 TLLLGPPSSGKTTLLLALAGKLDKSLQVSGDITYNGYQLDEFVPRKTSAYISQNDLHVGI 259

Query:   241 MTVRETLAFSARCQGVGTRYEMLTELARREKAAGIKPDPDIDVYMKAIATEGQEANVITD 300
             MTV+ETL FSARCQGVGTRY++L ELARREK AGI P+ D+D++MKA A +G + +++TD
Sbjct:   260 MTVKETLDFSARCQGVGTRYDLLNELARREKDAGIFPEADVDLFMKASAAQGVKNSLVTD 319

Query:   301 YYLKVLGLDVCADTMVGDEMIRGISGGQKKRVTTGEMMVGPALALFMDEISTGLDSSTTF 360
             Y LK+LGLD+C DT+VGD+M+RGISGGQKKRVTTGEM+VGP   LFMDEISTGLDSSTTF
Sbjct:   320 YTLKILGLDICKDTIVGDDMMRGISGGQKKRVTTGEMIVGPTKTLFMDEISTGLDSSTTF 379

Query:   361 QIVNCLRQNIHINSGTAVISLLQPAPETYDLFDDIILLSDGQIVYQGPRELVLEFFASMG 420
             QIV CL+Q +H+N  T ++SLLQPAPET+DLFDDIIL+S+GQIVYQGPR+ +LEFF S G
Sbjct:   380 QIVKCLQQIVHLNEATVLMSLLQPAPETFDLFDDIILVSEGQIVYQGPRDNILEFFESFG 439

Query:   421 FRCPKRKGVADFLQEVTSRKDQRQYWAHKEKPYRFVTVQEFAEAFQSFHVGQKISDELRT 480
             F+CP+RKG ADFLQEVTS+KDQ QYW +  +PY ++ V EFA  ++SFHVG K+S+EL  
Sbjct:   440 FKCPERKGTADFLQEVTSKKDQEQYWVNPNRPYHYIPVSEFASRYKSFHVGTKMSNELAV 499

Query:   481 PFDKSKSHRAALTTETYGVGKRELLKANISRELLLMKRNSFVYIFKLIQIAFVAVVYMTL 540
             PFDKS+ H+AAL  + Y V KRELLK+   +E LLM+RN+F Y+FK +QI  +A +  TL
Sbjct:   500 PFDKSRGHKAALVFDKYSVSKRELLKSCWDKEWLLMQRNAFFYVFKTVQIVIIAAITSTL 559

Query:   541 FLRTKMHKDTVTDGGIFAGATFFAITMVNFNGFSEISMTIAKLPVFYKQRDFRFFPPWAY 600
             FLRT+M+     D  ++ GA  F + +  FNGF+E++M +++LPVFYKQRD  F+P W +
Sbjct:   560 FLRTEMNTRNEGDANLYIGALLFGMIINMFNGFAEMAMMVSRLPVFYKQRDLLFYPSWTF 619

Query:   601 AIPSWILKIPVSFLEVAVWVFLSYYVVGYDSNAGRFFKQYALLLGVNQMASALFRFIAVT 660
             ++P+++L IP S LE   W+ ++YY +G+  +A RFFKQ+ L+  + QMA++LFR IA  
Sbjct:   620 SLPTFLLGIPSSILESTAWMVVTYYSIGFAPDASRFFKQFLLVFLIQQMAASLFRLIASV 679

Query:   661 GRNMVVANTXXXXXXXXXXXXXXXXXXREDIKKWWKWAYWCSPLTYAQNAIVANEFLGHS 720
              R M++ANT                  +  I  WW WAYW SPLTYA N +V NE     
Sbjct:   680 CRTMMIANTGGALTLLLVFLLGGFLLPKGKIPDWWGWAYWVSPLTYAFNGLVVNEMFAPR 739

Query:   721 W--KKFTQDSSETLGVQVLKSRGFFAHEYWYWXXXXXXXXXXXXXXXAYTLALTFLDPFE 778
             W  K  + +S+  LG  VL +   +  + WYW                +TLALT+L+P  
Sbjct:   740 WMNKMASSNSTIKLGTMVLNTWDVYHQKNWYWISVGALLCFTALFNILFTLALTYLNPLG 799

Query:   779 KPRAVITEEIESNEQDDRIGGNVQLSTLGGSSNHNTRSGSTDDIRGXXXXXXXXXXXXXX 838
             K   ++ EE   NE  D+ G +    +L  S+    R G      G              
Sbjct:   800 KKAGLLPEE--ENEDADQ-GKDPMRRSL--STADGNRRGEV--AMGRMSRDSAAEASGGA 852

Query:   839 XXRPKKKGMVLPFEPHSLTFDEVVYSVDMPEEMKVQGVLEDKLVLLNGVSGAFRPGVLTA 898
                  KKGMVLPF P +++FD+V Y VDMP EM+ QGV E +L LL GV+GAFRPGVLTA
Sbjct:   853 G---NKKGMVLPFTPLAMSFDDVKYFVDMPGEMRDQGVTETRLQLLKGVTGAFRPGVLTA 909

Query:   899 LMGVSGAGKTTLMDVLAGRKTGGYITGNITISGYPKKQETFARISGYCEQNDIHSPFVTI 958
             LMGVSGAGKTTLMDVLAGRKTGGYI G++ ISG+PK QETFARISGYCEQ DIHSP VT+
Sbjct:   910 LMGVSGAGKTTLMDVLAGRKTGGYIEGDVRISGFPKVQETFARISGYCEQTDIHSPQVTV 969

Query:   959 YESLLFSAWLRLSPEVDSETRKMFIDEVMELVELNPLRQSLVGLPGVSGLSTEQRKRLTI 1018
              ESL+FSA+LRL  EV  + + MF+D+VMELVEL+ LR S+VGLPGV+GLSTEQRKRLTI
Sbjct:   970 RESLIFSAFLRLPKEVGKDEKMMFVDQVMELVELDSLRDSIVGLPGVTGLSTEQRKRLTI 1029

Query:  1019 AVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFEAFDEL 1078
             AVELVANPSIIFMDEPTSGLDARAAAIVMR VRNTVDTGRTVVCTIHQPSIDIFEAFDEL
Sbjct:  1030 AVELVANPSIIFMDEPTSGLDARAAAIVMRAVRNTVDTGRTVVCTIHQPSIDIFEAFDEL 1089

Query:  1079 FLMKRGGQEIYVGPLGRHSCHLISYFEAIPGVQKIKDGYNPATWMLEVSAASQELALGID 1138
              LMKRGGQ IY GPLG++S  ++ YFE+ PGV KI + YNPATWMLE S+ + EL L +D
Sbjct:  1090 MLMKRGGQVIYAGPLGQNSHKVVEYFESFPGVSKIPEKYNPATWMLEASSLAAELKLSVD 1149

Query:  1139 FTEHYKRSDLYRRNKALIEDLSRPPPGSKDLYFPTQFSQSSWIQFVACLWKQHWSYWRNP 1198
             F E Y +S L++RNKAL+++LS PP G+ DLYF TQFSQ++W QF +CLWKQ W+YWR+P
Sbjct:  1150 FAELYNQSALHQRNKALVKELSVPPAGASDLYFATQFSQNTWGQFKSCLWKQWWTYWRSP 1209

Query:  1199 PYTAVRFFFTAFIALLFGSLFWDLGGRTKRNQDLFNAMGSMFTAVLFLGVQYCSSVQPIV 1258
              Y  VRF FT   +LL G++FW +GG      DL   +G+++ A++F+G+  CS+VQP+V
Sbjct:  1210 DYNLVRFIFTLATSLLIGTVFWQIGGNRSNAGDLTMVIGALYAAIIFVGINNCSTVQPMV 1269

Query:  1259 SVERTVFYREKAAGMYAGIPWALAQVMIEIPYILVQSVVYGAIVYAMIGFEWTAAKFFWY 1318
             +VERTVFYRE+AAGMY+ +P+A++QV  E+PY+L+Q+V Y  IVYAM+GFEW A KFFW+
Sbjct:  1270 AVERTVFYRERAAGMYSAMPYAISQVTCELPYVLIQTVYYSLIVYAMVGFEWKAEKFFWF 1329

Query:  1319 IXXXXXXXXXXXXXXXMAVALTPNHHIAAIVSTLFYGLWNVFSGFIIPRP 1368
             +               M V+LTPN  +A+I ++ FYG++N+FSGF IPRP
Sbjct:  1330 VFVSYFSFLYWTYYGMMTVSLTPNQQVASIFASAFYGIFNLFSGFFIPRP 1379
GO:0000166 "nucleotide binding" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA
GO:0016887 "ATPase activity" evidence=IEA
GO:0017111 "nucleoside-triphosphatase activity" evidence=IEA
GO:0042626 "ATPase activity, coupled to transmembrane movement of substances" evidence=ISS
GO:0009941 "chloroplast envelope" evidence=IDA
GO:0005886 "plasma membrane" evidence=IDA
GO:0009507 "chloroplast" evidence=IDA
GO:0005739 "mitochondrion" evidence=IDA
GO:0009627 "systemic acquired resistance" evidence=RCA;IMP
GO:0009817 "defense response to fungus, incompatible interaction" evidence=IMP
GO:0006855 "drug transmembrane transport" evidence=ISS
GO:0031348 "negative regulation of defense response" evidence=RCA;IMP
GO:0005774 "vacuolar membrane" evidence=IDA
GO:0015086 "cadmium ion transmembrane transporter activity" evidence=IDA
GO:0015691 "cadmium ion transport" evidence=IMP
GO:0016020 "membrane" evidence=IDA
GO:0042344 "indole glucosinolate catabolic process" evidence=IMP
GO:0042742 "defense response to bacterium" evidence=RCA;IMP
GO:0052544 "defense response by callose deposition in cell wall" evidence=IMP
GO:0071366 "cellular response to indolebutyric acid stimulus" evidence=IMP
GO:0009737 "response to abscisic acid stimulus" evidence=IDA
GO:0000165 "MAPK cascade" evidence=RCA
GO:0006612 "protein targeting to membrane" evidence=RCA
GO:0006995 "cellular response to nitrogen starvation" evidence=RCA
GO:0009595 "detection of biotic stimulus" evidence=RCA
GO:0009697 "salicylic acid biosynthetic process" evidence=RCA
GO:0009862 "systemic acquired resistance, salicylic acid mediated signaling pathway" evidence=RCA
GO:0009867 "jasmonic acid mediated signaling pathway" evidence=RCA
GO:0009963 "positive regulation of flavonoid biosynthetic process" evidence=RCA
GO:0010200 "response to chitin" evidence=RCA
GO:0010310 "regulation of hydrogen peroxide metabolic process" evidence=RCA
GO:0010363 "regulation of plant-type hypersensitive response" evidence=RCA
GO:0030003 "cellular cation homeostasis" evidence=RCA
GO:0031347 "regulation of defense response" evidence=RCA
GO:0043900 "regulation of multi-organism process" evidence=RCA
GO:0050832 "defense response to fungus" evidence=RCA
GO:0070838 "divalent metal ion transport" evidence=RCA
TAIR|locus:2196593 ABCG40 "ATP-binding cassette G40" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2019693 ABCG39 "ATP-binding cassette G39" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2044893 ABCG34 "ATP-binding cassette G34" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2037703 ABCG35 "ATP-binding cassette G35" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2039523 ABCG32 "ATP-binding cassette G32" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2094952 ABCG29 "ATP-binding cassette G29" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2045683 ABCG31 "ATP-binding cassette G31" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2049867 ABCG33 "ATP-binding cassette G33" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2084081 ABCG37 "ATP-binding cassette G37" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q2PCF1PDR2_NICPLNo assigned EC number0.58580.95750.9117N/Ano
Q0JLC5PDR3_ORYSJNo assigned EC number0.69890.96110.9176yesno
Q9M9E1AB40G_ARATHNo assigned EC number0.69510.95900.9374yesno
O24367TUR2_SPIPONo assigned EC number0.69340.96110.9278N/Ano
Q76CU2PDR1_TOBACNo assigned EC number0.72290.95470.9260N/Ano
Q949G3PDR1_NICPLNo assigned EC number0.70530.95470.9247N/Ano
A2WSH0PDR3_ORYSINo assigned EC number0.69810.96110.9176N/Ano
Q5W274PDR3_TOBACNo assigned EC number0.53110.95180.9149N/Ano

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1391
PLN031401470 PLN03140, PLN03140, ABC transporter G family membe 0.0
TIGR00956 1394 TIGR00956, 3a01205, Pleiotropic Drug Resistance (P 0.0
cd03232192 cd03232, ABCG_PDR_domain2, Second domain of the pl 1e-100
TIGR00955617 TIGR00955, 3a01204, The Eye Pigment Precursor Tran 9e-89
TIGR00955617 TIGR00955, 3a01204, The Eye Pigment Precursor Tran 4e-74
cd03213194 cd03213, ABCG_EPDR, Eye pigment and drug resistanc 2e-72
cd03234226 cd03234, ABCG_White, White pigment protein homolog 1e-54
PLN03211659 PLN03211, PLN03211, ABC transporter G-25; Provisio 3e-46
pfam01061210 pfam01061, ABC2_membrane, ABC-2 type transporter 3e-45
COG1131293 COG1131, CcmA, ABC-type multidrug transport system 6e-44
TIGR009561394 TIGR00956, 3a01205, Pleiotropic Drug Resistance (P 2e-42
pfam01061210 pfam01061, ABC2_membrane, ABC-2 type transporter 2e-42
cd03234226 cd03234, ABCG_White, White pigment protein homolog 6e-42
cd03233202 cd03233, ABCG_PDR_domain1, First domain of the ple 4e-39
COG1131293 COG1131, CcmA, ABC-type multidrug transport system 3e-38
cd03233202 cd03233, ABCG_PDR_domain1, First domain of the ple 5e-37
PLN031401470 PLN03140, PLN03140, ABC transporter G family membe 7e-34
PLN03211659 PLN03211, PLN03211, ABC transporter G-25; Provisio 1e-33
cd03233202 cd03233, ABCG_PDR_domain1, First domain of the ple 2e-33
cd03263220 cd03263, ABC_subfamily_A, ATP-binding cassette dom 9e-32
cd03213194 cd03213, ABCG_EPDR, Eye pigment and drug resistanc 4e-30
cd03225211 cd03225, ABC_cobalt_CbiO_domain1, First domain of 1e-29
cd03264211 cd03264, ABC_drug_resistance_like, ABC-type multid 9e-29
pfam0837065 pfam08370, PDR_assoc, Plant PDR ABC transporter as 3e-27
cd03235213 cd03235, ABC_Metallic_Cations, ATP-binding cassett 3e-24
COG1120258 COG1120, FepC, ABC-type cobalamin/Fe3+-siderophore 2e-23
cd03263220 cd03263, ABC_subfamily_A, ATP-binding cassette dom 3e-23
cd03255218 cd03255, ABC_MJ0796_LolCDE_FtsE, ATP-binding casse 2e-22
cd03214180 cd03214, ABC_Iron-Siderophores_B12_Hemin, ATP-bind 3e-22
COG1120258 COG1120, FepC, ABC-type cobalamin/Fe3+-siderophore 5e-22
cd03225211 cd03225, ABC_cobalt_CbiO_domain1, First domain of 6e-22
cd03230173 cd03230, ABC_DR_subfamily_A, ATP-binding cassette 9e-22
cd03232192 cd03232, ABCG_PDR_domain2, Second domain of the pl 1e-21
cd03259213 cd03259, ABC_Carb_Solutes_like, ATP-binding casset 3e-21
cd03229178 cd03229, ABC_Class3, ATP-binding cassette domain o 3e-21
COG1121254 COG1121, ZnuC, ABC-type Mn/Zn transport systems, A 5e-21
cd03213194 cd03213, ABCG_EPDR, Eye pigment and drug resistanc 2e-20
COG1122235 COG1122, CbiO, ABC-type cobalt transport system, A 2e-20
cd03226205 cd03226, ABC_cobalt_CbiO_domain2, Second domain of 2e-20
COG4988559 COG4988, CydD, ABC-type transport system involved 4e-20
COG1136226 COG1136, SalX, ABC-type antimicrobial peptide tran 6e-20
TIGR01166190 TIGR01166, cbiO, cobalt transport protein ATP-bind 8e-20
cd00267157 cd00267, ABC_ATPase, ATP-binding cassette transpor 4e-19
TIGR01188302 TIGR01188, drrA, daunorubicin resistance ABC trans 5e-19
COG2274709 COG2274, SunT, ABC-type bacteriocin/lantibiotic ex 9e-19
COG1122235 COG1122, CbiO, ABC-type cobalt transport system, A 2e-18
cd03255218 cd03255, ABC_MJ0796_LolCDE_FtsE, ATP-binding casse 3e-18
TIGR02857529 TIGR02857, CydD, thiol reductant ABC exporter, Cyd 4e-18
cd03265220 cd03265, ABC_DrrA, Daunorubicin/doxorubicin resist 4e-18
COG1118345 COG1118, CysA, ABC-type sulfate/molybdate transpor 6e-18
cd03219236 cd03219, ABC_Mj1267_LivG_branched, ATP-binding cas 1e-17
cd03245220 cd03245, ABCC_bacteriocin_exporters, ATP-binding c 1e-17
cd03261235 cd03261, ABC_Org_Solvent_Resistant, ATP-binding ca 1e-17
cd03266218 cd03266, ABC_NatA_sodium_exporter, ATP-binding cas 1e-17
TIGR02868530 TIGR02868, CydC, thiol reductant ABC exporter, Cyd 2e-17
cd03292214 cd03292, ABC_FtsE_transporter, ATP-binding cassett 2e-17
cd03293220 cd03293, ABC_NrtD_SsuB_transporters, ATP-binding c 3e-17
cd03228171 cd03228, ABCC_MRP_Like, ATP-binding cassette domai 4e-17
TIGR02315243 TIGR02315, ABC_phnC, phosphonate ABC transporter, 4e-17
cd03261235 cd03261, ABC_Org_Solvent_Resistant, ATP-binding ca 5e-17
TIGR03864236 TIGR03864, PQQ_ABC_ATP, ABC transporter, ATP-bindi 5e-17
cd03256241 cd03256, ABC_PhnC_transporter, ATP-binding cassett 5e-17
COG4555245 COG4555, NatA, ABC-type Na+ transport system, ATPa 5e-17
cd03268208 cd03268, ABC_BcrA_bacitracin_resist, ATP-binding c 9e-17
cd03256241 cd03256, ABC_PhnC_transporter, ATP-binding cassett 1e-16
COG3842352 COG3842, PotA, ABC-type spermidine/putrescine tran 1e-16
COG3638258 COG3638, COG3638, ABC-type phosphate/phosphonate t 1e-16
COG1136226 COG1136, SalX, ABC-type antimicrobial peptide tran 2e-16
COG3839338 COG3839, MalK, ABC-type sugar transport systems, A 3e-16
TIGR00968237 TIGR00968, 3a0106s01, sulfate ABC transporter, ATP 3e-16
TIGR03608206 TIGR03608, L_ocin_972_ABC, putative bacteriocin ex 4e-16
PRK13539207 PRK13539, PRK13539, cytochrome c biogenesis protei 5e-16
cd03257228 cd03257, ABC_NikE_OppD_transporters, ATP-binding c 5e-16
cd03297214 cd03297, ABC_ModC_molybdenum_transporter, ATP-bind 7e-16
COG1118345 COG1118, CysA, ABC-type sulfate/molybdate transpor 9e-16
COG4555245 COG4555, NatA, ABC-type Na+ transport system, ATPa 9e-16
COG3839338 COG3839, MalK, ABC-type sugar transport systems, A 9e-16
cd03259213 cd03259, ABC_Carb_Solutes_like, ATP-binding casset 2e-15
COG0411250 COG0411, LivG, ABC-type branched-chain amino acid 2e-15
TIGR03873256 TIGR03873, F420-0_ABC_ATP, proposed F420-0 ABC tra 2e-15
PRK13537306 PRK13537, PRK13537, nodulation ABC transporter Nod 2e-15
COG1121254 COG1121, ZnuC, ABC-type Mn/Zn transport systems, A 4e-15
TIGR01978243 TIGR01978, sufC, FeS assembly ATPase SufC 4e-15
PRK13536340 PRK13536, PRK13536, nodulation factor exporter sub 4e-15
COG4559259 COG4559, COG4559, ABC-type hemin transport system, 4e-15
COG4133209 COG4133, CcmA, ABC-type transport system involved 4e-15
COG3638258 COG3638, COG3638, ABC-type phosphate/phosphonate t 6e-15
cd03224222 cd03224, ABC_TM1139_LivF_branched, ATP-binding cas 6e-15
cd03219236 cd03219, ABC_Mj1267_LivG_branched, ATP-binding cas 1e-14
COG3842352 COG3842, PotA, ABC-type spermidine/putrescine tran 1e-14
cd03257228 cd03257, ABC_NikE_OppD_transporters, ATP-binding c 1e-14
cd03260227 cd03260, ABC_PstB_phosphate_transporter, ATP-bindi 1e-14
cd03269210 cd03269, ABC_putative_ATPase, ATP-binding cassette 1e-14
cd03246173 cd03246, ABCC_Protease_Secretion, ATP-binding cass 1e-14
cd03218232 cd03218, ABC_YhbG, ATP-binding cassette component 1e-14
cd03296239 cd03296, ABC_CysA_sulfate_importer, ATP-binding ca 1e-14
COG1116248 COG1116, TauB, ABC-type nitrate/sulfonate/bicarbon 2e-14
COG4988559 COG4988, CydD, ABC-type transport system involved 3e-14
COG1123539 COG1123, COG1123, ATPase components of various ABC 4e-14
PRK13548258 PRK13548, hmuV, hemin importer ATP-binding subunit 5e-14
TIGR03375694 TIGR03375, type_I_sec_LssB, type I secretion syste 9e-14
cd03235213 cd03235, ABC_Metallic_Cations, ATP-binding cassett 1e-13
cd03245220 cd03245, ABCC_bacteriocin_exporters, ATP-binding c 1e-13
COG0411250 COG0411, LivG, ABC-type branched-chain amino acid 1e-13
COG4559259 COG4559, COG4559, ABC-type hemin transport system, 1e-13
cd03296239 cd03296, ABC_CysA_sulfate_importer, ATP-binding ca 1e-13
COG4674249 COG4674, COG4674, Uncharacterized ABC-type transpo 1e-13
COG0396251 COG0396, sufC, Cysteine desulfurase activator ATPa 1e-13
COG4152300 COG4152, COG4152, ABC-type uncharacterized transpo 1e-13
cd03254229 cd03254, ABCC_Glucan_exporter_like, ATP-binding ca 1e-13
COG1127263 COG1127, Ttg2A, ABC-type transport system involved 1e-13
cd03264211 cd03264, ABC_drug_resistance_like, ABC-type multid 2e-13
PRK13539207 PRK13539, PRK13539, cytochrome c biogenesis protei 2e-13
TIGR03873256 TIGR03873, F420-0_ABC_ATP, proposed F420-0 ABC tra 2e-13
COG0396251 COG0396, sufC, Cysteine desulfurase activator ATPa 2e-13
PRK10895241 PRK10895, PRK10895, lipopolysaccharide ABC transpo 2e-13
COG4604252 COG4604, CeuD, ABC-type enterochelin transport sys 2e-13
TIGR01189198 TIGR01189, ccmA, heme ABC exporter, ATP-binding pr 2e-13
TIGR01288303 TIGR01288, nodI, ATP-binding ABC transporter famil 2e-13
TIGR02857529 TIGR02857, CydD, thiol reductant ABC exporter, Cyd 3e-13
TIGR02315243 TIGR02315, ABC_phnC, phosphonate ABC transporter, 3e-13
cd03224222 cd03224, ABC_TM1139_LivF_branched, ATP-binding cas 3e-13
COG1124252 COG1124, DppF, ABC-type dipeptide/oligopeptide/nic 3e-13
COG1129500 COG1129, MglA, ABC-type sugar transport system, AT 3e-13
cd03232192 cd03232, ABCG_PDR_domain2, Second domain of the pl 4e-13
cd03230173 cd03230, ABC_DR_subfamily_A, ATP-binding cassette 4e-13
PRK13548258 PRK13548, hmuV, hemin importer ATP-binding subunit 6e-13
PRK13636283 PRK13636, cbiO, cobalt transporter ATP-binding sub 6e-13
cd03266218 cd03266, ABC_NatA_sodium_exporter, ATP-binding cas 7e-13
cd03293220 cd03293, ABC_NrtD_SsuB_transporters, ATP-binding c 8e-13
COG1127263 COG1127, Ttg2A, ABC-type transport system involved 8e-13
TIGR00968237 TIGR00968, 3a0106s01, sulfate ABC transporter, ATP 9e-13
cd03228171 cd03228, ABCC_MRP_Like, ATP-binding cassette domai 1e-12
cd03252237 cd03252, ABCC_Hemolysin, ATP-binding cassette doma 1e-12
cd03249238 cd03249, ABC_MTABC3_MDL1_MDL2, ATP-binding cassett 1e-12
TIGR03411242 TIGR03411, urea_trans_UrtD, urea ABC transporter, 1e-12
cd03253236 cd03253, ABCC_ATM1_transporter, ATP-binding casset 1e-12
COG2274709 COG2274, SunT, ABC-type bacteriocin/lantibiotic ex 2e-12
cd03297214 cd03297, ABC_ModC_molybdenum_transporter, ATP-bind 2e-12
cd03250204 cd03250, ABCC_MRP_domain1, ATP-binding cassette do 2e-12
COG4525259 COG4525, TauB, ABC-type taurine transport system, 2e-12
TIGR012572272 TIGR01257, rim_protein, retinal-specific rim ABC t 2e-12
COG0410237 COG0410, LivF, ABC-type branched-chain amino acid 2e-12
TIGR02982220 TIGR02982, heterocyst_DevA, ABC exporter ATP-bindi 2e-12
PRK11231255 PRK11231, fecE, iron-dicitrate transporter ATP-bin 3e-12
TIGR01842544 TIGR01842, type_I_sec_PrtD, type I secretion syste 3e-12
cd03301213 cd03301, ABC_MalK_N, The N-terminal ATPase domain 3e-12
TIGR02868530 TIGR02868, CydC, thiol reductant ABC exporter, Cyd 4e-12
COG1137243 COG1137, YhbG, ABC-type (unclassified) transport s 4e-12
COG1132567 COG1132, MdlB, ABC-type multidrug transport system 4e-12
TIGR03740223 TIGR03740, galliderm_ABC, gallidermin-class lantib 5e-12
PRK13638271 PRK13638, cbiO, cobalt transporter ATP-binding sub 5e-12
PRK11231255 PRK11231, fecE, iron-dicitrate transporter ATP-bin 6e-12
PRK14239252 PRK14239, PRK14239, phosphate transporter ATP-bind 6e-12
cd03267236 cd03267, ABC_NatA_like, ATP-binding cassette domai 6e-12
PRK15056272 PRK15056, PRK15056, manganese/iron transporter ATP 6e-12
cd03253236 cd03253, ABCC_ATM1_transporter, ATP-binding casset 9e-12
cd03299235 cd03299, ABC_ModC_like, ATP-binding cassette domai 9e-12
cd03226205 cd03226, ABC_cobalt_CbiO_domain2, Second domain of 1e-11
cd03249238 cd03249, ABC_MTABC3_MDL1_MDL2, ATP-binding cassett 1e-11
cd03300232 cd03300, ABC_PotA_N, ATP-binding cassette domain o 1e-11
COG4586325 COG4586, COG4586, ABC-type uncharacterized transpo 1e-11
TIGR03258362 TIGR03258, PhnT, 2-aminoethylphosphonate ABC trans 1e-11
cd00267157 cd00267, ABC_ATPase, ATP-binding cassette transpor 2e-11
TIGR03864236 TIGR03864, PQQ_ABC_ATP, ABC transporter, ATP-bindi 2e-11
cd03260227 cd03260, ABC_PstB_phosphate_transporter, ATP-bindi 2e-11
cd03269210 cd03269, ABC_putative_ATPase, ATP-binding cassette 2e-11
COG4604252 COG4604, CeuD, ABC-type enterochelin transport sys 2e-11
TIGR02982220 TIGR02982, heterocyst_DevA, ABC exporter ATP-bindi 2e-11
cd03300232 cd03300, ABC_PotA_N, ATP-binding cassette domain o 2e-11
PRK10584228 PRK10584, PRK10584, putative ABC transporter ATP-b 2e-11
COG1125309 COG1125, OpuBA, ABC-type proline/glycine betaine t 2e-11
PRK13547272 PRK13547, hmuV, hemin importer ATP-binding subunit 2e-11
COG4618580 COG4618, ArpD, ABC-type protease/lipase transport 2e-11
COG1135339 COG1135, AbcC, ABC-type metal ion transport system 2e-11
cd03295242 cd03295, ABC_OpuCA_Osmoprotection, ATP-binding cas 2e-11
cd03265220 cd03265, ABC_DrrA, Daunorubicin/doxorubicin resist 3e-11
COG1123539 COG1123, COG1123, ATPase components of various ABC 3e-11
cd03251234 cd03251, ABCC_MsbA, ATP-binding cassette domain of 3e-11
TIGR03522301 TIGR03522, GldA_ABC_ATP, gliding motility-associat 3e-11
pfam00005119 pfam00005, ABC_tran, ABC transporter 3e-11
PRK09984262 PRK09984, PRK09984, phosphonate/organophosphate es 3e-11
TIGR02673214 TIGR02673, FtsE, cell division ATP-binding protein 4e-11
COG1117253 COG1117, PstB, ABC-type phosphate transport system 5e-11
COG1123539 COG1123, COG1123, ATPase components of various ABC 6e-11
cd03299235 cd03299, ABC_ModC_like, ATP-binding cassette domai 6e-11
COG1135339 COG1135, AbcC, ABC-type metal ion transport system 7e-11
cd03292214 cd03292, ABC_FtsE_transporter, ATP-binding cassett 8e-11
TIGR02211221 TIGR02211, LolD_lipo_ex, lipoprotein releasing sys 8e-11
TIGR02142354 TIGR02142, modC_ABC, molybdenum ABC transporter, A 8e-11
PRK11264250 PRK11264, PRK11264, putative amino-acid ABC transp 9e-11
COG2884223 COG2884, FtsE, Predicted ATPase involved in cell d 9e-11
COG4136213 COG4136, COG4136, ABC-type uncharacterized transpo 9e-11
TIGR03265353 TIGR03265, PhnT2, putative 2-aminoethylphosphonate 1e-10
COG0488530 COG0488, Uup, ATPase components of ABC transporter 1e-10
COG4181228 COG4181, COG4181, Predicted ABC-type transport sys 1e-10
PRK09700510 PRK09700, PRK09700, D-allose transporter ATP-bindi 1e-10
PRK13639275 PRK13639, cbiO, cobalt transporter ATP-binding sub 1e-10
cd03301213 cd03301, ABC_MalK_N, The N-terminal ATPase domain 2e-10
TIGR03258362 TIGR03258, PhnT, 2-aminoethylphosphonate ABC trans 2e-10
COG4181228 COG4181, COG4181, Predicted ABC-type transport sys 2e-10
PRK13652277 PRK13652, cbiO, cobalt transporter ATP-binding sub 2e-10
PRK11248255 PRK11248, tauB, taurine transporter ATP-binding su 2e-10
COG4987573 COG4987, CydC, ABC-type transport system involved 2e-10
COG0444316 COG0444, DppD, ABC-type dipeptide/oligopeptide/nic 2e-10
COG4138248 COG4138, BtuD, ABC-type cobalamin transport system 2e-10
cd03258233 cd03258, ABC_MetN_methionine_transporter, ATP-bind 2e-10
TIGR03796710 TIGR03796, NHLM_micro_ABC1, NHLM bacteriocin syste 2e-10
PRK13640282 PRK13640, cbiO, cobalt transporter ATP-binding sub 2e-10
TIGR03797686 TIGR03797, NHLM_micro_ABC2, NHLM bacteriocin syste 2e-10
COG0410237 COG0410, LivF, ABC-type branched-chain amino acid 3e-10
COG3845501 COG3845, COG3845, ABC-type uncharacterized transpo 3e-10
PRK13631320 PRK13631, cbiO, cobalt transporter ATP-binding sub 3e-10
TIGR02203571 TIGR02203, MsbA_lipidA, lipid A export permease/AT 3e-10
COG1123539 COG1123, COG1123, ATPase components of various ABC 4e-10
cd03250204 cd03250, ABCC_MRP_domain1, ATP-binding cassette do 4e-10
TIGR01187325 TIGR01187, potA, spermidine/putrescine ABC transpo 4e-10
COG4107258 COG4107, PhnK, ABC-type phosphonate transport syst 4e-10
TIGR03410230 TIGR03410, urea_trans_UrtE, urea ABC transporter, 4e-10
PRK09452375 PRK09452, potA, putrescine/spermidine ABC transpor 4e-10
cd03231201 cd03231, ABC_CcmA_heme_exporter, Cytochrome c biog 4e-10
cd03214180 cd03214, ABC_Iron-Siderophores_B12_Hemin, ATP-bind 5e-10
COG1119257 COG1119, ModF, ABC-type molybdenum transport syste 5e-10
PRK14272252 PRK14272, PRK14272, phosphate ABC transporter ATP- 5e-10
TIGR01846694 TIGR01846, type_I_sec_HlyB, type I secretion syste 5e-10
TIGR01166190 TIGR01166, cbiO, cobalt transport protein ATP-bind 6e-10
PRK11288501 PRK11288, araG, L-arabinose transporter ATP-bindin 6e-10
PRK10575265 PRK10575, PRK10575, iron-hydroxamate transporter A 7e-10
PRK09536402 PRK09536, btuD, corrinoid ABC transporter ATPase; 8e-10
COG1125309 COG1125, OpuBA, ABC-type proline/glycine betaine t 9e-10
COG1101263 COG1101, PhnK, ABC-type uncharacterized transport 9e-10
TIGR01188302 TIGR01188, drrA, daunorubicin resistance ABC trans 1e-09
COG4525259 COG4525, TauB, ABC-type taurine transport system, 1e-09
COG4586325 COG4586, COG4586, ABC-type uncharacterized transpo 1e-09
cd03251234 cd03251, ABCC_MsbA, ATP-binding cassette domain of 1e-09
COG0444316 COG0444, DppD, ABC-type dipeptide/oligopeptide/nic 1e-09
COG3840231 COG3840, ThiQ, ABC-type thiamine transport system, 1e-09
COG4148352 COG4148, ModC, ABC-type molybdate transport system 1e-09
TIGR01193708 TIGR01193, bacteriocin_ABC, ABC-type bacteriocin t 1e-09
TIGR00972247 TIGR00972, 3a0107s01c2, phosphate ABC transporter, 1e-09
cd03217200 cd03217, ABC_FeS_Assembly, ABC-type transport syst 2e-09
COG1132567 COG1132, MdlB, ABC-type multidrug transport system 3e-09
COG1119257 COG1119, ModF, ABC-type molybdenum transport syste 3e-09
TIGR02323253 TIGR02323, CP_lyasePhnK, phosphonate C-P lyase sys 3e-09
cd03254229 cd03254, ABCC_Glucan_exporter_like, ATP-binding ca 4e-09
TIGR03522301 TIGR03522, GldA_ABC_ATP, gliding motility-associat 4e-09
cd03298211 cd03298, ABC_ThiQ_thiamine_transporter, ATP-bindin 4e-09
PRK11174588 PRK11174, PRK11174, cysteine/glutathione ABC trans 5e-09
PRK13643288 PRK13643, cbiO, cobalt transporter ATP-binding sub 5e-09
TIGR03375694 TIGR03375, type_I_sec_LssB, type I secretion syste 6e-09
PRK14255252 PRK14255, PRK14255, phosphate ABC transporter ATP- 6e-09
COG4133209 COG4133, CcmA, ABC-type transport system involved 7e-09
COG0488530 COG0488, Uup, ATPase components of ABC transporter 7e-09
TIGR01187325 TIGR01187, potA, spermidine/putrescine ABC transpo 7e-09
TIGR01189198 TIGR01189, ccmA, heme ABC exporter, ATP-binding pr 9e-09
TIGR01978243 TIGR01978, sufC, FeS assembly ATPase SufC 1e-08
PRK13547272 PRK13547, hmuV, hemin importer ATP-binding subunit 1e-08
COG4987573 COG4987, CydC, ABC-type transport system involved 1e-08
COG5265497 COG5265, ATM1, ABC-type transport system involved 1e-08
PRK13647274 PRK13647, cbiO, cobalt transporter ATP-binding sub 1e-08
COG1116248 COG1116, TauB, ABC-type nitrate/sulfonate/bicarbon 2e-08
cd03258233 cd03258, ABC_MetN_methionine_transporter, ATP-bind 2e-08
TIGR01277213 TIGR01277, thiQ, thiamine ABC transporter, ATP-bin 2e-08
COG1126240 COG1126, GlnQ, ABC-type polar amino acid transport 2e-08
cd03248226 cd03248, ABCC_TAP, ATP-binding cassette domain of 2e-08
cd03262213 cd03262, ABC_HisP_GlnQ, ATP-binding cassette domai 2e-08
COG4152300 COG4152, COG4152, ABC-type uncharacterized transpo 3e-08
cd03252237 cd03252, ABCC_Hemolysin, ATP-binding cassette doma 3e-08
TIGR03265353 TIGR03265, PhnT2, putative 2-aminoethylphosphonate 3e-08
COG1126240 COG1126, GlnQ, ABC-type polar amino acid transport 3e-08
PRK14247250 PRK14247, PRK14247, phosphate ABC transporter ATP- 3e-08
cd03268208 cd03268, ABC_BcrA_bacitracin_resist, ATP-binding c 4e-08
PRK13537306 PRK13537, PRK13537, nodulation ABC transporter Nod 4e-08
TIGR02673214 TIGR02673, FtsE, cell division ATP-binding protein 4e-08
cd03244221 cd03244, ABCC_MRP_domain2, ATP-binding cassette do 4e-08
PRK14253249 PRK14253, PRK14253, phosphate ABC transporter ATP- 4e-08
PRK13646286 PRK13646, cbiO, cobalt transporter ATP-binding sub 4e-08
TIGR01186363 TIGR01186, proV, glycine betaine/L-proline transpo 5e-08
COG4619223 COG4619, COG4619, ABC-type uncharacterized transpo 5e-08
PRK11248255 PRK11248, tauB, taurine transporter ATP-binding su 6e-08
PRK14241258 PRK14241, PRK14241, phosphate transporter ATP-bind 6e-08
cd03229178 cd03229, ABC_Class3, ATP-binding cassette domain o 7e-08
PRK10253265 PRK10253, PRK10253, iron-enterobactin transporter 7e-08
PRK13540200 PRK13540, PRK13540, cytochrome c biogenesis protei 7e-08
TIGR03771223 TIGR03771, anch_rpt_ABC, anchored repeat-type ABC 8e-08
PRK13639275 PRK13639, cbiO, cobalt transporter ATP-binding sub 9e-08
cd03295242 cd03295, ABC_OpuCA_Osmoprotection, ATP-binding cas 1e-07
PRK09700510 PRK09700, PRK09700, D-allose transporter ATP-bindi 1e-07
PRK14235267 PRK14235, PRK14235, phosphate transporter ATP-bind 1e-07
PRK14261253 PRK14261, PRK14261, phosphate ABC transporter ATP- 1e-07
PRK10247225 PRK10247, PRK10247, putative ABC transporter ATP-b 1e-07
PRK14245250 PRK14245, PRK14245, phosphate ABC transporter ATP- 1e-07
TIGR02204576 TIGR02204, MsbA_rel, ABC transporter, permease/ATP 1e-07
PRK10982491 PRK10982, PRK10982, galactose/methyl galaxtoside t 1e-07
TIGR02769265 TIGR02769, nickel_nikE, nickel import ATP-binding 1e-07
cd00267157 cd00267, ABC_ATPase, ATP-binding cassette transpor 2e-07
cd00267157 cd00267, ABC_ATPase, ATP-binding cassette transpor 2e-07
TIGR01842544 TIGR01842, type_I_sec_PrtD, type I secretion syste 2e-07
COG4136213 COG4136, COG4136, ABC-type uncharacterized transpo 2e-07
COG0488530 COG0488, Uup, ATPase components of ABC transporter 2e-07
TIGR02323253 TIGR02323, CP_lyasePhnK, phosphonate C-P lyase sys 2e-07
TIGR02769265 TIGR02769, nickel_nikE, nickel import ATP-binding 2e-07
PRK11629233 PRK11629, lolD, lipoprotein transporter ATP-bindin 2e-07
TIGR01184230 TIGR01184, ntrCD, nitrate transport ATP-binding su 2e-07
PRK10851353 PRK10851, PRK10851, sulfate/thiosulfate transporte 2e-07
cd03238176 cd03238, ABC_UvrA, ATP-binding cassette domain of 2e-07
COG1124252 COG1124, DppF, ABC-type dipeptide/oligopeptide/nic 3e-07
PRK13636283 PRK13636, cbiO, cobalt transporter ATP-binding sub 3e-07
PRK14239252 PRK14239, PRK14239, phosphate transporter ATP-bind 3e-07
COG1117253 COG1117, PstB, ABC-type phosphate transport system 3e-07
PRK14272252 PRK14272, PRK14272, phosphate ABC transporter ATP- 3e-07
PRK13641287 PRK13641, cbiO, cobalt transporter ATP-binding sub 3e-07
PRK14240250 PRK14240, PRK14240, phosphate transporter ATP-bind 3e-07
PRK14262250 PRK14262, PRK14262, phosphate ABC transporter ATP- 3e-07
PRK09580248 PRK09580, sufC, cysteine desulfurase ATPase compon 3e-07
PRK10762501 PRK10762, PRK10762, D-ribose transporter ATP bindi 3e-07
TIGR01257 2272 TIGR01257, rim_protein, retinal-specific rim ABC t 4e-07
TIGR03410230 TIGR03410, urea_trans_UrtE, urea ABC transporter, 4e-07
PRK13635279 PRK13635, cbiO, cobalt transporter ATP-binding sub 4e-07
TIGR02770230 TIGR02770, nickel_nikD, nickel import ATP-binding 4e-07
cd03298211 cd03298, ABC_ThiQ_thiamine_transporter, ATP-bindin 5e-07
PRK13643288 PRK13643, cbiO, cobalt transporter ATP-binding sub 5e-07
TIGR02770230 TIGR02770, nickel_nikD, nickel import ATP-binding 5e-07
PRK13651305 PRK13651, PRK13651, cobalt transporter ATP-binding 5e-07
PRK14250241 PRK14250, PRK14250, phosphate ABC transporter ATP- 5e-07
pfam00005119 pfam00005, ABC_tran, ABC transporter 6e-07
TIGR00972247 TIGR00972, 3a0107s01c2, phosphate ABC transporter, 6e-07
COG4619223 COG4619, COG4619, ABC-type uncharacterized transpo 6e-07
PRK14270251 PRK14270, PRK14270, phosphate ABC transporter ATP- 6e-07
PRK10851353 PRK10851, PRK10851, sulfate/thiosulfate transporte 7e-07
PRK10419268 PRK10419, nikE, nickel transporter ATP-binding pro 7e-07
cd03288257 cd03288, ABCC_SUR2, ATP-binding cassette domain 2 7e-07
COG4175386 COG4175, ProV, ABC-type proline/glycine betaine tr 7e-07
TIGR01184230 TIGR01184, ntrCD, nitrate transport ATP-binding su 8e-07
TIGR01288303 TIGR01288, nodI, ATP-binding ABC transporter famil 9e-07
PRK09536402 PRK09536, btuD, corrinoid ABC transporter ATPase; 9e-07
PRK15134529 PRK15134, PRK15134, microcin C ABC transporter ATP 9e-07
cd03216163 cd03216, ABC_Carb_Monos_I, First domain of the ATP 9e-07
PRK13536340 PRK13536, PRK13536, nodulation factor exporter sub 1e-06
COG3840231 COG3840, ThiQ, ABC-type thiamine transport system, 1e-06
cd03217200 cd03217, ABC_FeS_Assembly, ABC-type transport syst 1e-06
TIGR01277213 TIGR01277, thiQ, thiamine ABC transporter, ATP-bin 1e-06
COG4167267 COG4167, SapF, ABC-type antimicrobial peptide tran 1e-06
cd03369207 cd03369, ABCC_NFT1, ATP-binding cassette domain 2 1e-06
PRK11160574 PRK11160, PRK11160, cysteine/glutathione ABC trans 1e-06
PRK14271276 PRK14271, PRK14271, phosphate ABC transporter ATP- 1e-06
TIGR02203571 TIGR02203, MsbA_lipidA, lipid A export permease/AT 2e-06
TIGR03771223 TIGR03771, anch_rpt_ABC, anchored repeat-type ABC 2e-06
PRK09580248 PRK09580, sufC, cysteine desulfurase ATPase compon 2e-06
PRK13657588 PRK13657, PRK13657, cyclic beta-1,2-glucan ABC tra 2e-06
cd03247178 cd03247, ABCC_cytochrome_bd, ATP-binding cassette 2e-06
TIGR03005252 TIGR03005, ectoine_ehuA, ectoine/hydroxyectoine AB 2e-06
PRK13549506 PRK13549, PRK13549, xylose transporter ATP-binding 2e-06
PRK13538204 PRK13538, PRK13538, cytochrome c biogenesis protei 2e-06
PRK11701258 PRK11701, phnK, phosphonate C-P lyase system prote 2e-06
COG4161242 COG4161, ArtP, ABC-type arginine transport system, 2e-06
PRK13638271 PRK13638, cbiO, cobalt transporter ATP-binding sub 3e-06
COG4618580 COG4618, ArpD, ABC-type protease/lipase transport 3e-06
PRK09452375 PRK09452, potA, putrescine/spermidine ABC transpor 3e-06
TIGR02204576 TIGR02204, MsbA_rel, ABC transporter, permease/ATP 3e-06
cd03216163 cd03216, ABC_Carb_Monos_I, First domain of the ATP 3e-06
PRK13538204 PRK13538, PRK13538, cytochrome c biogenesis protei 3e-06
PRK14273254 PRK14273, PRK14273, phosphate ABC transporter ATP- 3e-06
COG1245591 COG1245, COG1245, Predicted ATPase, RNase L inhibi 3e-06
cd03236255 cd03236, ABC_RNaseL_inhibitor_domain1, The ATP-bin 3e-06
PRK14251251 PRK14251, PRK14251, phosphate ABC transporter ATP- 3e-06
TIGR02633500 TIGR02633, xylG, D-xylose ABC transporter, ATP-bin 3e-06
PRK14267253 PRK14267, PRK14267, phosphate ABC transporter ATP- 3e-06
COG5265497 COG5265, ATM1, ABC-type transport system involved 4e-06
PRK13644274 PRK13644, cbiO, cobalt transporter ATP-binding sub 4e-06
COG4172534 COG4172, COG4172, ABC-type uncharacterized transpo 4e-06
PRK14238271 PRK14238, PRK14238, phosphate transporter ATP-bind 4e-06
PRK11300255 PRK11300, livG, leucine/isoleucine/valine transpor 4e-06
PRK14236272 PRK14236, PRK14236, phosphate transporter ATP-bind 4e-06
cd03294269 cd03294, ABC_Pro_Gly_Betaine, ATP-binding cassette 5e-06
PRK09493240 PRK09493, glnQ, glutamine ABC transporter ATP-bind 5e-06
PRK11432351 PRK11432, fbpC, ferric transporter ATP-binding sub 5e-06
PRK14256252 PRK14256, PRK14256, phosphate ABC transporter ATP- 5e-06
CHL00131252 CHL00131, ycf16, sulfate ABC transporter protein; 5e-06
PRK13635279 PRK13635, cbiO, cobalt transporter ATP-binding sub 6e-06
TIGR02633500 TIGR02633, xylG, D-xylose ABC transporter, ATP-bin 6e-06
cd03231201 cd03231, ABC_CcmA_heme_exporter, Cytochrome c biog 7e-06
cd03294269 cd03294, ABC_Pro_Gly_Betaine, ATP-binding cassette 7e-06
PRK13632271 PRK13632, cbiO, cobalt transporter ATP-binding sub 7e-06
cd03262213 cd03262, ABC_HisP_GlnQ, ATP-binding cassette domai 8e-06
COG4175386 COG4175, ProV, ABC-type proline/glycine betaine tr 8e-06
COG4608268 COG4608, AppF, ABC-type oligopeptide transport sys 8e-06
COG4598256 COG4598, HisP, ABC-type histidine transport system 9e-06
PRK03695248 PRK03695, PRK03695, vitamin B12-transporter ATPase 9e-06
PRK13637287 PRK13637, cbiO, cobalt transporter ATP-binding sub 9e-06
COG4148352 COG4148, ModC, ABC-type molybdate transport system 1e-05
PRK03695248 PRK03695, PRK03695, vitamin B12-transporter ATPase 1e-05
PRK14275286 PRK14275, PRK14275, phosphate ABC transporter ATP- 1e-05
PRK14259269 PRK14259, PRK14259, phosphate ABC transporter ATP- 1e-05
TIGR01193708 TIGR01193, bacteriocin_ABC, ABC-type bacteriocin t 2e-05
cd03217200 cd03217, ABC_FeS_Assembly, ABC-type transport syst 2e-05
PRK14255252 PRK14255, PRK14255, phosphate ABC transporter ATP- 2e-05
PRK14247250 PRK14247, PRK14247, phosphate ABC transporter ATP- 2e-05
TIGR01186363 TIGR01186, proV, glycine betaine/L-proline transpo 2e-05
PRK14270251 PRK14270, PRK14270, phosphate ABC transporter ATP- 2e-05
PRK11160574 PRK11160, PRK11160, cysteine/glutathione ABC trans 2e-05
PRK11432351 PRK11432, fbpC, ferric transporter ATP-binding sub 2e-05
PRK10619257 PRK10619, PRK10619, histidine/lysine/arginine/orni 2e-05
PRK13543214 PRK13543, PRK13543, cytochrome c biogenesis protei 2e-05
PRK11000369 PRK11000, PRK11000, maltose/maltodextrin transport 2e-05
TIGR02314343 TIGR02314, ABC_MetN, D-methionine ABC transporter, 2e-05
cd03290218 cd03290, ABCC_SUR1_N, ATP-binding cassette domain 2e-05
PRK14242253 PRK14242, PRK14242, phosphate transporter ATP-bind 2e-05
TIGR00958711 TIGR00958, 3a01208, Conjugate Transporter-2 (CT2) 2e-05
PRK14237267 PRK14237, PRK14237, phosphate transporter ATP-bind 2e-05
TIGR03269520 TIGR03269, met_CoM_red_A2, methyl coenzyme M reduc 2e-05
TIGR02142354 TIGR02142, modC_ABC, molybdenum ABC transporter, A 3e-05
COG3845501 COG3845, COG3845, ABC-type uncharacterized transpo 3e-05
PRK10253265 PRK10253, PRK10253, iron-enterobactin transporter 3e-05
cd03247178 cd03247, ABCC_cytochrome_bd, ATP-binding cassette 3e-05
PRK13543214 PRK13543, PRK13543, cytochrome c biogenesis protei 3e-05
PRK13634290 PRK13634, cbiO, cobalt transporter ATP-binding sub 3e-05
PRK09544251 PRK09544, znuC, high-affinity zinc transporter ATP 3e-05
PLN032321495 PLN03232, PLN03232, ABC transporter C family membe 3e-05
COG1129500 COG1129, MglA, ABC-type sugar transport system, AT 4e-05
cd03267236 cd03267, ABC_NatA_like, ATP-binding cassette domai 4e-05
COG2884223 COG2884, FtsE, Predicted ATPase involved in cell d 4e-05
PRK13651305 PRK13651, PRK13651, cobalt transporter ATP-binding 4e-05
TIGR03269520 TIGR03269, met_CoM_red_A2, methyl coenzyme M reduc 4e-05
COG4178604 COG4178, COG4178, ABC-type uncharacterized transpo 4e-05
COG1134249 COG1134, TagH, ABC-type polysaccharide/polyol phos 4e-05
cd03246173 cd03246, ABCC_Protease_Secretion, ATP-binding cass 5e-05
COG1129500 COG1129, MglA, ABC-type sugar transport system, AT 5e-05
TIGR03411242 TIGR03411, urea_trans_UrtD, urea ABC transporter, 5e-05
TIGR01192585 TIGR01192, chvA, glucan exporter ATP-binding prote 5e-05
PRK11174588 PRK11174, PRK11174, cysteine/glutathione ABC trans 6e-05
PRK14246257 PRK14246, PRK14246, phosphate ABC transporter ATP- 6e-05
PRK10535 648 PRK10535, PRK10535, macrolide transporter ATP-bind 7e-05
PRK11607377 PRK11607, potG, putrescine transporter ATP-binding 7e-05
TIGR03608206 TIGR03608, L_ocin_972_ABC, putative bacteriocin ex 8e-05
CHL00131252 CHL00131, ycf16, sulfate ABC transporter protein; 8e-05
PRK13632271 PRK13632, cbiO, cobalt transporter ATP-binding sub 8e-05
cd03290218 cd03290, ABCC_SUR1_N, ATP-binding cassette domain 8e-05
PRK14249251 PRK14249, PRK14249, phosphate ABC transporter ATP- 8e-05
PRK13647274 PRK13647, cbiO, cobalt transporter ATP-binding sub 9e-05
PRK10771232 PRK10771, thiQ, thiamine transporter ATP-binding s 9e-05
PRK11144352 PRK11144, modC, molybdate transporter ATP-binding 9e-05
PTZ00265 1466 PTZ00265, PTZ00265, multidrug resistance protein ( 9e-05
TIGR012572272 TIGR01257, rim_protein, retinal-specific rim ABC t 1e-04
TIGR02211221 TIGR02211, LolD_lipo_ex, lipoprotein releasing sys 1e-04
COG4138248 COG4138, BtuD, ABC-type cobalamin transport system 1e-04
COG1101263 COG1101, PhnK, ABC-type uncharacterized transport 1e-04
cd03248226 cd03248, ABCC_TAP, ATP-binding cassette domain of 1e-04
TIGR03005252 TIGR03005, ectoine_ehuA, ectoine/hydroxyectoine AB 1e-04
COG4608268 COG4608, AppF, ABC-type oligopeptide transport sys 1e-04
PRK14246257 PRK14246, PRK14246, phosphate ABC transporter ATP- 1e-04
PRK11607377 PRK11607, potG, putrescine transporter ATP-binding 1e-04
PRK11614237 PRK11614, livF, leucine/isoleucine/valine transpor 1e-04
PRK10908222 PRK10908, PRK10908, cell division protein FtsE; Pr 1e-04
TIGR02324224 TIGR02324, CP_lyasePhnL, phosphonate C-P lyase sys 1e-04
cd03227162 cd03227, ABC_Class2, ATP-binding cassette domain o 1e-04
smart00382148 smart00382, AAA, ATPases associated with a variety 1e-04
PRK14274259 PRK14274, PRK14274, phosphate ABC transporter ATP- 1e-04
PRK13648269 PRK13648, cbiO, cobalt transporter ATP-binding sub 1e-04
COG0488530 COG0488, Uup, ATPase components of ABC transporter 2e-04
TIGR03797686 TIGR03797, NHLM_micro_ABC2, NHLM bacteriocin syste 2e-04
PRK10575265 PRK10575, PRK10575, iron-hydroxamate transporter A 2e-04
PRK10247225 PRK10247, PRK10247, putative ABC transporter ATP-b 2e-04
PRK14240250 PRK14240, PRK14240, phosphate transporter ATP-bind 2e-04
PRK14256252 PRK14256, PRK14256, phosphate ABC transporter ATP- 2e-04
PRK13637287 PRK13637, cbiO, cobalt transporter ATP-binding sub 2e-04
TIGR02314343 TIGR02314, ABC_MetN, D-methionine ABC transporter, 2e-04
PRK09544251 PRK09544, znuC, high-affinity zinc transporter ATP 2e-04
PLN032321495 PLN03232, PLN03232, ABC transporter C family membe 2e-04
PRK10771232 PRK10771, thiQ, thiamine transporter ATP-binding s 2e-04
PTZ002651466 PTZ00265, PTZ00265, multidrug resistance protein ( 2e-04
PRK13649280 PRK13649, cbiO, cobalt transporter ATP-binding sub 2e-04
cd03221144 cd03221, ABCF_EF-3, ATP-binding cassette domain of 2e-04
PRK14243264 PRK14243, PRK14243, phosphate transporter ATP-bind 2e-04
PRK11308327 PRK11308, dppF, dipeptide transporter ATP-binding 2e-04
PRK14269246 PRK14269, PRK14269, phosphate ABC transporter ATP- 2e-04
PRK14266250 PRK14266, PRK14266, phosphate ABC transporter ATP- 2e-04
cd03220224 cd03220, ABC_KpsT_Wzt, ATP-binding cassette compon 2e-04
cd03220224 cd03220, ABC_KpsT_Wzt, ATP-binding cassette compon 2e-04
PRK15439510 PRK15439, PRK15439, autoinducer 2 ABC transporter 2e-04
PRK14264305 PRK14264, PRK14264, phosphate ABC transporter ATP- 2e-04
cd03229178 cd03229, ABC_Class3, ATP-binding cassette domain o 3e-04
cd03218232 cd03218, ABC_YhbG, ATP-binding cassette component 3e-04
smart00382148 smart00382, AAA, ATPases associated with a variety 3e-04
cd03223166 cd03223, ABCD_peroxisomal_ALDP, ATP-binding casset 3e-04
COG4674249 COG4674, COG4674, Uncharacterized ABC-type transpo 4e-04
PRK09700510 PRK09700, PRK09700, D-allose transporter ATP-bindi 4e-04
PRK14259269 PRK14259, PRK14259, phosphate ABC transporter ATP- 4e-04
PRK13633280 PRK13633, PRK13633, cobalt transporter ATP-binding 4e-04
PRK15112267 PRK15112, PRK15112, antimicrobial peptide ABC syst 4e-04
TIGR01257 2272 TIGR01257, rim_protein, retinal-specific rim ABC t 5e-04
TIGR01846694 TIGR01846, type_I_sec_HlyB, type I secretion syste 5e-04
PRK14251251 PRK14251, PRK14251, phosphate ABC transporter ATP- 5e-04
PRK14254285 PRK14254, PRK14254, phosphate ABC transporter ATP- 5e-04
PRK13645289 PRK13645, cbiO, cobalt transporter ATP-binding sub 5e-04
COG1137243 COG1137, YhbG, ABC-type (unclassified) transport s 6e-04
TIGR03740223 TIGR03740, galliderm_ABC, gallidermin-class lantib 6e-04
PRK14250241 PRK14250, PRK14250, phosphate ABC transporter ATP- 6e-04
PRK14274259 PRK14274, PRK14274, phosphate ABC transporter ATP- 6e-04
PRK11176582 PRK11176, PRK11176, lipid transporter ATP-binding/ 7e-04
PRK14252265 PRK14252, PRK14252, phosphate ABC transporter ATP- 8e-04
PRK13642277 PRK13642, cbiO, cobalt transporter ATP-binding sub 8e-04
PRK10789569 PRK10789, PRK10789, putative multidrug transporter 8e-04
TIGR03796710 TIGR03796, NHLM_micro_ABC1, NHLM bacteriocin syste 9e-04
COG4107258 COG4107, PhnK, ABC-type phosphonate transport syst 9e-04
PRK14242253 PRK14242, PRK14242, phosphate transporter ATP-bind 9e-04
cd03214180 cd03214, ABC_Iron-Siderophores_B12_Hemin, ATP-bind 0.001
PRK10584228 PRK10584, PRK10584, putative ABC transporter ATP-b 0.001
PRK11264250 PRK11264, PRK11264, putative amino-acid ABC transp 0.001
PRK13631320 PRK13631, cbiO, cobalt transporter ATP-binding sub 0.001
PRK11288501 PRK11288, araG, L-arabinose transporter ATP-bindin 0.001
PRK11629233 PRK11629, lolD, lipoprotein transporter ATP-bindin 0.001
TIGR00958711 TIGR00958, 3a01208, Conjugate Transporter-2 (CT2) 0.001
TIGR01192585 TIGR01192, chvA, glucan exporter ATP-binding prote 0.001
PRK11614237 PRK11614, livF, leucine/isoleucine/valine transpor 0.001
cd03237246 cd03237, ABC_RNaseL_inhibitor_domain2, The ATP-bin 0.001
PRK11124242 PRK11124, artP, arginine transporter ATP-binding s 0.001
PRK13640282 PRK13640, cbiO, cobalt transporter ATP-binding sub 0.002
PRK14253249 PRK14253, PRK14253, phosphate ABC transporter ATP- 0.002
PRK14261253 PRK14261, PRK14261, phosphate ABC transporter ATP- 0.002
cd03238176 cd03238, ABC_UvrA, ATP-binding cassette domain of 0.002
COG4172534 COG4172, COG4172, ABC-type uncharacterized transpo 0.002
TIGR03269520 TIGR03269, met_CoM_red_A2, methyl coenzyme M reduc 0.002
cd03237246 cd03237, ABC_RNaseL_inhibitor_domain2, The ATP-bin 0.002
PRK14257329 PRK14257, PRK14257, phosphate ABC transporter ATP- 0.002
COG0842286 COG0842, COG0842, ABC-type multidrug transport sys 0.002
PRK14258261 PRK14258, PRK14258, phosphate ABC transporter ATP- 0.002
PRK13650279 PRK13650, cbiO, cobalt transporter ATP-binding sub 0.002
PTZ00243 1560 PTZ00243, PTZ00243, ABC transporter; Provisional 0.002
COG4107258 COG4107, PhnK, ABC-type phosphonate transport syst 0.003
PRK10419268 PRK10419, nikE, nickel transporter ATP-binding pro 0.003
PRK13634290 PRK13634, cbiO, cobalt transporter ATP-binding sub 0.003
PRK10535648 PRK10535, PRK10535, macrolide transporter ATP-bind 0.003
cd03223166 cd03223, ABCD_peroxisomal_ALDP, ATP-binding casset 0.003
PRK14244251 PRK14244, PRK14244, phosphate ABC transporter ATP- 0.003
TIGR03415382 TIGR03415, ABC_choXWV_ATP, choline ABC transporter 0.003
TIGR00957 1522 TIGR00957, MRP_assoc_pro, multi drug resistance-as 0.003
PRK10744260 PRK10744, pstB, phosphate transporter ATP-binding 0.003
PRK14268258 PRK14268, PRK14268, phosphate ABC transporter ATP- 0.003
PRK11650356 PRK11650, ugpC, glycerol-3-phosphate transporter A 0.003
PRK14248268 PRK14248, PRK14248, phosphate ABC transporter ATP- 0.003
cd03228171 cd03228, ABCC_MRP_Like, ATP-binding cassette domai 0.004
PRK11701258 PRK11701, phnK, phosphonate C-P lyase system prote 0.004
PRK14266250 PRK14266, PRK14266, phosphate ABC transporter ATP- 0.004
COG0842286 COG0842, COG0842, ABC-type multidrug transport sys 0.004
pfam13481154 pfam13481, AAA_25, AAA domain 0.004
>gnl|CDD|215599 PLN03140, PLN03140, ABC transporter G family member; Provisional Back     alignment and domain information 
 Score = 2008 bits (5205), Expect = 0.0
 Identities = 842/1374 (61%), Positives = 1046/1374 (76%), Gaps = 18/1374 (1%)

Query: 11   STSLRRSASRWNTNSIGAFS-------RSSREEDDEEALKWAALEKLPTYNRLRKGILTT 63
              S+ RS SR + N    FS       R+S  ++DEEALKWAA+EKLPTY+RLR  I+ +
Sbjct: 9    RRSISRSVSRSSRNMEDVFSGGSQSRRRTSSVDEDEEALKWAAIEKLPTYSRLRTSIMKS 68

Query: 64   --------SRGEANEVDVYNLGLQERQRLIDKLVKVTDVDNERFLLKLKNRIDRVGIDLP 115
                    ++    EVDV  L   +RQ+ ID + KV + DNE+FL K +NRIDRVGI LP
Sbjct: 69   FVENDVYGNQLLHKEVDVTKLDGNDRQKFIDMVFKVAEEDNEKFLKKFRNRIDRVGIKLP 128

Query: 116  KVEVRYEHLNVEAEAFLASNALPSFIKFYTNIFEDILNYLRIIPSKKRHLTILKDVSGVI 175
             VEVR+EHL VEA+ ++ S ALP+      NI E  L  L I  +KK  LTILKD SG+I
Sbjct: 129  TVEVRFEHLTVEADCYIGSRALPTLPNAARNIAESALGMLGINLAKKTKLTILKDASGII 188

Query: 176  KPGRLTLLLGPPSSGKTTLLLALAGKLDPTLKVSGTVTYNGHDMDEFVPQRTAAYISQHD 235
            KP R+TLLLGPPSSGKTTLLLALAGKLDP+LKVSG +TYNG+ ++EFVP++T+AYISQ+D
Sbjct: 189  KPSRMTLLLGPPSSGKTTLLLALAGKLDPSLKVSGEITYNGYRLNEFVPRKTSAYISQND 248

Query: 236  NHIGEMTVRETLAFSARCQGVGTRYEMLTELARREKAAGIKPDPDIDVYMKAIATEGQEA 295
             H+G MTV+ETL FSARCQGVGTRY++L+ELARREK AGI P+ ++D++MKA A EG ++
Sbjct: 249  VHVGVMTVKETLDFSARCQGVGTRYDLLSELARREKDAGIFPEAEVDLFMKATAMEGVKS 308

Query: 296  NVITDYYLKVLGLDVCADTMVGDEMIRGISGGQKKRVTTGEMMVGPALALFMDEISTGLD 355
            ++ITDY LK+LGLD+C DT+VGDEMIRGISGGQKKRVTTGEM+VGP   LFMDEISTGLD
Sbjct: 309  SLITDYTLKILGLDICKDTIVGDEMIRGISGGQKKRVTTGEMIVGPTKTLFMDEISTGLD 368

Query: 356  SSTTFQIVNCLRQNIHINSGTAVISLLQPAPETYDLFDDIILLSDGQIVYQGPRELVLEF 415
            SSTT+QIV CL+Q +H+   T ++SLLQPAPET+DLFDDIILLS+GQIVYQGPR+ +LEF
Sbjct: 369  SSTTYQIVKCLQQIVHLTEATVLMSLLQPAPETFDLFDDIILLSEGQIVYQGPRDHILEF 428

Query: 416  FASMGFRCPKRKGVADFLQEVTSRKDQRQYWAHKEKPYRFVTVQEFAEAFQSFHVGQKIS 475
            F S GF+CP+RKG ADFLQEVTS+KDQ QYWA + KPYR+++V EFAE F+SFHVG ++ 
Sbjct: 429  FESCGFKCPERKGTADFLQEVTSKKDQEQYWADRNKPYRYISVSEFAERFKSFHVGMQLE 488

Query: 476  DELRTPFDKSKSHRAALTTETYGVGKRELLKANISRELLLMKRNSFVYIFKLIQIAFVAV 535
            +EL  PFDKS+SH+AAL    Y V K ELLKA   +E LLMKRN+FVY+FK +QI  VA 
Sbjct: 489  NELSVPFDKSQSHKAALVFSKYSVPKMELLKACWDKEWLLMKRNAFVYVFKTVQIIIVAA 548

Query: 536  VYMTLFLRTKMHKDTVTDGGIFAGATFFAITMVNFNGFSEISMTIAKLPVFYKQRDFRFF 595
            +  T+FLRT+MH     DG ++ GA  F++ +  FNGF+E+++ I +LPVFYKQRD  F 
Sbjct: 549  IASTVFLRTEMHTRNEEDGALYIGALLFSMIINMFNGFAELALMIQRLPVFYKQRDLLFH 608

Query: 596  PPWAYAIPSWILKIPVSFLEVAVWVFLSYYVVGYDSNAGRFFKQYALLLGVNQMASALFR 655
            PPW + +P+++L IP+S +E  VWV ++YY +G+   A RFFKQ  L+  + QMA+ +FR
Sbjct: 609  PPWTFTLPTFLLGIPISIIESVVWVVITYYSIGFAPEASRFFKQLLLVFLIQQMAAGIFR 668

Query: 656  FIAVTGRNMVVANTFGSFALLVLLSLGGFILSREDIKKWWKWAYWCSPLTYAQNAIVANE 715
             IA   R M++ANT G+  LL++  LGGFIL + +I  WW+WAYW SPL+Y  NA+  NE
Sbjct: 669  LIASVCRTMIIANTGGALVLLLVFLLGGFILPKGEIPNWWEWAYWVSPLSYGFNALAVNE 728

Query: 716  FLGHSW-KKFTQDSSETLGVQVLKSRGFFAHEYWYWLGLGALFGFVLLLNFAYTLALTFL 774
                 W  K   D+S  LG  VL     F  + WYW+G+GAL GF +L N  +TLALT+L
Sbjct: 729  MFAPRWMNKMASDNSTRLGTAVLNIFDVFTDKNWYWIGVGALLGFTILFNVLFTLALTYL 788

Query: 775  DPFEKPRAVITEEIESNEQDDRIGGNVQLSTLGGSSNHNTRSGSTDDIRGQQSSSQSLSL 834
            +P  K +A+I+EE     + +       LS+  G++          +  G   +    S 
Sbjct: 789  NPLGKKQAIISEETAEEMEGEEDSIPRSLSSADGNNTREVAIQRMSNPEGLSKNRD--SS 846

Query: 835  AEAEASRPKKKGMVLPFEPHSLTFDEVVYSVDMPEEMKVQGVLEDKLVLLNGVSGAFRPG 894
             EA      K+GMVLPF P +++FD+V Y VDMP EMK QGV ED+L LL  V+GAFRPG
Sbjct: 847  LEAANGVAPKRGMVLPFTPLAMSFDDVNYFVDMPAEMKEQGVTEDRLQLLREVTGAFRPG 906

Query: 895  VLTALMGVSGAGKTTLMDVLAGRKTGGYITGNITISGYPKKQETFARISGYCEQNDIHSP 954
            VLTALMGVSGAGKTTLMDVLAGRKTGGYI G+I ISG+PKKQETFARISGYCEQNDIHSP
Sbjct: 907  VLTALMGVSGAGKTTLMDVLAGRKTGGYIEGDIRISGFPKKQETFARISGYCEQNDIHSP 966

Query: 955  FVTIYESLLFSAWLRLSPEVDSETRKMFIDEVMELVELNPLRQSLVGLPGVSGLSTEQRK 1014
             VT+ ESL++SA+LRL  EV  E + MF+DEVMELVEL+ L+ ++VGLPGV+GLSTEQRK
Sbjct: 967  QVTVRESLIYSAFLRLPKEVSKEEKMMFVDEVMELVELDNLKDAIVGLPGVTGLSTEQRK 1026

Query: 1015 RLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFEA 1074
            RLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFEA
Sbjct: 1027 RLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFEA 1086

Query: 1075 FDELFLMKRGGQEIYVGPLGRHSCHLISYFEAIPGVQKIKDGYNPATWMLEVSAASQELA 1134
            FDEL LMKRGGQ IY GPLGR+S  +I YFEAIPGV KIK+ YNPATWMLEVS+ + E+ 
Sbjct: 1087 FDELLLMKRGGQVIYSGPLGRNSHKIIEYFEAIPGVPKIKEKYNPATWMLEVSSLAAEVK 1146

Query: 1135 LGIDFTEHYKRSDLYRRNKALIEDLSRPPPGSKDLYFPTQFSQSSWIQFVACLWKQHWSY 1194
            LGIDF EHYK S LY+RNKAL+++LS PPPG+ DLYF TQ+SQS+W QF +CLWKQ W+Y
Sbjct: 1147 LGIDFAEHYKSSSLYQRNKALVKELSTPPPGASDLYFATQYSQSTWGQFKSCLWKQWWTY 1206

Query: 1195 WRNPPYTAVRFFFTAFIALLFGSLFWDLGGRTKRNQDLFNAMGSMFTAVLFLGVQYCSSV 1254
            WR+P Y  VRFFFT   AL+ G++FW +G +     DL   +G+M+ AVLF+G+  CS+V
Sbjct: 1207 WRSPDYNLVRFFFTLAAALMVGTIFWKVGTKRSNANDLTMVIGAMYAAVLFVGINNCSTV 1266

Query: 1255 QPIVSVERTVFYREKAAGMYAGIPWALAQVMIEIPYILVQSVVYGAIVYAMIGFEWTAAK 1314
            QP+V+VERTVFYRE+AAGMY+ +P+A+AQV+ EIPY+L+Q+  Y  IVYAM+ FEWTAAK
Sbjct: 1267 QPMVAVERTVFYRERAAGMYSALPYAIAQVVCEIPYVLIQTTYYTLIVYAMVAFEWTAAK 1326

Query: 1315 FFWYIFFMYFTLLFFTFYGMMAVALTPNHHIAAIVSTLFYGLWNVFSGFIIPRP 1368
            FFW+ F  +F+ L+FT+YGMM V+LTPN  +AAI +  FYGL+N+FSGF IPRP
Sbjct: 1327 FFWFYFISFFSFLYFTYYGMMTVSLTPNQQVAAIFAAAFYGLFNLFSGFFIPRP 1380

Length = 1470
>gnl|CDD|233208 TIGR00956, 3a01205, Pleiotropic Drug Resistance (PDR) Family protein Back     alignment and domain information
>gnl|CDD|213199 cd03232, ABCG_PDR_domain2, Second domain of the pleiotropic drug resistance-like (PDR) subfamily G of ATP-binding cassette transporters Back     alignment and domain information
>gnl|CDD|233207 TIGR00955, 3a01204, The Eye Pigment Precursor Transporter (EPP) Family protein Back     alignment and domain information
>gnl|CDD|233207 TIGR00955, 3a01204, The Eye Pigment Precursor Transporter (EPP) Family protein Back     alignment and domain information
>gnl|CDD|213180 cd03213, ABCG_EPDR, Eye pigment and drug resistance transporter subfamily G of the ATP-binding cassette superfamily Back     alignment and domain information
>gnl|CDD|213201 cd03234, ABCG_White, White pigment protein homolog of ABCG transporter subfamily Back     alignment and domain information
>gnl|CDD|215634 PLN03211, PLN03211, ABC transporter G-25; Provisional Back     alignment and domain information
>gnl|CDD|216273 pfam01061, ABC2_membrane, ABC-2 type transporter Back     alignment and domain information
>gnl|CDD|224054 COG1131, CcmA, ABC-type multidrug transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|233208 TIGR00956, 3a01205, Pleiotropic Drug Resistance (PDR) Family protein Back     alignment and domain information
>gnl|CDD|216273 pfam01061, ABC2_membrane, ABC-2 type transporter Back     alignment and domain information
>gnl|CDD|213201 cd03234, ABCG_White, White pigment protein homolog of ABCG transporter subfamily Back     alignment and domain information
>gnl|CDD|213200 cd03233, ABCG_PDR_domain1, First domain of the pleiotropic drug resistance-like subfamily G of ATP-binding cassette transporters Back     alignment and domain information
>gnl|CDD|224054 COG1131, CcmA, ABC-type multidrug transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|213200 cd03233, ABCG_PDR_domain1, First domain of the pleiotropic drug resistance-like subfamily G of ATP-binding cassette transporters Back     alignment and domain information
>gnl|CDD|215599 PLN03140, PLN03140, ABC transporter G family member; Provisional Back     alignment and domain information
>gnl|CDD|215634 PLN03211, PLN03211, ABC transporter G-25; Provisional Back     alignment and domain information
>gnl|CDD|213200 cd03233, ABCG_PDR_domain1, First domain of the pleiotropic drug resistance-like subfamily G of ATP-binding cassette transporters Back     alignment and domain information
>gnl|CDD|213230 cd03263, ABC_subfamily_A, ATP-binding cassette domain of the lipid transporters, subfamily A Back     alignment and domain information
>gnl|CDD|213180 cd03213, ABCG_EPDR, Eye pigment and drug resistance transporter subfamily G of the ATP-binding cassette superfamily Back     alignment and domain information
>gnl|CDD|213192 cd03225, ABC_cobalt_CbiO_domain1, First domain of the ATP-binding cassette component of cobalt transport system Back     alignment and domain information
>gnl|CDD|213231 cd03264, ABC_drug_resistance_like, ABC-type multidrug transport system, ATPase component Back     alignment and domain information
>gnl|CDD|219810 pfam08370, PDR_assoc, Plant PDR ABC transporter associated Back     alignment and domain information
>gnl|CDD|213202 cd03235, ABC_Metallic_Cations, ATP-binding cassette domain of the metal-type transporters Back     alignment and domain information
>gnl|CDD|224045 COG1120, FepC, ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|213230 cd03263, ABC_subfamily_A, ATP-binding cassette domain of the lipid transporters, subfamily A Back     alignment and domain information
>gnl|CDD|213222 cd03255, ABC_MJ0796_LolCDE_FtsE, ATP-binding cassette domain of the transporters involved in export of lipoprotein and macrolide, and cell division protein Back     alignment and domain information
>gnl|CDD|213181 cd03214, ABC_Iron-Siderophores_B12_Hemin, ATP-binding component of iron-siderophores, vitamin B12 and hemin transporters and related proteins Back     alignment and domain information
>gnl|CDD|224045 COG1120, FepC, ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|213192 cd03225, ABC_cobalt_CbiO_domain1, First domain of the ATP-binding cassette component of cobalt transport system Back     alignment and domain information
>gnl|CDD|213197 cd03230, ABC_DR_subfamily_A, ATP-binding cassette domain of the drug resistance transporter and related proteins, subfamily A Back     alignment and domain information
>gnl|CDD|213199 cd03232, ABCG_PDR_domain2, Second domain of the pleiotropic drug resistance-like (PDR) subfamily G of ATP-binding cassette transporters Back     alignment and domain information
>gnl|CDD|213226 cd03259, ABC_Carb_Solutes_like, ATP-binding cassette domain of the carbohydrate and solute transporters-like Back     alignment and domain information
>gnl|CDD|213196 cd03229, ABC_Class3, ATP-binding cassette domain of the binding protein-dependent transport systems Back     alignment and domain information
>gnl|CDD|224046 COG1121, ZnuC, ABC-type Mn/Zn transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|213180 cd03213, ABCG_EPDR, Eye pigment and drug resistance transporter subfamily G of the ATP-binding cassette superfamily Back     alignment and domain information
>gnl|CDD|224047 COG1122, CbiO, ABC-type cobalt transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|213193 cd03226, ABC_cobalt_CbiO_domain2, Second domain of the ATP-binding cassette component of cobalt transport system Back     alignment and domain information
>gnl|CDD|227321 COG4988, CydD, ABC-type transport system involved in cytochrome bd biosynthesis, ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|224059 COG1136, SalX, ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|130234 TIGR01166, cbiO, cobalt transport protein ATP-binding subunit Back     alignment and domain information
>gnl|CDD|213179 cd00267, ABC_ATPase, ATP-binding cassette transporter nucleotide-binding domain Back     alignment and domain information
>gnl|CDD|130256 TIGR01188, drrA, daunorubicin resistance ABC transporter ATP-binding subunit Back     alignment and domain information
>gnl|CDD|225183 COG2274, SunT, ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|224047 COG1122, CbiO, ABC-type cobalt transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|213222 cd03255, ABC_MJ0796_LolCDE_FtsE, ATP-binding cassette domain of the transporters involved in export of lipoprotein and macrolide, and cell division protein Back     alignment and domain information
>gnl|CDD|234033 TIGR02857, CydD, thiol reductant ABC exporter, CydD subunit Back     alignment and domain information
>gnl|CDD|213232 cd03265, ABC_DrrA, Daunorubicin/doxorubicin resistance ATP-binding protein Back     alignment and domain information
>gnl|CDD|224043 COG1118, CysA, ABC-type sulfate/molybdate transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|213186 cd03219, ABC_Mj1267_LivG_branched, ATP-binding cassette component of branched chain amino acids transport system Back     alignment and domain information
>gnl|CDD|213212 cd03245, ABCC_bacteriocin_exporters, ATP-binding cassette domain of bacteriocin exporters, subfamily C Back     alignment and domain information
>gnl|CDD|213228 cd03261, ABC_Org_Solvent_Resistant, ATP-binding cassette transport system involved in resistant to organic solvents Back     alignment and domain information
>gnl|CDD|213233 cd03266, ABC_NatA_sodium_exporter, ATP-binding cassette domain of the Na+ transporter Back     alignment and domain information
>gnl|CDD|234041 TIGR02868, CydC, thiol reductant ABC exporter, CydC subunit Back     alignment and domain information
>gnl|CDD|213259 cd03292, ABC_FtsE_transporter, ATP-binding cassette domain of the cell division transporter Back     alignment and domain information
>gnl|CDD|213260 cd03293, ABC_NrtD_SsuB_transporters, ATP-binding cassette domain of the nitrate and sulfonate transporters Back     alignment and domain information
>gnl|CDD|213195 cd03228, ABCC_MRP_Like, ATP-binding cassette domain of multidrug resistance protein-like transporters Back     alignment and domain information
>gnl|CDD|131368 TIGR02315, ABC_phnC, phosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|213228 cd03261, ABC_Org_Solvent_Resistant, ATP-binding cassette transport system involved in resistant to organic solvents Back     alignment and domain information
>gnl|CDD|188394 TIGR03864, PQQ_ABC_ATP, ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system Back     alignment and domain information
>gnl|CDD|213223 cd03256, ABC_PhnC_transporter, ATP-binding cassette domain of the binding protein-dependent phosphonate transport system Back     alignment and domain information
>gnl|CDD|226927 COG4555, NatA, ABC-type Na+ transport system, ATPase component [Energy production and conversion / Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|213235 cd03268, ABC_BcrA_bacitracin_resist, ATP-binding cassette domain of the bacitracin-resistance transporter Back     alignment and domain information
>gnl|CDD|213223 cd03256, ABC_PhnC_transporter, ATP-binding cassette domain of the binding protein-dependent phosphonate transport system Back     alignment and domain information
>gnl|CDD|226361 COG3842, PotA, ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|226164 COG3638, COG3638, ABC-type phosphate/phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|224059 COG1136, SalX, ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|226359 COG3839, MalK, ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|130041 TIGR00968, 3a0106s01, sulfate ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|188353 TIGR03608, L_ocin_972_ABC, putative bacteriocin export ABC transporter, lactococcin 972 group Back     alignment and domain information
>gnl|CDD|237421 PRK13539, PRK13539, cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>gnl|CDD|213224 cd03257, ABC_NikE_OppD_transporters, ATP-binding cassette domain of nickel/oligopeptides specific transporters Back     alignment and domain information
>gnl|CDD|213264 cd03297, ABC_ModC_molybdenum_transporter, ATP-binding cassette domain of the molybdenum transport system Back     alignment and domain information
>gnl|CDD|224043 COG1118, CysA, ABC-type sulfate/molybdate transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|226927 COG4555, NatA, ABC-type Na+ transport system, ATPase component [Energy production and conversion / Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|226359 COG3839, MalK, ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|213226 cd03259, ABC_Carb_Solutes_like, ATP-binding cassette domain of the carbohydrate and solute transporters-like Back     alignment and domain information
>gnl|CDD|223488 COG0411, LivG, ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|163585 TIGR03873, F420-0_ABC_ATP, proposed F420-0 ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|237420 PRK13537, PRK13537, nodulation ABC transporter NodI; Provisional Back     alignment and domain information
>gnl|CDD|224046 COG1121, ZnuC, ABC-type Mn/Zn transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|233665 TIGR01978, sufC, FeS assembly ATPase SufC Back     alignment and domain information
>gnl|CDD|237419 PRK13536, PRK13536, nodulation factor exporter subunit NodI; Provisional Back     alignment and domain information
>gnl|CDD|226929 COG4559, COG4559, ABC-type hemin transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|226617 COG4133, CcmA, ABC-type transport system involved in cytochrome c biogenesis, ATPase component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|226164 COG3638, COG3638, ABC-type phosphate/phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|213191 cd03224, ABC_TM1139_LivF_branched, ATP-binding cassette domain of branched-chain amino acid transporter Back     alignment and domain information
>gnl|CDD|213186 cd03219, ABC_Mj1267_LivG_branched, ATP-binding cassette component of branched chain amino acids transport system Back     alignment and domain information
>gnl|CDD|226361 COG3842, PotA, ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|213224 cd03257, ABC_NikE_OppD_transporters, ATP-binding cassette domain of nickel/oligopeptides specific transporters Back     alignment and domain information
>gnl|CDD|213227 cd03260, ABC_PstB_phosphate_transporter, ATP-binding cassette domain of the phosphate transport system Back     alignment and domain information
>gnl|CDD|213236 cd03269, ABC_putative_ATPase, ATP-binding cassette domain of an uncharacterized transporter Back     alignment and domain information
>gnl|CDD|213213 cd03246, ABCC_Protease_Secretion, ATP-binding cassette domain of PrtD, subfamily C Back     alignment and domain information
>gnl|CDD|213185 cd03218, ABC_YhbG, ATP-binding cassette component of YhbG transport system Back     alignment and domain information
>gnl|CDD|213263 cd03296, ABC_CysA_sulfate_importer, ATP-binding cassette domain of the sulfate transporter Back     alignment and domain information
>gnl|CDD|224041 COG1116, TauB, ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|227321 COG4988, CydD, ABC-type transport system involved in cytochrome bd biosynthesis, ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|224048 COG1123, COG1123, ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] Back     alignment and domain information
>gnl|CDD|237422 PRK13548, hmuV, hemin importer ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|234189 TIGR03375, type_I_sec_LssB, type I secretion system ATPase, LssB family Back     alignment and domain information
>gnl|CDD|213202 cd03235, ABC_Metallic_Cations, ATP-binding cassette domain of the metal-type transporters Back     alignment and domain information
>gnl|CDD|213212 cd03245, ABCC_bacteriocin_exporters, ATP-binding cassette domain of bacteriocin exporters, subfamily C Back     alignment and domain information
>gnl|CDD|223488 COG0411, LivG, ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|226929 COG4559, COG4559, ABC-type hemin transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|213263 cd03296, ABC_CysA_sulfate_importer, ATP-binding cassette domain of the sulfate transporter Back     alignment and domain information
>gnl|CDD|227019 COG4674, COG4674, Uncharacterized ABC-type transport system, ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|223473 COG0396, sufC, Cysteine desulfurase activator ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|226631 COG4152, COG4152, ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|213221 cd03254, ABCC_Glucan_exporter_like, ATP-binding cassette domain of glucan transporter and related proteins, subfamily C Back     alignment and domain information
>gnl|CDD|224052 COG1127, Ttg2A, ABC-type transport system involved in resistance to organic solvents, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>gnl|CDD|213231 cd03264, ABC_drug_resistance_like, ABC-type multidrug transport system, ATPase component Back     alignment and domain information
>gnl|CDD|237421 PRK13539, PRK13539, cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>gnl|CDD|163585 TIGR03873, F420-0_ABC_ATP, proposed F420-0 ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|223473 COG0396, sufC, Cysteine desulfurase activator ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|182817 PRK10895, PRK10895, lipopolysaccharide ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|226963 COG4604, CeuD, ABC-type enterochelin transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|233305 TIGR01189, ccmA, heme ABC exporter, ATP-binding protein CcmA Back     alignment and domain information
>gnl|CDD|130355 TIGR01288, nodI, ATP-binding ABC transporter family nodulation protein NodI Back     alignment and domain information
>gnl|CDD|234033 TIGR02857, CydD, thiol reductant ABC exporter, CydD subunit Back     alignment and domain information
>gnl|CDD|131368 TIGR02315, ABC_phnC, phosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|213191 cd03224, ABC_TM1139_LivF_branched, ATP-binding cassette domain of branched-chain amino acid transporter Back     alignment and domain information
>gnl|CDD|224049 COG1124, DppF, ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|224053 COG1129, MglA, ABC-type sugar transport system, ATPase component [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|213199 cd03232, ABCG_PDR_domain2, Second domain of the pleiotropic drug resistance-like (PDR) subfamily G of ATP-binding cassette transporters Back     alignment and domain information
>gnl|CDD|213197 cd03230, ABC_DR_subfamily_A, ATP-binding cassette domain of the drug resistance transporter and related proteins, subfamily A Back     alignment and domain information
>gnl|CDD|237422 PRK13548, hmuV, hemin importer ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|184196 PRK13636, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|213233 cd03266, ABC_NatA_sodium_exporter, ATP-binding cassette domain of the Na+ transporter Back     alignment and domain information
>gnl|CDD|213260 cd03293, ABC_NrtD_SsuB_transporters, ATP-binding cassette domain of the nitrate and sulfonate transporters Back     alignment and domain information
>gnl|CDD|224052 COG1127, Ttg2A, ABC-type transport system involved in resistance to organic solvents, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>gnl|CDD|130041 TIGR00968, 3a0106s01, sulfate ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|213195 cd03228, ABCC_MRP_Like, ATP-binding cassette domain of multidrug resistance protein-like transporters Back     alignment and domain information
>gnl|CDD|213219 cd03252, ABCC_Hemolysin, ATP-binding cassette domain of hemolysin B, subfamily C Back     alignment and domain information
>gnl|CDD|213216 cd03249, ABC_MTABC3_MDL1_MDL2, ATP-binding cassette domain of a mitochondrial protein MTABC3 and related proteins Back     alignment and domain information
>gnl|CDD|234200 TIGR03411, urea_trans_UrtD, urea ABC transporter, ATP-binding protein UrtD Back     alignment and domain information
>gnl|CDD|213220 cd03253, ABCC_ATM1_transporter, ATP-binding cassette domain of iron-sulfur clusters transporter, subfamily C Back     alignment and domain information
>gnl|CDD|225183 COG2274, SunT, ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|213264 cd03297, ABC_ModC_molybdenum_transporter, ATP-binding cassette domain of the molybdenum transport system Back     alignment and domain information
>gnl|CDD|213217 cd03250, ABCC_MRP_domain1, ATP-binding cassette domain 1 of multidrug resistance-associated protein, subfamily C Back     alignment and domain information
>gnl|CDD|226905 COG4525, TauB, ABC-type taurine transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|130324 TIGR01257, rim_protein, retinal-specific rim ABC transporter Back     alignment and domain information
>gnl|CDD|223487 COG0410, LivF, ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|132027 TIGR02982, heterocyst_DevA, ABC exporter ATP-binding subunit, DevA family Back     alignment and domain information
>gnl|CDD|183044 PRK11231, fecE, iron-dicitrate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|200134 TIGR01842, type_I_sec_PrtD, type I secretion system ABC transporter, PrtD family Back     alignment and domain information
>gnl|CDD|213268 cd03301, ABC_MalK_N, The N-terminal ATPase domain of the maltose transporter, MalK Back     alignment and domain information
>gnl|CDD|234041 TIGR02868, CydC, thiol reductant ABC exporter, CydC subunit Back     alignment and domain information
>gnl|CDD|224060 COG1137, YhbG, ABC-type (unclassified) transport system, ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|224055 COG1132, MdlB, ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|163452 TIGR03740, galliderm_ABC, gallidermin-class lantibiotic protection ABC transporter, ATP-binding subunit Back     alignment and domain information
>gnl|CDD|184198 PRK13638, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|183044 PRK11231, fecE, iron-dicitrate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|184585 PRK14239, PRK14239, phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|213234 cd03267, ABC_NatA_like, ATP-binding cassette domain of an uncharacterized transporter similar in sequence to NatA Back     alignment and domain information
>gnl|CDD|185016 PRK15056, PRK15056, manganese/iron transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|213220 cd03253, ABCC_ATM1_transporter, ATP-binding cassette domain of iron-sulfur clusters transporter, subfamily C Back     alignment and domain information
>gnl|CDD|213266 cd03299, ABC_ModC_like, ATP-binding cassette domain similar to the molybdate transporter Back     alignment and domain information
>gnl|CDD|213193 cd03226, ABC_cobalt_CbiO_domain2, Second domain of the ATP-binding cassette component of cobalt transport system Back     alignment and domain information
>gnl|CDD|213216 cd03249, ABC_MTABC3_MDL1_MDL2, ATP-binding cassette domain of a mitochondrial protein MTABC3 and related proteins Back     alignment and domain information
>gnl|CDD|213267 cd03300, ABC_PotA_N, ATP-binding cassette domain of the polyamine transporter Back     alignment and domain information
>gnl|CDD|226952 COG4586, COG4586, ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|132302 TIGR03258, PhnT, 2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT Back     alignment and domain information
>gnl|CDD|213179 cd00267, ABC_ATPase, ATP-binding cassette transporter nucleotide-binding domain Back     alignment and domain information
>gnl|CDD|188394 TIGR03864, PQQ_ABC_ATP, ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system Back     alignment and domain information
>gnl|CDD|213227 cd03260, ABC_PstB_phosphate_transporter, ATP-binding cassette domain of the phosphate transport system Back     alignment and domain information
>gnl|CDD|213236 cd03269, ABC_putative_ATPase, ATP-binding cassette domain of an uncharacterized transporter Back     alignment and domain information
>gnl|CDD|226963 COG4604, CeuD, ABC-type enterochelin transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|132027 TIGR02982, heterocyst_DevA, ABC exporter ATP-binding subunit, DevA family Back     alignment and domain information
>gnl|CDD|213267 cd03300, ABC_PotA_N, ATP-binding cassette domain of the polyamine transporter Back     alignment and domain information
>gnl|CDD|182569 PRK10584, PRK10584, putative ABC transporter ATP-binding protein YbbA; Provisional Back     alignment and domain information
>gnl|CDD|224050 COG1125, OpuBA, ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|184132 PRK13547, hmuV, hemin importer ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|226969 COG4618, ArpD, ABC-type protease/lipase transport system, ATPase and permease components [General function prediction only] Back     alignment and domain information
>gnl|CDD|224058 COG1135, AbcC, ABC-type metal ion transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|213262 cd03295, ABC_OpuCA_Osmoprotection, ATP-binding cassette domain of the osmoprotectant transporter Back     alignment and domain information
>gnl|CDD|213232 cd03265, ABC_DrrA, Daunorubicin/doxorubicin resistance ATP-binding protein Back     alignment and domain information
>gnl|CDD|224048 COG1123, COG1123, ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] Back     alignment and domain information
>gnl|CDD|213218 cd03251, ABCC_MsbA, ATP-binding cassette domain of the bacterial lipid flippase and related proteins, subfamily C Back     alignment and domain information
>gnl|CDD|132561 TIGR03522, GldA_ABC_ATP, gliding motility-associated ABC transporter ATP-binding subunit GldA Back     alignment and domain information
>gnl|CDD|215650 pfam00005, ABC_tran, ABC transporter Back     alignment and domain information
>gnl|CDD|182182 PRK09984, PRK09984, phosphonate/organophosphate ester transporter subunit; Provisional Back     alignment and domain information
>gnl|CDD|131721 TIGR02673, FtsE, cell division ATP-binding protein FtsE Back     alignment and domain information
>gnl|CDD|224042 COG1117, PstB, ABC-type phosphate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|224048 COG1123, COG1123, ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] Back     alignment and domain information
>gnl|CDD|213266 cd03299, ABC_ModC_like, ATP-binding cassette domain similar to the molybdate transporter Back     alignment and domain information
>gnl|CDD|224058 COG1135, AbcC, ABC-type metal ion transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|213259 cd03292, ABC_FtsE_transporter, ATP-binding cassette domain of the cell division transporter Back     alignment and domain information
>gnl|CDD|131266 TIGR02211, LolD_lipo_ex, lipoprotein releasing system, ATP-binding protein Back     alignment and domain information
>gnl|CDD|131197 TIGR02142, modC_ABC, molybdenum ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|183063 PRK11264, PRK11264, putative amino-acid ABC transporter ATP-binding protein YecC; Provisional Back     alignment and domain information
>gnl|CDD|225438 COG2884, FtsE, Predicted ATPase involved in cell division [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|226620 COG4136, COG4136, ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|234152 TIGR03265, PhnT2, putative 2-aminoethylphosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|223562 COG0488, Uup, ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] Back     alignment and domain information
>gnl|CDD|226647 COG4181, COG4181, Predicted ABC-type transport system involved in lysophospholipase L1 biosynthesis, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>gnl|CDD|182036 PRK09700, PRK09700, D-allose transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|184199 PRK13639, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|213268 cd03301, ABC_MalK_N, The N-terminal ATPase domain of the maltose transporter, MalK Back     alignment and domain information
>gnl|CDD|132302 TIGR03258, PhnT, 2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT Back     alignment and domain information
>gnl|CDD|226647 COG4181, COG4181, Predicted ABC-type transport system involved in lysophospholipase L1 biosynthesis, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>gnl|CDD|172200 PRK13652, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|183056 PRK11248, tauB, taurine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|227320 COG4987, CydC, ABC-type transport system involved in cytochrome bd biosynthesis, fused ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|223521 COG0444, DppD, ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|226622 COG4138, BtuD, ABC-type cobalamin transport system, ATPase component [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|213225 cd03258, ABC_MetN_methionine_transporter, ATP-binding cassette domain of methionine transporter Back     alignment and domain information
>gnl|CDD|163508 TIGR03796, NHLM_micro_ABC1, NHLM bacteriocin system ABC transporter, peptidase/ATP-binding protein Back     alignment and domain information
>gnl|CDD|184200 PRK13640, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|234357 TIGR03797, NHLM_micro_ABC2, NHLM bacteriocin system ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|223487 COG0410, LivF, ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|226364 COG3845, COG3845, ABC-type uncharacterized transport systems, ATPase components [General function prediction only] Back     alignment and domain information
>gnl|CDD|237451 PRK13631, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|131258 TIGR02203, MsbA_lipidA, lipid A export permease/ATP-binding protein MsbA Back     alignment and domain information
>gnl|CDD|224048 COG1123, COG1123, ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] Back     alignment and domain information
>gnl|CDD|213217 cd03250, ABCC_MRP_domain1, ATP-binding cassette domain 1 of multidrug resistance-associated protein, subfamily C Back     alignment and domain information
>gnl|CDD|162242 TIGR01187, potA, spermidine/putrescine ABC transporter ATP-binding subunit Back     alignment and domain information
>gnl|CDD|226592 COG4107, PhnK, ABC-type phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|234199 TIGR03410, urea_trans_UrtE, urea ABC transporter, ATP-binding protein UrtE Back     alignment and domain information
>gnl|CDD|236523 PRK09452, potA, putrescine/spermidine ABC transporter ATPase protein; Reviewed Back     alignment and domain information
>gnl|CDD|213198 cd03231, ABC_CcmA_heme_exporter, Cytochrome c biogenesis ATP-binding export protein Back     alignment and domain information
>gnl|CDD|213181 cd03214, ABC_Iron-Siderophores_B12_Hemin, ATP-binding component of iron-siderophores, vitamin B12 and hemin transporters and related proteins Back     alignment and domain information
>gnl|CDD|224044 COG1119, ModF, ABC-type molybdenum transport system, ATPase component/photorepair protein PhrA [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|172760 PRK14272, PRK14272, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|233596 TIGR01846, type_I_sec_HlyB, type I secretion system ABC transporter, HlyB family Back     alignment and domain information
>gnl|CDD|130234 TIGR01166, cbiO, cobalt transport protein ATP-binding subunit Back     alignment and domain information
>gnl|CDD|183077 PRK11288, araG, L-arabinose transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|182561 PRK10575, PRK10575, iron-hydroxamate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|236554 PRK09536, btuD, corrinoid ABC transporter ATPase; Reviewed Back     alignment and domain information
>gnl|CDD|224050 COG1125, OpuBA, ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|224026 COG1101, PhnK, ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|130256 TIGR01188, drrA, daunorubicin resistance ABC transporter ATP-binding subunit Back     alignment and domain information
>gnl|CDD|226905 COG4525, TauB, ABC-type taurine transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|226952 COG4586, COG4586, ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|213218 cd03251, ABCC_MsbA, ATP-binding cassette domain of the bacterial lipid flippase and related proteins, subfamily C Back     alignment and domain information
>gnl|CDD|223521 COG0444, DppD, ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|226360 COG3840, ThiQ, ABC-type thiamine transport system, ATPase component [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|226628 COG4148, ModC, ABC-type molybdate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|130261 TIGR01193, bacteriocin_ABC, ABC-type bacteriocin transporter Back     alignment and domain information
>gnl|CDD|188099 TIGR00972, 3a0107s01c2, phosphate ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|213184 cd03217, ABC_FeS_Assembly, ABC-type transport system involved in Fe-S cluster assembly, ATPase component Back     alignment and domain information
>gnl|CDD|224055 COG1132, MdlB, ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|224044 COG1119, ModF, ABC-type molybdenum transport system, ATPase component/photorepair protein PhrA [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|188208 TIGR02323, CP_lyasePhnK, phosphonate C-P lyase system protein PhnK Back     alignment and domain information
>gnl|CDD|213221 cd03254, ABCC_Glucan_exporter_like, ATP-binding cassette domain of glucan transporter and related proteins, subfamily C Back     alignment and domain information
>gnl|CDD|132561 TIGR03522, GldA_ABC_ATP, gliding motility-associated ABC transporter ATP-binding subunit GldA Back     alignment and domain information
>gnl|CDD|213265 cd03298, ABC_ThiQ_thiamine_transporter, ATP-binding cassette domain of the thiamine transport system Back     alignment and domain information
>gnl|CDD|236870 PRK11174, PRK11174, cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed Back     alignment and domain information
>gnl|CDD|184203 PRK13643, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|234189 TIGR03375, type_I_sec_LssB, type I secretion system ATPase, LssB family Back     alignment and domain information
>gnl|CDD|172743 PRK14255, PRK14255, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|226617 COG4133, CcmA, ABC-type transport system involved in cytochrome c biogenesis, ATPase component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|223562 COG0488, Uup, ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] Back     alignment and domain information
>gnl|CDD|162242 TIGR01187, potA, spermidine/putrescine ABC transporter ATP-binding subunit Back     alignment and domain information
>gnl|CDD|233305 TIGR01189, ccmA, heme ABC exporter, ATP-binding protein CcmA Back     alignment and domain information
>gnl|CDD|233665 TIGR01978, sufC, FeS assembly ATPase SufC Back     alignment and domain information
>gnl|CDD|184132 PRK13547, hmuV, hemin importer ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|227320 COG4987, CydC, ABC-type transport system involved in cytochrome bd biosynthesis, fused ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|227590 COG5265, ATM1, ABC-type transport system involved in Fe-S cluster assembly, permease and ATPase components [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|237457 PRK13647, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|224041 COG1116, TauB, ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|213225 cd03258, ABC_MetN_methionine_transporter, ATP-binding cassette domain of methionine transporter Back     alignment and domain information
>gnl|CDD|130344 TIGR01277, thiQ, thiamine ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|224051 COG1126, GlnQ, ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|213215 cd03248, ABCC_TAP, ATP-binding cassette domain of the Transporter Associated with Antigen Processing, subfamily C Back     alignment and domain information
>gnl|CDD|213229 cd03262, ABC_HisP_GlnQ, ATP-binding cassette domain of the histidine and glutamine transporters Back     alignment and domain information
>gnl|CDD|226631 COG4152, COG4152, ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|213219 cd03252, ABCC_Hemolysin, ATP-binding cassette domain of hemolysin B, subfamily C Back     alignment and domain information
>gnl|CDD|234152 TIGR03265, PhnT2, putative 2-aminoethylphosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|224051 COG1126, GlnQ, ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|172735 PRK14247, PRK14247, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|213235 cd03268, ABC_BcrA_bacitracin_resist, ATP-binding cassette domain of the bacitracin-resistance transporter Back     alignment and domain information
>gnl|CDD|237420 PRK13537, PRK13537, nodulation ABC transporter NodI; Provisional Back     alignment and domain information
>gnl|CDD|131721 TIGR02673, FtsE, cell division ATP-binding protein FtsE Back     alignment and domain information
>gnl|CDD|213211 cd03244, ABCC_MRP_domain2, ATP-binding cassette domain 2 of multidrug resistance-associated protein Back     alignment and domain information
>gnl|CDD|172741 PRK14253, PRK14253, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|184205 PRK13646, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|130254 TIGR01186, proV, glycine betaine/L-proline transport ATP binding subunit Back     alignment and domain information
>gnl|CDD|226970 COG4619, COG4619, ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|183056 PRK11248, tauB, taurine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|184587 PRK14241, PRK14241, phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|213196 cd03229, ABC_Class3, ATP-binding cassette domain of the binding protein-dependent transport systems Back     alignment and domain information
>gnl|CDD|182336 PRK10253, PRK10253, iron-enterobactin transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|184127 PRK13540, PRK13540, cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>gnl|CDD|163483 TIGR03771, anch_rpt_ABC, anchored repeat-type ABC transporter, ATP-binding subunit Back     alignment and domain information
>gnl|CDD|184199 PRK13639, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|213262 cd03295, ABC_OpuCA_Osmoprotection, ATP-binding cassette domain of the osmoprotectant transporter Back     alignment and domain information
>gnl|CDD|182036 PRK09700, PRK09700, D-allose transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|237645 PRK14235, PRK14235, phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|172749 PRK14261, PRK14261, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|182331 PRK10247, PRK10247, putative ABC transporter ATP-binding protein YbbL; Provisional Back     alignment and domain information
>gnl|CDD|172733 PRK14245, PRK14245, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|131259 TIGR02204, MsbA_rel, ABC transporter, permease/ATP-binding protein Back     alignment and domain information
>gnl|CDD|182880 PRK10982, PRK10982, galactose/methyl galaxtoside transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|131816 TIGR02769, nickel_nikE, nickel import ATP-binding protein NikE Back     alignment and domain information
>gnl|CDD|213179 cd00267, ABC_ATPase, ATP-binding cassette transporter nucleotide-binding domain Back     alignment and domain information
>gnl|CDD|213179 cd00267, ABC_ATPase, ATP-binding cassette transporter nucleotide-binding domain Back     alignment and domain information
>gnl|CDD|200134 TIGR01842, type_I_sec_PrtD, type I secretion system ABC transporter, PrtD family Back     alignment and domain information
>gnl|CDD|226620 COG4136, COG4136, ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|223562 COG0488, Uup, ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] Back     alignment and domain information
>gnl|CDD|188208 TIGR02323, CP_lyasePhnK, phosphonate C-P lyase system protein PhnK Back     alignment and domain information
>gnl|CDD|131816 TIGR02769, nickel_nikE, nickel import ATP-binding protein NikE Back     alignment and domain information
>gnl|CDD|183244 PRK11629, lolD, lipoprotein transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|130252 TIGR01184, ntrCD, nitrate transport ATP-binding subunits C and D Back     alignment and domain information
>gnl|CDD|182778 PRK10851, PRK10851, sulfate/thiosulfate transporter subunit; Provisional Back     alignment and domain information
>gnl|CDD|213205 cd03238, ABC_UvrA, ATP-binding cassette domain of the excision repair protein UvrA Back     alignment and domain information
>gnl|CDD|224049 COG1124, DppF, ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|184196 PRK13636, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|184585 PRK14239, PRK14239, phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|224042 COG1117, PstB, ABC-type phosphate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|172760 PRK14272, PRK14272, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|237456 PRK13641, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|184586 PRK14240, PRK14240, phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|172750 PRK14262, PRK14262, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|181965 PRK09580, sufC, cysteine desulfurase ATPase component; Reviewed Back     alignment and domain information
>gnl|CDD|236755 PRK10762, PRK10762, D-ribose transporter ATP binding protein; Provisional Back     alignment and domain information
>gnl|CDD|130324 TIGR01257, rim_protein, retinal-specific rim ABC transporter Back     alignment and domain information
>gnl|CDD|234199 TIGR03410, urea_trans_UrtE, urea ABC transporter, ATP-binding protein UrtE Back     alignment and domain information
>gnl|CDD|184195 PRK13635, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|131817 TIGR02770, nickel_nikD, nickel import ATP-binding protein NikD Back     alignment and domain information
>gnl|CDD|213265 cd03298, ABC_ThiQ_thiamine_transporter, ATP-binding cassette domain of the thiamine transport system Back     alignment and domain information
>gnl|CDD|184203 PRK13643, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|131817 TIGR02770, nickel_nikD, nickel import ATP-binding protein NikD Back     alignment and domain information
>gnl|CDD|184210 PRK13651, PRK13651, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|237648 PRK14250, PRK14250, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|215650 pfam00005, ABC_tran, ABC transporter Back     alignment and domain information
>gnl|CDD|188099 TIGR00972, 3a0107s01c2, phosphate ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|226970 COG4619, COG4619, ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|184597 PRK14270, PRK14270, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|182778 PRK10851, PRK10851, sulfate/thiosulfate transporter subunit; Provisional Back     alignment and domain information
>gnl|CDD|236689 PRK10419, nikE, nickel transporter ATP-binding protein NikE; Provisional Back     alignment and domain information
>gnl|CDD|213255 cd03288, ABCC_SUR2, ATP-binding cassette domain 2 of the sulfonylurea receptor SUR Back     alignment and domain information
>gnl|CDD|226643 COG4175, ProV, ABC-type proline/glycine betaine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|130252 TIGR01184, ntrCD, nitrate transport ATP-binding subunits C and D Back     alignment and domain information
>gnl|CDD|130355 TIGR01288, nodI, ATP-binding ABC transporter family nodulation protein NodI Back     alignment and domain information
>gnl|CDD|236554 PRK09536, btuD, corrinoid ABC transporter ATPase; Reviewed Back     alignment and domain information
>gnl|CDD|237917 PRK15134, PRK15134, microcin C ABC transporter ATP-binding protein YejF; Provisional Back     alignment and domain information
>gnl|CDD|213183 cd03216, ABC_Carb_Monos_I, First domain of the ATP-binding cassette component of monosaccharide transport system Back     alignment and domain information
>gnl|CDD|237419 PRK13536, PRK13536, nodulation factor exporter subunit NodI; Provisional Back     alignment and domain information
>gnl|CDD|226360 COG3840, ThiQ, ABC-type thiamine transport system, ATPase component [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|213184 cd03217, ABC_FeS_Assembly, ABC-type transport system involved in Fe-S cluster assembly, ATPase component Back     alignment and domain information
>gnl|CDD|130344 TIGR01277, thiQ, thiamine ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|226637 COG4167, SapF, ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|213269 cd03369, ABCC_NFT1, ATP-binding cassette domain 2 of NFT1, subfamily C Back     alignment and domain information
>gnl|CDD|236865 PRK11160, PRK11160, cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed Back     alignment and domain information
>gnl|CDD|172759 PRK14271, PRK14271, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|131258 TIGR02203, MsbA_lipidA, lipid A export permease/ATP-binding protein MsbA Back     alignment and domain information
>gnl|CDD|163483 TIGR03771, anch_rpt_ABC, anchored repeat-type ABC transporter, ATP-binding subunit Back     alignment and domain information
>gnl|CDD|181965 PRK09580, sufC, cysteine desulfurase ATPase component; Reviewed Back     alignment and domain information
>gnl|CDD|184214 PRK13657, PRK13657, cyclic beta-1,2-glucan ABC transporter; Provisional Back     alignment and domain information
>gnl|CDD|213214 cd03247, ABCC_cytochrome_bd, ATP-binding cassette domain of CydCD, subfamily C Back     alignment and domain information
>gnl|CDD|132050 TIGR03005, ectoine_ehuA, ectoine/hydroxyectoine ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|184134 PRK13549, PRK13549, xylose transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|184125 PRK13538, PRK13538, cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>gnl|CDD|183280 PRK11701, phnK, phosphonate C-P lyase system protein PhnK; Provisional Back     alignment and domain information
>gnl|CDD|226635 COG4161, ArtP, ABC-type arginine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|184198 PRK13638, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|226969 COG4618, ArpD, ABC-type protease/lipase transport system, ATPase and permease components [General function prediction only] Back     alignment and domain information
>gnl|CDD|236523 PRK09452, potA, putrescine/spermidine ABC transporter ATPase protein; Reviewed Back     alignment and domain information
>gnl|CDD|131259 TIGR02204, MsbA_rel, ABC transporter, permease/ATP-binding protein Back     alignment and domain information
>gnl|CDD|213183 cd03216, ABC_Carb_Monos_I, First domain of the ATP-binding cassette component of monosaccharide transport system Back     alignment and domain information
>gnl|CDD|184125 PRK13538, PRK13538, cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>gnl|CDD|172761 PRK14273, PRK14273, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|224166 COG1245, COG1245, Predicted ATPase, RNase L inhibitor (RLI) homolog [General function prediction only] Back     alignment and domain information
>gnl|CDD|213203 cd03236, ABC_RNaseL_inhibitor_domain1, The ATP-binding cassette domain 1 of RNase L inhibitor Back     alignment and domain information
>gnl|CDD|172739 PRK14251, PRK14251, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|131681 TIGR02633, xylG, D-xylose ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|184596 PRK14267, PRK14267, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|227590 COG5265, ATM1, ABC-type transport system involved in Fe-S cluster assembly, permease and ATPase components [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|106587 PRK13644, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|226641 COG4172, COG4172, ABC-type uncharacterized transport system, duplicated ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|184584 PRK14238, PRK14238, phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|183080 PRK11300, livG, leucine/isoleucine/valine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|184582 PRK14236, PRK14236, phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|213261 cd03294, ABC_Pro_Gly_Betaine, ATP-binding cassette domain of the osmoprotectant proline/glycine betaine uptake system Back     alignment and domain information
>gnl|CDD|181906 PRK09493, glnQ, glutamine ABC transporter ATP-binding protein; Reviewed Back     alignment and domain information
>gnl|CDD|183133 PRK11432, fbpC, ferric transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|172744 PRK14256, PRK14256, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|214372 CHL00131, ycf16, sulfate ABC transporter protein; Validated Back     alignment and domain information
>gnl|CDD|184195 PRK13635, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|131681 TIGR02633, xylG, D-xylose ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|213198 cd03231, ABC_CcmA_heme_exporter, Cytochrome c biogenesis ATP-binding export protein Back     alignment and domain information
>gnl|CDD|213261 cd03294, ABC_Pro_Gly_Betaine, ATP-binding cassette domain of the osmoprotectant proline/glycine betaine uptake system Back     alignment and domain information
>gnl|CDD|237452 PRK13632, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|213229 cd03262, ABC_HisP_GlnQ, ATP-binding cassette domain of the histidine and glutamine transporters Back     alignment and domain information
>gnl|CDD|226643 COG4175, ProV, ABC-type proline/glycine betaine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|226967 COG4608, AppF, ABC-type oligopeptide transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|226961 COG4598, HisP, ABC-type histidine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|235150 PRK03695, PRK03695, vitamin B12-transporter ATPase; Provisional Back     alignment and domain information
>gnl|CDD|237455 PRK13637, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|226628 COG4148, ModC, ABC-type molybdate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|235150 PRK03695, PRK03695, vitamin B12-transporter ATPase; Provisional Back     alignment and domain information
>gnl|CDD|237652 PRK14275, PRK14275, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|172747 PRK14259, PRK14259, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|130261 TIGR01193, bacteriocin_ABC, ABC-type bacteriocin transporter Back     alignment and domain information
>gnl|CDD|213184 cd03217, ABC_FeS_Assembly, ABC-type transport system involved in Fe-S cluster assembly, ATPase component Back     alignment and domain information
>gnl|CDD|172743 PRK14255, PRK14255, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|172735 PRK14247, PRK14247, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|130254 TIGR01186, proV, glycine betaine/L-proline transport ATP binding subunit Back     alignment and domain information
>gnl|CDD|184597 PRK14270, PRK14270, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|236865 PRK11160, PRK11160, cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed Back     alignment and domain information
>gnl|CDD|183133 PRK11432, fbpC, ferric transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|182592 PRK10619, PRK10619, histidine/lysine/arginine/ornithine transporter subunit; Provisional Back     alignment and domain information
>gnl|CDD|184129 PRK13543, PRK13543, cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>gnl|CDD|182893 PRK11000, PRK11000, maltose/maltodextrin transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|131367 TIGR02314, ABC_MetN, D-methionine ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|213257 cd03290, ABCC_SUR1_N, ATP-binding cassette domain of the sulfonylurea receptor, subfamily C Back     alignment and domain information
>gnl|CDD|172730 PRK14242, PRK14242, phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|233209 TIGR00958, 3a01208, Conjugate Transporter-2 (CT2) Family protein Back     alignment and domain information
>gnl|CDD|237646 PRK14237, PRK14237, phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|132313 TIGR03269, met_CoM_red_A2, methyl coenzyme M reductase system, component A2 Back     alignment and domain information
>gnl|CDD|131197 TIGR02142, modC_ABC, molybdenum ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|226364 COG3845, COG3845, ABC-type uncharacterized transport systems, ATPase components [General function prediction only] Back     alignment and domain information
>gnl|CDD|182336 PRK10253, PRK10253, iron-enterobactin transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|213214 cd03247, ABCC_cytochrome_bd, ATP-binding cassette domain of CydCD, subfamily C Back     alignment and domain information
>gnl|CDD|184129 PRK13543, PRK13543, cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>gnl|CDD|237454 PRK13634, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|181939 PRK09544, znuC, high-affinity zinc transporter ATPase; Reviewed Back     alignment and domain information
>gnl|CDD|215640 PLN03232, PLN03232, ABC transporter C family member; Provisional Back     alignment and domain information
>gnl|CDD|224053 COG1129, MglA, ABC-type sugar transport system, ATPase component [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|213234 cd03267, ABC_NatA_like, ATP-binding cassette domain of an uncharacterized transporter similar in sequence to NatA Back     alignment and domain information
>gnl|CDD|225438 COG2884, FtsE, Predicted ATPase involved in cell division [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|184210 PRK13651, PRK13651, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|132313 TIGR03269, met_CoM_red_A2, methyl coenzyme M reductase system, component A2 Back     alignment and domain information
>gnl|CDD|226646 COG4178, COG4178, ABC-type uncharacterized transport system, permease and ATPase components [General function prediction only] Back     alignment and domain information
>gnl|CDD|224057 COG1134, TagH, ABC-type polysaccharide/polyol phosphate transport system, ATPase component [Carbohydrate transport and metabolism / Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|213213 cd03246, ABCC_Protease_Secretion, ATP-binding cassette domain of PrtD, subfamily C Back     alignment and domain information
>gnl|CDD|224053 COG1129, MglA, ABC-type sugar transport system, ATPase component [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|234200 TIGR03411, urea_trans_UrtD, urea ABC transporter, ATP-binding protein UrtD Back     alignment and domain information
>gnl|CDD|130260 TIGR01192, chvA, glucan exporter ATP-binding protein Back     alignment and domain information
>gnl|CDD|236870 PRK11174, PRK11174, cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed Back     alignment and domain information
>gnl|CDD|172734 PRK14246, PRK14246, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|182528 PRK10535, PRK10535, macrolide transporter ATP-binding /permease protein; Provisional Back     alignment and domain information
>gnl|CDD|183226 PRK11607, potG, putrescine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|188353 TIGR03608, L_ocin_972_ABC, putative bacteriocin export ABC transporter, lactococcin 972 group Back     alignment and domain information
>gnl|CDD|214372 CHL00131, ycf16, sulfate ABC transporter protein; Validated Back     alignment and domain information
>gnl|CDD|237452 PRK13632, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|213257 cd03290, ABCC_SUR1_N, ATP-binding cassette domain of the sulfonylurea receptor, subfamily C Back     alignment and domain information
>gnl|CDD|184590 PRK14249, PRK14249, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|237457 PRK13647, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|182716 PRK10771, thiQ, thiamine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|182993 PRK11144, modC, molybdate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|240339 PTZ00265, PTZ00265, multidrug resistance protein (mdr1); Provisional Back     alignment and domain information
>gnl|CDD|130324 TIGR01257, rim_protein, retinal-specific rim ABC transporter Back     alignment and domain information
>gnl|CDD|131266 TIGR02211, LolD_lipo_ex, lipoprotein releasing system, ATP-binding protein Back     alignment and domain information
>gnl|CDD|226622 COG4138, BtuD, ABC-type cobalamin transport system, ATPase component [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|224026 COG1101, PhnK, ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|213215 cd03248, ABCC_TAP, ATP-binding cassette domain of the Transporter Associated with Antigen Processing, subfamily C Back     alignment and domain information
>gnl|CDD|132050 TIGR03005, ectoine_ehuA, ectoine/hydroxyectoine ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|226967 COG4608, AppF, ABC-type oligopeptide transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|172734 PRK14246, PRK14246, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|183226 PRK11607, potG, putrescine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|183231 PRK11614, livF, leucine/isoleucine/valine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|182829 PRK10908, PRK10908, cell division protein FtsE; Provisional Back     alignment and domain information
>gnl|CDD|131377 TIGR02324, CP_lyasePhnL, phosphonate C-P lyase system protein PhnL Back     alignment and domain information
>gnl|CDD|213194 cd03227, ABC_Class2, ATP-binding cassette domain of non-transporter proteins Back     alignment and domain information
>gnl|CDD|214640 smart00382, AAA, ATPases associated with a variety of cellular activities Back     alignment and domain information
>gnl|CDD|172762 PRK14274, PRK14274, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|184207 PRK13648, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|223562 COG0488, Uup, ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] Back     alignment and domain information
>gnl|CDD|234357 TIGR03797, NHLM_micro_ABC2, NHLM bacteriocin system ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|182561 PRK10575, PRK10575, iron-hydroxamate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|182331 PRK10247, PRK10247, putative ABC transporter ATP-binding protein YbbL; Provisional Back     alignment and domain information
>gnl|CDD|184586 PRK14240, PRK14240, phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|172744 PRK14256, PRK14256, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|237455 PRK13637, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|131367 TIGR02314, ABC_MetN, D-methionine ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|181939 PRK09544, znuC, high-affinity zinc transporter ATPase; Reviewed Back     alignment and domain information
>gnl|CDD|215640 PLN03232, PLN03232, ABC transporter C family member; Provisional Back     alignment and domain information
>gnl|CDD|182716 PRK10771, thiQ, thiamine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|240339 PTZ00265, PTZ00265, multidrug resistance protein (mdr1); Provisional Back     alignment and domain information
>gnl|CDD|184208 PRK13649, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|213188 cd03221, ABCF_EF-3, ATP-binding cassette domain of elongation factor 3, subfamily F Back     alignment and domain information
>gnl|CDD|184588 PRK14243, PRK14243, phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|236898 PRK11308, dppF, dipeptide transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|172757 PRK14269, PRK14269, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|237651 PRK14266, PRK14266, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|213187 cd03220, ABC_KpsT_Wzt, ATP-binding cassette component of polysaccharide transport system Back     alignment and domain information
>gnl|CDD|213187 cd03220, ABC_KpsT_Wzt, ATP-binding cassette component of polysaccharide transport system Back     alignment and domain information
>gnl|CDD|185336 PRK15439, PRK15439, autoinducer 2 ABC transporter ATP-binding protein LsrA; Provisional Back     alignment and domain information
>gnl|CDD|184594 PRK14264, PRK14264, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|213196 cd03229, ABC_Class3, ATP-binding cassette domain of the binding protein-dependent transport systems Back     alignment and domain information
>gnl|CDD|213185 cd03218, ABC_YhbG, ATP-binding cassette component of YhbG transport system Back     alignment and domain information
>gnl|CDD|214640 smart00382, AAA, ATPases associated with a variety of cellular activities Back     alignment and domain information
>gnl|CDD|213190 cd03223, ABCD_peroxisomal_ALDP, ATP-binding cassette domain of peroxisomal transporter, subfamily D Back     alignment and domain information
>gnl|CDD|227019 COG4674, COG4674, Uncharacterized ABC-type transport system, ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|182036 PRK09700, PRK09700, D-allose transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|172747 PRK14259, PRK14259, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|237453 PRK13633, PRK13633, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|185067 PRK15112, PRK15112, antimicrobial peptide ABC system ATP-binding protein SapF; Provisional Back     alignment and domain information
>gnl|CDD|130324 TIGR01257, rim_protein, retinal-specific rim ABC transporter Back     alignment and domain information
>gnl|CDD|233596 TIGR01846, type_I_sec_HlyB, type I secretion system ABC transporter, HlyB family Back     alignment and domain information
>gnl|CDD|172739 PRK14251, PRK14251, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|237649 PRK14254, PRK14254, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|184204 PRK13645, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|224060 COG1137, YhbG, ABC-type (unclassified) transport system, ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|163452 TIGR03740, galliderm_ABC, gallidermin-class lantibiotic protection ABC transporter, ATP-binding subunit Back     alignment and domain information
>gnl|CDD|237648 PRK14250, PRK14250, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|172762 PRK14274, PRK14274, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|183016 PRK11176, PRK11176, lipid transporter ATP-binding/permease protein; Provisional Back     alignment and domain information
>gnl|CDD|172740 PRK14252, PRK14252, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|184202 PRK13642, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|182732 PRK10789, PRK10789, putative multidrug transporter membrane\ATP-binding components; Provisional Back     alignment and domain information
>gnl|CDD|163508 TIGR03796, NHLM_micro_ABC1, NHLM bacteriocin system ABC transporter, peptidase/ATP-binding protein Back     alignment and domain information
>gnl|CDD|226592 COG4107, PhnK, ABC-type phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|172730 PRK14242, PRK14242, phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|213181 cd03214, ABC_Iron-Siderophores_B12_Hemin, ATP-binding component of iron-siderophores, vitamin B12 and hemin transporters and related proteins Back     alignment and domain information
>gnl|CDD|182569 PRK10584, PRK10584, putative ABC transporter ATP-binding protein YbbA; Provisional Back     alignment and domain information
>gnl|CDD|183063 PRK11264, PRK11264, putative amino-acid ABC transporter ATP-binding protein YecC; Provisional Back     alignment and domain information
>gnl|CDD|237451 PRK13631, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|183077 PRK11288, araG, L-arabinose transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|183244 PRK11629, lolD, lipoprotein transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|233209 TIGR00958, 3a01208, Conjugate Transporter-2 (CT2) Family protein Back     alignment and domain information
>gnl|CDD|130260 TIGR01192, chvA, glucan exporter ATP-binding protein Back     alignment and domain information
>gnl|CDD|183231 PRK11614, livF, leucine/isoleucine/valine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|213204 cd03237, ABC_RNaseL_inhibitor_domain2, The ATP-binding cassette domain 2 of RNase L inhibitor Back     alignment and domain information
>gnl|CDD|182980 PRK11124, artP, arginine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|184200 PRK13640, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|172741 PRK14253, PRK14253, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|172749 PRK14261, PRK14261, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|213205 cd03238, ABC_UvrA, ATP-binding cassette domain of the excision repair protein UvrA Back     alignment and domain information
>gnl|CDD|226641 COG4172, COG4172, ABC-type uncharacterized transport system, duplicated ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|132313 TIGR03269, met_CoM_red_A2, methyl coenzyme M reductase system, component A2 Back     alignment and domain information
>gnl|CDD|213204 cd03237, ABC_RNaseL_inhibitor_domain2, The ATP-binding cassette domain 2 of RNase L inhibitor Back     alignment and domain information
>gnl|CDD|172745 PRK14257, PRK14257, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|223912 COG0842, COG0842, ABC-type multidrug transport system, permease component [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|184593 PRK14258, PRK14258, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|184209 PRK13650, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|240327 PTZ00243, PTZ00243, ABC transporter; Provisional Back     alignment and domain information
>gnl|CDD|226592 COG4107, PhnK, ABC-type phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|236689 PRK10419, nikE, nickel transporter ATP-binding protein NikE; Provisional Back     alignment and domain information
>gnl|CDD|237454 PRK13634, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|182528 PRK10535, PRK10535, macrolide transporter ATP-binding /permease protein; Provisional Back     alignment and domain information
>gnl|CDD|213190 cd03223, ABCD_peroxisomal_ALDP, ATP-binding cassette domain of peroxisomal transporter, subfamily D Back     alignment and domain information
>gnl|CDD|172732 PRK14244, PRK14244, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|188317 TIGR03415, ABC_choXWV_ATP, choline ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|188098 TIGR00957, MRP_assoc_pro, multi drug resistance-associated protein (MRP) Back     alignment and domain information
>gnl|CDD|182692 PRK10744, pstB, phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|172756 PRK14268, PRK14268, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|236947 PRK11650, ugpC, glycerol-3-phosphate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|237647 PRK14248, PRK14248, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|213195 cd03228, ABCC_MRP_Like, ATP-binding cassette domain of multidrug resistance protein-like transporters Back     alignment and domain information
>gnl|CDD|183280 PRK11701, phnK, phosphonate C-P lyase system protein PhnK; Provisional Back     alignment and domain information
>gnl|CDD|237651 PRK14266, PRK14266, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|223912 COG0842, COG0842, ABC-type multidrug transport system, permease component [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|222165 pfam13481, AAA_25, AAA domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 1391
KOG00651391 consensus Pleiotropic drug resistance proteins (PD 100.0
PLN031401470 ABC transporter G family member; Provisional 100.0
TIGR00956 1394 3a01205 Pleiotropic Drug Resistance (PDR) Family p 100.0
KOG0061613 consensus Transporter, ABC superfamily (Breast can 100.0
PLN03211659 ABC transporter G-25; Provisional 100.0
TIGR00955617 3a01204 The Eye Pigment Precursor Transporter (EPP 100.0
TIGR00956 1394 3a01205 Pleiotropic Drug Resistance (PDR) Family p 100.0
PLN03140 1470 ABC transporter G family member; Provisional 100.0
KOG0061613 consensus Transporter, ABC superfamily (Breast can 100.0
PLN03211659 ABC transporter G-25; Provisional 100.0
TIGR00955617 3a01204 The Eye Pigment Precursor Transporter (EPP 100.0
KOG00551228 consensus Multidrug/pheromone exporter, ABC superf 100.0
KOG0065 1391 consensus Pleiotropic drug resistance proteins (PD 100.0
KOG00541381 consensus Multidrug resistance-associated protein/ 100.0
TIGR012572272 rim_protein retinal-specific rim ABC transporter. 100.0
PLN031301622 ABC transporter C family member; Provisional 100.0
PLN032321495 ABC transporter C family member; Provisional 100.0
PTZ002651466 multidrug resistance protein (mdr1); Provisional 100.0
TIGR009571522 MRP_assoc_pro multi drug resistance-associated pro 100.0
COG1123539 ATPase components of various ABC-type transport sy 100.0
PRK13549506 xylose transporter ATP-binding subunit; Provisiona 100.0
TIGR012711490 CFTR_protein cystic fibrosis transmembrane conduct 100.0
PRK10762501 D-ribose transporter ATP binding protein; Provisio 100.0
PRK09700510 D-allose transporter ATP-binding protein; Provisio 100.0
PRK10261623 glutathione transporter ATP-binding protein; Provi 100.0
PTZ002431560 ABC transporter; Provisional 100.0
TIGR03269520 met_CoM_red_A2 methyl coenzyme M reductase system, 100.0
PRK15134529 microcin C ABC transporter ATP-binding protein Yej 100.0
PRK15439510 autoinducer 2 ABC transporter ATP-binding protein 100.0
TIGR02633500 xylG D-xylose ABC transporter, ATP-binding protein 100.0
PRK11288501 araG L-arabinose transporter ATP-binding protein; 100.0
PRK10982491 galactose/methyl galaxtoside transporter ATP-bindi 100.0
PRK10938490 putative molybdenum transport ATP-binding protein 100.0
COG4172534 ABC-type uncharacterized transport system, duplica 100.0
PRK11819556 putative ABC transporter ATP-binding protein; Revi 100.0
PRK15064530 ABC transporter ATP-binding protein; Provisional 100.0
TIGR03719552 ABC_ABC_ChvD ATP-binding cassette protein, ChvD fa 100.0
PRK10636638 putative ABC transporter ATP-binding protein; Prov 100.0
PRK11147635 ABC transporter ATPase component; Reviewed 100.0
PRK13409590 putative ATPase RIL; Provisional 100.0
COG1129500 MglA ABC-type sugar transport system, ATPase compo 100.0
PLN03073718 ABC transporter F family; Provisional 100.0
COG0488530 Uup ATPase components of ABC transporters with dup 100.0
COG3845501 ABC-type uncharacterized transport systems, ATPase 100.0
COG1126240 GlnQ ABC-type polar amino acid transport system, A 100.0
KOG0927614 consensus Predicted transporter (ABC superfamily) 100.0
COG1126240 GlnQ ABC-type polar amino acid transport system, A 100.0
COG1125309 OpuBA ABC-type proline/glycine betaine transport s 100.0
COG1135339 AbcC ABC-type metal ion transport system, ATPase c 100.0
COG1131293 CcmA ABC-type multidrug transport system, ATPase c 100.0
COG3839338 MalK ABC-type sugar transport systems, ATPase comp 100.0
KOG0058716 consensus Peptide exporter, ABC superfamily [Intra 100.0
COG1135339 AbcC ABC-type metal ion transport system, ATPase c 100.0
COG1121254 ZnuC ABC-type Mn/Zn transport systems, ATPase comp 100.0
COG1120258 FepC ABC-type cobalamin/Fe3+-siderophores transpor 100.0
COG3842352 PotA ABC-type spermidine/putrescine transport syst 100.0
COG1127263 Ttg2A ABC-type transport system involved in resist 100.0
COG1120258 FepC ABC-type cobalamin/Fe3+-siderophores transpor 100.0
COG1116248 TauB ABC-type nitrate/sulfonate/bicarbonate transp 100.0
COG1127263 Ttg2A ABC-type transport system involved in resist 100.0
COG1118345 CysA ABC-type sulfate/molybdate transport systems, 100.0
COG1116248 TauB ABC-type nitrate/sulfonate/bicarbonate transp 100.0
COG1131293 CcmA ABC-type multidrug transport system, ATPase c 100.0
COG3638258 ABC-type phosphate/phosphonate transport system, A 100.0
TIGR01257 2272 rim_protein retinal-specific rim ABC transporter. 100.0
COG1136226 SalX ABC-type antimicrobial peptide transport syst 100.0
COG1125309 OpuBA ABC-type proline/glycine betaine transport s 100.0
COG1117253 PstB ABC-type phosphate transport system, ATPase c 100.0
COG2274709 SunT ABC-type bacteriocin/lantibiotic exporters, c 100.0
COG1121254 ZnuC ABC-type Mn/Zn transport systems, ATPase comp 100.0
COG3638258 ABC-type phosphate/phosphonate transport system, A 100.0
COG4555245 NatA ABC-type Na+ transport system, ATPase compone 100.0
COG1118345 CysA ABC-type sulfate/molybdate transport systems, 100.0
COG4555245 NatA ABC-type Na+ transport system, ATPase compone 100.0
COG2884223 FtsE Predicted ATPase involved in cell division [C 100.0
COG1136226 SalX ABC-type antimicrobial peptide transport syst 100.0
COG1117253 PstB ABC-type phosphate transport system, ATPase c 100.0
KOG0057591 consensus Mitochondrial Fe/S cluster exporter, ABC 100.0
TIGR02314343 ABC_MetN D-methionine ABC transporter, ATP-binding 100.0
COG3839338 MalK ABC-type sugar transport systems, ATPase comp 100.0
KOG00551228 consensus Multidrug/pheromone exporter, ABC superf 100.0
PRK13537306 nodulation ABC transporter NodI; Provisional 100.0
TIGR03265353 PhnT2 putative 2-aminoethylphosphonate ABC transpo 100.0
PRK11432351 fbpC ferric transporter ATP-binding subunit; Provi 100.0
PRK11650356 ugpC glycerol-3-phosphate transporter ATP-binding 100.0
TIGR03258362 PhnT 2-aminoethylphosphonate ABC transport system, 100.0
KOG0056790 consensus Heavy metal exporter HMT1, ABC superfami 100.0
COG3842352 PotA ABC-type spermidine/putrescine transport syst 100.0
PRK13537306 nodulation ABC transporter NodI; Provisional 100.0
COG1124252 DppF ABC-type dipeptide/oligopeptide/nickel transp 100.0
PRK09452375 potA putrescine/spermidine ABC transporter ATPase 100.0
TIGR02314343 ABC_MetN D-methionine ABC transporter, ATP-binding 100.0
cd03261235 ABC_Org_Solvent_Resistant ABC (ATP-binding cassett 100.0
COG1122235 CbiO ABC-type cobalt transport system, ATPase comp 100.0
PRK10851353 sulfate/thiosulfate transporter subunit; Provision 100.0
TIGR01186363 proV glycine betaine/L-proline transport ATP bindi 100.0
COG1132567 MdlB ABC-type multidrug transport system, ATPase a 100.0
cd03261235 ABC_Org_Solvent_Resistant ABC (ATP-binding cassett 100.0
TIGR03265353 PhnT2 putative 2-aminoethylphosphonate ABC transpo 100.0
PRK11650356 ugpC glycerol-3-phosphate transporter ATP-binding 100.0
COG0410237 LivF ABC-type branched-chain amino acid transport 100.0
PRK11607377 potG putrescine transporter ATP-binding subunit; P 100.0
COG2274709 SunT ABC-type bacteriocin/lantibiotic exporters, c 100.0
COG2884223 FtsE Predicted ATPase involved in cell division [C 100.0
PRK11174588 cysteine/glutathione ABC transporter membrane/ATP- 100.0
COG3840231 ThiQ ABC-type thiamine transport system, ATPase co 100.0
PRK11432351 fbpC ferric transporter ATP-binding subunit; Provi 100.0
PRK11000369 maltose/maltodextrin transporter ATP-binding prote 100.0
PRK13536340 nodulation factor exporter subunit NodI; Provision 100.0
TIGR03258362 PhnT 2-aminoethylphosphonate ABC transport system, 100.0
COG1122235 CbiO ABC-type cobalt transport system, ATPase comp 100.0
PRK11153343 metN DL-methionine transporter ATP-binding subunit 100.0
cd03259213 ABC_Carb_Solutes_like ABC Carbohydrate and Solute 100.0
PRK13536340 nodulation factor exporter subunit NodI; Provision 100.0
COG3840231 ThiQ ABC-type thiamine transport system, ATPase co 100.0
TIGR01188302 drrA daunorubicin resistance ABC transporter ATP-b 100.0
PRK10851353 sulfate/thiosulfate transporter subunit; Provision 100.0
TIGR00960216 3a0501s02 Type II (General) Secretory Pathway (IIS 100.0
KOG0062582 consensus ATPase component of ABC transporters wit 100.0
cd03293220 ABC_NrtD_SsuB_transporters NrtD and SsuB are the A 100.0
cd03259213 ABC_Carb_Solutes_like ABC Carbohydrate and Solute 100.0
cd03269210 ABC_putative_ATPase This subfamily is involved in 100.0
TIGR01288303 nodI ATP-binding ABC transporter family nodulation 100.0
PRK13637287 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK09452375 potA putrescine/spermidine ABC transporter ATPase 100.0
cd03265220 ABC_DrrA DrrA is the ATP-binding protein component 100.0
cd03265220 ABC_DrrA DrrA is the ATP-binding protein component 100.0
cd03301213 ABC_MalK_N The N-terminal ATPase domain of the mal 100.0
TIGR01188302 drrA daunorubicin resistance ABC transporter ATP-b 100.0
COG1124252 DppF ABC-type dipeptide/oligopeptide/nickel transp 100.0
COG0411250 LivG ABC-type branched-chain amino acid transport 100.0
cd03219236 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC trans 100.0
cd03296239 ABC_CysA_sulfate_importer Part of the ABC transpor 100.0
COG1137243 YhbG ABC-type (unclassified) transport system, ATP 100.0
PRK11153343 metN DL-methionine transporter ATP-binding subunit 100.0
TIGR01288303 nodI ATP-binding ABC transporter family nodulation 100.0
cd03296239 ABC_CysA_sulfate_importer Part of the ABC transpor 100.0
PRK13634290 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
KOG0058716 consensus Peptide exporter, ABC superfamily [Intra 100.0
cd03218232 ABC_YhbG The ABC transporters belonging to the Yhb 100.0
cd03266218 ABC_NatA_sodium_exporter NatA is the ATPase compon 100.0
cd03219236 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC trans 100.0
PRK11607377 potG putrescine transporter ATP-binding subunit; P 100.0
PRK11000369 maltose/maltodextrin transporter ATP-binding prote 100.0
COG4559259 ABC-type hemin transport system, ATPase component 100.0
cd03258233 ABC_MetN_methionine_transporter MetN (also known a 100.0
COG4988559 CydD ABC-type transport system involved in cytochr 100.0
cd03301213 ABC_MalK_N The N-terminal ATPase domain of the mal 100.0
COG4987573 CydC ABC-type transport system involved in cytochr 100.0
PRK13643288 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
cd03234226 ABCG_White The White subfamily represents ABC tran 100.0
TIGR01186363 proV glycine betaine/L-proline transport ATP bindi 100.0
TIGR03522301 GldA_ABC_ATP gliding motility-associated ABC trans 100.0
PRK09536402 btuD corrinoid ABC transporter ATPase; Reviewed 100.0
TIGR03797686 NHPM_micro_ABC2 NHPM bacteriocin system ABC transp 100.0
cd03268208 ABC_BcrA_bacitracin_resist The BcrA subfamily repr 100.0
TIGR00960216 3a0501s02 Type II (General) Secretory Pathway (IIS 100.0
cd03260227 ABC_PstB_phosphate_transporter Phosphate uptake is 100.0
cd03293220 ABC_NrtD_SsuB_transporters NrtD and SsuB are the A 100.0
TIGR03522301 GldA_ABC_ATP gliding motility-associated ABC trans 100.0
cd03218232 ABC_YhbG The ABC transporters belonging to the Yhb 100.0
cd03258233 ABC_MetN_methionine_transporter MetN (also known a 100.0
COG1137243 YhbG ABC-type (unclassified) transport system, ATP 100.0
cd03256241 ABC_PhnC_transporter ABC-type phosphate/phosphonat 100.0
cd03255218 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of 100.0
PRK09493240 glnQ glutamine ABC transporter ATP-binding protein 100.0
PRK11629233 lolD lipoprotein transporter ATP-binding subunit; 100.0
PRK13650279 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK13637287 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
TIGR02673214 FtsE cell division ATP-binding protein FtsE. This 100.0
cd03226205 ABC_cobalt_CbiO_domain2 Domain II of the ABC compo 100.0
cd03263220 ABC_subfamily_A The ABCA subfamily mediates the tr 100.0
PRK11264250 putative amino-acid ABC transporter ATP-binding pr 100.0
PRK13647274 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
cd03263220 ABC_subfamily_A The ABCA subfamily mediates the tr 100.0
cd03224222 ABC_TM1139_LivF_branched LivF (TM1139) is part of 100.0
PRK11831269 putative ABC transporter ATP-binding protein YrbF; 100.0
cd03256241 ABC_PhnC_transporter ABC-type phosphate/phosphonat 100.0
PRK09536402 btuD corrinoid ABC transporter ATPase; Reviewed 100.0
cd03260227 ABC_PstB_phosphate_transporter Phosphate uptake is 100.0
cd03269210 ABC_putative_ATPase This subfamily is involved in 100.0
cd03292214 ABC_FtsE_transporter FtsE is a hydrophilic nucleot 100.0
cd03295242 ABC_OpuCA_Osmoprotection OpuCA is a the ATP bindin 100.0
cd03295242 ABC_OpuCA_Osmoprotection OpuCA is a the ATP bindin 100.0
PRK13631320 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
cd03294269 ABC_Pro_Gly_Bertaine This family comprises the gly 100.0
PRK13651305 cobalt transporter ATP-binding subunit; Provisiona 100.0
TIGR03375694 type_I_sec_LssB type I secretion system ATPase, Ls 100.0
cd03255218 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of 100.0
PRK13647274 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK11629233 lolD lipoprotein transporter ATP-binding subunit; 100.0
cd03224222 ABC_TM1139_LivF_branched LivF (TM1139) is part of 100.0
PRK15079331 oligopeptide ABC transporter ATP-binding protein O 100.0
TIGR03864236 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, 100.0
TIGR02315243 ABC_phnC phosphonate ABC transporter, ATP-binding 100.0
PRK11248255 tauB taurine transporter ATP-binding subunit; Prov 100.0
cd03294269 ABC_Pro_Gly_Bertaine This family comprises the gly 100.0
PRK10790592 putative multidrug transporter membrane\ATP-bindin 100.0
PRK13634290 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
TIGR03796710 NHPM_micro_ABC1 NHPM bacteriocin system ABC transp 100.0
PRK13646286 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK11831269 putative ABC transporter ATP-binding protein YrbF; 100.0
COG4618580 ArpD ABC-type protease/lipase transport system, AT 100.0
TIGR01193708 bacteriocin_ABC ABC-type bacteriocin transporter. 100.0
TIGR02315243 ABC_phnC phosphonate ABC transporter, ATP-binding 100.0
PTZ002651466 multidrug resistance protein (mdr1); Provisional 100.0
PRK11160574 cysteine/glutathione ABC transporter membrane/ATP- 100.0
cd03264211 ABC_drug_resistance_like ABC-type multidrug transp 100.0
cd03268208 ABC_BcrA_bacitracin_resist The BcrA subfamily repr 100.0
PRK13643288 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK09473330 oppD oligopeptide transporter ATP-binding componen 100.0
PRK13651305 cobalt transporter ATP-binding subunit; Provisiona 100.0
PRK11176582 lipid transporter ATP-binding/permease protein; Pr 100.0
cd03266218 ABC_NatA_sodium_exporter NatA is the ATPase compon 100.0
PRK13635279 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK10908222 cell division protein FtsE; Provisional 100.0
PRK09493240 glnQ glutamine ABC transporter ATP-binding protein 100.0
COG4559259 ABC-type hemin transport system, ATPase component 100.0
PRK13631320 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK10619257 histidine/lysine/arginine/ornithine transporter su 100.0
COG0410237 LivF ABC-type branched-chain amino acid transport 100.0
TIGR00958711 3a01208 Conjugate Transporter-2 (CT2) Family prote 100.0
COG0444316 DppD ABC-type dipeptide/oligopeptide/nickel transp 100.0
PRK10070400 glycine betaine transporter ATP-binding subunit; P 100.0
PRK13636283 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK10895241 lipopolysaccharide ABC transporter ATP-binding pro 100.0
PRK11264250 putative amino-acid ABC transporter ATP-binding pr 100.0
COG4175386 ProV ABC-type proline/glycine betaine transport sy 100.0
cd03257228 ABC_NikE_OppD_transporters The ABC transporter sub 100.0
cd03226205 ABC_cobalt_CbiO_domain2 Domain II of the ABC compo 100.0
cd03233202 ABC_PDR_domain1 The pleiotropic drug resistance (P 100.0
cd03262213 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP- 100.0
COG4152300 ABC-type uncharacterized transport system, ATPase 100.0
cd03235213 ABC_Metallic_Cations ABC component of the metal-ty 100.0
TIGR00972247 3a0107s01c2 phosphate ABC transporter, ATP-binding 100.0
cd03264211 ABC_drug_resistance_like ABC-type multidrug transp 100.0
TIGR03415382 ABC_choXWV_ATP choline ABC transporter, ATP-bindin 100.0
TIGR03864236 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, 100.0
PRK13646286 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK13636283 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
cd03234226 ABCG_White The White subfamily represents ABC tran 100.0
TIGR03740223 galliderm_ABC gallidermin-class lantibiotic protec 100.0
PRK11247257 ssuB aliphatic sulfonates transport ATP-binding su 100.0
PRK11248255 tauB taurine transporter ATP-binding subunit; Prov 100.0
cd03225211 ABC_cobalt_CbiO_domain1 Domain I of the ABC compon 100.0
COG0411250 LivG ABC-type branched-chain amino acid transport 100.0
PRK11247257 ssuB aliphatic sulfonates transport ATP-binding su 100.0
PRK11022326 dppD dipeptide transporter ATP-binding subunit; Pr 100.0
cd03257228 ABC_NikE_OppD_transporters The ABC transporter sub 100.0
TIGR02211221 LolD_lipo_ex lipoprotein releasing system, ATP-bin 100.0
PRK13650279 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK11614237 livF leucine/isoleucine/valine transporter ATP-bin 100.0
PRK15079331 oligopeptide ABC transporter ATP-binding protein O 100.0
PRK14247250 phosphate ABC transporter ATP-binding protein; Pro 100.0
TIGR03005252 ectoine_ehuA ectoine/hydroxyectoine ABC transporte 100.0
PRK11308327 dppF dipeptide transporter ATP-binding subunit; Pr 100.0
PRK13644274 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
TIGR02211221 LolD_lipo_ex lipoprotein releasing system, ATP-bin 100.0
PRK11300255 livG leucine/isoleucine/valine transporter ATP-bin 100.0
TIGR03410230 urea_trans_UrtE urea ABC transporter, ATP-binding 100.0
PRK13641287 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK10895241 lipopolysaccharide ABC transporter ATP-binding pro 100.0
PRK11124242 artP arginine transporter ATP-binding subunit; Pro 100.0
TIGR01978243 sufC FeS assembly ATPase SufC. SufC is part of the 100.0
cd03267236 ABC_NatA_like Similar in sequence to NatA, this is 100.0
PRK13652277 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK14267253 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK13632271 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK13641287 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
TIGR03005252 ectoine_ehuA ectoine/hydroxyectoine ABC transporte 100.0
PRK11614237 livF leucine/isoleucine/valine transporter ATP-bin 100.0
cd03292214 ABC_FtsE_transporter FtsE is a hydrophilic nucleot 100.0
PRK14273254 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK13633280 cobalt transporter ATP-binding subunit; Provisiona 100.0
TIGR02673214 FtsE cell division ATP-binding protein FtsE. This 100.0
KOG0057591 consensus Mitochondrial Fe/S cluster exporter, ABC 100.0
TIGR00972247 3a0107s01c2 phosphate ABC transporter, ATP-binding 100.0
PRK14268258 phosphate ABC transporter ATP-binding protein; Pro 100.0
TIGR03797686 NHPM_micro_ABC2 NHPM bacteriocin system ABC transp 100.0
PRK13548258 hmuV hemin importer ATP-binding subunit; Provision 100.0
PRK13548258 hmuV hemin importer ATP-binding subunit; Provision 100.0
PRK13652277 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
TIGR03411242 urea_trans_UrtD urea ABC transporter, ATP-binding 100.0
cd03298211 ABC_ThiQ_thiamine_transporter ABC-type thiamine tr 100.0
PRK13644274 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK13635279 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK14273254 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK13648269 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
COG4525259 TauB ABC-type taurine transport system, ATPase com 100.0
TIGR03411242 urea_trans_UrtD urea ABC transporter, ATP-binding 100.0
cd03233202 ABC_PDR_domain1 The pleiotropic drug resistance (P 100.0
PRK11231255 fecE iron-dicitrate transporter ATP-binding subuni 100.0
PRK11300255 livG leucine/isoleucine/valine transporter ATP-bin 100.0
PRK13649280 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK14241258 phosphate transporter ATP-binding protein; Provisi 100.0
PRK13638271 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK14245250 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK14250241 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK14268258 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK14242253 phosphate transporter ATP-binding protein; Provisi 100.0
PRK10619257 histidine/lysine/arginine/ornithine transporter su 100.0
PRK10253265 iron-enterobactin transporter ATP-binding protein; 100.0
TIGR02769265 nickel_nikE nickel import ATP-binding protein NikE 100.0
PRK10908222 cell division protein FtsE; Provisional 100.0
cd03232192 ABC_PDR_domain2 The pleiotropic drug resistance-li 100.0
PRK10744260 pstB phosphate transporter ATP-binding protein; Pr 100.0
PRK10575265 iron-hydroxamate transporter ATP-binding subunit; 100.0
TIGR01842544 type_I_sec_PrtD type I secretion system ABC transp 100.0
TIGR02769265 nickel_nikE nickel import ATP-binding protein NikE 100.0
PRK14257329 phosphate ABC transporter ATP-binding protein; Pro 100.0
cd03300232 ABC_PotA_N PotA is an ABC-type transporter and the 100.0
PRK13640282 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK10584228 putative ABC transporter ATP-binding protein YbbA; 100.0
PRK10584228 putative ABC transporter ATP-binding protein YbbA; 100.0
PRK15093330 antimicrobial peptide ABC transporter ATP-binding 100.0
COG4988559 CydD ABC-type transport system involved in cytochr 100.0
PRK13638271 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK10070400 glycine betaine transporter ATP-binding subunit; P 100.0
PRK13639275 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK13639275 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK13649280 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK11124242 artP arginine transporter ATP-binding subunit; Pro 100.0
COG5265497 ATM1 ABC-type transport system involved in Fe-S cl 100.0
cd03300232 ABC_PotA_N PotA is an ABC-type transporter and the 100.0
PRK14247250 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK09984262 phosphonate/organophosphate ester transporter subu 100.0
TIGR03873256 F420-0_ABC_ATP proposed F420-0 ABC transporter, AT 100.0
TIGR03410230 urea_trans_UrtE urea ABC transporter, ATP-binding 100.0
KOG0066807 consensus eIF2-interacting protein ABC50 (ABC supe 100.0
cd03298211 ABC_ThiQ_thiamine_transporter ABC-type thiamine tr 100.0
PRK14237267 phosphate transporter ATP-binding protein; Provisi 100.0
TIGR01184230 ntrCD nitrate transport ATP-binding subunits C and 100.0
PRK13645289 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK14235267 phosphate transporter ATP-binding protein; Provisi 100.0
TIGR03740223 galliderm_ABC gallidermin-class lantibiotic protec 100.0
PRK10253265 iron-enterobactin transporter ATP-binding protein; 100.0
PRK10575265 iron-hydroxamate transporter ATP-binding subunit; 100.0
PRK14256252 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK14267253 phosphate ABC transporter ATP-binding protein; Pro 100.0
TIGR01277213 thiQ thiamine ABC transporter, ATP-binding protein 100.0
PRK11308327 dppF dipeptide transporter ATP-binding subunit; Pr 100.0
PRK11022326 dppD dipeptide transporter ATP-binding subunit; Pr 100.0
PRK13632271 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
TIGR01978243 sufC FeS assembly ATPase SufC. SufC is part of the 100.0
PRK10771232 thiQ thiamine transporter ATP-binding subunit; Pro 100.0
TIGR03415382 ABC_choXWV_ATP choline ABC transporter, ATP-bindin 100.0
cd03225211 ABC_cobalt_CbiO_domain1 Domain I of the ABC compon 100.0
PRK14242253 phosphate transporter ATP-binding protein; Provisi 100.0
TIGR00968237 3a0106s01 sulfate ABC transporter, ATP-binding pro 100.0
cd03299235 ABC_ModC_like Archeal protein closely related to M 100.0
TIGR01846694 type_I_sec_HlyB type I secretion system ABC transp 100.0
TIGR00968237 3a0106s01 sulfate ABC transporter, ATP-binding pro 100.0
PRK09473330 oppD oligopeptide transporter ATP-binding componen 100.0
PRK14269246 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK13648269 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK11144352 modC molybdate transporter ATP-binding protein; Pr 100.0
PRK10789569 putative multidrug transporter membrane\ATP-bindin 100.0
TIGR01193708 bacteriocin_ABC ABC-type bacteriocin transporter. 100.0
PRK13633280 cobalt transporter ATP-binding subunit; Provisiona 100.0
PRK13549506 xylose transporter ATP-binding subunit; Provisiona 100.0
PRK11231255 fecE iron-dicitrate transporter ATP-binding subuni 100.0
PRK13547272 hmuV hemin importer ATP-binding subunit; Provision 100.0
PRK13645289 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK09984262 phosphonate/organophosphate ester transporter subu 100.0
TIGR03873256 F420-0_ABC_ATP proposed F420-0 ABC transporter, AT 100.0
COG4525259 TauB ABC-type taurine transport system, ATPase com 100.0
TIGR03796710 NHPM_micro_ABC1 NHPM bacteriocin system ABC transp 100.0
PRK14235267 phosphate transporter ATP-binding protein; Provisi 100.0
cd03267236 ABC_NatA_like Similar in sequence to NatA, this is 100.0
PRK10744260 pstB phosphate transporter ATP-binding protein; Pr 100.0
PRK14250241 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK13657588 cyclic beta-1,2-glucan ABC transporter; Provisiona 100.0
PRK14259269 phosphate ABC transporter ATP-binding protein; Pro 100.0
TIGR02770230 nickel_nikD nickel import ATP-binding protein NikD 100.0
PRK13640282 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
cd03262213 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP- 100.0
TIGR02203571 MsbA_lipidA lipid A export permease/ATP-binding pr 100.0
PRK10771232 thiQ thiamine transporter ATP-binding subunit; Pro 100.0
TIGR03608206 L_ocin_972_ABC putative bacteriocin export ABC tra 100.0
TIGR02142354 modC_ABC molybdenum ABC transporter, ATP-binding p 100.0
PRK13642277 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK15112267 antimicrobial peptide ABC system ATP-binding prote 100.0
TIGR01277213 thiQ thiamine ABC transporter, ATP-binding protein 100.0
PLN031301622 ABC transporter C family member; Provisional 100.0
cd03235213 ABC_Metallic_Cations ABC component of the metal-ty 100.0
PRK14237267 phosphate transporter ATP-binding protein; Provisi 100.0
TIGR01184230 ntrCD nitrate transport ATP-binding subunits C and 100.0
PRK14257329 phosphate ABC transporter ATP-binding protein; Pro 100.0
cd03299235 ABC_ModC_like Archeal protein closely related to M 100.0
cd03213194 ABCG_EPDR ABCG transporters are involved in eye pi 100.0
TIGR01192585 chvA glucan exporter ATP-binding protein. This mod 100.0
PRK14239252 phosphate transporter ATP-binding protein; Provisi 100.0
PRK15093330 antimicrobial peptide ABC transporter ATP-binding 100.0
PRK14270251 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK14244251 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK14245250 phosphate ABC transporter ATP-binding protein; Pro 100.0
COG0444316 DppD ABC-type dipeptide/oligopeptide/nickel transp 100.0
PRK14274259 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK14240250 phosphate transporter ATP-binding protein; Provisi 100.0
PRK14241258 phosphate transporter ATP-binding protein; Provisi 100.0
PRK11701258 phnK phosphonate C-P lyase system protein PhnK; Pr 100.0
PRK14262250 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK15112267 antimicrobial peptide ABC system ATP-binding prote 100.0
PRK14270251 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK14258261 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK00635 1809 excinuclease ABC subunit A; Provisional 100.0
cd03297214 ABC_ModC_molybdenum_transporter ModC is an ABC-typ 100.0
TIGR02142354 modC_ABC molybdenum ABC transporter, ATP-binding p 100.0
PRK00349943 uvrA excinuclease ABC subunit A; Reviewed 100.0
PRK14256252 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK14260259 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK11144352 modC molybdate transporter ATP-binding protein; Pr 100.0
PRK14253249 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK14269246 phosphate ABC transporter ATP-binding protein; Pro 100.0
PLN032321495 ABC transporter C family member; Provisional 100.0
PRK10418254 nikD nickel transporter ATP-binding protein NikD; 100.0
PRK14274259 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK11174588 cysteine/glutathione ABC transporter membrane/ATP- 100.0
PRK14236272 phosphate transporter ATP-binding protein; Provisi 100.0
PRK13642277 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK14272252 phosphate ABC transporter ATP-binding protein; Pro 100.0
TIGR02770230 nickel_nikD nickel import ATP-binding protein NikD 100.0
COG1245591 Predicted ATPase, RNase L inhibitor (RLI) homolog 100.0
PRK14262250 phosphate ABC transporter ATP-binding protein; Pro 100.0
COG4181228 Predicted ABC-type transport system involved in ly 100.0
PRK14259269 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK10418254 nikD nickel transporter ATP-binding protein NikD; 100.0
PRK14239252 phosphate transporter ATP-binding protein; Provisi 100.0
PRK10762501 D-ribose transporter ATP binding protein; Provisio 100.0
TIGR02982220 heterocyst_DevA ABC exporter ATP-binding subunit, 100.0
PRK11701258 phnK phosphonate C-P lyase system protein PhnK; Pr 100.0
TIGR01846694 type_I_sec_HlyB type I secretion system ABC transp 100.0
PRK14249251 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK14240250 phosphate transporter ATP-binding protein; Provisi 100.0
PRK14248268 phosphate ABC transporter ATP-binding protein; Pro 100.0
TIGR02204576 MsbA_rel ABC transporter, permease/ATP-binding pro 100.0
PRK14263261 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK14261253 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK09700510 D-allose transporter ATP-binding protein; Provisio 100.0
PRK13547272 hmuV hemin importer ATP-binding subunit; Provision 100.0
cd03252237 ABCC_Hemolysin The ABC-transporter hemolysin B is 100.0
PRK14275286 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK14248268 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK14271276 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK14271276 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK15056272 manganese/iron transporter ATP-binding protein; Pr 100.0
PRK13543214 cytochrome c biogenesis protein CcmA; Provisional 100.0
PRK14272252 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK14255252 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK14244251 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK14251251 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK14251251 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK13538204 cytochrome c biogenesis protein CcmA; Provisional 100.0
PRK14253249 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK14275286 phosphate ABC transporter ATP-binding protein; Pro 100.0
COG1132567 MdlB ABC-type multidrug transport system, ATPase a 100.0
PRK14236272 phosphate transporter ATP-binding protein; Provisi 100.0
cd03213194 ABCG_EPDR ABCG transporters are involved in eye pi 100.0
cd03231201 ABC_CcmA_heme_exporter CcmA, the ATP-binding compo 100.0
PRK14249251 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK14265274 phosphate ABC transporter ATP-binding protein; Pro 100.0
cd03289275 ABCC_CFTR2 The CFTR subfamily domain 2. The cystic 100.0
PRK10419268 nikE nickel transporter ATP-binding protein NikE; 100.0
PRK14261253 phosphate ABC transporter ATP-binding protein; Pro 100.0
cd03289275 ABCC_CFTR2 The CFTR subfamily domain 2. The cystic 100.0
TIGR02633500 xylG D-xylose ABC transporter, ATP-binding protein 100.0
TIGR009571522 MRP_assoc_pro multi drug resistance-associated pro 100.0
COG4181228 Predicted ABC-type transport system involved in ly 100.0
PRK14258261 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK14260259 phosphate ABC transporter ATP-binding protein; Pro 100.0
cd03220224 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transpo 100.0
PRK10790592 putative multidrug transporter membrane\ATP-bindin 100.0
PRK14254285 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK11176582 lipid transporter ATP-binding/permease protein; Pr 100.0
COG4987573 CydC ABC-type transport system involved in cytochr 100.0
TIGR02868529 CydC thiol reductant ABC exporter, CydC subunit. T 100.0
TIGR02323253 CP_lyasePhnK phosphonate C-P lyase system protein 100.0
cd03252237 ABCC_Hemolysin The ABC-transporter hemolysin B is 100.0
PRK10419268 nikE nickel transporter ATP-binding protein NikE; 100.0
PRK15439510 autoinducer 2 ABC transporter ATP-binding protein 100.0
COG1123539 ATPase components of various ABC-type transport sy 100.0
cd03297214 ABC_ModC_molybdenum_transporter ModC is an ABC-typ 100.0
PRK11288501 araG L-arabinose transporter ATP-binding protein; 100.0
PRK14238271 phosphate transporter ATP-binding protein; Provisi 100.0
CHL00131252 ycf16 sulfate ABC transporter protein; Validated 100.0
PRK14238271 phosphate transporter ATP-binding protein; Provisi 100.0
TIGR02982220 heterocyst_DevA ABC exporter ATP-binding subunit, 100.0
PRK14243264 phosphate transporter ATP-binding protein; Provisi 100.0
PRK10247225 putative ABC transporter ATP-binding protein YbbL; 100.0
TIGR00630924 uvra excinuclease ABC, A subunit. This family is b 100.0
PRK11160574 cysteine/glutathione ABC transporter membrane/ATP- 100.0
PRK14255252 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK14265274 phosphate ABC transporter ATP-binding protein; Pro 100.0
cd03251234 ABCC_MsbA MsbA is an essential ABC transporter, cl 100.0
COG4148352 ModC ABC-type molybdate transport system, ATPase c 100.0
TIGR02323253 CP_lyasePhnK phosphonate C-P lyase system protein 100.0
PRK10247225 putative ABC transporter ATP-binding protein YbbL; 100.0
COG4152300 ABC-type uncharacterized transport system, ATPase 100.0
PRK10261623 glutathione transporter ATP-binding protein; Provi 100.0
cd03230173 ABC_DR_subfamily_A This family of ATP-binding prot 100.0
>KOG0065 consensus Pleiotropic drug resistance proteins (PDR1-15), ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information 
Probab=100.00  E-value=1.4e-246  Score=2267.22  Aligned_cols=1271  Identities=53%  Similarity=0.924  Sum_probs=1190.4

Q ss_pred             cchhHhhhHHHHhhCCChhhhhhcccccC-CCCcccccccccchHhhHHHHHHhhhccccChHHHHHHHHHHHhhcCCCC
Q 000612           36 EDDEEALKWAALEKLPTYNRLRKGILTTS-RGEANEVDVYNLGLQERQRLIDKLVKVTDVDNERFLLKLKNRIDRVGIDL  114 (1391)
Q Consensus        36 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  114 (1391)
                      +||||+|||||+|||||++|   +++.+. ++   ++|+.+++..++..+.++..+..++|+++++.+++++++++  ++
T Consensus        12 ~~~e~~~~~a~~~~~pt~~~---~~~~~~~~~---~~d~~~~~~~~~~~~~~~~~~~~~~d~~~~l~~~r~~~~~~--~~   83 (1391)
T KOG0065|consen   12 DEDEEALRWAAIERLPTFDR---SLLRSIFES---EVDVTKLDPDDDPKFIEKSSKHWEQDNEKLLEKLRERIDRV--EL   83 (1391)
T ss_pred             chhHHHHHHHHHhcCccccc---hhhhhhccC---cccccCCCcccchhHHHHhHHHHhhhHHHHHHHHHhhcCcc--cC
Confidence            44999999999999999999   555432 22   79999999999999999999999999999999999999998  88


Q ss_pred             CcceEEEeeeEEEEEEecCCCcCCChhHHHHHHHHHHHhHhhhcCCccccceeeecceEEEeCCeEEEEEcCCCCcHHHH
Q 000612          115 PKVEVRYEHLNVEAEAFLASNALPSFIKFYTNIFEDILNYLRIIPSKKRHLTILKDVSGVIKPGRLTLLLGPPSSGKTTL  194 (1391)
Q Consensus       115 ~~~~v~~~~l~~~~~~~~~~~~~~t~~~~~~~~~~~~~~~~~~~~~~~~~~~iL~~vs~~i~~G~~~~llGp~GsGKSTL  194 (1391)
                      |.++++++++.+++++..|    ||+.|...+.++.++...+..  ++.+.+||+|+||.++||+|++++||||||||||
T Consensus        84 p~~~~~~~~~gv~a~~~~~----~t~~n~~~~~~~~~~~~~~~~--~~~~~~il~~~sg~~~pg~m~lvLG~pgsG~ttl  157 (1391)
T KOG0065|consen   84 PTIEVRFSALGVEADVTYG----PTLVNILSNPLESILRMLGKR--KKKKIQILKDISGIIKPGEMTLVLGPPGSGKTTL  157 (1391)
T ss_pred             CceEEEeeecccccccccc----hhhhhhhhhHHHHHhhhcccc--ccccceeecCcceeEcCCceEEEecCCCCchHHH
Confidence            9999999999999998765    999999999999887766644  5566889999999999999999999999999999


Q ss_pred             HHHHhcCCCCCCCceeEEEEcCccCCCcCccceEEEEcCCCCCCCCCCHHHHHHHhhhhcCCCchhhhhHHHHHHHHhcC
Q 000612          195 LLALAGKLDPTLKVSGTVTYNGHDMDEFVPQRTAAYISQHDNHIGEMTVRETLAFSARCQGVGTRYEMLTELARREKAAG  274 (1391)
Q Consensus       195 L~~L~G~~~~~~~~~G~V~~~G~~~~~~~~~~~~~yv~Q~d~~~~~lTVrE~l~f~~~~~~~~~~~~~~~~~~~~~~~~~  274 (1391)
                      |++|+|.++...+.+|+|+|||++.+++.+++.++|++|+|.|+|+|||||+|+|+++|++++.|++   +..|++++. 
T Consensus       158 lkal~g~~~~~~~~~~~isy~G~~~~e~~~~~~~aY~~e~DvH~p~lTVreTldFa~rck~~~~r~~---~~~R~e~~~-  233 (1391)
T KOG0065|consen  158 LKALAGKLDNFLKSSGEITYNGHDLKEFVPKKTVAYNSEQDVHFPELTVRETLDFAARCKGPGSRYD---EVSRREKLA-  233 (1391)
T ss_pred             HHHHhCCCcccccCCCceeECCCcccccccCceEEeccccccccceeEEeehhhHHHhccCCccccc---cccHHHHHH-
Confidence            9999999998877789999999999999999999999999999999999999999999999998876   445555431 


Q ss_pred             CCCCCChHHHHHHHhhhhhhHHHHHHHHHHHcCCcccccccccccccccCChhhhhHHHHHHHHhcCCccceeecCCCCC
Q 000612          275 IKPDPDIDVYMKAIATEGQEANVITDYYLKVLGLDVCADTMVGDEMIRGISGGQKKRVTTGEMMVGPALALFMDEISTGL  354 (1391)
Q Consensus       275 ~~p~~d~~~~~~~~~~~~~~~~~~~~~~l~~lgL~~~~dt~vg~~~~~~LSGGqrqRvsia~al~~~p~vllLDEPtsgL  354 (1391)
                                            .++|++++++||++|+||+|||+++||+||||||||+||+++++++++++|||+|+||
T Consensus       234 ----------------------~~~d~~lkilGL~~~~dT~VGnd~~RGvSGGerKRvsi~E~~v~~~~~~~~De~t~GL  291 (1391)
T KOG0065|consen  234 ----------------------AMTDYLLKILGLDHCADTLVGNDMVRGVSGGERKRVSIGEMLVGPASILFWDEITRGL  291 (1391)
T ss_pred             ----------------------HHHHHHHHHhCchhhccceecccccccccCcccceeeeeeeeecCcceeeeecccccc
Confidence                                  2689999999999999999999999999999999999999999999999999999999


Q ss_pred             CHHHHHHHHHHHHHHhHhcCCeEEEEEecCchhHHhhcCeEEEEcCCeEEEecChhHHHHHHHhcCCCCCCCCChHHHHH
Q 000612          355 DSSTTFQIVNCLRQNIHINSGTAVISLLQPAPETYDLFDDIILLSDGQIVYQGPRELVLEFFASMGFRCPKRKGVADFLQ  434 (1391)
Q Consensus       355 D~~t~~~i~~~L~~~~~~~~~t~ii~i~q~~~~~~~~~D~iilL~~G~iv~~G~~~~~~~~f~~~G~~cp~~~~~adfl~  434 (1391)
                      |++|+.+|+++||+++|..+.|.+++++||+++++++||+|++|++|++||+||++++++||+++||.||+++++|||++
T Consensus       292 DSsTal~iik~lr~~a~~~~~t~~vsi~Q~s~~~~~lFD~v~lL~eG~~iy~Gp~d~~~~yFe~~Gf~cP~r~~~ADfLt  371 (1391)
T KOG0065|consen  292 DSSTAFQIIKALRQLAHITGATALVSILQPSPEIYDLFDDVILLSEGYQIYQGPRDEVLPYFEDMGFKCPPRKGTADFLT  371 (1391)
T ss_pred             cHHHHHHHHHHHHHHHhhhcceEEEEeccCChHHHHhhhheeeeeccceEEeccHHHHHHHHHhcCccCCCccCHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HhcCchhhhhhhhhcCCCCccCCHHHHHHHHHhchhhhhHHHhhcCCCccccccccccccccccCcHHHHHHHHHHHHHH
Q 000612          435 EVTSRKDQRQYWAHKEKPYRFVTVQEFAEAFQSFHVGQKISDELRTPFDKSKSHRAALTTETYGVGKRELLKANISRELL  514 (1391)
Q Consensus       435 ~v~s~~~~~~~~~~~~~~~~~~~~~e~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~s~~~~~~~~~~R~~~  514 (1391)
                      ++++++++.++|..+..|+.+.+++|+++.|.+++.+.++..+++.++++.+.++.++..++|.++.|+|++.|+.|+++
T Consensus       372 ~vts~k~~~~~~~~~~~~~~~~~~~ef~~~~~~s~~~~~l~~~l~~~~~~~k~~~~al~s~~y~v~~~~qvk~c~~R~f~  451 (1391)
T KOG0065|consen  372 EVTSKKDQEQYWNKRSKPYPYTSVSEFAEYFLNSEDYAKLKKELSKPYDKSKKHKAALVSSKYSVPYWEQVKACTIREFL  451 (1391)
T ss_pred             HhhcCccccccccccCCCcccCCHHHHHHHHhcchhhHHHHHHhcchhhhhhccchhhcCCceeccHHHHHHHHHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHhcchHHHHHHHHHHHHHHHHHHHHhhcccCCCcccccccchhhHHHHHHHHHHHhHHHHHHHHhhhhhhHHHhhhcCC
Q 000612          515 LMKRNSFVYIFKLIQIAFVAVVYMTLFLRTKMHKDTVTDGGIFAGATFFAITMVNFNGFSEISMTIAKLPVFYKQRDFRF  594 (1391)
Q Consensus       515 ~~~R~~~~~~~~~~~~~~~~li~gt~f~~~~~~~~~~~~~~~~~g~lff~~~~~~~~~~~~l~~~~~~~~vf~k~r~~~~  594 (1391)
                      +++||.+++++++++.+++++++|++|+++.+  ++..+...+.|++||++++.+|+++++++++++++|||+|||+..|
T Consensus       452 l~k~n~~~~~~~~~~~~i~ali~gslF~~~~~--~t~~~~~~~~~~lffsll~~~f~~laEi~~~~~~~pv~~Khr~~~f  529 (1391)
T KOG0065|consen  452 LMKRNYFYYVFKTVQLVIQALITGSLFYRTPM--STTSGGYSRGGALFFALLFNLFNGLAEIALTFQRLPVFYKHRDLSF  529 (1391)
T ss_pred             HHhCCceEEEhHHHHHHHHHHHHhhheeeccC--cccccchhhhhHHHHHHHHHHHHhHHHHHHHHhhcchHHHhhcccc
Confidence            99999999999999999999999999999885  5566788899999999999999999999999999999999999999


Q ss_pred             CChhhHHHHHHHHHhhHHHHHHHHHHHHHHhhcCCCCcHHHHHHHHHHHHHHHHHHHHHHHHHHHhcccHHHHHHHHHHH
Q 000612          595 FPPWAYAIPSWILKIPVSFLEVAVWVFLSYYVVGYDSNAGRFFKQYALLLGVNQMASALFRFIAVTGRNMVVANTFGSFA  674 (1391)
Q Consensus       595 y~~~ay~la~~i~~iP~~~~~~~i~~~i~Y~~~g~~~~~~~f~~~~l~~~~~~~~~~~l~~~ia~~~~~~~ia~~~~~~~  674 (1391)
                      |+||++.++.+++++|..++++++|.+|+||++|+.+++++||++|+++++++++++++|++++++++++.+|+.+|++.
T Consensus       530 Y~p~A~al~s~l~~~P~~~i~~~vf~iI~Yfl~gl~~~A~rFF~~fL~lf~~~~~~s~lFr~ia~l~~t~~~An~~g~~~  609 (1391)
T KOG0065|consen  530 YPPWAEALASTLLKIPSSFIESVVFVIITYFLIGLKRNAGRFFIQFLFLFLCQFCMSGLFRFIASLSRTLSIANLIGGIL  609 (1391)
T ss_pred             cChHHHHHHHHHHhCcHHHHHHHHHHHHHHHHhcCCcchHHHHHHHHHHHHHHHHHHHHHHHHHHhcchHHHHhhHhHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHhhcccCccchhHHHHHHHHHcHHHHHHHHHHHHhhcCCccccc------------cCC---Ccchhhhhhhhc
Q 000612          675 LLVLLSLGGFILSREDIKKWWKWAYWCSPLTYAQNAIVANEFLGHSWKKF------------TQD---SSETLGVQVLKS  739 (1391)
Q Consensus       675 ~l~~~l~~Gf~i~~~~ip~~~~W~~~isP~~y~~~al~~nef~~~~~~~~------------~~~---~~~~~g~~~L~~  739 (1391)
                      ++++.+++||+|+..+||+||+|++|++|++|+++++++|||++.+|.|.            ...   ...+.|..+++.
T Consensus       610 ~L~i~m~~Gf~Ip~~~m~~W~~Wi~yinPl~Y~fesl~~NEF~~~~~~c~p~gp~y~n~~~~~~~c~~~~~~~G~~~v~g  689 (1391)
T KOG0065|consen  610 LLVLFMYGGFVIPKKDMPPWFRWIAYINPLMYAFESLMSNEFHGRRWPCSPSGPAYDNISIENKVCAATGATLGNDYVSG  689 (1391)
T ss_pred             HHHHHHHcceeeeccccchHHHHHHHHCHHHHHHHHHHHhhhhcccCCCCCCCCcccccccccccchhhccccCceEEec
Confidence            99999999999999999999999999999999999999999999999997            111   235678999998


Q ss_pred             cCcc-----cccchhHHHHHHHHHHHHHHHHHHHHHHHhcCCCCCCcceeeccccccccccccCCcccccccCCCCCCCC
Q 000612          740 RGFF-----AHEYWYWLGLGALFGFVLLLNFAYTLALTFLDPFEKPRAVITEEIESNEQDDRIGGNVQLSTLGGSSNHNT  814 (1391)
Q Consensus       740 ~~~~-----~~~~~~w~~~g~l~~~~~~~~~~~~l~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  814 (1391)
                      +++.     ...+|+|+++|+++||.++|++++.+++.|+++..+.++++..+...........                
T Consensus       690 ~~~l~~~~~y~~~~~Wr~~gillgf~v~f~~~~~ia~~yl~p~~~~~~~l~~~~~~~~~~~~~~----------------  753 (1391)
T KOG0065|consen  690 RDYLKVQYQYEYKWYWRNFGILLGFTVFFNFVFLIALEYLKPLKKSGAILVFKKGKEKKKVKSA----------------  753 (1391)
T ss_pred             ccccccccccccceeEeehhHHHHHHHHHHHHHHHHHHhcCccccccceeeeccchhhhcchhc----------------
Confidence            8887     7888999999999999999999999999999999888877654433222100000                


Q ss_pred             CCCCCCcccccccccchhhhhhhhcCCCcCCCcccCCCCceeEEeceeeEeecchhhhhcccccCceEEeeccEEEEeCC
Q 000612          815 RSGSTDDIRGQQSSSQSLSLAEAEASRPKKKGMVLPFEPHSLTFDEVVYSVDMPEEMKVQGVLEDKLVLLNGVSGAFRPG  894 (1391)
Q Consensus       815 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~~~~~~~~~~~~~~~~~~~~~iL~~vs~~i~~G  894 (1391)
                      ......            +. ..+....+++++..|+.+..++++||.|.+++|.+++.+|   +++++|+||||.++||
T Consensus       754 ~~~~~~------------~~-~~~s~~~~~~~~~~~~~~~~~~~~~V~~w~dl~~~~~~qG---~~~qLL~~V~G~~kPG  817 (1391)
T KOG0065|consen  754 GSSSEI------------EK-LDDSSHQEKNKMVLPFTPLSLTFKDVFYWVDLPYEMPIQG---GTRQLLNNVSGAFKPG  817 (1391)
T ss_pred             cccccc------------cc-cccccccccccccCCCccccccccceEEEEeCCccccccc---cceEhhhcCceEecCC
Confidence            000000            00 0001111345777889899999999999999998888776   6688999999999999


Q ss_pred             eEEEEEccCCCChHHHHHhHcCCCCCCeEEEEEEEcCccCCcccccceEEEeccCCCCCCCCcHHHHHHHHHHhcCCCCC
Q 000612          895 VLTALMGVSGAGKTTLMDVLAGRKTGGYITGNITISGYPKKQETFARISGYCEQNDIHSPFVTIYESLLFSAWLRLSPEV  974 (1391)
Q Consensus       895 e~~al~G~sGaGKSTLl~~L~g~~~~~~~~G~i~i~g~~~~~~~~~~~~gyv~Q~~~~~~~lTv~e~l~f~a~lr~~~~~  974 (1391)
                      .++||||+||||||||||+|+||+++|.++|+|.|||+|+++.+|+|.+|||+|+|+|.+.+||+|.|.|+|+||++.++
T Consensus       818 ~LTALMG~SGAGKTTLLdvLA~R~t~G~I~Gdi~i~G~p~~q~tF~R~~GYvqQ~DiH~~~~TVrESL~fSA~LRlp~~v  897 (1391)
T KOG0065|consen  818 VLTALMGESGAGKTTLLDVLAGRKTGGYIEGDILISGFPKDQETFARVSGYVEQQDIHSPELTVRESLRFSAALRLPKEV  897 (1391)
T ss_pred             ceeehhcCCCCchHHHHHHHhcCcccceEEeEEEECCeeCchhhhccccceeecccccCcccchHHHHHHHHHHcCCCcC
Confidence            99999999999999999999999999999999999999999899999999999999999999999999999999999999


Q ss_pred             CHHHHHHHHHHHHHHcCCcccccccccCCCCCCCCHHHHHHHHHHHHHhhCC-CEEEEeCCCCCCCHHHHHHHHHHHHHH
Q 000612          975 DSETRKMFIDEVMELVELNPLRQSLVGLPGVSGLSTEQRKRLTIAVELVANP-SIIFMDEPTSGLDARAAAIVMRTVRNT 1053 (1391)
Q Consensus       975 ~~~~~~~~v~~~l~~l~L~~~~~~~vg~~~~~~lSgGqrqRl~iA~~L~~~p-~illLDEPTsgLD~~s~~~i~~~l~~~ 1053 (1391)
                      +.+++.++|++|++.+||.+++|.+||.+| +|||++|||||+||+||++|| .||||||||||||++++..|++++|++
T Consensus       898 ~~~ek~~yVe~Vi~lleL~~~~daiVG~~G-~GLs~eQRKrLTIgVELvA~P~~ilFLDEPTSGLDsqaA~~i~~~lrkl  976 (1391)
T KOG0065|consen  898 SDEEKYEYVEEVIELLELKEYADALVGLPG-SGLSTEQRKRLTIGVELVANPSSILFLDEPTSGLDSQAAAIVMRFLRKL  976 (1391)
T ss_pred             CHHHHHHHHHHHHHHhCchhhhhhhccCCC-CCCCHHHhceeeEEEEEecCCceeEEecCCCCCccHHHHHHHHHHHHHH
Confidence            999999999999999999999999999998 999999999999999999999 999999999999999999999999999


Q ss_pred             HhCCCEEEEEecCCCHHHHHhcCeEEEEecCcEEEEecCCCCchhhHHHHHHhCCCcccCCCCCCCccceeeecchhhhh
Q 000612         1054 VDTGRTVVCTIHQPSIDIFEAFDELFLMKRGGQEIYVGPLGRHSCHLISYFEAIPGVQKIKDGYNPATWMLEVSAASQEL 1133 (1391)
Q Consensus      1054 ~~~g~tvi~~~Hqps~~i~~~~D~~~ll~~gG~~~y~G~~~~~~~~~~~yF~~~~g~~~~~~~~npa~~~l~v~~~~~~~ 1133 (1391)
                      +++|+|||||+||||.++|+.||++++|++||++||+||+|++|+++++|||+++|++ |++..||||||||+++.+.+.
T Consensus       977 a~tGqtIlCTIHQPS~~ife~FD~LLLLkrGGqtVY~G~lG~~s~~li~YFes~~~~~-~~~~~NPA~~mLevi~~~~~~ 1055 (1391)
T KOG0065|consen  977 ADTGQTILCTIHQPSIDIFEAFDELLLLKRGGQTVYFGPLGENSSKLIEYFESIGGVK-CISDENPAEWMLEVIGAGAEA 1055 (1391)
T ss_pred             HhcCCeEEEEecCCcHHHHHHHhHHHHHhcCCeEEEecCcccccHHHHHHHHhcCCcc-CCCCCChHHHHHhhccccccc
Confidence            9999999999999999999999999999999999999999999999999999999885 666669999999999998888


Q ss_pred             hhcccHHHHHhhcHHHHHHHHHHHhhCCCCCC-CCCCCCCCccCCcHHHHHHHHHHHHHHHHhcChHHHHHHHHHHHHHH
Q 000612         1134 ALGIDFTEHYKRSDLYRRNKALIEDLSRPPPG-SKDLYFPTQFSQSSWIQFVACLWKQHWSYWRNPPYTAVRFFFTAFIA 1212 (1391)
Q Consensus      1134 ~~~~~~~~~~~~s~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~Q~~~l~~R~~~~~~R~~~~~~~r~~~~~~~~ 1212 (1391)
                      ..+.||++.|++|+++++++++++++++++++ +.+..++++|++|+|.|++.|+||++++|||+|+|+.+|++++++.|
T Consensus      1056 ~~~~D~a~~w~~S~e~k~~~e~v~~l~~~~~~~~~~~~~~~~fa~s~~~Q~k~~l~Rq~~syWRsp~y~~ar~~~~i~~g 1135 (1391)
T KOG0065|consen 1056 SLSVDFAEIWKNSEEYKRNKELVKELSQPPPGFSTDLEFKTRFAQSLWYQFKLCLWRQFLSYWRSPDYLMARFALTIVAG 1135 (1391)
T ss_pred             ccCccHHHHHhccHHHHHHHHHHHHHhcCCccCCcccccccccchhHHHHHHHHHHHHHHHHhCCcHHHHHHHHHHHHHH
Confidence            88999999999999999999999999999988 78888999999999999999999999999999999999999999999


Q ss_pred             HHHhHhhcccCCCCCChhhHHHHHHHHHHHHHHHHHhhhhcccchhhhhhhHHHhhhcCCCCChHHHHHHHHHHHHHHHH
Q 000612         1213 LLFGSLFWDLGGRTKRNQDLFNAMGSMFTAVLFLGVQYCSSVQPIVSVERTVFYREKAAGMYAGIPWALAQVMIEIPYIL 1292 (1391)
Q Consensus      1213 l~~G~~f~~~~~~~~~~~~~~~~~g~~f~~~~~~~~~~~~~v~~~~~~er~v~~rE~~~~~Y~~~~y~~a~~l~eiP~~~ 1292 (1391)
                      |+||++||++|+   ++||++|.+|++|+++++.+.+++..++|.+..||.++|||+++||||+.||++||+++|+||++
T Consensus      1136 l~iGf~F~~~g~---~~q~lqn~m~a~yma~v~~~~~~~~~~~~~v~~e~~y~~RE~~s~mYs~~~~~~aq~~vEiP~~l 1212 (1391)
T KOG0065|consen 1136 LFIGFTFWKVGH---NVQGLQNAMGAAYMATVFSGPNNNQLQQPAVATERLYEYRERASNMYSWTPFALAQVLVEIPYNL 1212 (1391)
T ss_pred             HhheeeeeecCC---cHHHHHHHHHHHHHHHHHhhhhhhhhhhhHHhhhhhheeeecccCcccHHHHHHHHHHHHHHHHH
Confidence            999999999994   68999999999999999999999988999999999999999999999999999999999999999


Q ss_pred             HHHHHHhhhhhcccccccCHhHHHHHHHHHHHHHHHHHHHHHHHHHhcCCHHHHHHHHHHHHHHHHhhcccccCCCCCcc
Q 000612         1293 VQSVVYGAIVYAMIGFEWTAAKFFWYIFFMYFTLLFFTFYGMMAVALTPNHHIAAIVSTLFYGLWNVFSGFIIPRPVSLV 1372 (1391)
Q Consensus      1293 ~~~~~~~~i~Y~~~g~~~~~~~f~~~~~~~~~~~~~~~~~g~~~~~~~p~~~~A~~~~~~~~~~~~lf~Gf~i~~~~ip~ 1372 (1391)
                      +++.+|.+|+|+|+||++++.+|+||+++++++.+|++++|||+++++||.++|+++++++++++++||||++|++.||.
T Consensus      1213 ~~stl~~~~~Y~~iGF~~~a~~~~~f~~~~~~f~lYf~~~Gmm~~s~tPn~~~Aav~~s~~~s~~~~F~G~l~p~~~iP~ 1292 (1391)
T KOG0065|consen 1213 LQSTLFFLITYYPIGFYWTASKFFWFLLFMFIFFLYFTTLGMMLVSLTPNLQTAAVIASLFFSFWNLFSGFLQPRSLIPK 1292 (1391)
T ss_pred             HHHHHhheeeeeeccchhhHHHHHHHHHHHHHHHHHHHHHHHHHHHhCCChhHHHHHHHHHHHHHHHhcccccccccccc
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             chhhhhhhcccccCCCCCC
Q 000612         1373 FPFLFQMLDFFFRLNNFCY 1391 (1391)
Q Consensus      1373 ~~~w~~y~s~~~~~~~~~~ 1391 (1391)
                      ||+      ||||+||++|
T Consensus      1293 fW~------wmy~lsP~ty 1305 (1391)
T KOG0065|consen 1293 FWI------WMYYLSPVTY 1305 (1391)
T ss_pred             eee------eeeecCcHHH
Confidence            999      6888899887

>PLN03140 ABC transporter G family member; Provisional Back     alignment and domain information
>TIGR00956 3a01205 Pleiotropic Drug Resistance (PDR) Family protein Back     alignment and domain information
>KOG0061 consensus Transporter, ABC superfamily (Breast cancer resistance protein) [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PLN03211 ABC transporter G-25; Provisional Back     alignment and domain information
>TIGR00955 3a01204 The Eye Pigment Precursor Transporter (EPP) Family protein Back     alignment and domain information
>TIGR00956 3a01205 Pleiotropic Drug Resistance (PDR) Family protein Back     alignment and domain information
>PLN03140 ABC transporter G family member; Provisional Back     alignment and domain information
>KOG0061 consensus Transporter, ABC superfamily (Breast cancer resistance protein) [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PLN03211 ABC transporter G-25; Provisional Back     alignment and domain information
>TIGR00955 3a01204 The Eye Pigment Precursor Transporter (EPP) Family protein Back     alignment and domain information
>KOG0055 consensus Multidrug/pheromone exporter, ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>KOG0065 consensus Pleiotropic drug resistance proteins (PDR1-15), ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>KOG0054 consensus Multidrug resistance-associated protein/mitoxantrone resistance protein, ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>TIGR01257 rim_protein retinal-specific rim ABC transporter Back     alignment and domain information
>PLN03130 ABC transporter C family member; Provisional Back     alignment and domain information
>PLN03232 ABC transporter C family member; Provisional Back     alignment and domain information
>PTZ00265 multidrug resistance protein (mdr1); Provisional Back     alignment and domain information
>TIGR00957 MRP_assoc_pro multi drug resistance-associated protein (MRP) Back     alignment and domain information
>COG1123 ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] Back     alignment and domain information
>PRK13549 xylose transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR01271 CFTR_protein cystic fibrosis transmembrane conductor regulator (CFTR) Back     alignment and domain information
>PRK10762 D-ribose transporter ATP binding protein; Provisional Back     alignment and domain information
>PRK09700 D-allose transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10261 glutathione transporter ATP-binding protein; Provisional Back     alignment and domain information
>PTZ00243 ABC transporter; Provisional Back     alignment and domain information
>TIGR03269 met_CoM_red_A2 methyl coenzyme M reductase system, component A2 Back     alignment and domain information
>PRK15134 microcin C ABC transporter ATP-binding protein YejF; Provisional Back     alignment and domain information
>PRK15439 autoinducer 2 ABC transporter ATP-binding protein LsrA; Provisional Back     alignment and domain information
>TIGR02633 xylG D-xylose ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK11288 araG L-arabinose transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10982 galactose/methyl galaxtoside transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10938 putative molybdenum transport ATP-binding protein ModF; Provisional Back     alignment and domain information
>COG4172 ABC-type uncharacterized transport system, duplicated ATPase component [General function prediction only] Back     alignment and domain information
>PRK11819 putative ABC transporter ATP-binding protein; Reviewed Back     alignment and domain information
>PRK15064 ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR03719 ABC_ABC_ChvD ATP-binding cassette protein, ChvD family Back     alignment and domain information
>PRK10636 putative ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11147 ABC transporter ATPase component; Reviewed Back     alignment and domain information
>PRK13409 putative ATPase RIL; Provisional Back     alignment and domain information
>COG1129 MglA ABC-type sugar transport system, ATPase component [Carbohydrate transport and metabolism] Back     alignment and domain information
>PLN03073 ABC transporter F family; Provisional Back     alignment and domain information
>COG0488 Uup ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] Back     alignment and domain information
>COG3845 ABC-type uncharacterized transport systems, ATPase components [General function prediction only] Back     alignment and domain information
>COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>KOG0927 consensus Predicted transporter (ABC superfamily) [General function prediction only] Back     alignment and domain information
>COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>COG1125 OpuBA ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>COG1135 AbcC ABC-type metal ion transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG1131 CcmA ABC-type multidrug transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>COG3839 MalK ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG0058 consensus Peptide exporter, ABC superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG1135 AbcC ABC-type metal ion transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG1121 ZnuC ABC-type Mn/Zn transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG1120 FepC ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>COG3842 PotA ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>COG1127 Ttg2A ABC-type transport system involved in resistance to organic solvents, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>COG1120 FepC ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>COG1116 TauB ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG1127 Ttg2A ABC-type transport system involved in resistance to organic solvents, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>COG1118 CysA ABC-type sulfate/molybdate transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG1116 TauB ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG1131 CcmA ABC-type multidrug transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>COG3638 ABC-type phosphate/phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR01257 rim_protein retinal-specific rim ABC transporter Back     alignment and domain information
>COG1136 SalX ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>COG1125 OpuBA ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>COG1117 PstB ABC-type phosphate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG2274 SunT ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain [Defense mechanisms] Back     alignment and domain information
>COG1121 ZnuC ABC-type Mn/Zn transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG3638 ABC-type phosphate/phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG4555 NatA ABC-type Na+ transport system, ATPase component [Energy production and conversion / Inorganic ion transport and metabolism] Back     alignment and domain information
>COG1118 CysA ABC-type sulfate/molybdate transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG4555 NatA ABC-type Na+ transport system, ATPase component [Energy production and conversion / Inorganic ion transport and metabolism] Back     alignment and domain information
>COG2884 FtsE Predicted ATPase involved in cell division [Cell division and chromosome partitioning] Back     alignment and domain information
>COG1136 SalX ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>COG1117 PstB ABC-type phosphate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG0057 consensus Mitochondrial Fe/S cluster exporter, ABC superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>TIGR02314 ABC_MetN D-methionine ABC transporter, ATP-binding protein Back     alignment and domain information
>COG3839 MalK ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG0055 consensus Multidrug/pheromone exporter, ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK13537 nodulation ABC transporter NodI; Provisional Back     alignment and domain information
>TIGR03265 PhnT2 putative 2-aminoethylphosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK11432 fbpC ferric transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11650 ugpC glycerol-3-phosphate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR03258 PhnT 2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT Back     alignment and domain information
>KOG0056 consensus Heavy metal exporter HMT1, ABC superfamily [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG3842 PotA ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>PRK13537 nodulation ABC transporter NodI; Provisional Back     alignment and domain information
>COG1124 DppF ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK09452 potA putrescine/spermidine ABC transporter ATPase protein; Reviewed Back     alignment and domain information
>TIGR02314 ABC_MetN D-methionine ABC transporter, ATP-binding protein Back     alignment and domain information
>cd03261 ABC_Org_Solvent_Resistant ABC (ATP-binding cassette) transport system involved in resistant to organic solvents; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>COG1122 CbiO ABC-type cobalt transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK10851 sulfate/thiosulfate transporter subunit; Provisional Back     alignment and domain information
>TIGR01186 proV glycine betaine/L-proline transport ATP binding subunit Back     alignment and domain information
>COG1132 MdlB ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms] Back     alignment and domain information
>cd03261 ABC_Org_Solvent_Resistant ABC (ATP-binding cassette) transport system involved in resistant to organic solvents; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>TIGR03265 PhnT2 putative 2-aminoethylphosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK11650 ugpC glycerol-3-phosphate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG0410 LivF ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>PRK11607 potG putrescine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG2274 SunT ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain [Defense mechanisms] Back     alignment and domain information
>COG2884 FtsE Predicted ATPase involved in cell division [Cell division and chromosome partitioning] Back     alignment and domain information
>PRK11174 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed Back     alignment and domain information
>COG3840 ThiQ ABC-type thiamine transport system, ATPase component [Coenzyme metabolism] Back     alignment and domain information
>PRK11432 fbpC ferric transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11000 maltose/maltodextrin transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13536 nodulation factor exporter subunit NodI; Provisional Back     alignment and domain information
>TIGR03258 PhnT 2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT Back     alignment and domain information
>COG1122 CbiO ABC-type cobalt transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK11153 metN DL-methionine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03259 ABC_Carb_Solutes_like ABC Carbohydrate and Solute Transporters-like subgroup Back     alignment and domain information
>PRK13536 nodulation factor exporter subunit NodI; Provisional Back     alignment and domain information
>COG3840 ThiQ ABC-type thiamine transport system, ATPase component [Coenzyme metabolism] Back     alignment and domain information
>TIGR01188 drrA daunorubicin resistance ABC transporter ATP-binding subunit Back     alignment and domain information
>PRK10851 sulfate/thiosulfate transporter subunit; Provisional Back     alignment and domain information
>TIGR00960 3a0501s02 Type II (General) Secretory Pathway (IISP) Family protein Back     alignment and domain information
>KOG0062 consensus ATPase component of ABC transporters with duplicated ATPase domains/Translation elongation factor EF-3b [Amino acid transport and metabolism; Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd03293 ABC_NrtD_SsuB_transporters NrtD and SsuB are the ATP-binding subunits of the bacterial ABC-type nitrate and sulfonate transport systems, respectively Back     alignment and domain information
>cd03259 ABC_Carb_Solutes_like ABC Carbohydrate and Solute Transporters-like subgroup Back     alignment and domain information
>cd03269 ABC_putative_ATPase This subfamily is involved in drug resistance, nodulation, lipid transport, and bacteriocin and lantibiotic immunity Back     alignment and domain information
>TIGR01288 nodI ATP-binding ABC transporter family nodulation protein NodI Back     alignment and domain information
>PRK13637 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK09452 potA putrescine/spermidine ABC transporter ATPase protein; Reviewed Back     alignment and domain information
>cd03265 ABC_DrrA DrrA is the ATP-binding protein component of a bacterial exporter complex that confers resistance to the antibiotics daunorubicin and doxorubicin Back     alignment and domain information
>cd03265 ABC_DrrA DrrA is the ATP-binding protein component of a bacterial exporter complex that confers resistance to the antibiotics daunorubicin and doxorubicin Back     alignment and domain information
>cd03301 ABC_MalK_N The N-terminal ATPase domain of the maltose transporter, MalK Back     alignment and domain information
>TIGR01188 drrA daunorubicin resistance ABC transporter ATP-binding subunit Back     alignment and domain information
>COG1124 DppF ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>COG0411 LivG ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>cd03219 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC transporter subfamily is involved in the transport of the hydrophobic amino acids leucine, isoleucine and valine Back     alignment and domain information
>cd03296 ABC_CysA_sulfate_importer Part of the ABC transporter complex cysAWTP involved in sulfate import Back     alignment and domain information
>COG1137 YhbG ABC-type (unclassified) transport system, ATPase component [General function prediction only] Back     alignment and domain information
>PRK11153 metN DL-methionine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR01288 nodI ATP-binding ABC transporter family nodulation protein NodI Back     alignment and domain information
>cd03296 ABC_CysA_sulfate_importer Part of the ABC transporter complex cysAWTP involved in sulfate import Back     alignment and domain information
>PRK13634 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>KOG0058 consensus Peptide exporter, ABC superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd03218 ABC_YhbG The ABC transporters belonging to the YhbG family are similar to members of the Mj1267_LivG family, which is involved in the transport of branched-chain amino acids Back     alignment and domain information
>cd03266 ABC_NatA_sodium_exporter NatA is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled proton or K+ uptake Back     alignment and domain information
>cd03219 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC transporter subfamily is involved in the transport of the hydrophobic amino acids leucine, isoleucine and valine Back     alignment and domain information
>PRK11607 potG putrescine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11000 maltose/maltodextrin transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG4559 ABC-type hemin transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd03258 ABC_MetN_methionine_transporter MetN (also known as YusC) is an ABC-type transporter encoded by metN of the metNPQ operon in Bacillus subtilis that is involved in methionine transport Back     alignment and domain information
>COG4988 CydD ABC-type transport system involved in cytochrome bd biosynthesis, ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd03301 ABC_MalK_N The N-terminal ATPase domain of the maltose transporter, MalK Back     alignment and domain information
>COG4987 CydC ABC-type transport system involved in cytochrome bd biosynthesis, fused ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK13643 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03234 ABCG_White The White subfamily represents ABC transporters homologous to the Drosophila white gene, which acts as a dimeric importer for eye pigment precursors Back     alignment and domain information
>TIGR01186 proV glycine betaine/L-proline transport ATP binding subunit Back     alignment and domain information
>TIGR03522 GldA_ABC_ATP gliding motility-associated ABC transporter ATP-binding subunit GldA Back     alignment and domain information
>PRK09536 btuD corrinoid ABC transporter ATPase; Reviewed Back     alignment and domain information
>TIGR03797 NHPM_micro_ABC2 NHPM bacteriocin system ABC transporter, ATP-binding protein Back     alignment and domain information
>cd03268 ABC_BcrA_bacitracin_resist The BcrA subfamily represents ABC transporters involved in peptide antibiotic resistance Back     alignment and domain information
>TIGR00960 3a0501s02 Type II (General) Secretory Pathway (IISP) Family protein Back     alignment and domain information
>cd03260 ABC_PstB_phosphate_transporter Phosphate uptake is of fundamental importance in the cell physiology of bacteria because phosphate is required as a nutrient Back     alignment and domain information
>cd03293 ABC_NrtD_SsuB_transporters NrtD and SsuB are the ATP-binding subunits of the bacterial ABC-type nitrate and sulfonate transport systems, respectively Back     alignment and domain information
>TIGR03522 GldA_ABC_ATP gliding motility-associated ABC transporter ATP-binding subunit GldA Back     alignment and domain information
>cd03218 ABC_YhbG The ABC transporters belonging to the YhbG family are similar to members of the Mj1267_LivG family, which is involved in the transport of branched-chain amino acids Back     alignment and domain information
>cd03258 ABC_MetN_methionine_transporter MetN (also known as YusC) is an ABC-type transporter encoded by metN of the metNPQ operon in Bacillus subtilis that is involved in methionine transport Back     alignment and domain information
>COG1137 YhbG ABC-type (unclassified) transport system, ATPase component [General function prediction only] Back     alignment and domain information
>cd03256 ABC_PhnC_transporter ABC-type phosphate/phosphonate transport system Back     alignment and domain information
>cd03255 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of liporoteins from the cytoplasmic membrane (LolCDE) Back     alignment and domain information
>PRK09493 glnQ glutamine ABC transporter ATP-binding protein; Reviewed Back     alignment and domain information
>PRK11629 lolD lipoprotein transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13650 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13637 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR02673 FtsE cell division ATP-binding protein FtsE Back     alignment and domain information
>cd03226 ABC_cobalt_CbiO_domain2 Domain II of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota Back     alignment and domain information
>cd03263 ABC_subfamily_A The ABCA subfamily mediates the transport of a variety of lipid compounds Back     alignment and domain information
>PRK11264 putative amino-acid ABC transporter ATP-binding protein YecC; Provisional Back     alignment and domain information
>PRK13647 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03263 ABC_subfamily_A The ABCA subfamily mediates the transport of a variety of lipid compounds Back     alignment and domain information
>cd03224 ABC_TM1139_LivF_branched LivF (TM1139) is part of the LIV-I bacterial ABC-type two-component transport system that imports neutral, branched-chain amino acids Back     alignment and domain information
>PRK11831 putative ABC transporter ATP-binding protein YrbF; Provisional Back     alignment and domain information
>cd03256 ABC_PhnC_transporter ABC-type phosphate/phosphonate transport system Back     alignment and domain information
>PRK09536 btuD corrinoid ABC transporter ATPase; Reviewed Back     alignment and domain information
>cd03260 ABC_PstB_phosphate_transporter Phosphate uptake is of fundamental importance in the cell physiology of bacteria because phosphate is required as a nutrient Back     alignment and domain information
>cd03269 ABC_putative_ATPase This subfamily is involved in drug resistance, nodulation, lipid transport, and bacteriocin and lantibiotic immunity Back     alignment and domain information
>cd03292 ABC_FtsE_transporter FtsE is a hydrophilic nucleotide-binding protein that binds FtsX to form a heterodimeric ATP-binding cassette (ABC)-type transporter that associates with the bacterial inner membrane Back     alignment and domain information
>cd03295 ABC_OpuCA_Osmoprotection OpuCA is a the ATP binding component of a bacterial solute transporter that serves a protective role to cells growing in a hyperosmolar environment Back     alignment and domain information
>cd03295 ABC_OpuCA_Osmoprotection OpuCA is a the ATP binding component of a bacterial solute transporter that serves a protective role to cells growing in a hyperosmolar environment Back     alignment and domain information
>PRK13631 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03294 ABC_Pro_Gly_Bertaine This family comprises the glycine betaine/L-proline ATP binding subunit in bacteria and its equivalents in archaea Back     alignment and domain information
>PRK13651 cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR03375 type_I_sec_LssB type I secretion system ATPase, LssB family Back     alignment and domain information
>cd03255 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of liporoteins from the cytoplasmic membrane (LolCDE) Back     alignment and domain information
>PRK13647 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11629 lolD lipoprotein transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03224 ABC_TM1139_LivF_branched LivF (TM1139) is part of the LIV-I bacterial ABC-type two-component transport system that imports neutral, branched-chain amino acids Back     alignment and domain information
>PRK15079 oligopeptide ABC transporter ATP-binding protein OppF; Provisional Back     alignment and domain information
>TIGR03864 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system Back     alignment and domain information
>TIGR02315 ABC_phnC phosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK11248 tauB taurine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03294 ABC_Pro_Gly_Bertaine This family comprises the glycine betaine/L-proline ATP binding subunit in bacteria and its equivalents in archaea Back     alignment and domain information
>PRK10790 putative multidrug transporter membrane\ATP-binding components; Provisional Back     alignment and domain information
>PRK13634 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR03796 NHPM_micro_ABC1 NHPM bacteriocin system ABC transporter, peptidase/ATP-binding protein Back     alignment and domain information
>PRK13646 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11831 putative ABC transporter ATP-binding protein YrbF; Provisional Back     alignment and domain information
>COG4618 ArpD ABC-type protease/lipase transport system, ATPase and permease components [General function prediction only] Back     alignment and domain information
>TIGR01193 bacteriocin_ABC ABC-type bacteriocin transporter Back     alignment and domain information
>TIGR02315 ABC_phnC phosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>PTZ00265 multidrug resistance protein (mdr1); Provisional Back     alignment and domain information
>PRK11160 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed Back     alignment and domain information
>cd03264 ABC_drug_resistance_like ABC-type multidrug transport system, ATPase component Back     alignment and domain information
>cd03268 ABC_BcrA_bacitracin_resist The BcrA subfamily represents ABC transporters involved in peptide antibiotic resistance Back     alignment and domain information
>PRK13643 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK09473 oppD oligopeptide transporter ATP-binding component; Provisional Back     alignment and domain information
>PRK13651 cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11176 lipid transporter ATP-binding/permease protein; Provisional Back     alignment and domain information
>cd03266 ABC_NatA_sodium_exporter NatA is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled proton or K+ uptake Back     alignment and domain information
>PRK13635 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK10908 cell division protein FtsE; Provisional Back     alignment and domain information
>PRK09493 glnQ glutamine ABC transporter ATP-binding protein; Reviewed Back     alignment and domain information
>COG4559 ABC-type hemin transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK13631 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK10619 histidine/lysine/arginine/ornithine transporter subunit; Provisional Back     alignment and domain information
>COG0410 LivF ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR00958 3a01208 Conjugate Transporter-2 (CT2) Family protein Back     alignment and domain information
>COG0444 DppD ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK10070 glycine betaine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13636 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK10895 lipopolysaccharide ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11264 putative amino-acid ABC transporter ATP-binding protein YecC; Provisional Back     alignment and domain information
>COG4175 ProV ABC-type proline/glycine betaine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>cd03257 ABC_NikE_OppD_transporters The ABC transporter subfamily specific for the transport of dipeptides, oligopeptides (OppD), and nickel (NikDE) Back     alignment and domain information
>cd03226 ABC_cobalt_CbiO_domain2 Domain II of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota Back     alignment and domain information
>cd03233 ABC_PDR_domain1 The pleiotropic drug resistance (PDR) family of ATP-binding cassette (ABC) transporters Back     alignment and domain information
>cd03262 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP-binding components of the bacterial periplasmic histidine and glutamine permeases, repectively Back     alignment and domain information
>COG4152 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>cd03235 ABC_Metallic_Cations ABC component of the metal-type transporters Back     alignment and domain information
>TIGR00972 3a0107s01c2 phosphate ABC transporter, ATP-binding protein Back     alignment and domain information
>cd03264 ABC_drug_resistance_like ABC-type multidrug transport system, ATPase component Back     alignment and domain information
>TIGR03415 ABC_choXWV_ATP choline ABC transporter, ATP-binding protein Back     alignment and domain information
>TIGR03864 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system Back     alignment and domain information
>PRK13646 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13636 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03234 ABCG_White The White subfamily represents ABC transporters homologous to the Drosophila white gene, which acts as a dimeric importer for eye pigment precursors Back     alignment and domain information
>TIGR03740 galliderm_ABC gallidermin-class lantibiotic protection ABC transporter, ATP-binding subunit Back     alignment and domain information
>PRK11247 ssuB aliphatic sulfonates transport ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11248 tauB taurine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03225 ABC_cobalt_CbiO_domain1 Domain I of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota Back     alignment and domain information
>COG0411 LivG ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>PRK11247 ssuB aliphatic sulfonates transport ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11022 dppD dipeptide transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03257 ABC_NikE_OppD_transporters The ABC transporter subfamily specific for the transport of dipeptides, oligopeptides (OppD), and nickel (NikDE) Back     alignment and domain information
>TIGR02211 LolD_lipo_ex lipoprotein releasing system, ATP-binding protein Back     alignment and domain information
>PRK13650 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11614 livF leucine/isoleucine/valine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK15079 oligopeptide ABC transporter ATP-binding protein OppF; Provisional Back     alignment and domain information
>PRK14247 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR03005 ectoine_ehuA ectoine/hydroxyectoine ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK11308 dppF dipeptide transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13644 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR02211 LolD_lipo_ex lipoprotein releasing system, ATP-binding protein Back     alignment and domain information
>PRK11300 livG leucine/isoleucine/valine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR03410 urea_trans_UrtE urea ABC transporter, ATP-binding protein UrtE Back     alignment and domain information
>PRK13641 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK10895 lipopolysaccharide ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11124 artP arginine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR01978 sufC FeS assembly ATPase SufC Back     alignment and domain information
>cd03267 ABC_NatA_like Similar in sequence to NatA, this is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled to proton or K+ uptake Back     alignment and domain information
>PRK13652 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14267 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13632 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13641 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR03005 ectoine_ehuA ectoine/hydroxyectoine ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK11614 livF leucine/isoleucine/valine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03292 ABC_FtsE_transporter FtsE is a hydrophilic nucleotide-binding protein that binds FtsX to form a heterodimeric ATP-binding cassette (ABC)-type transporter that associates with the bacterial inner membrane Back     alignment and domain information
>PRK14273 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13633 cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR02673 FtsE cell division ATP-binding protein FtsE Back     alignment and domain information
>KOG0057 consensus Mitochondrial Fe/S cluster exporter, ABC superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>TIGR00972 3a0107s01c2 phosphate ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK14268 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR03797 NHPM_micro_ABC2 NHPM bacteriocin system ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK13548 hmuV hemin importer ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13548 hmuV hemin importer ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13652 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR03411 urea_trans_UrtD urea ABC transporter, ATP-binding protein UrtD Back     alignment and domain information
>cd03298 ABC_ThiQ_thiamine_transporter ABC-type thiamine tranport system; part of the binding-protein-dependent transport system tbpA-thiPQ for thiamine and TPP Back     alignment and domain information
>PRK13644 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13635 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14273 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13648 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG4525 TauB ABC-type taurine transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR03411 urea_trans_UrtD urea ABC transporter, ATP-binding protein UrtD Back     alignment and domain information
>cd03233 ABC_PDR_domain1 The pleiotropic drug resistance (PDR) family of ATP-binding cassette (ABC) transporters Back     alignment and domain information
>PRK11231 fecE iron-dicitrate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11300 livG leucine/isoleucine/valine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13649 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14241 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13638 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14245 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14250 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14268 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14242 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10619 histidine/lysine/arginine/ornithine transporter subunit; Provisional Back     alignment and domain information
>PRK10253 iron-enterobactin transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR02769 nickel_nikE nickel import ATP-binding protein NikE Back     alignment and domain information
>PRK10908 cell division protein FtsE; Provisional Back     alignment and domain information
>cd03232 ABC_PDR_domain2 The pleiotropic drug resistance-like (PDR) family of ATP-binding cassette (ABC) transporters Back     alignment and domain information
>PRK10744 pstB phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10575 iron-hydroxamate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR01842 type_I_sec_PrtD type I secretion system ABC transporter, PrtD family Back     alignment and domain information
>TIGR02769 nickel_nikE nickel import ATP-binding protein NikE Back     alignment and domain information
>PRK14257 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03300 ABC_PotA_N PotA is an ABC-type transporter and the ATPase component of the spermidine/putrescine-preferential uptake system consisting of PotA, -B, -C, and -D Back     alignment and domain information
>PRK13640 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK10584 putative ABC transporter ATP-binding protein YbbA; Provisional Back     alignment and domain information
>PRK10584 putative ABC transporter ATP-binding protein YbbA; Provisional Back     alignment and domain information
>PRK15093 antimicrobial peptide ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG4988 CydD ABC-type transport system involved in cytochrome bd biosynthesis, ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK13638 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK10070 glycine betaine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13639 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13639 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13649 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11124 artP arginine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG5265 ATM1 ABC-type transport system involved in Fe-S cluster assembly, permease and ATPase components [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd03300 ABC_PotA_N PotA is an ABC-type transporter and the ATPase component of the spermidine/putrescine-preferential uptake system consisting of PotA, -B, -C, and -D Back     alignment and domain information
>PRK14247 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK09984 phosphonate/organophosphate ester transporter subunit; Provisional Back     alignment and domain information
>TIGR03873 F420-0_ABC_ATP proposed F420-0 ABC transporter, ATP-binding protein Back     alignment and domain information
>TIGR03410 urea_trans_UrtE urea ABC transporter, ATP-binding protein UrtE Back     alignment and domain information
>KOG0066 consensus eIF2-interacting protein ABC50 (ABC superfamily) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd03298 ABC_ThiQ_thiamine_transporter ABC-type thiamine tranport system; part of the binding-protein-dependent transport system tbpA-thiPQ for thiamine and TPP Back     alignment and domain information
>PRK14237 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR01184 ntrCD nitrate transport ATP-binding subunits C and D Back     alignment and domain information
>PRK13645 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14235 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR03740 galliderm_ABC gallidermin-class lantibiotic protection ABC transporter, ATP-binding subunit Back     alignment and domain information
>PRK10253 iron-enterobactin transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10575 iron-hydroxamate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14256 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14267 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR01277 thiQ thiamine ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK11308 dppF dipeptide transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11022 dppD dipeptide transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13632 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR01978 sufC FeS assembly ATPase SufC Back     alignment and domain information
>PRK10771 thiQ thiamine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR03415 ABC_choXWV_ATP choline ABC transporter, ATP-binding protein Back     alignment and domain information
>cd03225 ABC_cobalt_CbiO_domain1 Domain I of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota Back     alignment and domain information
>PRK14242 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR00968 3a0106s01 sulfate ABC transporter, ATP-binding protein Back     alignment and domain information
>cd03299 ABC_ModC_like Archeal protein closely related to ModC Back     alignment and domain information
>TIGR01846 type_I_sec_HlyB type I secretion system ABC transporter, HlyB family Back     alignment and domain information
>TIGR00968 3a0106s01 sulfate ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK09473 oppD oligopeptide transporter ATP-binding component; Provisional Back     alignment and domain information
>PRK14269 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13648 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11144 modC molybdate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10789 putative multidrug transporter membrane\ATP-binding components; Provisional Back     alignment and domain information
>TIGR01193 bacteriocin_ABC ABC-type bacteriocin transporter Back     alignment and domain information
>PRK13633 cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13549 xylose transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11231 fecE iron-dicitrate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13547 hmuV hemin importer ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13645 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK09984 phosphonate/organophosphate ester transporter subunit; Provisional Back     alignment and domain information
>TIGR03873 F420-0_ABC_ATP proposed F420-0 ABC transporter, ATP-binding protein Back     alignment and domain information
>COG4525 TauB ABC-type taurine transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR03796 NHPM_micro_ABC1 NHPM bacteriocin system ABC transporter, peptidase/ATP-binding protein Back     alignment and domain information
>PRK14235 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03267 ABC_NatA_like Similar in sequence to NatA, this is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled to proton or K+ uptake Back     alignment and domain information
>PRK10744 pstB phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14250 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13657 cyclic beta-1,2-glucan ABC transporter; Provisional Back     alignment and domain information
>PRK14259 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR02770 nickel_nikD nickel import ATP-binding protein NikD Back     alignment and domain information
>PRK13640 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03262 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP-binding components of the bacterial periplasmic histidine and glutamine permeases, repectively Back     alignment and domain information
>TIGR02203 MsbA_lipidA lipid A export permease/ATP-binding protein MsbA Back     alignment and domain information
>PRK10771 thiQ thiamine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR03608 L_ocin_972_ABC putative bacteriocin export ABC transporter, lactococcin 972 group Back     alignment and domain information
>TIGR02142 modC_ABC molybdenum ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK13642 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK15112 antimicrobial peptide ABC system ATP-binding protein SapF; Provisional Back     alignment and domain information
>TIGR01277 thiQ thiamine ABC transporter, ATP-binding protein Back     alignment and domain information
>PLN03130 ABC transporter C family member; Provisional Back     alignment and domain information
>cd03235 ABC_Metallic_Cations ABC component of the metal-type transporters Back     alignment and domain information
>PRK14237 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR01184 ntrCD nitrate transport ATP-binding subunits C and D Back     alignment and domain information
>PRK14257 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03299 ABC_ModC_like Archeal protein closely related to ModC Back     alignment and domain information
>cd03213 ABCG_EPDR ABCG transporters are involved in eye pigment (EP) precursor transport, regulation of lipid-trafficking mechanisms, and pleiotropic drug resistance (DR) Back     alignment and domain information
>TIGR01192 chvA glucan exporter ATP-binding protein Back     alignment and domain information
>PRK14239 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK15093 antimicrobial peptide ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14270 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14244 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14245 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG0444 DppD ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK14274 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14240 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14241 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11701 phnK phosphonate C-P lyase system protein PhnK; Provisional Back     alignment and domain information
>PRK14262 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK15112 antimicrobial peptide ABC system ATP-binding protein SapF; Provisional Back     alignment and domain information
>PRK14270 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14258 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK00635 excinuclease ABC subunit A; Provisional Back     alignment and domain information
>cd03297 ABC_ModC_molybdenum_transporter ModC is an ABC-type transporter and the ATPase component of a molybdate transport system that also includes the periplasmic binding protein ModA and the membrane protein ModB Back     alignment and domain information
>TIGR02142 modC_ABC molybdenum ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK00349 uvrA excinuclease ABC subunit A; Reviewed Back     alignment and domain information
>PRK14256 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14260 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11144 modC molybdate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14253 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14269 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PLN03232 ABC transporter C family member; Provisional Back     alignment and domain information
>PRK10418 nikD nickel transporter ATP-binding protein NikD; Provisional Back     alignment and domain information
>PRK14274 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11174 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed Back     alignment and domain information
>PRK14236 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13642 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14272 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR02770 nickel_nikD nickel import ATP-binding protein NikD Back     alignment and domain information
>COG1245 Predicted ATPase, RNase L inhibitor (RLI) homolog [General function prediction only] Back     alignment and domain information
>PRK14262 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG4181 Predicted ABC-type transport system involved in lysophospholipase L1 biosynthesis, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PRK14259 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10418 nikD nickel transporter ATP-binding protein NikD; Provisional Back     alignment and domain information
>PRK14239 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10762 D-ribose transporter ATP binding protein; Provisional Back     alignment and domain information
>TIGR02982 heterocyst_DevA ABC exporter ATP-binding subunit, DevA family Back     alignment and domain information
>PRK11701 phnK phosphonate C-P lyase system protein PhnK; Provisional Back     alignment and domain information
>TIGR01846 type_I_sec_HlyB type I secretion system ABC transporter, HlyB family Back     alignment and domain information
>PRK14249 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14240 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14248 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR02204 MsbA_rel ABC transporter, permease/ATP-binding protein Back     alignment and domain information
>PRK14263 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14261 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK09700 D-allose transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13547 hmuV hemin importer ATP-binding subunit; Provisional Back     alignment and domain information
>cd03252 ABCC_Hemolysin The ABC-transporter hemolysin B is a central component of the secretion machinery that translocates the toxin, hemolysin A, in a Sec-independent fashion across both membranes of E Back     alignment and domain information
>PRK14275 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14248 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14271 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14271 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK15056 manganese/iron transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13543 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>PRK14272 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14255 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14244 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14251 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14251 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13538 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>PRK14253 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14275 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG1132 MdlB ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms] Back     alignment and domain information
>PRK14236 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03213 ABCG_EPDR ABCG transporters are involved in eye pigment (EP) precursor transport, regulation of lipid-trafficking mechanisms, and pleiotropic drug resistance (DR) Back     alignment and domain information
>cd03231 ABC_CcmA_heme_exporter CcmA, the ATP-binding component of the bacterial CcmAB transporter Back     alignment and domain information
>PRK14249 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14265 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03289 ABCC_CFTR2 The CFTR subfamily domain 2 Back     alignment and domain information
>PRK10419 nikE nickel transporter ATP-binding protein NikE; Provisional Back     alignment and domain information
>PRK14261 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03289 ABCC_CFTR2 The CFTR subfamily domain 2 Back     alignment and domain information
>TIGR02633 xylG D-xylose ABC transporter, ATP-binding protein Back     alignment and domain information
>TIGR00957 MRP_assoc_pro multi drug resistance-associated protein (MRP) Back     alignment and domain information
>COG4181 Predicted ABC-type transport system involved in lysophospholipase L1 biosynthesis, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PRK14258 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14260 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03220 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transporter subfamily is involved in extracellular polysaccharide export Back     alignment and domain information
>PRK10790 putative multidrug transporter membrane\ATP-binding components; Provisional Back     alignment and domain information
>PRK14254 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11176 lipid transporter ATP-binding/permease protein; Provisional Back     alignment and domain information
>COG4987 CydC ABC-type transport system involved in cytochrome bd biosynthesis, fused ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02868 CydC thiol reductant ABC exporter, CydC subunit Back     alignment and domain information
>TIGR02323 CP_lyasePhnK phosphonate C-P lyase system protein PhnK Back     alignment and domain information
>cd03252 ABCC_Hemolysin The ABC-transporter hemolysin B is a central component of the secretion machinery that translocates the toxin, hemolysin A, in a Sec-independent fashion across both membranes of E Back     alignment and domain information
>PRK10419 nikE nickel transporter ATP-binding protein NikE; Provisional Back     alignment and domain information
>PRK15439 autoinducer 2 ABC transporter ATP-binding protein LsrA; Provisional Back     alignment and domain information
>COG1123 ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] Back     alignment and domain information
>cd03297 ABC_ModC_molybdenum_transporter ModC is an ABC-type transporter and the ATPase component of a molybdate transport system that also includes the periplasmic binding protein ModA and the membrane protein ModB Back     alignment and domain information
>PRK11288 araG L-arabinose transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14238 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>CHL00131 ycf16 sulfate ABC transporter protein; Validated Back     alignment and domain information
>PRK14238 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR02982 heterocyst_DevA ABC exporter ATP-binding subunit, DevA family Back     alignment and domain information
>PRK14243 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10247 putative ABC transporter ATP-binding protein YbbL; Provisional Back     alignment and domain information
>TIGR00630 uvra excinuclease ABC, A subunit Back     alignment and domain information
>PRK11160 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed Back     alignment and domain information
>PRK14255 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14265 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03251 ABCC_MsbA MsbA is an essential ABC transporter, closely related to eukaryotic MDR proteins Back     alignment and domain information
>COG4148 ModC ABC-type molybdate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR02323 CP_lyasePhnK phosphonate C-P lyase system protein PhnK Back     alignment and domain information
>PRK10247 putative ABC transporter ATP-binding protein YbbL; Provisional Back     alignment and domain information
>COG4152 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>PRK10261 glutathione transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03230 ABC_DR_subfamily_A This family of ATP-binding proteins belongs to a multisubunit transporter involved in drug resistance (BcrA and DrrA), nodulation, lipid transport, and lantibiotic immunity Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1391
1oxx_K353 Crystal Structure Of Glcv, The Abc-Atpase Of The Gl 1e-10
1oxs_C353 Crystal Structure Of Glcv, The Abc-Atpase Of The Gl 1e-10
2pmk_A243 Crystal Structures Of An Isolated Abc-Atpase In Com 3e-10
2it1_A362 Structure Of Ph0203 Protein From Pyrococcus Horikos 3e-10
1mt0_A241 Atp-Binding Domain Of Haemolysin B From Escherichia 3e-10
2ff7_A247 The Abc-Atpase Of The Abc-Transporter Hlyb In The A 3e-10
4hlu_D268 Structure Of The Ecfa-a' Heterodimer Bound To Adp L 4e-10
3b5j_A243 Crystal Structures Of The S504a Mutant Of An Isolat 7e-10
3gfo_A275 Structure Of Cbio1 From Clostridium Perfringens: Pa 7e-10
2ffb_A247 The Crystal Structure Of The Hlyb-Nbd E631q Mutant 8e-10
1v43_A372 Crystal Structure Of Atpase Subunit Of Abc Sugar Tr 9e-10
1vci_A373 Crystal Structure Of The Atp-binding Cassette Of Mu 9e-10
2yyz_A359 Crystal Structure Of Sugar Abc Transporter, Atp-Bin 2e-09
1xef_A241 Crystal Structure Of The AtpMG2+ BOUND COMPOSITE DI 5e-09
2ffa_A247 Crystal Structure Of Abc-Atpase H662a Of The Abc-Tr 5e-09
1l2t_A235 Dimeric Structure Of Mj0796, A Bacterial Abc Transp 1e-08
1z47_A355 Structure Of The Atpase Subunit Cysa Of The Putativ 1e-08
3tif_A235 Dimeric Structure Of A Post-Hydrolysis State Of The 3e-08
3g60_A 1284 Structure Of P-Glycoprotein Reveals A Molecular Bas 4e-08
3g5u_A 1284 Structure Of P-Glycoprotein Reveals A Molecular Bas 4e-08
1mv5_A243 Crystal Structure Of Lmra Atp-Binding Domain Length 5e-08
3c41_J242 Abc Protein Artp In Complex With Amp-PnpMG2+ Length 1e-07
4ayt_A595 Structure Of The Human Mitochondrial Abc Transporte 1e-07
4f4c_A 1321 The Crystal Structure Of The Multi-Drug Transporter 2e-07
2olj_A263 Abc Protein Artp In Complex With AdpMG2+ Length = 2 2e-07
4ayw_A619 Structure Of The Human Mitochondrial Abc Transporte 2e-07
1q12_A381 Crystal Structure Of The Atp-bound E. Coli Malk Len 3e-07
1q1b_A381 Crystal Structure Of E. Coli Malk In The Nucleotide 3e-07
2r6g_A381 The Crystal Structure Of The E. Coli Maltose Transp 6e-07
2d3w_A248 Crystal Structure Of Escherichia Coli Sufc, An Atpa 7e-07
1g29_1372 Malk Length = 372 8e-07
2zu0_C267 Crystal Structure Of Sufc-Sufd Complex Involved In 9e-07
2ixf_A271 Crystal Structure Of The Atpase Domain Of Tap1 With 1e-06
2d62_A375 Crystal Structure Of Multiple Sugar Binding Transpo 2e-06
1f3o_A235 Crystal Structure Of Mj0796 Atp-Binding Cassette Le 2e-06
2nq2_C253 An Inward-Facing Conformation Of A Putative Metal-C 3e-06
2d2e_A250 Crystal Structure Of Atypical Cytoplasmic Abc-Atpas 4e-06
4dbl_C249 Crystal Structure Of E159q Mutant Of Btucdf Length 5e-06
2hyd_A578 Multidrug Abc Transporter Sav1866 Length = 578 5e-06
4fi3_C249 Structure Of Vitamin B12 Transporter Btucd-F In A N 6e-06
3b5x_A582 Crystal Structure Of Msba From Vibrio Cholerae Leng 7e-06
1vpl_A256 Crystal Structure Of Abc Transporter Atp-binding Pr 8e-06
1l7v_C249 Bacterial Abc Transporter Involved In B12 Uptake Le 9e-06
3qf4_A587 Crystal Structure Of A Heterodimeric Abc Transporte 1e-05
2ghi_A260 Crystal Structure Of Plasmodium Yoelii Multidrug Re 1e-05
2qi9_C249 Abc-Transporter Btucd In Complex With Its Periplasm 1e-05
1g9x_A257 Characterization Of The Twinning Structure Of Mj126 1e-05
1yqt_A538 Rnase-L Inhibitor Length = 538 1e-05
1gaj_A257 Crystal Structure Of A Nucleotide-Free Atp-Binding 1e-05
2pcj_A224 Crystal Structure Of Abc Transporter (Aq_297) From 1e-05
1g6h_A257 Crystal Structure Of The Adp Conformation Of Mj1267 2e-05
2ixe_A271 Crystal Structure Of The Atpase Domain Of Tap1 With 3e-05
1jj7_A260 Crystal Structure Of The C-Terminal Atpase Domain O 3e-05
1b0u_A262 Atp-Binding Subunit Of The Histidine Permease From 3e-05
2ixg_A271 Crystal Structure Of The Atpase Domain Of Tap1 With 4e-05
3ozx_A538 Crystal Structure Of Abce1 Of Sulfolubus Solfataric 4e-05
3ozx_A538 Crystal Structure Of Abce1 Of Sulfolubus Solfataric 7e-04
1ji0_A240 Crystal Structure Analysis Of The Abc Transporter F 7e-05
3d31_A348 Modbc From Methanosarcina Acetivorans Length = 348 8e-05
2yz2_A266 Crystal Structure Of The Abc Transporter In The Cob 8e-05
4hlu_A268 Structure Of The Ecfa-a' Heterodimer Bound To Adp L 9e-05
3dhw_C343 Crystal Structure Of Methionine Importer Metni Leng 2e-04
3b5y_A582 Crystal Structure Of Msba From Salmonella Typhimuri 2e-04
3b5w_A582 Crystal Structure Of Eschericia Coli Msba Length = 2e-04
3tuj_C366 Inward Facing Conformations Of The Metni Methionine 2e-04
2ihy_A279 Structure Of The Staphylococcus Aureus Putative Atp 2e-04
3nh6_A306 Nucleotide Binding Domain Of Human Abcb6 (Apo Struc 2e-04
2onk_A240 Abc Transporter Modbc In Complex With Its Binding P 2e-04
3bk7_A607 Structure Of The Complete Abce1RNAASE-L Inhibitor P 2e-04
3j15_B593 Model Of Ribosome-Bound Archaeal Pelota And Abce1 L 3e-04
3fvq_A359 Crystal Structure Of The Nucleotide Binding Domain 3e-04
3tui_C366 Inward Facing Conformations Of The Metni Methionine 3e-04
4g1u_C266 X-Ray Structure Of The Bacterial Heme Transporter H 4e-04
3j16_B608 Models Of Ribosome-Bound Dom34p And Rli1p And Their 7e-04
2cbz_A237 Structure Of The Human Multidrug Resistance Protein 9e-04
>pdb|1OXX|K Chain K, Crystal Structure Of Glcv, The Abc-Atpase Of The Glucose Abc Transporter From Sulfolobus Solfataricus Length = 353 Back     alignment and structure 
Iteration: 1

 Score = 66.6 bits (161), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 80/296 (27%), Positives = 140/296 (47%), Gaps = 35/296 (11%)
Query: 880  KLVLLNGVSGAFRPGVLTALMGVSGAGKTTLMDVLAG---RKTGG-YITGNITISGYPKK 935
            K+V L+ V+     G    ++G SGAGKTT M ++AG     TG  Y    +  S     
Sbjct: 17   KVVALDNVNINIENGERFGILGPSGAGKTTFMRIIAGLDVPSTGELYFDDRLVASNGKLI 76
Query: 936  QETFARISGYCEQNDIHSPFVTIYESLLFS-AWLRLSPEVDSETRKMFIDEVMELVELNP 994
                 R  G   Q     P +T +E++ F    +++S E   E RK  ++EV ++++++ 
Sbjct: 77   VPPEDRKIGMVFQTWALYPNLTAFENIAFPLTNMKMSKE---EIRKR-VEEVAKILDIH- 131
Query: 995  LRQSLVGLPGVSGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDAR---AAAIVMRTVR 1051
                L   P    LS  Q++R+ +A  LV +PS++ +DEP S LDAR   +A  +++ V+
Sbjct: 132  --HVLNHFP--RELSGAQQQRVALARALVKDPSLLLLDEPFSNLDARMRDSARALVKEVQ 187
Query: 1052 NTVDTGRTVVCTIHQPSIDIFEAFDELFLMKRGG-------QEIYVGPLGRHSCHLISYF 1104
            + +  G T++   H P+ DIF   D + ++ +G        +++Y  P+      LI   
Sbjct: 188  SRL--GVTLLVVSHDPA-DIFAIADRVGVLVKGKLVQVGKPEDLYDNPVSIQVASLIGEI 244
Query: 1105 EAIPGVQKIKDGYNPATWMLEVSAASQELALGIDFTEHYKRSDLYRRNKALIEDLS 1160
              + G +   +G    +    VS +S    +GI       R +  + +K +I+D S
Sbjct: 245  NELEG-KVTNEGVVIGSLRFPVSVSSDRAIIGI-------RPEDVKLSKDVIKDDS 292
>pdb|1OXS|C Chain C, Crystal Structure Of Glcv, The Abc-Atpase Of The Glucose Abc Transporter From Sulfolobus Solfataricus Length = 353 Back     alignment and structure
>pdb|2PMK|A Chain A, Crystal Structures Of An Isolated Abc-Atpase In Complex With Tnp-Adp Length = 243 Back     alignment and structure
>pdb|2IT1|A Chain A, Structure Of Ph0203 Protein From Pyrococcus Horikoshii Length = 362 Back     alignment and structure
>pdb|1MT0|A Chain A, Atp-Binding Domain Of Haemolysin B From Escherichia Coli Length = 241 Back     alignment and structure
>pdb|2FF7|A Chain A, The Abc-Atpase Of The Abc-Transporter Hlyb In The Adp Bound State Length = 247 Back     alignment and structure
>pdb|4HLU|D Chain D, Structure Of The Ecfa-a' Heterodimer Bound To Adp Length = 268 Back     alignment and structure
>pdb|3B5J|A Chain A, Crystal Structures Of The S504a Mutant Of An Isolated Abc-atpase In Complex With Tnp-adp Length = 243 Back     alignment and structure
>pdb|3GFO|A Chain A, Structure Of Cbio1 From Clostridium Perfringens: Part Of The Abc Transporter Complex Cbionq Length = 275 Back     alignment and structure
>pdb|2FFB|A Chain A, The Crystal Structure Of The Hlyb-Nbd E631q Mutant In Complex With Adp Length = 247 Back     alignment and structure
>pdb|1V43|A Chain A, Crystal Structure Of Atpase Subunit Of Abc Sugar Transporter Length = 372 Back     alignment and structure
>pdb|1VCI|A Chain A, Crystal Structure Of The Atp-binding Cassette Of Multisugar Transporter From Pyrococcus Horikoshii Ot3 Complexed With Atp Length = 373 Back     alignment and structure
>pdb|2YYZ|A Chain A, Crystal Structure Of Sugar Abc Transporter, Atp-Binding Protein Length = 359 Back     alignment and structure
>pdb|1XEF|A Chain A, Crystal Structure Of The AtpMG2+ BOUND COMPOSITE DIMER OF HLYB-Nbd Length = 241 Back     alignment and structure
>pdb|2FFA|A Chain A, Crystal Structure Of Abc-Atpase H662a Of The Abc-Transporter Hlyb In Complex With Adp Length = 247 Back     alignment and structure
>pdb|1L2T|A Chain A, Dimeric Structure Of Mj0796, A Bacterial Abc Transporter Cassette Length = 235 Back     alignment and structure
>pdb|1Z47|A Chain A, Structure Of The Atpase Subunit Cysa Of The Putative Sulfate Atp-Binding Cassette (Abc) Transporter From Alicyclobacillus Acidocaldarius Length = 355 Back     alignment and structure
>pdb|3TIF|A Chain A, Dimeric Structure Of A Post-Hydrolysis State Of The Atp-Binding Cassette Mj0796 Bound To Adp And Pi Length = 235 Back     alignment and structure
>pdb|3G60|A Chain A, Structure Of P-Glycoprotein Reveals A Molecular Basis For Poly-Specific Drug Binding Length = 1284 Back     alignment and structure
>pdb|3G5U|A Chain A, Structure Of P-Glycoprotein Reveals A Molecular Basis For Poly-Specific Drug Binding Length = 1284 Back     alignment and structure
>pdb|1MV5|A Chain A, Crystal Structure Of Lmra Atp-Binding Domain Length = 243 Back     alignment and structure
>pdb|3C41|J Chain J, Abc Protein Artp In Complex With Amp-PnpMG2+ Length = 242 Back     alignment and structure
>pdb|4AYT|A Chain A, Structure Of The Human Mitochondrial Abc Transporter, Abcb10 Length = 595 Back     alignment and structure
>pdb|4F4C|A Chain A, The Crystal Structure Of The Multi-Drug Transporter Length = 1321 Back     alignment and structure
>pdb|2OLJ|A Chain A, Abc Protein Artp In Complex With AdpMG2+ Length = 263 Back     alignment and structure
>pdb|4AYW|A Chain A, Structure Of The Human Mitochondrial Abc Transporter, Abcb10 (plate Form) Length = 619 Back     alignment and structure
>pdb|1Q12|A Chain A, Crystal Structure Of The Atp-bound E. Coli Malk Length = 381 Back     alignment and structure
>pdb|1Q1B|A Chain A, Crystal Structure Of E. Coli Malk In The Nucleotide-Free Form Length = 381 Back     alignment and structure
>pdb|2R6G|A Chain A, The Crystal Structure Of The E. Coli Maltose Transporter Length = 381 Back     alignment and structure
>pdb|2D3W|A Chain A, Crystal Structure Of Escherichia Coli Sufc, An Atpase Compenent Of The Suf Iron-Sulfur Cluster Assembly Machinery Length = 248 Back     alignment and structure
>pdb|1G29|1 Chain 1, Malk Length = 372 Back     alignment and structure
>pdb|2ZU0|C Chain C, Crystal Structure Of Sufc-Sufd Complex Involved In The Iron- Sulfur Cluster Biosynthesis Length = 267 Back     alignment and structure
>pdb|2IXF|A Chain A, Crystal Structure Of The Atpase Domain Of Tap1 With Atp (D645q, Q678h Mutant) Length = 271 Back     alignment and structure
>pdb|2D62|A Chain A, Crystal Structure Of Multiple Sugar Binding Transport Atp- Binding Protein Length = 375 Back     alignment and structure
>pdb|1F3O|A Chain A, Crystal Structure Of Mj0796 Atp-Binding Cassette Length = 235 Back     alignment and structure
>pdb|2NQ2|C Chain C, An Inward-Facing Conformation Of A Putative Metal-Chelate Type Abc Transporter. Length = 253 Back     alignment and structure
>pdb|2D2E|A Chain A, Crystal Structure Of Atypical Cytoplasmic Abc-Atpase Sufc From Thermus Thermophilus Hb8 Length = 250 Back     alignment and structure
>pdb|4DBL|C Chain C, Crystal Structure Of E159q Mutant Of Btucdf Length = 249 Back     alignment and structure
>pdb|2HYD|A Chain A, Multidrug Abc Transporter Sav1866 Length = 578 Back     alignment and structure
>pdb|4FI3|C Chain C, Structure Of Vitamin B12 Transporter Btucd-F In A Nucleotide-Bound State Length = 249 Back     alignment and structure
>pdb|3B5X|A Chain A, Crystal Structure Of Msba From Vibrio Cholerae Length = 582 Back     alignment and structure
>pdb|1VPL|A Chain A, Crystal Structure Of Abc Transporter Atp-binding Protein (tm0544) From Thermotoga Maritima At 2.10 A Resolution Length = 256 Back     alignment and structure
>pdb|1L7V|C Chain C, Bacterial Abc Transporter Involved In B12 Uptake Length = 249 Back     alignment and structure
>pdb|3QF4|A Chain A, Crystal Structure Of A Heterodimeric Abc Transporter In Its Inward- Facing Conformation Length = 587 Back     alignment and structure
>pdb|2GHI|A Chain A, Crystal Structure Of Plasmodium Yoelii Multidrug Resistance Protein 2 Length = 260 Back     alignment and structure
>pdb|2QI9|C Chain C, Abc-Transporter Btucd In Complex With Its Periplasmic Binding Protein Btuf Length = 249 Back     alignment and structure
>pdb|1G9X|A Chain A, Characterization Of The Twinning Structure Of Mj1267, An Atp-Binding Cassette Of An Abc Transporter Length = 257 Back     alignment and structure
>pdb|1YQT|A Chain A, Rnase-L Inhibitor Length = 538 Back     alignment and structure
>pdb|1GAJ|A Chain A, Crystal Structure Of A Nucleotide-Free Atp-Binding Cassette From An Abc Transporter Length = 257 Back     alignment and structure
>pdb|2PCJ|A Chain A, Crystal Structure Of Abc Transporter (Aq_297) From Aquifex Aeolicus Vf5 Length = 224 Back     alignment and structure
>pdb|1G6H|A Chain A, Crystal Structure Of The Adp Conformation Of Mj1267, An Atp- Binding Cassette Of An Abc Transporter Length = 257 Back     alignment and structure
>pdb|2IXE|A Chain A, Crystal Structure Of The Atpase Domain Of Tap1 With Atp (d645n Mutant) Length = 271 Back     alignment and structure
>pdb|1JJ7|A Chain A, Crystal Structure Of The C-Terminal Atpase Domain Of Human Tap1 Length = 260 Back     alignment and structure
>pdb|1B0U|A Chain A, Atp-Binding Subunit Of The Histidine Permease From Salmonella Typhimurium Length = 262 Back     alignment and structure
>pdb|2IXG|A Chain A, Crystal Structure Of The Atpase Domain Of Tap1 With Atp (S621a, G622v, D645n Mutant) Length = 271 Back     alignment and structure
>pdb|3OZX|A Chain A, Crystal Structure Of Abce1 Of Sulfolubus Solfataricus (-Fes Domain) Length = 538 Back     alignment and structure
>pdb|3OZX|A Chain A, Crystal Structure Of Abce1 Of Sulfolubus Solfataricus (-Fes Domain) Length = 538 Back     alignment and structure
>pdb|1JI0|A Chain A, Crystal Structure Analysis Of The Abc Transporter From Thermotoga Maritima Length = 240 Back     alignment and structure
>pdb|3D31|A Chain A, Modbc From Methanosarcina Acetivorans Length = 348 Back     alignment and structure
>pdb|2YZ2|A Chain A, Crystal Structure Of The Abc Transporter In The Cobalt Transport System Length = 266 Back     alignment and structure
>pdb|4HLU|A Chain A, Structure Of The Ecfa-a' Heterodimer Bound To Adp Length = 268 Back     alignment and structure
>pdb|3DHW|C Chain C, Crystal Structure Of Methionine Importer Metni Length = 343 Back     alignment and structure
>pdb|3B5Y|A Chain A, Crystal Structure Of Msba From Salmonella Typhimurium With Amppnp Length = 582 Back     alignment and structure
>pdb|3B5W|A Chain A, Crystal Structure Of Eschericia Coli Msba Length = 582 Back     alignment and structure
>pdb|3TUJ|C Chain C, Inward Facing Conformations Of The Metni Methionine Abc Transporter: Dm Crystal Form Length = 366 Back     alignment and structure
>pdb|2IHY|A Chain A, Structure Of The Staphylococcus Aureus Putative Atpase Subunit Of An Atp-Binding Cassette (Abc) Transporter Length = 279 Back     alignment and structure
>pdb|3NH6|A Chain A, Nucleotide Binding Domain Of Human Abcb6 (Apo Structure) Length = 306 Back     alignment and structure
>pdb|2ONK|A Chain A, Abc Transporter Modbc In Complex With Its Binding Protein Moda Length = 240 Back     alignment and structure
>pdb|3BK7|A Chain A, Structure Of The Complete Abce1RNAASE-L Inhibitor Protein From Pyrococcus Abysii Length = 607 Back     alignment and structure
>pdb|3J15|B Chain B, Model Of Ribosome-Bound Archaeal Pelota And Abce1 Length = 593 Back     alignment and structure
>pdb|3FVQ|A Chain A, Crystal Structure Of The Nucleotide Binding Domain Fbpc Complexed With Atp Length = 359 Back     alignment and structure
>pdb|3TUI|C Chain C, Inward Facing Conformations Of The Metni Methionine Abc Transporter: Cy5 Native Crystal Form Length = 366 Back     alignment and structure
>pdb|4G1U|C Chain C, X-Ray Structure Of The Bacterial Heme Transporter Hmuuv From Yersinia Pestis Length = 266 Back     alignment and structure
>pdb|3J16|B Chain B, Models Of Ribosome-Bound Dom34p And Rli1p And Their Ribosomal Binding Partners Length = 608 Back     alignment and structure
>pdb|2CBZ|A Chain A, Structure Of The Human Multidrug Resistance Protein 1 Nucleotide Binding Domain 1 Length = 237 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1391
1vpl_A256 ABC transporter, ATP-binding protein; TM0544, stru 9e-26
1vpl_A256 ABC transporter, ATP-binding protein; TM0544, stru 2e-16
1sgw_A214 Putative ABC transporter; structural genomics, P p 8e-23
1sgw_A214 Putative ABC transporter; structural genomics, P p 4e-17
2nq2_C253 Hypothetical ABC transporter ATP-binding protein H 8e-23
2nq2_C253 Hypothetical ABC transporter ATP-binding protein H 2e-16
2qi9_C249 Vitamin B12 import ATP-binding protein BTUD; inner 3e-22
2qi9_C249 Vitamin B12 import ATP-binding protein BTUD; inner 1e-18
3j16_B608 RLI1P; ribosome recycling, translation, eukarya, r 4e-20
3j16_B608 RLI1P; ribosome recycling, translation, eukarya, r 5e-14
3j16_B608 RLI1P; ribosome recycling, translation, eukarya, r 2e-10
3j16_B608 RLI1P; ribosome recycling, translation, eukarya, r 7e-10
2ihy_A279 ABC transporter, ATP-binding protein; ATPase, ABC 1e-19
2ihy_A279 ABC transporter, ATP-binding protein; ATPase, ABC 1e-18
3bk7_A607 ABC transporter ATP-binding protein; ABC ATPase, i 1e-19
3bk7_A607 ABC transporter ATP-binding protein; ABC ATPase, i 2e-13
3bk7_A607 ABC transporter ATP-binding protein; ABC ATPase, i 3e-13
3bk7_A607 ABC transporter ATP-binding protein; ABC ATPase, i 7e-09
3gfo_A275 Cobalt import ATP-binding protein CBIO 1; structur 2e-18
3gfo_A275 Cobalt import ATP-binding protein CBIO 1; structur 3e-15
2pjz_A263 Hypothetical protein ST1066; ATP binding protein, 2e-18
2pjz_A263 Hypothetical protein ST1066; ATP binding protein, 7e-14
1yqt_A538 RNAse L inhibitor; ATP-binding cassette, ribosome 3e-18
1yqt_A538 RNAse L inhibitor; ATP-binding cassette, ribosome 9e-13
1yqt_A538 RNAse L inhibitor; ATP-binding cassette, ribosome 9e-11
1yqt_A538 RNAse L inhibitor; ATP-binding cassette, ribosome 1e-07
3ozx_A538 RNAse L inhibitor; ATP binding cassette protein, h 2e-17
3ozx_A538 RNAse L inhibitor; ATP binding cassette protein, h 7e-12
3ozx_A538 RNAse L inhibitor; ATP binding cassette protein, h 8e-11
3ozx_A538 RNAse L inhibitor; ATP binding cassette protein, h 3e-10
2yz2_A266 Putative ABC transporter ATP-binding protein TM_0; 1e-16
2yz2_A266 Putative ABC transporter ATP-binding protein TM_0; 1e-15
1vt4_I1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-14
1vt4_I1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-13
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 7e-13
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-12
1vt4_I1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-11
1vt4_I1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-08
1g6h_A257 High-affinity branched-chain amino acid transport 4e-13
1g6h_A257 High-affinity branched-chain amino acid transport 6e-12
2pcj_A224 ABC transporter, lipoprotein-releasing system ATP- 5e-13
2pcj_A224 ABC transporter, lipoprotein-releasing system ATP- 7e-07
3tif_A235 Uncharacterized ABC transporter ATP-binding prote; 5e-13
3tif_A235 Uncharacterized ABC transporter ATP-binding prote; 5e-07
2zu0_C267 Probable ATP-dependent transporter SUFC; iron-sulf 4e-11
2zu0_C267 Probable ATP-dependent transporter SUFC; iron-sulf 9e-05
2d2e_A250 SUFC protein; ABC-ATPase, SUF protein, 310-helix, 2e-10
2d2e_A250 SUFC protein; ABC-ATPase, SUF protein, 310-helix, 9e-06
2iw3_A986 Elongation factor 3A; acetylation, ATP-binding, pr 4e-10
2iw3_A986 Elongation factor 3A; acetylation, ATP-binding, pr 5e-05
2iw3_A986 Elongation factor 3A; acetylation, ATP-binding, pr 7e-04
2ff7_A247 Alpha-hemolysin translocation ATP-binding protein 4e-10
2ff7_A247 Alpha-hemolysin translocation ATP-binding protein 1e-05
3nh6_A306 ATP-binding cassette SUB-family B member 6, mitoc; 7e-10
2ghi_A260 Transport protein; multidrug resistance protein, M 7e-10
2ghi_A260 Transport protein; multidrug resistance protein, M 5e-04
3g5u_A 1284 MCG1178, multidrug resistance protein 1A; P-glycop 8e-10
3g5u_A1284 MCG1178, multidrug resistance protein 1A; P-glycop 3e-07
2cbz_A237 Multidrug resistance-associated protein 1; ABC pro 1e-09
2cbz_A237 Multidrug resistance-associated protein 1; ABC pro 2e-06
1mv5_A243 LMRA, multidrug resistance ABC transporter ATP-bin 2e-09
1mv5_A243 LMRA, multidrug resistance ABC transporter ATP-bin 9e-08
3fvq_A359 Fe(3+) IONS import ATP-binding protein FBPC; nucle 1e-08
3fvq_A359 Fe(3+) IONS import ATP-binding protein FBPC; nucle 7e-07
1ji0_A240 ABC transporter; ATP binding protein, structural g 1e-08
1ji0_A240 ABC transporter; ATP binding protein, structural g 6e-06
2onk_A240 Molybdate/tungstate ABC transporter, ATP-binding p 1e-08
2onk_A240 Molybdate/tungstate ABC transporter, ATP-binding p 5e-05
2ixe_A271 Antigen peptide transporter 1; ABC ATPase, hydrola 1e-08
2ixe_A271 Antigen peptide transporter 1; ABC ATPase, hydrola 2e-05
1z47_A355 CYSA, putative ABC-transporter ATP-binding protein 2e-08
1z47_A355 CYSA, putative ABC-transporter ATP-binding protein 8e-07
2pze_A229 Cystic fibrosis transmembrane conductance regulat; 2e-08
2pze_A229 Cystic fibrosis transmembrane conductance regulat; 2e-06
3tui_C366 Methionine import ATP-binding protein METN; ABC-tr 2e-08
3tui_C366 Methionine import ATP-binding protein METN; ABC-tr 8e-07
3gd7_A390 Fusion complex of cystic fibrosis transmembrane co 1e-07
2bbs_A290 Cystic fibrosis transmembrane conductance regulato 1e-07
2bbs_A290 Cystic fibrosis transmembrane conductance regulato 1e-06
3d31_A348 Sulfate/molybdate ABC transporter, ATP-binding pro 5e-07
3d31_A348 Sulfate/molybdate ABC transporter, ATP-binding pro 6e-06
1oxx_K353 GLCV, glucose, ABC transporter, ATP binding protei 7e-07
1oxx_K353 GLCV, glucose, ABC transporter, ATP binding protei 1e-05
4a82_A578 Cystic fibrosis transmembrane conductance regulat; 8e-07
3b5x_A582 Lipid A export ATP-binding/permease protein MSBA; 2e-06
3qkt_A339 DNA double-strand break repair RAD50 ATPase; RECA- 2e-06
2yl4_A595 ATP-binding cassette SUB-family B member 10, mitoc 2e-06
2yl4_A595 ATP-binding cassette SUB-family B member 10, mitoc 4e-04
3b60_A582 Lipid A export ATP-binding/permease protein MSBA; 3e-06
2it1_A362 362AA long hypothetical maltose/maltodextrin trans 3e-05
2it1_A362 362AA long hypothetical maltose/maltodextrin trans 4e-04
1v43_A372 Sugar-binding transport ATP-binding protein; ATPas 2e-04
2yyz_A359 Sugar ABC transporter, ATP-binding protein; sugar 2e-04
1f2t_B148 RAD50 ABC-ATPase; DNA double-strand break repair, 4e-04
>1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12 Length = 256 Back     alignment and structure
 Score =  106 bits (268), Expect = 9e-26
 Identities = 46/186 (24%), Positives = 78/186 (41%), Gaps = 16/186 (8%)

Query: 884  LNGVSGAFRPGVLTALMGVSGAGKTTLMDVLAG--RKTGGYITGNITISGY-PKKQETFA 940
            L G+S     G +  L+G +GAGKTT + +++   + + G     +T+ G    ++    
Sbjct: 31   LKGISFEIEEGEIFGLIGPNGAGKTTTLRIISTLIKPSSG----IVTVFGKNVVEEPHEV 86

Query: 941  RIS-GYCEQNDIHSPFVTIYESLLFSAWLRLSPEVDSETRKMFIDEVMELVELNPLRQSL 999
            R    Y  +       +   E L F A    S   + E     ++   E+  L    +  
Sbjct: 87   RKLISYLPEEAGAYRNMQGIEYLRFVAGFYASSSSEIEEM---VERATEIAGLGEKIKDR 143

Query: 1000 VGLPGVSGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRT 1059
            V        S    ++L IA  L+ NP +  +DEPTSGLD   A  V + ++     G T
Sbjct: 144  VS-----TYSKGMVRKLLIARALMVNPRLAILDEPTSGLDVLNAREVRKILKQASQEGLT 198

Query: 1060 VVCTIH 1065
            ++ + H
Sbjct: 199  ILVSSH 204
>1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12 Length = 256 Back     alignment and structure
>1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12 Length = 214 Back     alignment and structure
>1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12 Length = 214 Back     alignment and structure
>2nq2_C Hypothetical ABC transporter ATP-binding protein HI1470; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae} Length = 253 Back     alignment and structure
>2nq2_C Hypothetical ABC transporter ATP-binding protein HI1470; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae} Length = 253 Back     alignment and structure
>2qi9_C Vitamin B12 import ATP-binding protein BTUD; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_C* 4dbl_C Length = 249 Back     alignment and structure
>2qi9_C Vitamin B12 import ATP-binding protein BTUD; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_C* 4dbl_C Length = 249 Back     alignment and structure
>3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; NMR {Saccharomyces cerevisiae} Length = 608 Back     alignment and structure
>3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; NMR {Saccharomyces cerevisiae} Length = 608 Back     alignment and structure
>3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; NMR {Saccharomyces cerevisiae} Length = 608 Back     alignment and structure
>3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; NMR {Saccharomyces cerevisiae} Length = 608 Back     alignment and structure
>2ihy_A ABC transporter, ATP-binding protein; ATPase, ABC cassette, hydrolase; HET: MSE; 1.90A {Staphylococcus aureus} Length = 279 Back     alignment and structure
>2ihy_A ABC transporter, ATP-binding protein; ATPase, ABC cassette, hydrolase; HET: MSE; 1.90A {Staphylococcus aureus} Length = 279 Back     alignment and structure
>3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* Length = 607 Back     alignment and structure
>3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* Length = 607 Back     alignment and structure
>3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* Length = 607 Back     alignment and structure
>3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* Length = 607 Back     alignment and structure
>3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124} Length = 275 Back     alignment and structure
>3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124} Length = 275 Back     alignment and structure
>2pjz_A Hypothetical protein ST1066; ATP binding protein, structural genomics, NPPSFA; 1.90A {Sulfolobus tokodaii} Length = 263 Back     alignment and structure
>2pjz_A Hypothetical protein ST1066; ATP binding protein, structural genomics, NPPSFA; 1.90A {Sulfolobus tokodaii} Length = 263 Back     alignment and structure
>1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} Length = 538 Back     alignment and structure
>1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} Length = 538 Back     alignment and structure
>1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} Length = 538 Back     alignment and structure
>1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} Length = 538 Back     alignment and structure
>3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} Length = 538 Back     alignment and structure
>3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} Length = 538 Back     alignment and structure
>3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} Length = 538 Back     alignment and structure
>3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} Length = 538 Back     alignment and structure
>2yz2_A Putative ABC transporter ATP-binding protein TM_0; cobalt transport, TM02 hydrolase, inner membrane, membrane, nucleotide-binding; 2.30A {Thermotoga maritima} Length = 266 Back     alignment and structure
>2yz2_A Putative ABC transporter ATP-binding protein TM_0; cobalt transport, TM02 hydrolase, inner membrane, membrane, nucleotide-binding; 2.30A {Thermotoga maritima} Length = 266 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1g6h_A High-affinity branched-chain amino acid transport ATP-binding protein; beta-core domain; HET: ADP; 1.60A {Methanocaldococcus jannaschii} SCOP: c.37.1.12 PDB: 1gaj_A 1g9x_A* Length = 257 Back     alignment and structure
>1g6h_A High-affinity branched-chain amino acid transport ATP-binding protein; beta-core domain; HET: ADP; 1.60A {Methanocaldococcus jannaschii} SCOP: c.37.1.12 PDB: 1gaj_A 1g9x_A* Length = 257 Back     alignment and structure
>2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein; structural genomics; 1.70A {Aquifex aeolicus} PDB: 2pcl_A Length = 224 Back     alignment and structure
>2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein; structural genomics; 1.70A {Aquifex aeolicus} PDB: 2pcl_A Length = 224 Back     alignment and structure
>3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A* Length = 235 Back     alignment and structure
>3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A* Length = 235 Back     alignment and structure
>2zu0_C Probable ATP-dependent transporter SUFC; iron-sulfur cluster, ABC-ATPase, ATP-binding, cytoplasm, nucleotide-binding; HET: MES; 2.20A {Escherichia coli} PDB: 2d3w_A Length = 267 Back     alignment and structure
>2zu0_C Probable ATP-dependent transporter SUFC; iron-sulfur cluster, ABC-ATPase, ATP-binding, cytoplasm, nucleotide-binding; HET: MES; 2.20A {Escherichia coli} PDB: 2d3w_A Length = 267 Back     alignment and structure
>2d2e_A SUFC protein; ABC-ATPase, SUF protein, 310-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics, binding; 1.70A {Thermus thermophilus} PDB: 2d2f_A* Length = 250 Back     alignment and structure
>2d2e_A SUFC protein; ABC-ATPase, SUF protein, 310-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics, binding; 1.70A {Thermus thermophilus} PDB: 2d2f_A* Length = 250 Back     alignment and structure
>2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A Length = 986 Back     alignment and structure
>2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A Length = 986 Back     alignment and structure
>2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A Length = 986 Back     alignment and structure
>2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A* Length = 247 Back     alignment and structure
>2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A* Length = 247 Back     alignment and structure
>3nh6_A ATP-binding cassette SUB-family B member 6, mitoc; ABC-transporter, ABCB6, nucleotide binding domain, heme BIOS transport protein; 2.00A {Homo sapiens} PDB: 3nh9_A* 3nha_A* 3nhb_A* Length = 306 Back     alignment and structure
>2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str} Length = 260 Back     alignment and structure
>2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str} Length = 260 Back     alignment and structure
>3g5u_A MCG1178, multidrug resistance protein 1A; P-glycoprotein, PGP, cyclic peptide, membrane protein; 3.80A {Mus musculus} PDB: 3g61_A* 3g60_A* Length = 1284 Back     alignment and structure
>3g5u_A MCG1178, multidrug resistance protein 1A; P-glycoprotein, PGP, cyclic peptide, membrane protein; 3.80A {Mus musculus} PDB: 3g61_A* 3g60_A* Length = 1284 Back     alignment and structure
>2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens} Length = 237 Back     alignment and structure
>2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens} Length = 237 Back     alignment and structure
>1mv5_A LMRA, multidrug resistance ABC transporter ATP-binding and permease protein; asymmetric dimer, tetramer, P-glycoprotein; HET: ATP ADP; 3.10A {Lactococcus lactis} SCOP: c.37.1.12 Length = 243 Back     alignment and structure
>1mv5_A LMRA, multidrug resistance ABC transporter ATP-binding and permease protein; asymmetric dimer, tetramer, P-glycoprotein; HET: ATP ADP; 3.10A {Lactococcus lactis} SCOP: c.37.1.12 Length = 243 Back     alignment and structure
>3fvq_A Fe(3+) IONS import ATP-binding protein FBPC; nucleotide binding domain, ABC motor domain, ferric iron transport, cell inner membrane; HET: ATP; 1.90A {Neisseria gonorrhoeae} Length = 359 Back     alignment and structure
>3fvq_A Fe(3+) IONS import ATP-binding protein FBPC; nucleotide binding domain, ABC motor domain, ferric iron transport, cell inner membrane; HET: ATP; 1.90A {Neisseria gonorrhoeae} Length = 359 Back     alignment and structure
>1ji0_A ABC transporter; ATP binding protein, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: ATP; 2.00A {Thermotoga maritima} SCOP: c.37.1.12 Length = 240 Back     alignment and structure
>1ji0_A ABC transporter; ATP binding protein, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: ATP; 2.00A {Thermotoga maritima} SCOP: c.37.1.12 Length = 240 Back     alignment and structure
>2onk_A Molybdate/tungstate ABC transporter, ATP-binding protein; membrane protein; 3.10A {Archaeoglobus fulgidus} SCOP: c.37.1.12 Length = 240 Back     alignment and structure
>2onk_A Molybdate/tungstate ABC transporter, ATP-binding protein; membrane protein; 3.10A {Archaeoglobus fulgidus} SCOP: c.37.1.12 Length = 240 Back     alignment and structure
>2ixe_A Antigen peptide transporter 1; ABC ATPase, hydrolase; HET: ATP; 2.0A {Rattus norvegicus} PDB: 2ixg_A* 2ixf_A* 1jj7_A* Length = 271 Back     alignment and structure
>2ixe_A Antigen peptide transporter 1; ABC ATPase, hydrolase; HET: ATP; 2.0A {Rattus norvegicus} PDB: 2ixg_A* 2ixf_A* 1jj7_A* Length = 271 Back     alignment and structure
>1z47_A CYSA, putative ABC-transporter ATP-binding protein; alpha/beta motif, beta sandwich, ligand binding protein; 1.90A {Alicyclobacillus acidocaldarius} Length = 355 Back     alignment and structure
>1z47_A CYSA, putative ABC-transporter ATP-binding protein; alpha/beta motif, beta sandwich, ligand binding protein; 1.90A {Alicyclobacillus acidocaldarius} Length = 355 Back     alignment and structure
>2pze_A Cystic fibrosis transmembrane conductance regulat; NBD, ABC transporter, CFTR, hydrolase; HET: ATP; 1.70A {Homo sapiens} PDB: 2pzg_A* 2pzf_A* 1ckx_A 1cky_A 1ckw_A 1ckz_A Length = 229 Back     alignment and structure
>2pze_A Cystic fibrosis transmembrane conductance regulat; NBD, ABC transporter, CFTR, hydrolase; HET: ATP; 1.70A {Homo sapiens} PDB: 2pzg_A* 2pzf_A* 1ckx_A 1cky_A 1ckw_A 1ckz_A Length = 229 Back     alignment and structure
>3tui_C Methionine import ATP-binding protein METN; ABC-transporter, type I ABC type importer, methionine uptake transporter, membrane protein; HET: ADP; 2.90A {Escherichia coli} PDB: 3tuj_C 3tuz_C* 3dhw_C Length = 366 Back     alignment and structure
>3tui_C Methionine import ATP-binding protein METN; ABC-transporter, type I ABC type importer, methionine uptake transporter, membrane protein; HET: ADP; 2.90A {Escherichia coli} PDB: 3tuj_C 3tuz_C* 3dhw_C Length = 366 Back     alignment and structure
>3gd7_A Fusion complex of cystic fibrosis transmembrane conductance regulator, residues 1193-1427...; CFTR, ABC transporter, nucleotide binding domain, NBD; HET: B44; 2.70A {Homo sapiens} Length = 390 Back     alignment and structure
>2bbs_A Cystic fibrosis transmembrane conductance regulator; ATP binding cassette, transport protein; HET: ATP; 2.05A {Homo sapiens} PDB: 2bbt_A* 1xmi_A* 1xmj_A* 2bbo_A* 3si7_A* 1r0w_A 1q3h_A 1r0x_A* 1r0y_A* 1r0z_A* 1r10_A* 1xf9_A* 1xfa_A* Length = 290 Back     alignment and structure
>2bbs_A Cystic fibrosis transmembrane conductance regulator; ATP binding cassette, transport protein; HET: ATP; 2.05A {Homo sapiens} PDB: 2bbt_A* 1xmi_A* 1xmj_A* 2bbo_A* 3si7_A* 1r0w_A 1q3h_A 1r0x_A* 1r0y_A* 1r0z_A* 1r10_A* 1xf9_A* 1xfa_A* Length = 290 Back     alignment and structure
>3d31_A Sulfate/molybdate ABC transporter, ATP-binding protein; ATP-binding, nucleotide-binding, membrane, transmembrane, transport protein; 3.00A {Methanosarcina acetivorans} SCOP: b.40.6.3 c.37.1.12 Length = 348 Back     alignment and structure
>3d31_A Sulfate/molybdate ABC transporter, ATP-binding protein; ATP-binding, nucleotide-binding, membrane, transmembrane, transport protein; 3.00A {Methanosarcina acetivorans} SCOP: b.40.6.3 c.37.1.12 Length = 348 Back     alignment and structure
>1oxx_K GLCV, glucose, ABC transporter, ATP binding protein; ABC-ATPase, ATP-binding cassette, ATPase, transport protein; 1.45A {Sulfolobus solfataricus} SCOP: b.40.6.3 c.37.1.12 PDB: 1oxs_C 1oxt_A 1oxu_A* 1oxv_A* Length = 353 Back     alignment and structure
>1oxx_K GLCV, glucose, ABC transporter, ATP binding protein; ABC-ATPase, ATP-binding cassette, ATPase, transport protein; 1.45A {Sulfolobus solfataricus} SCOP: b.40.6.3 c.37.1.12 PDB: 1oxs_C 1oxt_A 1oxu_A* 1oxv_A* Length = 353 Back     alignment and structure
>4a82_A Cystic fibrosis transmembrane conductance regulat; CFTR, ION channel, transport protein, casse protein; 2.00A {Homo sapiens} PDB: 2onj_A* 2hyd_A Length = 578 Back     alignment and structure
>3b5x_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; 5.50A {Vibrio cholerae} Length = 582 Back     alignment and structure
>3qkt_A DNA double-strand break repair RAD50 ATPase; RECA-like fold, coiled-coils, ATP binding, DNA bindi MRE11, replication; HET: DNA ANP; 1.90A {Pyrococcus furiosus} PDB: 3qku_A* 1ii8_A 3qks_B* 3qkr_B* 1ii8_B Length = 339 Back     alignment and structure
>3b60_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; HET: ANP; 3.70A {Salmonella typhimurium} SCOP: c.37.1.12 f.37.1.1 PDB: 3b5y_A* 3b5z_A* 3b5w_A Length = 582 Back     alignment and structure
>2it1_A 362AA long hypothetical maltose/maltodextrin transport ATP-binding protein; structural genomics, NPPSFA; 1.94A {Pyrococcus horikoshii} Length = 362 Back     alignment and structure
>2it1_A 362AA long hypothetical maltose/maltodextrin transport ATP-binding protein; structural genomics, NPPSFA; 1.94A {Pyrococcus horikoshii} Length = 362 Back     alignment and structure
>1v43_A Sugar-binding transport ATP-binding protein; ATPase, active transport, sugar uptake and regulation, transport protein; 2.20A {Pyrococcus horikoshii} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 1vci_A* Length = 372 Back     alignment and structure
>2yyz_A Sugar ABC transporter, ATP-binding protein; sugar transport, alpha and beta proteins (A/B) TM0421, structural genomics, NPPSFA; 2.11A {Thermotoga maritima} Length = 359 Back     alignment and structure
>1f2t_B RAD50 ABC-ATPase; DNA double-strand break repair, replication; 1.60A {Pyrococcus furiosus} SCOP: c.37.1.12 PDB: 1f2u_B* 1us8_B* Length = 148 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

No hit with probability above 80.00

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 1391
d1v43a3239 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N 6e-29
d1v43a3239 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N 1e-26
d1l2ta_230 c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jann 3e-28
d1l2ta_230 c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jann 2e-22
d1g6ha_254 c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jann 2e-27
d1g6ha_254 c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jann 2e-25
d1ji0a_240 c.37.1.12 (A:) Branched chain aminoacid ABC transp 4e-27
d1ji0a_240 c.37.1.12 (A:) Branched chain aminoacid ABC transp 2e-18
d2hyda1255 c.37.1.12 (A:324-578) Putative multidrug export AT 3e-25
d2hyda1255 c.37.1.12 (A:324-578) Putative multidrug export AT 6e-21
d3dhwc1240 c.37.1.12 (C:1-240) Methionine import ATP-binding 7e-25
d3dhwc1240 c.37.1.12 (C:1-240) Methionine import ATP-binding 1e-24
d1b0ua_258 c.37.1.12 (A:) ATP-binding subunit of the histidin 9e-25
d1b0ua_258 c.37.1.12 (A:) ATP-binding subunit of the histidin 7e-22
d1vpla_238 c.37.1.12 (A:) Putative ABC transporter TM0544 {Th 1e-24
d1vpla_238 c.37.1.12 (A:) Putative ABC transporter TM0544 {Th 4e-22
d1sgwa_200 c.37.1.12 (A:) Putative ABC transporter PF0895 {Py 2e-24
d1sgwa_200 c.37.1.12 (A:) Putative ABC transporter PF0895 {Py 2e-18
d1r0wa_281 c.37.1.12 (A:) Cystic fibrosis transmembrane condu 8e-24
d1r0wa_281 c.37.1.12 (A:) Cystic fibrosis transmembrane condu 3e-23
d1jj7a_251 c.37.1.12 (A:) Peptide transporter Tap1, C-termina 7e-23
d1jj7a_251 c.37.1.12 (A:) Peptide transporter Tap1, C-termina 1e-20
d3b60a1253 c.37.1.12 (A:329-581) Multidrug resistance ABC tra 9e-23
d3b60a1253 c.37.1.12 (A:329-581) Multidrug resistance ABC tra 1e-20
d1l7vc_231 c.37.1.12 (C:) ABC transporter involved in vitamin 2e-22
d1l7vc_231 c.37.1.12 (C:) ABC transporter involved in vitamin 5e-19
d2pmka1241 c.37.1.12 (A:467-707) Haemolysin B ATP-binding pro 8e-22
d2pmka1241 c.37.1.12 (A:467-707) Haemolysin B ATP-binding pro 1e-19
d2awna2232 c.37.1.12 (A:4-235) Maltose transport protein MalK 2e-21
d2awna2232 c.37.1.12 (A:4-235) Maltose transport protein MalK 1e-20
d1mv5a_242 c.37.1.12 (A:) Multidrug resistance ABC transporte 6e-21
d1mv5a_242 c.37.1.12 (A:) Multidrug resistance ABC transporte 2e-19
d3d31a2229 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transpor 8e-20
d3d31a2229 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transpor 4e-15
d1g2912240 c.37.1.12 (1:1-240) Maltose transport protein MalK 1e-19
d1g2912240 c.37.1.12 (1:1-240) Maltose transport protein MalK 4e-18
d1oxxk2242 c.37.1.12 (K:1-242) Glucose transport protein GlcV 2e-19
d1oxxk2242 c.37.1.12 (K:1-242) Glucose transport protein GlcV 5e-19
d2onka1240 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP 2e-15
d2onka1240 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP 9e-14
g1ii8.1369 c.37.1.12 (A:,B:) Rad50 {Archaeon Pyrococcus furio 1e-07
g1f2t.1292 c.37.1.12 (A:,B:) Rad50 {Archaeon Pyrococcus furio 3e-07
g1f2t.1292 c.37.1.12 (A:,B:) Rad50 {Archaeon Pyrococcus furio 2e-04
g1f2t.1292 c.37.1.12 (A:,B:) Rad50 {Archaeon Pyrococcus furio 8e-04
d1ye8a1178 c.37.1.11 (A:1-178) Hypothetical kinase-like prote 8e-07
d1ye8a1178 c.37.1.11 (A:1-178) Hypothetical kinase-like prote 1e-05
d1svma_362 c.37.1.20 (A:) Papillomavirus large T antigen heli 6e-05
d1w1wa_427 c.37.1.12 (A:) Smc head domain {Baker's yeast (Sac 9e-05
d1n0wa_242 c.37.1.11 (A:) DNA repair protein Rad51, catalytic 1e-04
d1np6a_170 c.37.1.10 (A:) Molybdopterin-guanine dinucleotide 6e-04
d2i1qa2258 c.37.1.11 (A:65-322) DNA repair protein Rad51, cat 0.002
d1szpa2251 c.37.1.11 (A:145-395) DNA repair protein Rad51, ca 0.002
d1nlfa_274 c.37.1.11 (A:) Hexameric replicative helicase repA 0.003
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Length = 239 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: ABC transporter ATPase domain-like
domain: Hypothetical protein PH0022, N-terminal domain
species: Pyrococcus horikoshii [TaxId: 53953]

 Score =  114 bits (287), Expect = 6e-29
 Identities = 56/271 (20%), Positives = 98/271 (36%), Gaps = 54/271 (19%)

Query: 165 LTILKDVSGVIKPGRLTLLLGPPSSGKTTLLLALAGKLDPTLKVSGTVTYNGHDMDEFVP 224
            T +  ++  IK G   +LLGP   GKTT L  +AG  +PT    G + +   D+    P
Sbjct: 19  FTAVNKLNLTIKDGEFLVLLGPSGCGKTTTLRMIAGLEEPT---EGRIYFGDRDVTYLPP 75

Query: 225 -QRTAAYISQHDNHIGEMTVRETLAFSARCQGVGTRYEMLTELARREKAAGIKPDPDIDV 283
             R  + + Q       MTV E +AF  + +                             
Sbjct: 76  KDRNISMVFQSYAVWPHMTVYENIAFPLKIKKFP-------------------------- 109

Query: 284 YMKAIATEGQEANVITDYYLKVLGLDVCADTMVGDEMIRGISGGQKKRVTTGEMMVGPAL 343
                     E +    +  ++L ++   +          +SGGQ++RV     +V    
Sbjct: 110 --------KDEIDKRVRWAAELLQIEELLNRYPAQ-----LSGGQRQRVAVARAIVVEPD 156

Query: 344 ALFMDEISTGLDSSTTFQIVNCLRQNIHINSGTAVISLLQPAPETYDLFDDIILLSDGQI 403
            L MDE  + LD+     +   +++ +        I +     E   + D I +++ GQ+
Sbjct: 157 VLLMDEPLSNLDAKLRVAMRAEIKK-LQQKLKVTTIYVTHDQVEAMTMGDRIAVMNRGQL 215

Query: 404 VYQG-PRELVLEFFASMGFRCPKRKGVADFL 433
           +  G P E+         +  P    VA F+
Sbjct: 216 LQIGSPTEV---------YLRPNSVFVATFI 237
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Length = 239 Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 230 Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 230 Back     information, alignment and structure
>d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 254 Back     information, alignment and structure
>d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 254 Back     information, alignment and structure
>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Length = 240 Back     information, alignment and structure
>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Length = 240 Back     information, alignment and structure
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Length = 255 Back     information, alignment and structure
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Length = 255 Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Length = 240 Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Length = 240 Back     information, alignment and structure
>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Length = 258 Back     information, alignment and structure
>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Length = 258 Back     information, alignment and structure
>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Length = 238 Back     information, alignment and structure
>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Length = 238 Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Length = 200 Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Length = 200 Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 281 Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 281 Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Length = 251 Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Length = 251 Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Length = 253 Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Length = 253 Back     information, alignment and structure
>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} Length = 231 Back     information, alignment and structure
>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} Length = 231 Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Length = 241 Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Length = 241 Back     information, alignment and structure
>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 232 Back     information, alignment and structure
>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 232 Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Length = 242 Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Length = 242 Back     information, alignment and structure
>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Length = 229 Back     information, alignment and structure
>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Length = 229 Back     information, alignment and structure
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Length = 240 Back     information, alignment and structure
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Length = 240 Back     information, alignment and structure
>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Length = 242 Back     information, alignment and structure
>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Length = 242 Back     information, alignment and structure
>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Length = 240 Back     information, alignment and structure
>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Length = 240 Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Length = 178 Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Length = 178 Back     information, alignment and structure
>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Length = 362 Back     information, alignment and structure
>d1w1wa_ c.37.1.12 (A:) Smc head domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 427 Back     information, alignment and structure
>d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Length = 170 Back     information, alignment and structure
>d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} Length = 258 Back     information, alignment and structure
>d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 251 Back     information, alignment and structure
>d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} Length = 274 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query1391
d2awna2232 Maltose transport protein MalK, N-terminal domain 100.0
d1v43a3239 Hypothetical protein PH0022, N-terminal domain {Py 100.0
d1g2912240 Maltose transport protein MalK, N-terminal domain 100.0
d1oxxk2242 Glucose transport protein GlcV, N-terminal domain 100.0
d3d31a2229 Sulfate/molybdate ABC transporter, ATP-binding pro 100.0
d1g2912240 Maltose transport protein MalK, N-terminal domain 100.0
d2pmka1241 Haemolysin B ATP-binding protein {Escherichia coli 100.0
d1v43a3239 Hypothetical protein PH0022, N-terminal domain {Py 100.0
d3dhwc1240 Methionine import ATP-binding protein MetN {Escher 100.0
d2awna2232 Maltose transport protein MalK, N-terminal domain 100.0
d1jj7a_251 Peptide transporter Tap1, C-terminal ABC domain {H 100.0
d1l2ta_230 MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 100.0
d2hyda1255 Putative multidrug export ATP-binding/permease pro 100.0
d1oxxk2242 Glucose transport protein GlcV, N-terminal domain 100.0
d3dhwc1240 Methionine import ATP-binding protein MetN {Escher 100.0
d1vpla_238 Putative ABC transporter TM0544 {Thermotoga mariti 100.0
d1l2ta_230 MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 100.0
d3b60a1253 Multidrug resistance ABC transporter MsbA, C-termi 100.0
d3d31a2229 Sulfate/molybdate ABC transporter, ATP-binding pro 100.0
d1vpla_238 Putative ABC transporter TM0544 {Thermotoga mariti 100.0
d1mv5a_242 Multidrug resistance ABC transporter LmrA, C-termi 100.0
d1ji0a_240 Branched chain aminoacid ABC transporter {Thermoto 100.0
d1b0ua_258 ATP-binding subunit of the histidine permease {Sal 100.0
d1g6ha_254 MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 100.0
d1ji0a_240 Branched chain aminoacid ABC transporter {Thermoto 100.0
d1g6ha_254 MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 100.0
d1b0ua_258 ATP-binding subunit of the histidine permease {Sal 100.0
d2onka1240 Molybdate/tungstate import ATP-binding protein Wtp 100.0
d2pmka1241 Haemolysin B ATP-binding protein {Escherichia coli 100.0
d1jj7a_251 Peptide transporter Tap1, C-terminal ABC domain {H 100.0
d2hyda1255 Putative multidrug export ATP-binding/permease pro 100.0
d2onka1240 Molybdate/tungstate import ATP-binding protein Wtp 100.0
d1mv5a_242 Multidrug resistance ABC transporter LmrA, C-termi 100.0
d3b60a1253 Multidrug resistance ABC transporter MsbA, C-termi 100.0
d1r0wa_281 Cystic fibrosis transmembrane conductance regulato 100.0
d1r0wa_281 Cystic fibrosis transmembrane conductance regulato 100.0
d1l7vc_231 ABC transporter involved in vitamin B12 uptake, Bt 100.0
d1l7vc_231 ABC transporter involved in vitamin B12 uptake, Bt 100.0
d1sgwa_200 Putative ABC transporter PF0895 {Pyrococcus furios 100.0
d1sgwa_200 Putative ABC transporter PF0895 {Pyrococcus furios 100.0
g1f2t.1292 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 99.85
g1f2t.1292 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 99.74
g1ii8.1369 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 99.67
g1ii8.1369 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 99.52
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 99.42
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 99.36
d1e69a_308 Smc head domain {Thermotoga maritima [TaxId: 2336] 99.18
d1w1wa_427 Smc head domain {Baker's yeast (Saccharomyces cere 99.0
d1e69a_308 Smc head domain {Thermotoga maritima [TaxId: 2336] 98.93
g1xew.1329 Smc head domain {Pyrococcus furiosus [TaxId: 2261] 98.87
d1w1wa_427 Smc head domain {Baker's yeast (Saccharomyces cere 98.51
g1xew.1329 Smc head domain {Pyrococcus furiosus [TaxId: 2261] 98.45
d1ewqa2224 DNA repair protein MutS, the C-terminal domain {Th 97.93
d1wb9a2234 DNA repair protein MutS, the C-terminal domain {Es 97.86
d1cr2a_277 Gene 4 protein (g4p, DNA primase), helicase domain 97.85
d1ewqa2224 DNA repair protein MutS, the C-terminal domain {Th 97.71
d1cr2a_277 Gene 4 protein (g4p, DNA primase), helicase domain 97.71
d1wb9a2234 DNA repair protein MutS, the C-terminal domain {Es 97.56
d1u0la2225 Probable GTPase EngC (YjeQ), C-terminal domain {Th 97.48
d1nlfa_274 Hexameric replicative helicase repA {Escherichia c 97.46
d1tf7a2242 Circadian clock protein KaiC {Synechococcus sp. st 97.46
d1zp6a1176 Hypothetical protein Atu3015 {Agrobacterium tumefa 97.28
d1nlfa_274 Hexameric replicative helicase repA {Escherichia c 97.25
d1np6a_170 Molybdopterin-guanine dinucleotide biosynthesis pr 97.1
d1t9ha2231 Probable GTPase EngC (YjeQ), C-terminal domain {Ba 97.1
d1u0la2225 Probable GTPase EngC (YjeQ), C-terminal domain {Th 97.1
d1znwa1182 Guanylate kinase {Mycobacterium tuberculosis [TaxI 97.09
d1g6oa_323 Hexameric traffic ATPase, HP0525 {Helicobacter pyl 97.0
d1knqa_171 Gluconate kinase {Escherichia coli [TaxId: 562]} 96.96
d1xjca_165 Molybdopterin-guanine dinucleotide biosynthesis pr 96.9
d1m8pa3183 ATP sulfurylase C-terminal domain {Fungus (Penicil 96.89
d1gvnb_273 Plasmid maintenance system epsilon/zeta, toxin zet 96.89
d1lw7a2192 Transcriptional regulator NadR, ribosylnicotinamid 96.86
d2bdta1176 Hypothetical protein BH3686 {Bacillus halodurans [ 96.81
d1n0wa_242 DNA repair protein Rad51, catalytic domain {Human 96.79
d1s96a_205 Guanylate kinase {Escherichia coli [TaxId: 562]} 96.76
d1znwa1182 Guanylate kinase {Mycobacterium tuberculosis [TaxI 96.74
d1y63a_174 Probable kinase LmjF30.1890 {Leishmania major [Tax 96.73
d1qhxa_178 Chloramphenicol phosphotransferase {Streptomyces v 96.67
d2i3ba1189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 96.66
d1lv7a_256 AAA domain of cell division protein FtsH {Escheric 96.66
d1ak2a1190 Adenylate kinase {Cow (Bos taurus), mitochondrial 96.63
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 96.62
d1svia_195 Probable GTPase EngB {Bacillus subtilis [TaxId: 14 96.61
d1t9ha2231 Probable GTPase EngC (YjeQ), C-terminal domain {Ba 96.6
d1rkba_173 Adenylate kinase {Human (Homo sapiens), isoenzyme 96.57
d2i1qa2258 DNA repair protein Rad51, catalytic domain {Archae 96.56
d1yrba1244 ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss 96.55
d3adka_194 Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} 96.54
d1qf9a_194 UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 96.54
d1zp6a1176 Hypothetical protein Atu3015 {Agrobacterium tumefa 96.51
d1p9ra_401 Extracellular secretion NTPase EpsE {Vibrio choler 96.49
d1ukza_196 Uridylate kinase {Baker's yeast (Saccharomyces cer 96.49
d1qhla_222 Cell division protein MukB {Escherichia coli [TaxI 96.47
d1np6a_170 Molybdopterin-guanine dinucleotide biosynthesis pr 96.42
d1szpa2251 DNA repair protein Rad51, catalytic domain {Baker' 96.42
d1mkya2186 Probable GTPase Der, N-terminal and middle domains 96.4
d1s96a_205 Guanylate kinase {Escherichia coli [TaxId: 562]} 96.38
d1ofha_309 HslU {Haemophilus influenzae [TaxId: 727]} 96.38
d1khta_190 Adenylate kinase {Archaeon Methanococcus voltae [T 96.37
d1x6va3195 Adenosine-5'phosphosulfate kinase (APS kinase) {Hu 96.36
d1ixza_247 AAA domain of cell division protein FtsH {Thermus 96.36
d2p67a1327 LAO/AO transport system kinase ArgK {Escherichia c 96.34
d1svia_195 Probable GTPase EngB {Bacillus subtilis [TaxId: 14 96.31
d1yj5a2172 5' polynucleotide kinase-3' phosphatase, C-termina 96.3
d1teva_194 UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] 96.29
d1zina1182 Adenylate kinase {Bacillus stearothermophilus [Tax 96.28
d1g41a_443 HslU {Haemophilus influenzae [TaxId: 727]} 96.28
d1pzna2254 DNA repair protein Rad51, catalytic domain {Archae 96.25
d1qhla_222 Cell division protein MukB {Escherichia coli [TaxI 96.24
d1zaka1189 Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} 96.23
d1knqa_171 Gluconate kinase {Escherichia coli [TaxId: 562]} 96.19
d2cxxa1184 GTP-binding protein engB {Pyrococcus horikoshii [T 96.19
d1nrjb_209 Signal recognition particle receptor beta-subunit 96.18
d1kaga_169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 96.16
d1mkya1171 Probable GTPase Der, N-terminal and middle domains 96.14
d1s3ga1182 Adenylate kinase {Bacillus globisporus [TaxId: 145 96.08
d1rz3a_198 Hypothetical protein rbstp0775 {Bacillus stearothe 96.07
d2ak3a1189 Adenylate kinase {Cow (Bos taurus), mitochondrial 96.07
d1lnza2185 Obg GTP-binding protein middle domain {Bacillus su 96.06
d1sxja2253 Replication factor C1 {Baker's yeast (Saccharomyce 96.06
d1kgda_178 Guanylate kinase-like domain of Cask {Human (Homo 96.03
d1m8pa3183 ATP sulfurylase C-terminal domain {Fungus (Penicil 96.02
d1bifa1213 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata 96.02
d1h65a_257 Chloroplast protein translocon GTPase Toc34 {Garde 96.02
d1gkya_186 Guanylate kinase {Baker's yeast (Saccharomyces cer 96.01
d2qm8a1323 Metallochaperone MeaB {Methylobacterium extorquens 96.0
d1tf7a2242 Circadian clock protein KaiC {Synechococcus sp. st 95.99
d1xjca_165 Molybdopterin-guanine dinucleotide biosynthesis pr 95.99
d1sq5a_308 Pantothenate kinase PanK {Escherichia coli [TaxId: 95.97
d1tf7a1242 Circadian clock protein KaiC {Synechococcus sp. st 95.96
d2cdna1181 Adenylate kinase {Mycobacterium tuberculosis [TaxI 95.96
d1tq4a_400 Interferon-inducible GTPase {Mouse (Mus musculus) 95.96
d1y63a_174 Probable kinase LmjF30.1890 {Leishmania major [Tax 95.93
d1akya1180 Adenylate kinase {Baker's yeast (Saccharomyces cer 95.92
d1r7ra3265 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 95.92
d1e4va1179 Adenylate kinase {Escherichia coli [TaxId: 562]} 95.91
d1ckea_225 CMP kinase {Escherichia coli [TaxId: 562]} 95.9
d1lv7a_256 AAA domain of cell division protein FtsH {Escheric 95.9
d1d2na_246 Hexamerization domain of N-ethylmalemide-sensitive 95.89
d1lvga_190 Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 95.88
d1q3ta_223 CMP kinase {Streptococcus pneumoniae [TaxId: 1313] 95.87
d1viaa_161 Shikimate kinase (AroK) {Campylobacter jejuni [Tax 95.86
d1ixza_247 AAA domain of cell division protein FtsH {Thermus 95.82
d1e6ca_170 Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax 95.82
d1v5wa_258 Meiotic recombination protein DMC1/LIM15 homolog { 95.81
d1in4a2238 Holliday junction helicase RuvB {Thermotoga mariti 95.8
d1e32a2258 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 95.8
d1lw7a2192 Transcriptional regulator NadR, ribosylnicotinamid 95.78
d1yrba1244 ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss 95.77
d1wf3a1178 GTPase Era, N-terminal domain {Thermus thermophilu 95.76
d2gj8a1161 Probable tRNA modification GTPase TrmE (MnmE), G d 95.76
d1egaa1179 GTPase Era, N-terminal domain {Escherichia coli [T 95.75
d1udxa2180 Obg GTP-binding protein middle domain {Thermus the 95.74
d2cxxa1184 GTP-binding protein engB {Pyrococcus horikoshii [T 95.73
d1ixsb2239 Holliday junction helicase RuvB {Thermus thermophi 95.69
d2gj8a1161 Probable tRNA modification GTPase TrmE (MnmE), G d 95.68
d2fh5b1207 Signal recognition particle receptor beta-subunit 95.68
d1rz3a_198 Hypothetical protein rbstp0775 {Bacillus stearothe 95.67
d1nksa_194 Adenylate kinase {Archaeon Sulfolobus acidocaldari 95.67
d1lnza2185 Obg GTP-binding protein middle domain {Bacillus su 95.67
d1uj2a_213 Uridine-cytidine kinase 2 {Human (Homo sapiens) [T 95.65
d1mkya2186 Probable GTPase Der, N-terminal and middle domains 95.64
d2iyva1165 Shikimate kinase (AroK) {Mycobacterium tuberculosi 95.61
d1f6ba_186 SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 95.61
d1tf7a1242 Circadian clock protein KaiC {Synechococcus sp. st 95.6
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 95.6
d1xp8a1268 RecA protein, ATPase-domain {Deinococcus radiodura 95.57
d1wb1a4179 Elongation factor SelB, N-terminal domain {Methano 95.57
d1u94a1263 RecA protein, ATPase-domain {Escherichia coli [Tax 95.54
d1kgda_178 Guanylate kinase-like domain of Cask {Human (Homo 95.53
d1h65a_257 Chloroplast protein translocon GTPase Toc34 {Garde 95.52
d1gkya_186 Guanylate kinase {Baker's yeast (Saccharomyces cer 95.52
d1tq4a_400 Interferon-inducible GTPase {Mouse (Mus musculus) 95.5
d1mkya1171 Probable GTPase Der, N-terminal and middle domains 95.43
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 95.42
d1r8sa_160 ADP-ribosylation factor {Human (Homo sapiens), ARF 95.42
d1nrjb_209 Signal recognition particle receptor beta-subunit 95.41
d1n0wa_242 DNA repair protein Rad51, catalytic domain {Human 95.41
d1p9ra_401 Extracellular secretion NTPase EpsE {Vibrio choler 95.37
d1qhxa_178 Chloramphenicol phosphotransferase {Streptomyces v 95.37
d2qtvb1166 SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta 95.37
d1m7ga_208 Adenosine-5'phosphosulfate kinase (APS kinase) {Fu 95.37
d1g6oa_323 Hexameric traffic ATPase, HP0525 {Helicobacter pyl 95.36
d1fnna2276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 95.36
d1ksha_165 ADP-ribosylation factor {Mouse (Mus musculus), ARL 95.36
d2fnaa2283 Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ 95.34
d1uj2a_213 Uridine-cytidine kinase 2 {Human (Homo sapiens) [T 95.32
d2bdta1176 Hypothetical protein BH3686 {Bacillus halodurans [ 95.32
d1egaa1179 GTPase Era, N-terminal domain {Escherichia coli [T 95.29
d1puia_188 Probable GTPase EngB {Escherichia coli [TaxId: 562 95.29
d1lvga_190 Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 95.28
d1wf3a1178 GTPase Era, N-terminal domain {Thermus thermophilu 95.24
d1knxa2177 HPr kinase HprK C-terminal domain {Mycoplasma pneu 95.24
d1g8pa_333 ATPase subunit of magnesium chelatase, BchI {Rhodo 95.22
d1udxa2180 Obg GTP-binding protein middle domain {Thermus the 95.19
d1sq5a_308 Pantothenate kinase PanK {Escherichia coli [TaxId: 95.18
d1rkba_173 Adenylate kinase {Human (Homo sapiens), isoenzyme 95.18
d1svma_362 Papillomavirus large T antigen helicase domain {Si 95.18
d1puia_188 Probable GTPase EngB {Escherichia coli [TaxId: 562 95.17
d1f6ba_186 SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 95.16
d1upta_169 ADP-ribosylation factor {Human (Homo sapiens), ARL 95.13
d1x6va3195 Adenosine-5'phosphosulfate kinase (APS kinase) {Hu 95.1
d1zj6a1177 ADP-ribosylation factor {Human (Homo sapiens), ARL 95.09
d1p5zb_241 Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 95.08
d1nn5a_209 Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 95.07
d1okkd2207 GTPase domain of the signal recognition particle r 94.96
d2i3ba1189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 94.94
d1g7sa4227 Initiation factor IF2/eIF5b, N-terminal (G) domain 94.93
d1qf9a_194 UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 94.88
d2vp4a1197 Deoxyribonucleoside kinase {Fruit fly (Drosophila 94.87
d1kkma_176 HPr kinase HprK C-terminal domain {Lactobacillus c 94.87
d1sxjd2237 Replication factor C2 {Baker's yeast (Saccharomyce 94.85
d2p67a1327 LAO/AO transport system kinase ArgK {Escherichia c 94.84
d1khta_190 Adenylate kinase {Archaeon Methanococcus voltae [T 94.8
d1ls1a2207 GTPase domain of the signal sequence recognition p 94.79
d1ak2a1190 Adenylate kinase {Cow (Bos taurus), mitochondrial 94.78
d4tmka_210 Thymidylate kinase {Escherichia coli [TaxId: 562]} 94.7
d1sxjb2224 Replication factor C4 {Baker's yeast (Saccharomyce 94.68
d1uf9a_191 Dephospho-CoA kinase {Thermus thermophilus [TaxId: 94.66
d1w44a_321 NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} 94.57
d1wxqa1319 GTP-binding protein PH0525 {Pyrococcus horikoshii 94.56
d1ls1a2207 GTPase domain of the signal sequence recognition p 94.52
d1sxjc2227 Replication factor C3 {Baker's yeast (Saccharomyce 94.52
d1r6bx3315 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 94.5
d2qtvb1166 SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta 94.48
d1a7ja_288 Phosphoribulokinase {Rhodobacter sphaeroides [TaxI 94.46
d1ukza_196 Uridylate kinase {Baker's yeast (Saccharomyces cer 94.46
d1w5sa2287 CDC6-like protein APE0152, N-terminal domain {Aero 94.42
d2vp4a1197 Deoxyribonucleoside kinase {Fruit fly (Drosophila 94.4
d1nn5a_209 Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 94.37
d1ko7a2169 HPr kinase HprK C-terminal domain {Staphylococcus 94.37
d1kaga_169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 94.36
d1ni3a1296 YchF GTP-binding protein N-terminal domain {Fissio 94.36
d2qm8a1323 Metallochaperone MeaB {Methylobacterium extorquens 94.35
d1fzqa_176 ADP-ribosylation factor {Mouse (Mus musculus), ARL 94.35
d1q3ta_223 CMP kinase {Streptococcus pneumoniae [TaxId: 1313] 94.31
d1wb1a4179 Elongation factor SelB, N-terminal domain {Methano 94.31
d1viaa_161 Shikimate kinase (AroK) {Campylobacter jejuni [Tax 94.29
d2i1qa2258 DNA repair protein Rad51, catalytic domain {Archae 94.27
d1m7ga_208 Adenosine-5'phosphosulfate kinase (APS kinase) {Fu 94.26
d1r8sa_160 ADP-ribosylation factor {Human (Homo sapiens), ARF 94.25
d1zaka1189 Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} 94.23
d1xzpa2160 TrmE GTPase domain {Thermotoga maritima [TaxId: 23 94.22
d1zd9a1164 ADP-ribosylation factor {Human (Homo sapiens), ARL 94.22
d1upta_169 ADP-ribosylation factor {Human (Homo sapiens), ARL 94.21
d1sxje2252 Replication factor C5 {Baker's yeast (Saccharomyce 94.2
d1p5zb_241 Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 94.2
d1vmaa2213 GTPase domain of the signal recognition particle r 94.19
d1jwyb_306 Dynamin G domain {Dictyostelium discoideum [TaxId: 94.17
d1gvnb_273 Plasmid maintenance system epsilon/zeta, toxin zet 94.15
d1szpa2251 DNA repair protein Rad51, catalytic domain {Baker' 94.14
d1odfa_286 Hypothetical protein Ygr205W {Baker's yeast (Sacch 94.13
d1tmka_214 Thymidylate kinase {Baker's yeast (Saccharomyces c 94.13
d1ksha_165 ADP-ribosylation factor {Mouse (Mus musculus), ARL 94.12
d2fh5b1207 Signal recognition particle receptor beta-subunit 94.11
d1bifa1213 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata 94.11
d1yj5a2172 5' polynucleotide kinase-3' phosphatase, C-termina 94.1
d1j8yf2211 GTPase domain of the signal sequence recognition p 94.03
d3raba_169 Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} 94.02
d1e6ca_170 Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax 93.99
d1kk1a3195 Initiation factor eIF2 gamma subunit, N-terminal ( 93.99
d2f7sa1186 Rab27b {Human (Homo sapiens) [TaxId: 9606]} 93.97
d1zj6a1177 ADP-ribosylation factor {Human (Homo sapiens), ARL 93.95
d1ky3a_175 Rab-related protein ypt7p {Baker's yeast (Saccharo 93.94
d1jjva_205 Dephospho-CoA kinase {Haemophilus influenzae [TaxI 93.88
d3adka_194 Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} 93.87
d1knxa2177 HPr kinase HprK C-terminal domain {Mycoplasma pneu 93.87
d1teva_194 UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] 93.86
d1mo6a1269 RecA protein, ATPase-domain {Mycobacterium tubercu 93.77
d2f9la1175 Rab11b {Human (Homo sapiens) [TaxId: 9606]} 93.75
d1vhta_208 Dephospho-CoA kinase {Escherichia coli [TaxId: 562 93.73
d1nksa_194 Adenylate kinase {Archaeon Sulfolobus acidocaldari 93.73
d1z2aa1164 Rab23 {Mouse (Mus musculus) [TaxId: 10090]} 93.67
d2qy9a2211 GTPase domain of the signal recognition particle r 93.67
d1uf9a_191 Dephospho-CoA kinase {Thermus thermophilus [TaxId: 93.63
d2gjsa1168 Rad {Human (Homo sapiens) [TaxId: 9606]} 93.63
d1wmsa_174 Rab9a {Human (Homo sapiens) [TaxId: 9606]} 93.61
d1a7ja_288 Phosphoribulokinase {Rhodobacter sphaeroides [TaxI 93.58
d1xp8a1268 RecA protein, ATPase-domain {Deinococcus radiodura 93.56
d2iyva1165 Shikimate kinase (AroK) {Mycobacterium tuberculosi 93.56
d1zina1182 Adenylate kinase {Bacillus stearothermophilus [Tax 93.5
d2akab1299 Dynamin G domain {Rat (Rattus norvegicus) [TaxId: 93.5
d2a5ja1173 Rab2b {Human (Homo sapiens) [TaxId: 9606]} 93.49
d2f7sa1186 Rab27b {Human (Homo sapiens) [TaxId: 9606]} 93.46
d1ctqa_166 cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 93.45
d1ofha_309 HslU {Haemophilus influenzae [TaxId: 727]} 93.45
d1tmka_214 Thymidylate kinase {Baker's yeast (Saccharomyces c 93.44
d1pzna2254 DNA repair protein Rad51, catalytic domain {Archae 93.39
d1jala1278 YchF GTP-binding protein N-terminal domain {Haemop 93.34
d1f5na2277 Interferon-induced guanylate-binding protein 1 (GB 93.29
d1htwa_158 Hypothetical protein HI0065 {Haemophilus influenza 93.28
d1vg8a_184 Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} 93.27
d1g7sa4227 Initiation factor IF2/eIF5b, N-terminal (G) domain 93.25
d2erxa1171 di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 93.22
d4tmka_210 Thymidylate kinase {Escherichia coli [TaxId: 562]} 93.19
d1s3ga1182 Adenylate kinase {Bacillus globisporus [TaxId: 145 93.17
d2g3ya1172 GTP-binding protein GEM {Human (Homo sapiens) [Tax 93.14
d2ew1a1171 Rab30 {Human (Homo sapiens) [TaxId: 9606]} 93.11
d1f5na2277 Interferon-induced guanylate-binding protein 1 (GB 93.08
d2erya1171 r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 93.07
d1gsia_208 Thymidylate kinase {Mycobacterium tuberculosis [Ta 93.07
d1kaoa_167 Rap2a {Human (Homo sapiens) [TaxId: 9606]} 93.07
d1v5wa_258 Meiotic recombination protein DMC1/LIM15 homolog { 93.06
d1fzqa_176 ADP-ribosylation factor {Mouse (Mus musculus), ARL 93.05
d2bcgy1194 GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisi 93.04
d1g16a_166 Rab-related protein Sec4 {Baker's yeast (Saccharom 93.04
d1okkd2207 GTPase domain of the signal recognition particle r 93.01
d1x3sa1177 Rab18 {Human (Homo sapiens) [TaxId: 9606]} 92.98
d1moza_182 ADP-ribosylation factor {Baker's yeast (Saccharomy 92.96
d1kkma_176 HPr kinase HprK C-terminal domain {Lactobacillus c 92.95
d2fnaa2283 Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ 92.91
d1sxja2253 Replication factor C1 {Baker's yeast (Saccharomyce 92.87
d1zd9a1164 ADP-ribosylation factor {Human (Homo sapiens), ARL 92.84
d1xzpa2160 TrmE GTPase domain {Thermotoga maritima [TaxId: 23 92.83
d1ckea_225 CMP kinase {Escherichia coli [TaxId: 562]} 92.82
d1xtqa1167 GTP-binding protein RheB {Human (Homo sapiens) [Ta 92.82
d1z0fa1166 Rab14 {Human (Homo sapiens) [TaxId: 9606]} 92.81
d1e4va1179 Adenylate kinase {Escherichia coli [TaxId: 562]} 92.79
d2bmea1174 Rab4a {Human (Homo sapiens) [TaxId: 9606]} 92.68
d2cdna1181 Adenylate kinase {Mycobacterium tuberculosis [TaxI 92.64
d1odfa_286 Hypothetical protein Ygr205W {Baker's yeast (Sacch 92.62
d1e0sa_173 ADP-ribosylation factor {Human (Homo sapiens), ARF 92.59
d3raba_169 Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} 92.55
d2ak3a1189 Adenylate kinase {Cow (Bos taurus), mitochondrial 92.55
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 92.53
d2fu5c1173 Rab8a {Mouse (Mus musculus) [TaxId: 10090]} 92.51
d1z06a1165 Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} 92.47
d2dy1a2267 Elongation factor G (EF-G), N-terminal (G) domain 92.39
d1l8qa2213 Chromosomal replication initiation factor DnaA {Aq 92.39
d1ky3a_175 Rab-related protein ypt7p {Baker's yeast (Saccharo 92.37
d1jjva_205 Dephospho-CoA kinase {Haemophilus influenzae [TaxI 92.33
d1yzqa1164 Rab6 {Human (Homo sapiens) [TaxId: 9606]} 92.29
d1nija1222 Hypothetical protein YjiA, N-terminal domain {Esch 92.18
d1mh1a_183 Rac {Human (Homo sapiens) [TaxId: 9606]} 92.18
d1ko7a2169 HPr kinase HprK C-terminal domain {Staphylococcus 92.16
d1z08a1167 Rab21 {Human (Homo sapiens) [TaxId: 9606]} 92.16
d1akya1180 Adenylate kinase {Baker's yeast (Saccharomyces cer 92.16
d1vmaa2213 GTPase domain of the signal recognition particle r 92.13
d2c78a3204 Elongation factor Tu (EF-Tu), N-terminal (G) domai 92.13
d1kmqa_177 RhoA {Human (Homo sapiens) [TaxId: 9606]} 92.1
d1gsia_208 Thymidylate kinase {Mycobacterium tuberculosis [Ta 92.04
d1xpua3289 Transcription termination factor Rho, ATPase domai 92.02
d1jwyb_306 Dynamin G domain {Dictyostelium discoideum [TaxId: 91.96
d2atva1168 Ras-like estrogen-regulated growth inhibitor, RERG 91.94
d1z0ja1167 Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} 91.94
d1xpua3289 Transcription termination factor Rho, ATPase domai 91.93
d1moza_182 ADP-ribosylation factor {Baker's yeast (Saccharomy 91.92
d1ctqa_166 cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 91.91
d2fn4a1173 r-Ras {Human (Homo sapiens) [TaxId: 9606]} 91.9
d1in4a2238 Holliday junction helicase RuvB {Thermotoga mariti 91.87
d1wxqa1319 GTP-binding protein PH0525 {Pyrococcus horikoshii 91.83
d2akab1299 Dynamin G domain {Rat (Rattus norvegicus) [TaxId: 91.81
d2f9la1175 Rab11b {Human (Homo sapiens) [TaxId: 9606]} 91.8
d1z2aa1164 Rab23 {Mouse (Mus musculus) [TaxId: 10090]} 91.79
d1qvra3315 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 91.78
d1uaaa1306 DEXX box DNA helicase {Escherichia coli, RepD [Tax 91.78
d2bmja1175 Centaurin gamma 1, G domain {Human (Homo sapiens) 91.74
d1vg8a_184 Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} 91.74
d2qn6a3205 Initiation factor eIF2 gamma subunit, N-terminal ( 91.74
d2gjsa1168 Rad {Human (Homo sapiens) [TaxId: 9606]} 91.71
d1i2ma_170 Ran {Human (Homo sapiens) [TaxId: 9606]} 91.7
d1deka_241 Deoxynucleoside monophosphate kinase {Bacteriophag 91.68
d1e9ra_433 Bacterial conjugative coupling protein TrwB {Esche 91.67
d1azta2221 Transducin (alpha subunit) {Cow (Bos taurus) [TaxI 91.67
d1pjra1318 DEXX box DNA helicase {Bacillus stearothermophilus 91.63
d2g6ba1170 Rab26 {Human (Homo sapiens) [TaxId: 9606]} 91.63
d1u8za_168 Ras-related protein RalA {Cotton-top tamarin (Sagu 91.62
d1htwa_158 Hypothetical protein HI0065 {Haemophilus influenza 91.61
d1ek0a_170 Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [T 91.59
d1r6bx2268 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 91.58
d1xtqa1167 GTP-binding protein RheB {Human (Homo sapiens) [Ta 91.56
d1j8yf2211 GTPase domain of the signal sequence recognition p 91.54
d2erxa1171 di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 91.54
d1w36d1359 Exodeoxyribonuclease V alpha chain (RecD) {Escheri 91.49
d2ocpa1241 Deoxyguanosine kinase {Human (Homo sapiens) [TaxId 91.47
d1r2qa_170 Rab5a {Human (Homo sapiens) [TaxId: 9606]} 91.42
d1r6bx3315 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 91.34
d1vhta_208 Dephospho-CoA kinase {Escherichia coli [TaxId: 562 91.33
d1g16a_166 Rab-related protein Sec4 {Baker's yeast (Saccharom 91.29
d2a5yb3277 CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI 91.28
d1u94a1263 RecA protein, ATPase-domain {Escherichia coli [Tax 91.27
d1x1ra1169 Ras-related protein M-Ras (XRas) {Mouse (Mus muscu 91.26
d2g3ya1172 GTP-binding protein GEM {Human (Homo sapiens) [Tax 91.22
d2bv3a2276 Elongation factor G (EF-G), N-terminal (G) domain 91.22
d2bcgy1194 GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisi 91.21
d1zcba2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 91.2
d2qy9a2211 GTPase domain of the signal recognition particle r 91.18
d1g41a_443 HslU {Haemophilus influenzae [TaxId: 727]} 91.18
d1d2na_246 Hexamerization domain of N-ethylmalemide-sensitive 91.1
d2ew1a1171 Rab30 {Human (Homo sapiens) [TaxId: 9606]} 91.09
d1kaoa_167 Rap2a {Human (Homo sapiens) [TaxId: 9606]} 91.03
d2a5ja1173 Rab2b {Human (Homo sapiens) [TaxId: 9606]} 91.0
d1wmsa_174 Rab9a {Human (Homo sapiens) [TaxId: 9606]} 90.91
d1sxjd2237 Replication factor C2 {Baker's yeast (Saccharomyce 90.87
d2erya1171 r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 90.87
d2atxa1185 RhoQ {Human (Homo sapiens) [TaxId: 9606]} 90.85
d1z0fa1166 Rab14 {Human (Homo sapiens) [TaxId: 9606]} 90.8
d1i2ma_170 Ran {Human (Homo sapiens) [TaxId: 9606]} 90.78
d2ngra_191 CDC42 {Human (Homo sapiens) [TaxId: 9606]} 90.74
d1z06a1165 Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} 90.71
d1kk1a3195 Initiation factor eIF2 gamma subunit, N-terminal ( 90.68
d1x3sa1177 Rab18 {Human (Homo sapiens) [TaxId: 9606]} 90.66
d1r7ra3265 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 90.65
d1ixsb2239 Holliday junction helicase RuvB {Thermus thermophi 90.63
d1a5ta2207 delta prime subunit of DNA polymerase III, N-domai 90.55
d1um8a_364 ClpX {Helicobacter pylori [TaxId: 210]} 90.54
d1mh1a_183 Rac {Human (Homo sapiens) [TaxId: 9606]} 90.53
d1njfa_239 delta prime subunit of DNA polymerase III, N-domai 90.53
d1fnna2276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 90.39
d1e0sa_173 ADP-ribosylation factor {Human (Homo sapiens), ARF 90.38
d1z0ja1167 Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} 90.28
d1yzqa1164 Rab6 {Human (Homo sapiens) [TaxId: 9606]} 90.24
d2fu5c1173 Rab8a {Mouse (Mus musculus) [TaxId: 10090]} 90.19
d1c1ya_167 Rap1A {Human (Homo sapiens) [TaxId: 9606]} 90.17
d1azta2221 Transducin (alpha subunit) {Cow (Bos taurus) [TaxI 90.15
d1z08a1167 Rab21 {Human (Homo sapiens) [TaxId: 9606]} 90.09
d2dy1a2267 Elongation factor G (EF-G), N-terminal (G) domain 90.08
d1kmqa_177 RhoA {Human (Homo sapiens) [TaxId: 9606]} 90.04
d1puja_273 Probable GTPase YlqF {Bacillus subtilis [TaxId: 14 89.99
d2bmea1174 Rab4a {Human (Homo sapiens) [TaxId: 9606]} 89.83
d1m7ba_179 RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} 89.81
d1e32a2258 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 89.79
d1zcba2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 89.75
d1sxjb2224 Replication factor C4 {Baker's yeast (Saccharomyce 89.63
d2fn4a1173 r-Ras {Human (Homo sapiens) [TaxId: 9606]} 89.62
d1ni3a1296 YchF GTP-binding protein N-terminal domain {Fissio 89.61
d2bv3a2276 Elongation factor G (EF-G), N-terminal (G) domain 89.58
d2qn6a3205 Initiation factor eIF2 gamma subunit, N-terminal ( 89.47
d1ek0a_170 Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [T 89.41
d1d2ea3196 Elongation factor Tu (EF-Tu), N-terminal (G) domai 89.36
d2ocpa1241 Deoxyguanosine kinase {Human (Homo sapiens) [TaxId 89.31
d2atxa1185 RhoQ {Human (Homo sapiens) [TaxId: 9606]} 89.25
d1u8za_168 Ras-related protein RalA {Cotton-top tamarin (Sagu 89.21
d1jbka_195 ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} 89.12
d1p6xa_333 Thymidine kinase {Equine herpesvirus type 4 [TaxId 89.02
d1x1ra1169 Ras-related protein M-Ras (XRas) {Mouse (Mus muscu 88.96
d2g6ba1170 Rab26 {Human (Homo sapiens) [TaxId: 9606]} 88.76
d1r2qa_170 Rab5a {Human (Homo sapiens) [TaxId: 9606]} 88.66
d2atva1168 Ras-like estrogen-regulated growth inhibitor, RERG 88.56
d1sxjc2227 Replication factor C3 {Baker's yeast (Saccharomyce 88.46
d1sxje2252 Replication factor C5 {Baker's yeast (Saccharomyce 88.39
d2bmja1175 Centaurin gamma 1, G domain {Human (Homo sapiens) 88.32
d1jala1278 YchF GTP-binding protein N-terminal domain {Haemop 88.16
d2jdid3276 Central domain of beta subunit of F1 ATP synthase 88.05
d1qvra2387 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 87.97
d2ngra_191 CDC42 {Human (Homo sapiens) [TaxId: 9606]} 87.89
d1w5sa2287 CDC6-like protein APE0152, N-terminal domain {Aero 87.68
d1e2ka_329 Thymidine kinase {Herpes simplex virus type 1, dif 87.63
d2c78a3204 Elongation factor Tu (EF-Tu), N-terminal (G) domai 87.59
d2jdid3276 Central domain of beta subunit of F1 ATP synthase 87.51
d1nija1222 Hypothetical protein YjiA, N-terminal domain {Esch 87.48
d1mo6a1269 RecA protein, ATPase-domain {Mycobacterium tubercu 87.48
d2bcjq2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 87.42
d1m7ba_179 RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} 87.41
d1c1ya_167 Rap1A {Human (Homo sapiens) [TaxId: 9606]} 87.38
d1zunb3222 Sulfate adenylate transferase subunit cysN/C, EF-T 86.81
d1deka_241 Deoxynucleoside monophosphate kinase {Bacteriophag 86.45
d1tuea_205 Replication protein E1 helicase domain {Human papi 86.27
d1osna_331 Thymidine kinase {Varicella-zoster virus [TaxId: 1 86.0
d1qvra3315 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 85.91
d1u0ja_267 Rep 40 protein helicase domain {Adeno-associated v 85.72
d1svma_362 Papillomavirus large T antigen helicase domain {Si 85.67
d1puja_273 Probable GTPase YlqF {Bacillus subtilis [TaxId: 14 85.66
d1e2ka_329 Thymidine kinase {Herpes simplex virus type 1, dif 85.66
d1l8qa2213 Chromosomal replication initiation factor DnaA {Aq 85.6
d1svsa1195 Transducin (alpha subunit) {Rat (Rattus norvegicus 85.47
d1jnya3224 Elongation factor eEF-1alpha, N-terminal (G) domai 85.35
d2bcjq2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 84.98
d1svsa1195 Transducin (alpha subunit) {Rat (Rattus norvegicus 84.98
d1n0ua2341 Elongation factor 2 (eEF-2), N-terminal (G) domain 84.2
d2bmfa2305 Dengue virus helicase {Dengue virus type 2 [TaxId: 84.0
d1d2ea3196 Elongation factor Tu (EF-Tu), N-terminal (G) domai 83.28
d1osna_331 Thymidine kinase {Varicella-zoster virus [TaxId: 1 83.19
d1r5ba3245 Eukaryotic peptide chain release factor ERF2, G do 83.17
d1um8a_364 ClpX {Helicobacter pylori [TaxId: 210]} 83.12
g1qhh.1623 DEXX box DNA helicase {Bacillus stearothermophilus 82.93
d1j3ba1318 Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxalo 82.75
d2olra1313 Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxalo 82.13
d1n0ua2341 Elongation factor 2 (eEF-2), N-terminal (G) domain 81.9
d1g8pa_333 ATPase subunit of magnesium chelatase, BchI {Rhodo 81.35
d1f60a3239 Elongation factor eEF-1alpha, N-terminal (G) domai 81.09
d1r6bx2268 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 80.01
>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: ABC transporter ATPase domain-like
domain: Maltose transport protein MalK, N-terminal domain
species: Escherichia coli [TaxId: 562]

Probab=100.00  E-value=0  Score=338.34  Aligned_cols=207  Identities=25%  Similarity=0.348  Sum_probs=164.7

Q ss_pred             CEEEECCEEEEECCEEEEEECCCCCCHHHHHHHHHCCCCCCCCCEEEEEECCCCCCCCCCC-CEEEEECCCCCCCCCCCH
Q ss_conf             2464241577848929999769999389999999469899998121999969347986765-219998378988999999
Q 000612          165 LTILKDVSGVIKPGRLTLLLGPPSSGKTTLLLALAGKLDPTLKVSGTVTYNGHDMDEFVPQ-RTAAYISQHDNHIGEMTV  243 (1391)
Q Consensus       165 ~~iL~~vs~~i~pG~~~~ilGp~GsGKSTLL~~LaG~~~~~~~~~G~v~~nG~~~~~~~~~-~~~~yv~Q~d~~~~~lTV  243 (1391)
                      +++|+|+|+.+++||+++|+||||||||||+++|+|.++|+   +|+|.+||.++.+..+. +.++||+|++.+++.+||
T Consensus        13 ~~~l~~isl~i~~Gei~~liGpsGsGKSTLl~~i~Gl~~p~---sG~I~i~g~~i~~~~~~~r~ig~v~Q~~~l~~~~tv   89 (232)
T d2awna2          13 VVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETIT---SGDLFIGEKRMNDTPPAERGVGMVFQSYALYPHLSV   89 (232)
T ss_dssp             EEEEEEEEEEECTTCEEEEECCTTSSHHHHHHHHHTSSCCS---EEEEEESSSCCTTSCGGGTCEEEECSSCCC------
T ss_pred             EEEEEEEEEEECCCCEEEEECCCCCHHHHHHHHHHCCCCCC---CCEEEECCEECCCCCHHHCEEEEECCCCCCCCCHHH
T ss_conf             99981117788699899999899982999999996587888---888999999778886444322234334202643337


Q ss_pred             HHHHHHHHHHCCCCCHHHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCC
Q ss_conf             99999865612787314566998999986299999886799999852224477999999999099543554334644556
Q 000612          244 RETLAFSARCQGVGTRYEMLTELARREKAAGIKPDPDIDVYMKAIATEGQEANVITDYYLKVLGLDVCADTMVGDEMIRG  323 (1391)
Q Consensus       244 rEtl~f~~~~~g~~~~~~~~~~~~~~~~~~~~~pd~d~d~~~~a~~~~~~~~~~~~d~il~~lgL~~~~dt~VG~~~~~g  323 (1391)
                      +||+.|+.++++...                                  ++...+++.+++.++|++..|..+.     .
T Consensus        90 ~eni~~~~~~~~~~~----------------------------------~~~~~~v~~~l~~~~l~~~~~~~~~-----~  130 (232)
T d2awna2          90 AENMSFGLKLAGAKK----------------------------------EVINQRVNQVAEVLQLAHLLDRKPK-----A  130 (232)
T ss_dssp             -------------------------------------------------CHHHHHHHHHHHHC-----------------
T ss_pred             HHHHHHHHHHCCCCH----------------------------------HHHHHHHHHHHHHCCCHHHHHCCHH-----H
T ss_conf             889789998759988----------------------------------9999999999975788656648965-----6


Q ss_pred             CCHHHHHHHHHHHHHHCCCCCCEEECCCCCCCHHHHHHHHHHHHHHHHHCCCEEEEEEECCCHHHHHHCCEEEEECCCEE
Q ss_conf             87445668999999733985342235998999997999999999986703986999982590038841370999739739
Q 000612          324 ISGGQKKRVTTGEMMVGPALALFMDEISTGLDSSTTFQIVNCLRQNIHINSGTAVISLLQPAPETYDLFDDIILLSDGQI  403 (1391)
Q Consensus       324 lSGGqrkRvsia~~l~~~~~illlDEptsgLDs~t~~~i~~~L~~~~~~~~~t~ii~l~Q~~~~~~~~fD~i~lL~~G~i  403 (1391)
                      |||||||||+||++|+.+|++++|||||+|||+.++.++++.|+++.+..+.| ++.++|...++..++|+|++|.+|++
T Consensus       131 LSGGqkQRvaiAraL~~~P~illlDEPts~LD~~~~~~i~~~l~~l~~~~g~t-ii~vTHd~~~a~~~~dri~vm~~G~i  209 (232)
T d2awna2         131 LSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRLGRT-MIYVTHDQVEAMTLADKIVVLDAGRV  209 (232)
T ss_dssp             ---------CHHHHHHTCCSEEEEESTTTTSCHHHHHHHHHHHHHHHHHSCCE-EEEEESCHHHHHHHCSEEEEEETTEE
T ss_pred             CCHHHHHHHHHHHHHHCCCCEEEECCCCCCCCHHHHHHHHHHHHHHHHHCCCE-EEEEECCHHHHHHHCCEEEEEECCEE
T ss_conf             99999999999999703998899758887889889989999999998742987-99994899999996999999979999


Q ss_pred             EEECCHHHHHH
Q ss_conf             98539667999
Q 000612          404 VYQGPRELVLE  414 (1391)
Q Consensus       404 v~~G~~~~~~~  414 (1391)
                      +++|+.+++.+
T Consensus       210 v~~G~~~el~~  220 (232)
T d2awna2         210 AQVGKPLELYH  220 (232)
T ss_dssp             EEEECHHHHHH
T ss_pred             EEEECHHHHHH
T ss_conf             99808999973
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Back     information, alignment and structure
>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Back     information, alignment and structure
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Back     information, alignment and structure
>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Back     information, alignment and structure
>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Back     information, alignment and structure
>d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1e69a_ c.37.1.12 (A:) Smc head domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1w1wa_ c.37.1.12 (A:) Smc head domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1e69a_ c.37.1.12 (A:) Smc head domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1w1wa_ c.37.1.12 (A:) Smc head domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ewqa2 c.37.1.12 (A:542-765) DNA repair protein MutS, the C-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1wb9a2 c.37.1.12 (A:567-800) DNA repair protein MutS, the C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} Back     information, alignment and structure
>d1ewqa2 c.37.1.12 (A:542-765) DNA repair protein MutS, the C-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} Back     information, alignment and structure
>d1wb9a2 c.37.1.12 (A:567-800) DNA repair protein MutS, the C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qhla_ c.37.1.12 (A:) Cell division protein MukB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1qhla_ c.37.1.12 (A:) Cell division protein MukB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} Back     information, alignment and structure
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1tq4a_ c.37.1.8 (A:) Interferon-inducible GTPase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1wb1a4 c.37.1.8 (A:1-179) Elongation factor SelB, N-terminal domain {Methanococcus maripaludis [TaxId: 39152]} Back     information, alignment and structure
>d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1tq4a_ c.37.1.8 (A:) Interferon-inducible GTPase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} Back     information, alignment and structure
>d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1knxa2 c.91.1.2 (A:133-309) HPr kinase HprK C-terminal domain {Mycoplasma pneumoniae [TaxId: 2104]} Back     information, alignment and structure
>d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} Back     information, alignment and structure
>d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Back     information, alignment and structure
>d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} Back     information, alignment and structure
>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} Back     information, alignment and structure
>d1p5zb_ c.37.1.1 (B:) Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g7sa4 c.37.1.8 (A:1-227) Initiation factor IF2/eIF5b, N-terminal (G) domain {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1kkma_ c.91.1.2 (A:) HPr kinase HprK C-terminal domain {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} Back     information, alignment and structure
>d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Back     information, alignment and structure
>d1wxqa1 c.37.1.8 (A:1-319) GTP-binding protein PH0525 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ko7a2 c.91.1.2 (A:130-298) HPr kinase HprK C-terminal domain {Staphylococcus xylosus [TaxId: 1288]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ni3a1 c.37.1.8 (A:11-306) YchF GTP-binding protein N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} Back     information, alignment and structure
>d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1wb1a4 c.37.1.8 (A:1-179) Elongation factor SelB, N-terminal domain {Methanococcus maripaludis [TaxId: 39152]} Back     information, alignment and structure
>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} Back     information, alignment and structure
>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} Back     information, alignment and structure
>d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1p5zb_ c.37.1.1 (B:) Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1jwyb_ c.37.1.8 (B:) Dynamin G domain {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1tmka_ c.37.1.1 (A:) Thymidylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} Back     information, alignment and structure
>d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d1kk1a3 c.37.1.8 (A:6-200) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Archaeon Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} Back     information, alignment and structure
>d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1jjva_ c.37.1.1 (A:) Dephospho-CoA kinase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1knxa2 c.91.1.2 (A:133-309) HPr kinase HprK C-terminal domain {Mycoplasma pneumoniae [TaxId: 2104]} Back     information, alignment and structure
>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vhta_ c.37.1.1 (A:) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2akab1 c.37.1.8 (B:6-304) Dynamin G domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1tmka_ c.37.1.1 (A:) Thymidylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1jala1 c.37.1.8 (A:1-278) YchF GTP-binding protein N-terminal domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1f5na2 c.37.1.8 (A:7-283) Interferon-induced guanylate-binding protein 1 (GBP1), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1htwa_ c.37.1.18 (A:) Hypothetical protein HI0065 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1g7sa4 c.37.1.8 (A:1-227) Initiation factor IF2/eIF5b, N-terminal (G) domain {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} Back     information, alignment and structure
>d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f5na2 c.37.1.8 (A:7-283) Interferon-induced guanylate-binding protein 1 (GBP1), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} Back     information, alignment and structure
>d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} Back     information, alignment and structure
>d1kkma_ c.91.1.2 (A:) HPr kinase HprK C-terminal domain {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} Back     information, alignment and structure
>d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} Back     information, alignment and structure
>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dy1a2 c.37.1.8 (A:8-274) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus, EF-G-2 [TaxId: 274]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1jjva_ c.37.1.1 (A:) Dephospho-CoA kinase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nija1 c.37.1.10 (A:2-223) Hypothetical protein YjiA, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ko7a2 c.91.1.2 (A:130-298) HPr kinase HprK C-terminal domain {Staphylococcus xylosus [TaxId: 1288]} Back     information, alignment and structure
>d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2c78a3 c.37.1.8 (A:9-212) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1xpua3 c.37.1.11 (A:129-417) Transcription termination factor Rho, ATPase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jwyb_ c.37.1.8 (B:) Dynamin G domain {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1xpua3 c.37.1.11 (A:129-417) Transcription termination factor Rho, ATPase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} Back     information, alignment and structure
>d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1wxqa1 c.37.1.8 (A:1-319) GTP-binding protein PH0525 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2akab1 c.37.1.8 (B:6-304) Dynamin G domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} Back     information, alignment and structure
>d2bmja1 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2qn6a3 c.37.1.8 (A:2-206) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i2ma_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1deka_ c.37.1.1 (A:) Deoxynucleoside monophosphate kinase {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1e9ra_ c.37.1.11 (A:) Bacterial conjugative coupling protein TrwB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1azta2 c.37.1.8 (A:35-65,A:202-391) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} Back     information, alignment and structure
>d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} Back     information, alignment and structure
>d1htwa_ c.37.1.18 (A:) Hypothetical protein HI0065 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ocpa1 c.37.1.1 (A:37-277) Deoxyguanosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vhta_ c.37.1.1 (A:) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bv3a2 c.37.1.8 (A:7-282) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i2ma_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1kk1a3 c.37.1.8 (A:6-200) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Archaeon Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} Back     information, alignment and structure
>d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1azta2 c.37.1.8 (A:35-65,A:202-391) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dy1a2 c.37.1.8 (A:8-274) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus, EF-G-2 [TaxId: 274]} Back     information, alignment and structure
>d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1puja_ c.37.1.8 (A:) Probable GTPase YlqF {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ni3a1 c.37.1.8 (A:11-306) YchF GTP-binding protein N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2bv3a2 c.37.1.8 (A:7-282) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2qn6a3 c.37.1.8 (A:2-206) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1d2ea3 c.37.1.8 (A:55-250) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Cow (Bos taurus), mitochondrial [TaxId: 9913]} Back     information, alignment and structure
>d2ocpa1 c.37.1.1 (A:37-277) Deoxyguanosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} Back     information, alignment and structure
>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1p6xa_ c.37.1.1 (A:) Thymidine kinase {Equine herpesvirus type 4 [TaxId: 10331]} Back     information, alignment and structure
>d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2bmja1 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jala1 c.37.1.8 (A:1-278) YchF GTP-binding protein N-terminal domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2jdid3 c.37.1.11 (D:82-357) Central domain of beta subunit of F1 ATP synthase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1e2ka_ c.37.1.1 (A:) Thymidine kinase {Herpes simplex virus type 1, different strains [TaxId: 10298]} Back     information, alignment and structure
>d2c78a3 c.37.1.8 (A:9-212) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2jdid3 c.37.1.11 (D:82-357) Central domain of beta subunit of F1 ATP synthase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1nija1 c.37.1.10 (A:2-223) Hypothetical protein YjiA, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2bcjq2 c.37.1.8 (Q:38-66,Q:184-354) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zunb3 c.37.1.8 (B:16-237) Sulfate adenylate transferase subunit cysN/C, EF-Tu domain G-like domain {Pseudomonas syringae pv. tomato [TaxId: 323]} Back     information, alignment and structure
>d1deka_ c.37.1.1 (A:) Deoxynucleoside monophosphate kinase {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1tuea_ c.37.1.20 (A:) Replication protein E1 helicase domain {Human papillomavirus type 18 [TaxId: 333761]} Back     information, alignment and structure
>d1osna_ c.37.1.1 (A:) Thymidine kinase {Varicella-zoster virus [TaxId: 10335]} Back     information, alignment and structure
>d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1u0ja_ c.37.1.20 (A:) Rep 40 protein helicase domain {Adeno-associated virus 2, AAV2 [TaxId: 10804]} Back     information, alignment and structure
>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Back     information, alignment and structure
>d1puja_ c.37.1.8 (A:) Probable GTPase YlqF {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1e2ka_ c.37.1.1 (A:) Thymidine kinase {Herpes simplex virus type 1, different strains [TaxId: 10298]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1svsa1 c.37.1.8 (A:32-60,A:182-347) Transducin (alpha subunit) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1jnya3 c.37.1.8 (A:4-227) Elongation factor eEF-1alpha, N-terminal (G) domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2bcjq2 c.37.1.8 (Q:38-66,Q:184-354) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1svsa1 c.37.1.8 (A:32-60,A:182-347) Transducin (alpha subunit) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1n0ua2 c.37.1.8 (A:3-343) Elongation factor 2 (eEF-2), N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Back     information, alignment and structure
>d1d2ea3 c.37.1.8 (A:55-250) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Cow (Bos taurus), mitochondrial [TaxId: 9913]} Back     information, alignment and structure
>d1osna_ c.37.1.1 (A:) Thymidine kinase {Varicella-zoster virus [TaxId: 10335]} Back     information, alignment and structure
>d1r5ba3 c.37.1.8 (A:215-459) Eukaryotic peptide chain release factor ERF2, G domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1j3ba1 c.91.1.1 (A:212-529) Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2olra1 c.91.1.1 (A:228-540) Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1n0ua2 c.37.1.8 (A:3-343) Elongation factor 2 (eEF-2), N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} Back     information, alignment and structure
>d1f60a3 c.37.1.8 (A:2-240) Elongation factor eEF-1alpha, N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure