Citrus Sinensis ID: 000704
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
|
|
Close Homologs for Annotation Transfer
Close Homologs in SWISS-PROT Database Detected by BLAST 
Original result of BLAST against SWISS-PROT Database
| ID | Alignment graph | Length |
Definition |
RBH(Q2H) |
RBH(H2Q) |
Q cover |
H cover |
Identity |
E-value |
| Query | 1342 | 2.2.26 [Sep-21-2011] | |||||||
| O81825 | 919 | Probable disease resistan | yes | no | 0.545 | 0.796 | 0.309 | 1e-82 | |
| Q9T048 | 985 | Disease resistance protei | no | no | 0.609 | 0.830 | 0.270 | 8e-69 | |
| Q42484 | 909 | Disease resistance protei | no | no | 0.551 | 0.814 | 0.269 | 2e-58 | |
| P60838 | 894 | Probable disease resistan | no | no | 0.425 | 0.638 | 0.290 | 9e-48 | |
| Q9FLB4 | 874 | Putative disease resistan | no | no | 0.557 | 0.855 | 0.265 | 2e-44 | |
| Q8RXS5 | 888 | Probable disease resistan | no | no | 0.432 | 0.654 | 0.267 | 6e-44 | |
| O64973 | 889 | Disease resistance protei | no | no | 0.478 | 0.722 | 0.269 | 3e-43 | |
| Q8L3R3 | 885 | Disease resistance protei | no | no | 0.440 | 0.667 | 0.265 | 2e-41 | |
| Q940K0 | 889 | Probable disease resistan | no | no | 0.426 | 0.644 | 0.268 | 2e-39 | |
| O64789 | 925 | Probable disease resistan | no | no | 0.426 | 0.619 | 0.273 | 4e-39 |
| >sp|O81825|DRL28_ARATH Probable disease resistance protein At4g27220 OS=Arabidopsis thaliana GN=At4g27220 PE=2 SV=1 | Back alignment and function desciption |
|---|
Score = 308 bits (790), Expect = 1e-82, Method: Compositional matrix adjust.
Identities = 242/781 (30%), Positives = 397/781 (50%), Gaps = 49/781 (6%)
Query: 160 VYMIGVYGMAGIGKTTLVK----EVARLAKEGRIFDEVVFAEVSQTPDLKRIRREIADQL 215
V IGV+GM G+GKTTLV+ ++ + A + F V++ VS+ DLKR++ +IA +L
Sbjct: 134 VQKIGVWGMGGVGKTTLVRTLNNDLLKYAATQQ-FALVIWVTVSKDFDLKRVQMDIAKRL 192
Query: 216 GLNFCEESDSERIMMLCNRLKREKKILVILDDIWTSLDLERTGIPFG-DVHRGCKILVTS 274
G F E ++ + +C RL K L+ILDD+W +DL++ GIP + + K+++TS
Sbjct: 193 GKRFTREQMNQLGLTICERLIDLKNFLLILDDVWHPIDLDQLGIPLALERSKDSKVVLTS 252
Query: 275 RRRDVLVSEMHCQNNYCVSVLNKEEAWSLFSKVVGNCVEDPDLQTVAIQVANECGGLPIA 334
RR +V +M N V+ L ++EAW LF VG +++ +A V++EC GLP+A
Sbjct: 253 RRLEV-CQQMMTNENIKVACLQEKEAWELFCHNVGEVANSDNVKPIAKDVSHECCGLPLA 311
Query: 335 ILTVARTLRNKP-LFVWKKALQELRFSARNFTGLEALLGSTIELIYNYLEGEELKLTFLL 393
I+T+ RTLR KP + VWK L L+ SA + E + G T++L Y++L+ + +K FL
Sbjct: 312 IITIGRTLRGKPQVEVWKHTLNLLKRSAPSIDTEEKIFG-TLKLSYDFLQ-DNMKSCFLF 369
Query: 394 CSLMKHPCDAPIMDLLKYGTGLGLFEDIYTMQERRDRVYALVRGLKDTCLLHDDDTADWF 453
C+L + +L+ Y GL + + ++ + LV LKD+CLL D D+ D
Sbjct: 370 CALFPEDYSIKVSELIMYWVAEGLLDGQHHYEDMMNEGVTLVERLKDSCLLEDGDSCDTV 429
Query: 454 SMLGFVRNVAISIASI------NLMVRNDALIEWPNKDMLKNCIAIFLHDINTGELPEG- 506
M VR+ AI S +L++ LIE+P + + + L LP
Sbjct: 430 KMHDVVRDFAIWFMSSQGEGFHSLVMAGRGLIEFPQDKFVSSVQRVSLMANKLERLPNNV 489
Query: 507 LEYPHLTSLCMNPKDPFLHIPDNFFAGMPKLRVLVLTRMKLLTLPSSFCHLPNLESLCLD 566
+E L + +P+ F P LR+L L+ +++ TLP SF +L +L SL L
Sbjct: 490 IEGVETLVLLLQGNSHVKEVPNGFLQAFPNLRILDLSGVRIRTLPDSFSNLHSLRSLVLR 549
Query: 567 QC-ILGDIAIIGNLKNLEILSLCCSDIEQLPREIGELTQLKLLDLSNCSKLKVIPPNVIS 625
C L ++ + +L L+ L L S I +LPR + L+ L+ + +SN +L+ IP I
Sbjct: 550 NCKKLRNLPSLESLVKLQFLDLHESAIRELPRGLEALSSLRYICVSNTYQLQSIPAGTIL 609
Query: 626 SLSQLEELYLGNTSVEWEFEGLNLERNNASLQELSILSHLTTLEIHIRDAVILPKGL--F 683
LS LE L + ++ W +G E A+L E++ L HL L I + D +
Sbjct: 610 QLSSLEVLDMAGSAYSWGIKGEERE-GQATLDEVTCLPHLQFLAIKLLDVLSFSYEFDSL 668
Query: 684 SQKLARYKILVGDVWDW--PGKSENRRTLKLKLPTNIYLDEIIMNLKEIEELYLDEVPGI 741
+++L +++ L + PG E + +N + ++ ++ ++ Y + + G+
Sbjct: 669 TKRLTKFQFLFSPIRSVSPPGTGEGCLAISDVNVSNASIGWLLQHVTSLDLNYCEGLNGM 728
Query: 742 ENVLYELDRKGLPALKHLRAQNNPFILCIVDSMAQVRCNAFPVLESMFLHNLIHLEKI-- 799
L + A+K L P + + S + + + FP LE + L N ++LE I
Sbjct: 729 FENLVTKSKSSFVAMKALSIHYFPSL--SLASGCESQLDLFPNLEELSLDN-VNLESIGE 785
Query: 800 CDGLLTAEFFSKLRIIKVRNCDKLKNIFSFSIVRG-LPQLQILKVIKCNNMEEIFSFGGE 858
+G L KL++++V C +LK +FS I+ G LP LQ +KV+ C +EE+F+F
Sbjct: 786 LNGFLGMR-LQKLKLLQVSGCRQLKRLFSDQILAGTLPNLQEIKVVSCLRLEELFNFSS- 843
Query: 859 DDVGYNEVDKIEFGQLRSLILKFLPQLTSFYAQLKSSDELDTPKPLFNERVVFPNLETLE 918
V + + +L + LK+LPQL S L N+RVV +LE LE
Sbjct: 844 --VPVDFCAESLLPKLTVIKLKYLPQLRS----------------LCNDRVVLESLEHLE 885
Query: 919 L 919
+
Sbjct: 886 V 886
|
Probable disease resistance protein. Arabidopsis thaliana (taxid: 3702) |
| >sp|Q9T048|DRL27_ARATH Disease resistance protein At4g27190 OS=Arabidopsis thaliana GN=At4g27190 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q42484|RPS2_ARATH Disease resistance protein RPS2 OS=Arabidopsis thaliana GN=RPS2 PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|P60838|DRL1_ARATH Probable disease resistance protein At1g12280 OS=Arabidopsis thaliana GN=At1g12280 PE=3 SV=1 | Back alignment and function description |
|---|
| >sp|Q9FLB4|DRL31_ARATH Putative disease resistance protein At5g05400 OS=Arabidopsis thaliana GN=At5g05400 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q8RXS5|DRL40_ARATH Probable disease resistance protein At5g63020 OS=Arabidopsis thaliana GN=At5g63020 PE=2 SV=2 | Back alignment and function description |
|---|
| >sp|O64973|RPS5_ARATH Disease resistance protein RPS5 OS=Arabidopsis thaliana GN=RPS5 PE=1 SV=2 | Back alignment and function description |
|---|
| >sp|Q8L3R3|RFL1_ARATH Disease resistance protein RFL1 OS=Arabidopsis thaliana GN=RFL1 PE=3 SV=2 | Back alignment and function description |
|---|
| >sp|Q940K0|DRL15_ARATH Probable disease resistance protein At1g61180 OS=Arabidopsis thaliana GN=At1g61180 PE=2 SV=2 | Back alignment and function description |
|---|
| >sp|O64789|DRL18_ARATH Probable disease resistance protein At1g61310 OS=Arabidopsis thaliana GN=At1g61310 PE=2 SV=1 | Back alignment and function description |
|---|
Close Homologs in the Non-Redundant Database Detected by BLAST
Original result of BLAST against Nonredundant Database
| GI | Alignment Graph | Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 1342 | ||||||
| 359488108 | 1436 | PREDICTED: disease resistance protein At | 0.969 | 0.905 | 0.397 | 0.0 | |
| 224111296 | 1315 | cc-nbs-lrr resistance protein [Populus t | 0.923 | 0.942 | 0.416 | 0.0 | |
| 359488288 | 1340 | PREDICTED: LOW QUALITY PROTEIN: probable | 0.920 | 0.921 | 0.401 | 0.0 | |
| 224143316 | 1337 | cc-nbs-lrr resistance protein [Populus t | 0.931 | 0.934 | 0.418 | 0.0 | |
| 224111284 | 1340 | cc-nbs-lrr resistance protein [Populus t | 0.947 | 0.948 | 0.415 | 0.0 | |
| 255563252 | 1603 | Disease resistance protein RPS5, putativ | 0.913 | 0.764 | 0.425 | 0.0 | |
| 224083434 | 1144 | cc-nbs-lrr resistance protein [Populus t | 0.763 | 0.895 | 0.450 | 0.0 | |
| 296087872 | 1152 | unnamed protein product [Vitis vinifera] | 0.793 | 0.924 | 0.427 | 0.0 | |
| 255574526 | 1232 | Disease resistance protein RFL1, putativ | 0.754 | 0.821 | 0.443 | 0.0 | |
| 147787802 | 1517 | hypothetical protein VITISV_005047 [Viti | 0.942 | 0.833 | 0.363 | 0.0 |
| >gi|359488108|ref|XP_003633701.1| PREDICTED: disease resistance protein At4g27190-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 869 bits (2245), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 560/1408 (39%), Positives = 799/1408 (56%), Gaps = 107/1408 (7%)
Query: 5 KQFGYFCCYKSNFDHLTKEVEKLRERRESVQHRVDFAKENGEEIEQSVENWLISVDKIVE 64
+Q Y Y++N + L+++V+ LR+ R QH VD A NG IE V W+ D ++
Sbjct: 22 RQLDYLFNYRTNIEDLSQKVDNLRDARARQQHSVDEAIGNGHIIEDDVCKWMKRADGFIQ 81
Query: 65 E-----AGKFVEDDEEANNPCFKVLCPNLKNRHHLSKKAAKEVKAIVELQDEGNFDRVSV 119
A KF+ED++EA CF LCPNLK+R+ LS++A K VE+ G F+RVS
Sbjct: 82 NGFIQNACKFLEDEKEARKSCFNRLCPNLKSRYQLSREARKRAGVAVEILGAGQFERVSY 141
Query: 120 RGISRDRLVAYTESYNEGHEFIESRESILNDILDALRGPYVYMIGVYGMAGIGKTTLVKE 179
R ++ A +E+ +ESR LN+++ ALR + IGV+G+ G+GKTTLVK+
Sbjct: 142 RAPLQEIRSAPSEA-------LESRMLTLNEVMVALRDAKINKIGVWGLGGVGKTTLVKQ 194
Query: 180 VARLAKEGRIFDEVVFAEVSQTPDLKRIRREIADQLGLNFCEESDSERIMMLCNRLKREK 239
VA A + ++FD+VV A V +TPDLK+I+ E+AD LG+ F EES+ R L R+ EK
Sbjct: 195 VAEQAAQEKLFDKVVTAAVLETPDLKKIQGELADLLGMKFEEESEQGRAARLYQRMNEEK 254
Query: 240 KILVILDDIWTSLDLERTGIPFGDVHRGCKILVTSRRRDVLVSEMHCQNNYCVSVLNKEE 299
IL+ILDDIW LDLE+ GIP D H+GCK+++TSR +L +EM Q ++ V L ++E
Sbjct: 255 TILIILDDIWAKLDLEKIGIPSPDHHKGCKLVLTSRNEHILSNEMDTQKDFRVQPLQEDE 314
Query: 300 AWSLFSKVVGNCVEDPDLQTVAIQVANECGGLPIAILTVARTLRNKPLFVWKKALQELRF 359
W LF G+ +E+P+LQ +A+ VA EC GLP+AI+TVA+ L+NK + +WK ALQ+L+
Sbjct: 315 TWILFKNTAGS-IENPELQPIAVDVAKECAGLPLAIVTVAKALKNKNVSIWKDALQQLKS 373
Query: 360 SA-RNFTGLEALLGSTIELIYNYLEGEELKLTFLLCSLMKHPCDAPIMDLLKYGTGLGLF 418
N TGL + S+++L Y +L+G E+K FLLC L+ D I DLLKYG GL LF
Sbjct: 374 QTLTNVTGLTTNVYSSLKLSYEHLKGVEVKSFFLLCGLISQ-NDISIRDLLKYGVGLRLF 432
Query: 419 EDIYTMQERRDRVYALVRGLKDTCLLHDDDTADWFSMLGFVRNVAISIAS--------IN 470
+ T++E ++R+ ALV LK + L + + M VR+ A IAS N
Sbjct: 433 QGTNTLEEAKNRIDALVDNLKSSNFLLETGHNAFVRMHDLVRSTARKIASDQHHVFTLQN 492
Query: 471 LMVRNDALIEWPNKDMLKNCIAIFLHDINTGELPEGLEYPHLTSL-CMN-PKDPFLHIPD 528
VR + WP D L+ + LHD + ELPEGL P L C + + + IP+
Sbjct: 493 TTVRVEG---WPRIDELQKVTWVSLHDCDIRELPEGLACPKLELFGCYDVNTNSAVQIPN 549
Query: 529 NFFAGMPKLRVLVLTRMKLLTLPSSFCHL-PNLESLCLDQCILGDIAIIGNLKNLEILSL 587
NFF M +L+VL L+RM+L +LP S CH NL +LCLD C LG+I II LK LEILSL
Sbjct: 550 NFFEEMKQLKVLDLSRMQLPSLPLS-CHCRTNLRTLCLDGCNLGEIVIIAELKKLEILSL 608
Query: 588 CCSDIEQLPREIGELTQLKLLDLSNCSKLKVIPPNVISSLSQLEELYLGNTSVEWEFEGL 647
SDIE+LPREI +LT L+L DL KLKVIPP+VISSLSQLE+L + N+ +WE EG
Sbjct: 609 TYSDIEKLPREIAQLTHLRLFDLKGSYKLKVIPPDVISSLSQLEDLCMENSFTQWEGEG- 667
Query: 648 NLERNNASLQELSILSHLTTLEIHIRDAVILPKGLFSQKLARYKILVGDVWDWPGKSENR 707
++NA L EL LSHLT+L+I I DA +LPK + L RY+I VGDVW W G SE
Sbjct: 668 ---KSNACLAELKHLSHLTSLDIQIPDAKLLPKDIVFDTLVRYRIFVGDVWSWGGISEAN 724
Query: 708 RTLKL-KLPTNIYL-DEIIMNLKEIEELYLDEVPGIENVLYELDRKGLPALKHLRAQNNP 765
+TL+L K T+++L D II LK E+L+L E+ G NVL +LD +G LKHL +++P
Sbjct: 725 KTLQLNKFDTSLHLVDGIIKLLKRTEDLHLRELCGGTNVLSKLDGEGFLKLKHLNVESSP 784
Query: 766 FILCIVDSMAQVRCN-AFPVLESMFLHNLIHLEKICDGLLTAEFFSKLRIIKVRNCDKLK 824
I IV+SM + AFPV+E++ L+ LI+L+++C G A F LR ++V +CD LK
Sbjct: 785 EIQYIVNSMDLTPSHGAFPVMETLSLNQLINLQEVCRGQFPAGSFGCLRKVEVEDCDGLK 844
Query: 825 NIFSFSIVRGLPQLQILKVIKCNNMEEIFSFGGEDDVGYNEVDKIEFGQLRSLILKFLPQ 884
+FS S+ RGL +L+ KV +C +M E+ S G ++ + V+ F +LRSL L+ LP+
Sbjct: 845 FLFSLSVARGLSRLEETKVTRCKSMVEMVS-QGRKEIKEDAVNVPLFPELRSLTLEDLPK 903
Query: 885 LTSFYAQLKSSDELDTPKPLFNERVVFPNLETL----------------ELYAINTERIW 928
L++F + + L P +V P+ L L ++N ++
Sbjct: 904 LSNFC--FEENPVLSKPA----STIVGPSTPPLNQPEIRDGQLLFSLGGNLRSLNLKKCM 957
Query: 929 HNQPVAVSPGIQNLTRLIVHGSEKIKYLF---------------PSSIVRNFVQLQHL-E 972
+ +QNL L V +K++ +F P + L L
Sbjct: 958 SLLKLFPPSLLQNLQELTVENCDKLEQVFDLEELNVDDGHVGLLPKLGKLRLIDLPKLRH 1017
Query: 973 ICHCTVLEEIVSKERGEEATATFVFPKVTYLKLCNLSELITFY-PGIHTLE--------- 1022
IC+C +FPK+ Y+ L L L +F PG H+L+
Sbjct: 1018 ICNCGSSRNHFPSSMASAPVGNIIFPKLFYISLGFLPNLTSFVSPGYHSLQRLHHADLDT 1077
Query: 1023 ---------WPLLKRLEVYGCNKVKIFTSEFLSFPKNSEEIQRNIPTQQALFLVEKVGSH 1073
WPLL+ L V C K+ +F E +F + E ++P FL +
Sbjct: 1078 PFPVLFDERWPLLEELRVSECYKLDVFAFETPTFQQRHGEGNLDMPL---FFLPHVAFPN 1134
Query: 1074 LEELKLSGKDITMIREGRLPTYLFQNLKILEVVNDKSD---NFPICFLQYFKNLEKLEL- 1129
LEEL+L T I + P F L++L V+D D P LQ NLE L++
Sbjct: 1135 LEELRLGDNRDTEIWPEQFPVDSFPRLRVLH-VHDYRDILVVIPSFMLQRLHNLEVLKVG 1193
Query: 1130 RWSSYKQIFSYK--EAEKHAGKLTHIKSLKLWELSDLMYLWNQGFKLDSVVENLEMLEVW 1187
SS K++F + + E A +L ++ ++L +L L LW + + +++LE LEVW
Sbjct: 1194 SCSSVKEVFQLEGLDEENQAKRLGRLREIELHDLPGLTRLWKENSEPGLDLQSLESLEVW 1253
Query: 1188 WCDNLVNLVPSSPSFRNLITLEVWYCKGLKNLVTSSTAKSLVQLMQLRIDGCKMITEIIS 1247
C +L+NLVPSS SF+NL TL+V C L++L++ S AKSLV+L L+I M+ E+++
Sbjct: 1254 NCGSLINLVPSSVSFQNLATLDVQSCGSLRSLISPSVAKSLVKLKTLKIGRSDMMEEVVA 1313
Query: 1248 NEGDVAEDEIVFSKLKWLSLENLESLTSFYSGNYTFKFPCLEDLFVIECPNMKIFSTRES 1307
NEG A DEI F KL+ + L L +LTSF SG Y F FP LE + V ECP MK+FS
Sbjct: 1314 NEGGEATDEITFYKLQHMELLYLPNLTSFSSGGYIFSFPSLEQMLVKECPKMKMFSPSLV 1373
Query: 1308 NTPKLQEVRQNWGLDKGCWEGGLNATIQ 1335
P+L+ ++ G ++ W+ LN I
Sbjct: 1374 TPPRLKRIK--VGDEEWPWQDDLNTAIH 1399
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|224111296|ref|XP_002332952.1| cc-nbs-lrr resistance protein [Populus trichocarpa] gi|222834264|gb|EEE72741.1| cc-nbs-lrr resistance protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|359488288|ref|XP_003633735.1| PREDICTED: LOW QUALITY PROTEIN: probable disease resistance protein At1g61310-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|224143316|ref|XP_002336027.1| cc-nbs-lrr resistance protein [Populus trichocarpa] gi|222838884|gb|EEE77235.1| cc-nbs-lrr resistance protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|224111284|ref|XP_002332949.1| cc-nbs-lrr resistance protein [Populus trichocarpa] gi|222834261|gb|EEE72738.1| cc-nbs-lrr resistance protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|255563252|ref|XP_002522629.1| Disease resistance protein RPS5, putative [Ricinus communis] gi|223538105|gb|EEF39716.1| Disease resistance protein RPS5, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|224083434|ref|XP_002307025.1| cc-nbs-lrr resistance protein [Populus trichocarpa] gi|222856474|gb|EEE94021.1| cc-nbs-lrr resistance protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|296087872|emb|CBI35155.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|255574526|ref|XP_002528174.1| Disease resistance protein RFL1, putative [Ricinus communis] gi|223532386|gb|EEF34181.1| Disease resistance protein RFL1, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|147787802|emb|CAN71755.1| hypothetical protein VITISV_005047 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST
Original result of BLAST against Gene Ontology (AMIGO)
| ID |
Alignment graph |
Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 1342 | ||||||
| TAIR|locus:2131689 | 919 | AT4G27220 [Arabidopsis thalian | 0.642 | 0.937 | 0.291 | 4.4e-85 | |
| TAIR|locus:2136447 | 985 | AT4G27190 [Arabidopsis thalian | 0.608 | 0.829 | 0.277 | 1.2e-72 | |
| TAIR|locus:2005517 | 909 | RPS2 "RESISTANT TO P. SYRINGAE | 0.399 | 0.589 | 0.292 | 4.5e-54 | |
| TAIR|locus:2034770 | 894 | SUMM2 "AT1G12280" [Arabidopsis | 0.587 | 0.881 | 0.263 | 7.8e-50 | |
| TAIR|locus:2201996 | 889 | RPS5 "AT1G12220" [Arabidopsis | 0.457 | 0.690 | 0.276 | 1.4e-47 | |
| TAIR|locus:2166320 | 888 | AT5G63020 [Arabidopsis thalian | 0.587 | 0.887 | 0.248 | 4.8e-47 | |
| TAIR|locus:2008510 | 967 | AT1G61190 "AT1G61190" [Arabido | 0.473 | 0.656 | 0.266 | 1e-45 | |
| TAIR|locus:2153474 | 874 | AT5G05400 [Arabidopsis thalian | 0.576 | 0.884 | 0.261 | 4.6e-43 | |
| TAIR|locus:2132741 | 892 | AT4G10780 [Arabidopsis thalian | 0.451 | 0.679 | 0.268 | 5.6e-43 | |
| TAIR|locus:2034765 | 884 | AT1G12290 [Arabidopsis thalian | 0.449 | 0.682 | 0.265 | 5.6e-43 |
| TAIR|locus:2131689 AT4G27220 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 858 (307.1 bits), Expect = 4.4e-85, P = 4.4e-85
Identities = 271/930 (29%), Positives = 454/930 (48%)
Query: 13 YKSNFDHLTKEVEKLRERRESVQHRVDFAKENGEEIEQSVENWLISVDKIVEEAGKFVED 72
++SN L + +E+L+ + V + + + +E+ + WL V++ V G+ +
Sbjct: 2 FRSNARALNRALERLKNVQTKVNEALKRSGIQEKSLERKLRIWLRKVEENVP-LGELIL- 59
Query: 73 DEEANNPCFKVLCPNLKNRHHLSXXXXXXXXXXXXLQDEGN--FDRVSVRGISRDRLVAY 130
E + C LS L+++G ++SV SR+ +
Sbjct: 60 --EKRSSC----------AIWLSDKDVEILEKVKRLEEQGQDLIKKISVNKSSREIVERV 107
Query: 131 T-ESYNEGHEFIESRESILNDILDALRGPYVYMIGVYGMAGIGKTTLVKEVAR-LAKEGR 188
S++ +E +L+ + D L+ V IGV+GM G+GKTTLV+ + L K
Sbjct: 108 LGPSFHPQKTALE----MLDKLKDCLKKKNVQKIGVWGMGGVGKTTLVRTLNNDLLKYAA 163
Query: 189 I--FDEVVFAEVSQTPDLKRIRREIADQLGLNFCEESDSERIMMLCNRLKREKKILVILD 246
F V++ VS+ DLKR++ +IA +LG F E ++ + +C RL K L+ILD
Sbjct: 164 TQQFALVIWVTVSKDFDLKRVQMDIAKRLGKRFTREQMNQLGLTICERLIDLKNFLLILD 223
Query: 247 DIWTSLDLERTGIPFG-DVHRGCKILVTSRRRDVLVSEMHCQNNYCVSVLNKEEAWSLFS 305
D+W +DL++ GIP + + K+++TSRR +V +M N V+ L ++EAW LF
Sbjct: 224 DVWHPIDLDQLGIPLALERSKDSKVVLTSRRLEVC-QQMMTNENIKVACLQEKEAWELFC 282
Query: 306 KVVGNCVEDPDLQTVAIQVANECGGLPIAILTVARTLRNKP-LFVWKKALQELRFSARNF 364
VG +++ +A V++EC GLP+AI+T+ RTLR KP + VWK L L+ SA +
Sbjct: 283 HNVGEVANSDNVKPIAKDVSHECCGLPLAIITIGRTLRGKPQVEVWKHTLNLLKRSAPSI 342
Query: 365 TGLEALLGSTIELIYNYLEGEELKLTFLLCSLMKHPCDAPIMDLLKYGTGLGLFEDIYTM 424
E + G T++L Y++L+ + +K FL C+L + +L+ Y GL + +
Sbjct: 343 DTEEKIFG-TLKLSYDFLQ-DNMKSCFLFCALFPEDYSIKVSELIMYWVAEGLLDGQHHY 400
Query: 425 QERRDRVYALVRGLKDTCLLHDDDTADWFSMLGFVRNVAISIASI------NLMVRNDAL 478
++ + LV LKD+CLL D D+ D M VR+ AI S +L++ L
Sbjct: 401 EDMMNEGVTLVERLKDSCLLEDGDSCDTVKMHDVVRDFAIWFMSSQGEGFHSLVMAGRGL 460
Query: 479 IEWPNKDMLKNCIAIFLHDINTGELPEG-LEYPHLTSLCMNPKDPFLHIPDNFFAGMPKL 537
IE+P + + + L LP +E L + +P+ F P L
Sbjct: 461 IEFPQDKFVSSVQRVSLMANKLERLPNNVIEGVETLVLLLQGNSHVKEVPNGFLQAFPNL 520
Query: 538 RVLVLTRMKLLTLPSSFCHLPNLESLCLDQCI-LGDIAIIGNLKNLEILSLCCSDIEQLP 596
R+L L+ +++ TLP SF +L +L SL L C L ++ + +L L+ L L S I +LP
Sbjct: 521 RILDLSGVRIRTLPDSFSNLHSLRSLVLRNCKKLRNLPSLESLVKLQFLDLHESAIRELP 580
Query: 597 REIGELTQLKLLDLSNCSKLKVIPPNVISSLSQLEELYLGNTSVEWEFEGLNLERNNASL 656
R + L+ L+ + +SN +L+ IP I LS LE L + ++ W +G E A+L
Sbjct: 581 RGLEALSSLRYICVSNTYQLQSIPAGTILQLSSLEVLDMAGSAYSWGIKGEERE-GQATL 639
Query: 657 QELSILSHLTTLEIHIRDAVILPKGLFS--QKLARYKILVGDVWDW--PGKSENRRTLKL 712
E++ L HL L I + D + S ++L +++ L + PG E +
Sbjct: 640 DEVTCLPHLQFLAIKLLDVLSFSYEFDSLTKRLTKFQFLFSPIRSVSPPGTGEGCLAISD 699
Query: 713 KLPTNIYLDEIIMNLKEIEELYLDEVPGIENVLYELDRKGLPALKHLRAQNNPFILCIVD 772
+N + ++ ++ ++ Y + + G+ L + A+K L P + +
Sbjct: 700 VNVSNASIGWLLQHVTSLDLNYCEGLNGMFENLVTKSKSSFVAMKALSIHYFPSLS--LA 757
Query: 773 SMAQVRCNAFPVLESMFLHNLIHLEKI--CDGLLTAEFFSKLRIIKVRNCDKLKNIFSFS 830
S + + + FP LE + L N ++LE I +G L KL++++V C +LK +FS
Sbjct: 758 SGCESQLDLFPNLEELSLDN-VNLESIGELNGFLGMRL-QKLKLLQVSGCRQLKRLFSDQ 815
Query: 831 IVRG-LPQLQILKVIKCNNMEEIFSFGGEDDVGYNEVDKIEFGQLRSLILKFLPQLTSFY 889
I+ G LP LQ +KV+ C +EE+F+F V + + +L + LK+LPQL S
Sbjct: 816 ILAGTLPNLQEIKVVSCLRLEELFNFSS---VPVDFCAESLLPKLTVIKLKYLPQLRS-- 870
Query: 890 AQLKSSDELDTPKPLFNERVVFPNLETLEL 919
L N+RVV +LE LE+
Sbjct: 871 --------------LCNDRVVLESLEHLEV 886
|
|
| TAIR|locus:2136447 AT4G27190 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2005517 RPS2 "RESISTANT TO P. SYRINGAE 2" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2034770 SUMM2 "AT1G12280" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2201996 RPS5 "AT1G12220" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2166320 AT5G63020 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2008510 AT1G61190 "AT1G61190" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2153474 AT5G05400 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2132741 AT4G10780 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2034765 AT1G12290 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Annotation Transfer from SWISS-PROT Entries
Original result of BLAST against SWISS-PROT
No confident hit for EC number transfering in SWISSPROT detected by BLAST
EC Number Prediction by Ezypred Server
Original result from Ezypred Server
Fail to connect to Ezypred Server
EC Number Prediction by EFICAz Software
| Prediction Level | EC number | Confidence of Prediction |
| 3rd Layer | 3.6.1 | LOW CONFIDENCE prediction! |
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING
Original result from the STRING server
 |
 |
 |
 |
 |
 |
 |
 |
 |
 | eugene3.03110007 | cc-nbs-lrr resistance protein (1315 aa) | ||||||
(Populus trichocarpa) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST
Original result of RPS-BLAST against CDD database part I
| ID | Alignment Graph | Length |
Definition |
E-value |
| Query | 1342 | |||
| pfam00931 | 285 | pfam00931, NB-ARC, NB-ARC domain | 1e-43 | |
| pfam13401 | 124 | pfam13401, AAA_22, AAA domain | 7e-10 | |
| COG4886 | 394 | COG4886, COG4886, Leucine-rich repeat (LRR) protei | 9e-08 | |
| pfam05729 | 165 | pfam05729, NACHT, NACHT domain | 4e-06 | |
| pfam13855 | 60 | pfam13855, LRR_8, Leucine rich repeat | 9e-06 | |
| smart00382 | 148 | smart00382, AAA, ATPases associated with a variety | 1e-05 | |
| pfam13191 | 154 | pfam13191, AAA_16, AAA ATPase domain | 2e-05 | |
| COG1474 | 366 | COG1474, CDC6, Cdc6-related protein, AAA superfami | 3e-05 | |
| PLN03210 | 1153 | PLN03210, PLN03210, Resistant to P | 8e-05 | |
| COG4886 | 394 | COG4886, COG4886, Leucine-rich repeat (LRR) protei | 4e-04 | |
| COG4886 | 394 | COG4886, COG4886, Leucine-rich repeat (LRR) protei | 7e-04 | |
| PLN03210 | 1153 | PLN03210, PLN03210, Resistant to P | 7e-04 | |
| COG4886 | 394 | COG4886, COG4886, Leucine-rich repeat (LRR) protei | 0.001 | |
| pfam13855 | 60 | pfam13855, LRR_8, Leucine rich repeat | 0.001 | |
| PRK13695 | 174 | PRK13695, PRK13695, putative NTPase; Provisional | 0.003 |
| >gnl|CDD|216202 pfam00931, NB-ARC, NB-ARC domain | Back alignment and domain information |
|---|
Score = 160 bits (407), Expect = 1e-43
Identities = 84/284 (29%), Positives = 140/284 (49%), Gaps = 11/284 (3%)
Query: 144 RESILNDILDAL--RGPYVYMIGVYGMAGIGKTTLVKEVARLAKEGRIFDEVVFAEVSQT 201
RE ++ +++ L + ++G+ GM G+GKTTL K++ G FD V + VS+T
Sbjct: 1 REDMIEALIEKLLEMSDNLGVVGIVGMGGVGKTTLAKQIYNDDSVGGHFDSVAWVVVSKT 60
Query: 202 PDLKRIRREIADQLGLNFC---EESDSERIMMLCNRLKREKKILVILDDIWTSLDLERTG 258
R++++I +LGL+ E+++SE + + L R K+ L++LDD+W D ++ G
Sbjct: 61 YTEFRLQKDILQELGLDDSDWVEKNESELAVKIKEALLR-KRFLLVLDDVWEKNDWDKIG 119
Query: 259 IPFGDVHRGCKILVTSRRRDVLVSEMHCQNNYCVSVLNKEEAWSLFSKVVG--NCVEDPD 316
+PF D G +++VT+R V + V L EE+W LFS V P+
Sbjct: 120 VPFPDGENGSRVIVTTRSESVAGRMGGTSKPHEVESLEPEESWELFSNKVFEKELPPCPE 179
Query: 317 LQTVAIQVANECGGLPIAILTVARTLRNKP-LFVWKKALQELRFSARNFTGLEALLGSTI 375
L+ VA ++ +C GLP+A+ + L K + W+ L++L GL +L S +
Sbjct: 180 LEEVAKEIVEKCKGLPLALKVLGGLLAFKSTVQEWEHVLEQLNNELAGRDGLNEVL-SIL 238
Query: 376 ELIYNYLEGEELKLTFLLCSLMKHPCDAPIMDLLKYGTGLGLFE 419
L Y+ L LK FL +L + L+K G
Sbjct: 239 SLSYDNLP-MHLKRCFLYLALFPEDYNIRKEQLIKLWIAEGFVI 281
|
Length = 285 |
| >gnl|CDD|222104 pfam13401, AAA_22, AAA domain | Back alignment and domain information |
|---|
| >gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|218719 pfam05729, NACHT, NACHT domain | Back alignment and domain information |
|---|
| >gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat | Back alignment and domain information |
|---|
| >gnl|CDD|214640 smart00382, AAA, ATPases associated with a variety of cellular activities | Back alignment and domain information |
|---|
| >gnl|CDD|221970 pfam13191, AAA_16, AAA ATPase domain | Back alignment and domain information |
|---|
| >gnl|CDD|224391 COG1474, CDC6, Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|215633 PLN03210, PLN03210, Resistant to P | Back alignment and domain information |
|---|
| >gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|215633 PLN03210, PLN03210, Resistant to P | Back alignment and domain information |
|---|
| >gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat | Back alignment and domain information |
|---|
| >gnl|CDD|237475 PRK13695, PRK13695, putative NTPase; Provisional | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch
Original result of HHsearch against CDD database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 1342 | |||
| KOG4658 | 889 | consensus Apoptotic ATPase [Signal transduction me | 100.0 | |
| PLN03210 | 1153 | Resistant to P. syringae 6; Provisional | 100.0 | |
| PF00931 | 287 | NB-ARC: NB-ARC domain; InterPro: IPR002182 This is | 100.0 | |
| PLN00113 | 968 | leucine-rich repeat receptor-like protein kinase; | 99.97 | |
| PLN00113 | 968 | leucine-rich repeat receptor-like protein kinase; | 99.97 | |
| KOG0618 | 1081 | consensus Serine/threonine phosphatase 2C containi | 99.86 | |
| PLN03210 | 1153 | Resistant to P. syringae 6; Provisional | 99.85 | |
| KOG4194 | 873 | consensus Membrane glycoprotein LIG-1 [Signal tran | 99.83 | |
| KOG0472 | 565 | consensus Leucine-rich repeat protein [Function un | 99.8 | |
| KOG4194 | 873 | consensus Membrane glycoprotein LIG-1 [Signal tran | 99.8 | |
| KOG0472 | 565 | consensus Leucine-rich repeat protein [Function un | 99.79 | |
| KOG0618 | 1081 | consensus Serine/threonine phosphatase 2C containi | 99.78 | |
| KOG0444 | 1255 | consensus Cytoskeletal regulator Flightless-I (con | 99.72 | |
| KOG0444 | 1255 | consensus Cytoskeletal regulator Flightless-I (con | 99.69 | |
| KOG0617 | 264 | consensus Ras suppressor protein (contains leucine | 99.51 | |
| KOG0617 | 264 | consensus Ras suppressor protein (contains leucine | 99.39 | |
| KOG4237 | 498 | consensus Extracellular matrix protein slit, conta | 99.35 | |
| PRK04841 | 903 | transcriptional regulator MalT; Provisional | 99.29 | |
| PRK15387 | 788 | E3 ubiquitin-protein ligase SspH2; Provisional | 99.27 | |
| PRK15387 | 788 | E3 ubiquitin-protein ligase SspH2; Provisional | 99.22 | |
| COG2909 | 894 | MalT ATP-dependent transcriptional regulator [Tran | 99.22 | |
| PRK15370 | 754 | E3 ubiquitin-protein ligase SlrP; Provisional | 99.22 | |
| KOG4658 | 889 | consensus Apoptotic ATPase [Signal transduction me | 99.21 | |
| KOG4341 | 483 | consensus F-box protein containing LRR [General fu | 99.21 | |
| KOG4341 | 483 | consensus F-box protein containing LRR [General fu | 99.14 | |
| TIGR03015 | 269 | pepcterm_ATPase putative secretion ATPase, PEP-CTE | 99.12 | |
| PRK15370 | 754 | E3 ubiquitin-protein ligase SlrP; Provisional | 99.09 | |
| PRK00411 | 394 | cdc6 cell division control protein 6; Reviewed | 99.06 | |
| PF01637 | 234 | Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 | 98.95 | |
| PF05729 | 166 | NACHT: NACHT domain | 98.94 | |
| PF14580 | 175 | LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ | 98.92 | |
| KOG4237 | 498 | consensus Extracellular matrix protein slit, conta | 98.89 | |
| PF14580 | 175 | LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ | 98.86 | |
| TIGR02928 | 365 | orc1/cdc6 family replication initiation protein. M | 98.86 | |
| KOG1259 | 490 | consensus Nischarin, modulator of integrin alpha5 | 98.85 | |
| KOG0532 | 722 | consensus Leucine-rich repeat (LRR) protein, conta | 98.81 | |
| TIGR00635 | 305 | ruvB Holliday junction DNA helicase, RuvB subunit. | 98.78 | |
| PRK00080 | 328 | ruvB Holliday junction DNA helicase RuvB; Reviewed | 98.78 | |
| KOG0532 | 722 | consensus Leucine-rich repeat (LRR) protein, conta | 98.68 | |
| cd00116 | 319 | LRR_RI Leucine-rich repeats (LRRs), ribonuclease i | 98.66 | |
| cd00116 | 319 | LRR_RI Leucine-rich repeats (LRRs), ribonuclease i | 98.66 | |
| KOG3207 | 505 | consensus Beta-tubulin folding cofactor E [Posttra | 98.65 | |
| PRK13342 | 413 | recombination factor protein RarA; Reviewed | 98.61 | |
| COG2256 | 436 | MGS1 ATPase related to the helicase subunit of the | 98.6 | |
| PTZ00112 | 1164 | origin recognition complex 1 protein; Provisional | 98.56 | |
| KOG1259 | 490 | consensus Nischarin, modulator of integrin alpha5 | 98.55 | |
| PRK06893 | 229 | DNA replication initiation factor; Validated | 98.55 | |
| PF13173 | 128 | AAA_14: AAA domain | 98.45 | |
| COG4886 | 394 | Leucine-rich repeat (LRR) protein [Function unknow | 98.43 | |
| PRK05564 | 313 | DNA polymerase III subunit delta'; Validated | 98.37 | |
| PRK14961 | 363 | DNA polymerase III subunits gamma and tau; Provisi | 98.35 | |
| PTZ00202 | 550 | tuzin; Provisional | 98.34 | |
| PRK14949 | 944 | DNA polymerase III subunits gamma and tau; Provisi | 98.33 | |
| TIGR03420 | 226 | DnaA_homol_Hda DnaA regulatory inactivator Hda. Me | 98.33 | |
| KOG2028 | 554 | consensus ATPase related to the helicase subunit o | 98.33 | |
| PRK12323 | 700 | DNA polymerase III subunits gamma and tau; Provisi | 98.32 | |
| PRK12402 | 337 | replication factor C small subunit 2; Reviewed | 98.32 | |
| PRK07003 | 830 | DNA polymerase III subunits gamma and tau; Validat | 98.29 | |
| cd01128 | 249 | rho_factor Transcription termination factor rho is | 98.29 | |
| COG1474 | 366 | CDC6 Cdc6-related protein, AAA superfamily ATPase | 98.28 | |
| TIGR02903 | 615 | spore_lon_C ATP-dependent protease, Lon family. Me | 98.27 | |
| PRK06645 | 507 | DNA polymerase III subunits gamma and tau; Validat | 98.26 | |
| PRK09376 | 416 | rho transcription termination factor Rho; Provisio | 98.26 | |
| PRK14960 | 702 | DNA polymerase III subunits gamma and tau; Provisi | 98.23 | |
| COG4886 | 394 | Leucine-rich repeat (LRR) protein [Function unknow | 98.23 | |
| PRK14957 | 546 | DNA polymerase III subunits gamma and tau; Provisi | 98.23 | |
| PRK14963 | 504 | DNA polymerase III subunits gamma and tau; Provisi | 98.23 | |
| PF13401 | 131 | AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S | 98.23 | |
| PLN03025 | 319 | replication factor C subunit; Provisional | 98.23 | |
| PF05496 | 233 | RuvB_N: Holliday junction DNA helicase ruvB N-term | 98.23 | |
| PRK14956 | 484 | DNA polymerase III subunits gamma and tau; Provisi | 98.21 | |
| COG3899 | 849 | Predicted ATPase [General function prediction only | 98.19 | |
| PRK04195 | 482 | replication factor C large subunit; Provisional | 98.19 | |
| PRK14962 | 472 | DNA polymerase III subunits gamma and tau; Provisi | 98.19 | |
| cd00009 | 151 | AAA The AAA+ (ATPases Associated with a wide varie | 98.19 | |
| PRK15386 | 426 | type III secretion protein GogB; Provisional | 98.18 | |
| PRK00440 | 319 | rfc replication factor C small subunit; Reviewed | 98.18 | |
| PRK15386 | 426 | type III secretion protein GogB; Provisional | 98.15 | |
| PF13855 | 61 | LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF | 98.13 | |
| PRK14951 | 618 | DNA polymerase III subunits gamma and tau; Provisi | 98.12 | |
| PLN03150 | 623 | hypothetical protein; Provisional | 98.11 | |
| PRK05896 | 605 | DNA polymerase III subunits gamma and tau; Validat | 98.1 | |
| PLN03150 | 623 | hypothetical protein; Provisional | 98.09 | |
| PRK13341 | 725 | recombination factor protein RarA/unknown domain f | 98.09 | |
| PRK08727 | 233 | hypothetical protein; Validated | 98.09 | |
| PRK07994 | 647 | DNA polymerase III subunits gamma and tau; Validat | 98.08 | |
| TIGR00678 | 188 | holB DNA polymerase III, delta' subunit. At positi | 98.08 | |
| PRK07940 | 394 | DNA polymerase III subunit delta'; Validated | 98.07 | |
| PF13855 | 61 | LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF | 98.07 | |
| PRK14964 | 491 | DNA polymerase III subunits gamma and tau; Provisi | 98.06 | |
| PRK08691 | 709 | DNA polymerase III subunits gamma and tau; Validat | 98.05 | |
| PRK09112 | 351 | DNA polymerase III subunit delta'; Validated | 98.05 | |
| PRK14958 | 509 | DNA polymerase III subunits gamma and tau; Provisi | 98.05 | |
| KOG3207 | 505 | consensus Beta-tubulin folding cofactor E [Posttra | 98.04 | |
| TIGR02397 | 355 | dnaX_nterm DNA polymerase III, subunit gamma and t | 98.04 | |
| PRK07471 | 365 | DNA polymerase III subunit delta'; Validated | 98.04 | |
| PRK14969 | 527 | DNA polymerase III subunits gamma and tau; Provisi | 98.03 | |
| PRK14955 | 397 | DNA polymerase III subunits gamma and tau; Provisi | 98.02 | |
| TIGR00767 | 415 | rho transcription termination factor Rho. Members | 98.0 | |
| PRK08084 | 235 | DNA replication initiation factor; Provisional | 98.0 | |
| COG3903 | 414 | Predicted ATPase [General function prediction only | 97.99 | |
| PRK09087 | 226 | hypothetical protein; Validated | 97.98 | |
| KOG1947 | 482 | consensus Leucine rich repeat proteins, some prote | 97.96 | |
| PF13191 | 185 | AAA_16: AAA ATPase domain; PDB: 2V1U_A. | 97.96 | |
| PRK07764 | 824 | DNA polymerase III subunits gamma and tau; Validat | 97.94 | |
| PRK14954 | 620 | DNA polymerase III subunits gamma and tau; Provisi | 97.93 | |
| TIGR01242 | 364 | 26Sp45 26S proteasome subunit P45 family. Many pro | 97.92 | |
| PRK14970 | 367 | DNA polymerase III subunits gamma and tau; Provisi | 97.9 | |
| PRK14971 | 614 | DNA polymerase III subunits gamma and tau; Provisi | 97.89 | |
| PRK14959 | 624 | DNA polymerase III subunits gamma and tau; Provisi | 97.88 | |
| PRK09111 | 598 | DNA polymerase III subunits gamma and tau; Validat | 97.88 | |
| PF12799 | 44 | LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ | 97.87 | |
| KOG2120 | 419 | consensus SCF ubiquitin ligase, Skp2 component [Po | 97.87 | |
| PRK07133 | 725 | DNA polymerase III subunits gamma and tau; Validat | 97.86 | |
| PF14516 | 331 | AAA_35: AAA-like domain | 97.83 | |
| PRK14952 | 584 | DNA polymerase III subunits gamma and tau; Provisi | 97.83 | |
| PRK08451 | 535 | DNA polymerase III subunits gamma and tau; Validat | 97.81 | |
| KOG2227 | 529 | consensus Pre-initiation complex, subunit CDC6, AA | 97.8 | |
| KOG1859 | 1096 | consensus Leucine-rich repeat proteins [General fu | 97.79 | |
| PRK14950 | 585 | DNA polymerase III subunits gamma and tau; Provisi | 97.77 | |
| PF05621 | 302 | TniB: Bacterial TniB protein; InterPro: IPR008868 | 97.76 | |
| KOG2120 | 419 | consensus SCF ubiquitin ligase, Skp2 component [Po | 97.76 | |
| PRK14953 | 486 | DNA polymerase III subunits gamma and tau; Provisi | 97.76 | |
| PRK11331 | 459 | 5-methylcytosine-specific restriction enzyme subun | 97.75 | |
| PF00308 | 219 | Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013 | 97.75 | |
| PRK06305 | 451 | DNA polymerase III subunits gamma and tau; Validat | 97.74 | |
| PRK14087 | 450 | dnaA chromosomal replication initiation protein; P | 97.73 | |
| PRK03992 | 389 | proteasome-activating nucleotidase; Provisional | 97.72 | |
| KOG1947 | 482 | consensus Leucine rich repeat proteins, some prote | 97.7 | |
| PF12799 | 44 | LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ | 97.69 | |
| PRK05642 | 234 | DNA replication initiation factor; Validated | 97.68 | |
| KOG1859 | 1096 | consensus Leucine-rich repeat proteins [General fu | 97.68 | |
| KOG0989 | 346 | consensus Replication factor C, subunit RFC4 [Repl | 97.67 | |
| KOG0531 | 414 | consensus Protein phosphatase 1, regulatory subuni | 97.66 | |
| PHA02544 | 316 | 44 clamp loader, small subunit; Provisional | 97.65 | |
| KOG0531 | 414 | consensus Protein phosphatase 1, regulatory subuni | 97.64 | |
| TIGR02881 | 261 | spore_V_K stage V sporulation protein K. Members o | 97.63 | |
| COG2255 | 332 | RuvB Holliday junction resolvasome, helicase subun | 97.61 | |
| PRK14948 | 620 | DNA polymerase III subunits gamma and tau; Provisi | 97.6 | |
| PRK06647 | 563 | DNA polymerase III subunits gamma and tau; Validat | 97.6 | |
| PRK08903 | 227 | DnaA regulatory inactivator Hda; Validated | 97.59 | |
| CHL00181 | 287 | cbbX CbbX; Provisional | 97.58 | |
| COG1373 | 398 | Predicted ATPase (AAA+ superfamily) [General funct | 97.58 | |
| TIGR03689 | 512 | pup_AAA proteasome ATPase. In the Actinobacteria, | 97.58 | |
| TIGR00362 | 405 | DnaA chromosomal replication initiator protein Dna | 97.58 | |
| TIGR02639 | 731 | ClpA ATP-dependent Clp protease ATP-binding subuni | 97.57 | |
| KOG2982 | 418 | consensus Uncharacterized conserved protein [Funct | 97.55 | |
| PRK14965 | 576 | DNA polymerase III subunits gamma and tau; Provisi | 97.54 | |
| PRK07399 | 314 | DNA polymerase III subunit delta'; Validated | 97.51 | |
| KOG3665 | 699 | consensus ZYG-1-like serine/threonine protein kina | 97.51 | |
| TIGR02880 | 284 | cbbX_cfxQ probable Rubsico expression protein CbbX | 97.51 | |
| TIGR03345 | 852 | VI_ClpV1 type VI secretion ATPase, ClpV1 family. M | 97.5 | |
| CHL00095 | 821 | clpC Clp protease ATP binding subunit | 97.49 | |
| KOG1909 | 382 | consensus Ran GTPase-activating protein [RNA proce | 97.48 | |
| PRK05563 | 559 | DNA polymerase III subunits gamma and tau; Validat | 97.46 | |
| PRK00149 | 450 | dnaA chromosomal replication initiation protein; R | 97.42 | |
| PTZ00454 | 398 | 26S protease regulatory subunit 6B-like protein; P | 97.41 | |
| KOG3665 | 699 | consensus ZYG-1-like serine/threonine protein kina | 97.39 | |
| PRK14086 | 617 | dnaA chromosomal replication initiation protein; P | 97.36 | |
| PRK05707 | 328 | DNA polymerase III subunit delta'; Validated | 97.35 | |
| KOG2543 | 438 | consensus Origin recognition complex, subunit 5 [R | 97.35 | |
| PRK06620 | 214 | hypothetical protein; Validated | 97.32 | |
| PRK14088 | 440 | dnaA chromosomal replication initiation protein; P | 97.31 | |
| PTZ00361 | 438 | 26 proteosome regulatory subunit 4-like protein; P | 97.31 | |
| PRK10536 | 262 | hypothetical protein; Provisional | 97.29 | |
| PF05673 | 249 | DUF815: Protein of unknown function (DUF815); Inte | 97.27 | |
| CHL00176 | 638 | ftsH cell division protein; Validated | 97.24 | |
| smart00382 | 148 | AAA ATPases associated with a variety of cellular | 97.2 | |
| TIGR00602 | 637 | rad24 checkpoint protein rad24. This family is bas | 97.2 | |
| PRK08118 | 167 | topology modulation protein; Reviewed | 97.18 | |
| TIGR03346 | 852 | chaperone_ClpB ATP-dependent chaperone ClpB. Membe | 97.16 | |
| PRK10865 | 857 | protein disaggregation chaperone; Provisional | 97.12 | |
| PRK11034 | 758 | clpA ATP-dependent Clp protease ATP-binding subuni | 97.12 | |
| PF00004 | 132 | AAA: ATPase family associated with various cellula | 97.11 | |
| KOG1909 | 382 | consensus Ran GTPase-activating protein [RNA proce | 97.11 | |
| PRK08058 | 329 | DNA polymerase III subunit delta'; Validated | 97.08 | |
| TIGR01241 | 495 | FtsH_fam ATP-dependent metalloprotease FtsH. HflB( | 97.08 | |
| PRK12422 | 445 | chromosomal replication initiation protein; Provis | 97.08 | |
| KOG0991 | 333 | consensus Replication factor C, subunit RFC2 [Repl | 97.06 | |
| PF13177 | 162 | DNA_pol3_delta2: DNA polymerase III, delta subunit | 97.04 | |
| PRK12608 | 380 | transcription termination factor Rho; Provisional | 97.04 | |
| PRK08769 | 319 | DNA polymerase III subunit delta'; Validated | 97.04 | |
| KOG0741 | 744 | consensus AAA+-type ATPase [Posttranslational modi | 97.04 | |
| COG1222 | 406 | RPT1 ATP-dependent 26S proteasome regulatory subun | 97.03 | |
| PRK06090 | 319 | DNA polymerase III subunit delta'; Validated | 96.99 | |
| COG0466 | 782 | Lon ATP-dependent Lon protease, bacterial type [Po | 96.96 | |
| COG0593 | 408 | DnaA ATPase involved in DNA replication initiation | 96.95 | |
| PRK08116 | 268 | hypothetical protein; Validated | 96.92 | |
| KOG2982 | 418 | consensus Uncharacterized conserved protein [Funct | 96.9 | |
| KOG0731 | 774 | consensus AAA+-type ATPase containing the peptidas | 96.89 | |
| PRK06871 | 325 | DNA polymerase III subunit delta'; Validated | 96.89 | |
| KOG1644 | 233 | consensus U2-associated snRNP A' protein [RNA proc | 96.88 | |
| PF04665 | 241 | Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 | 96.84 | |
| COG1223 | 368 | Predicted ATPase (AAA+ superfamily) [General funct | 96.77 | |
| KOG4579 | 177 | consensus Leucine-rich repeat (LRR) protein associ | 96.76 | |
| PRK07261 | 171 | topology modulation protein; Provisional | 96.75 | |
| KOG2004 | 906 | consensus Mitochondrial ATP-dependent protease PIM | 96.72 | |
| KOG0733 | 802 | consensus Nuclear AAA ATPase (VCP subfamily) [Post | 96.7 | |
| PHA00729 | 226 | NTP-binding motif containing protein | 96.65 | |
| COG3267 | 269 | ExeA Type II secretory pathway, component ExeA (pr | 96.64 | |
| TIGR00763 | 775 | lon ATP-dependent protease La. This protein is ind | 96.57 | |
| KOG1644 | 233 | consensus U2-associated snRNP A' protein [RNA proc | 96.56 | |
| PRK10865 | 857 | protein disaggregation chaperone; Provisional | 96.56 | |
| PRK06964 | 342 | DNA polymerase III subunit delta'; Validated | 96.55 | |
| CHL00195 | 489 | ycf46 Ycf46; Provisional | 96.54 | |
| PF02562 | 205 | PhoH: PhoH-like protein; InterPro: IPR003714 PhoH | 96.53 | |
| PRK07993 | 334 | DNA polymerase III subunit delta'; Validated | 96.51 | |
| KOG4579 | 177 | consensus Leucine-rich repeat (LRR) protein associ | 96.48 | |
| KOG2035 | 351 | consensus Replication factor C, subunit RFC3 [Cell | 96.39 | |
| TIGR02640 | 262 | gas_vesic_GvpN gas vesicle protein GvpN. Members o | 96.37 | |
| COG0542 | 786 | clpA ATP-binding subunits of Clp protease and DnaK | 96.34 | |
| TIGR02237 | 209 | recomb_radB DNA repair and recombination protein R | 96.33 | |
| PF00448 | 196 | SRP54: SRP54-type protein, GTPase domain; InterPro | 96.33 | |
| TIGR01243 | 733 | CDC48 AAA family ATPase, CDC48 subfamily. This sub | 96.32 | |
| KOG0743 | 457 | consensus AAA+-type ATPase [Posttranslational modi | 96.32 | |
| PRK08181 | 269 | transposase; Validated | 96.32 | |
| PRK12377 | 248 | putative replication protein; Provisional | 96.26 | |
| PRK08939 | 306 | primosomal protein DnaI; Reviewed | 96.23 | |
| PF10443 | 431 | RNA12: RNA12 protein; InterPro: IPR018850 Mitochon | 96.22 | |
| KOG0730 | 693 | consensus AAA+-type ATPase [Posttranslational modi | 96.21 | |
| COG1875 | 436 | NYN ribonuclease and ATPase of PhoH family domains | 96.19 | |
| PF13207 | 121 | AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6 | 96.19 | |
| TIGR03345 | 852 | VI_ClpV1 type VI secretion ATPase, ClpV1 family. M | 96.15 | |
| smart00763 | 361 | AAA_PrkA PrkA AAA domain. This is a family of PrkA | 96.13 | |
| PRK06921 | 266 | hypothetical protein; Provisional | 96.13 | |
| KOG0739 | 439 | consensus AAA+-type ATPase [Posttranslational modi | 96.13 | |
| PRK10787 | 784 | DNA-binding ATP-dependent protease La; Provisional | 96.12 | |
| TIGR01243 | 733 | CDC48 AAA family ATPase, CDC48 subfamily. This sub | 96.1 | |
| TIGR02639 | 731 | ClpA ATP-dependent Clp protease ATP-binding subuni | 96.1 | |
| TIGR03499 | 282 | FlhF flagellar biosynthetic protein FlhF. | 96.1 | |
| KOG2123 | 388 | consensus Uncharacterized conserved protein [Funct | 96.09 | |
| KOG2739 | 260 | consensus Leucine-rich acidic nuclear protein [Cel | 96.06 | |
| cd01123 | 235 | Rad51_DMC1_radA Rad51_DMC1_radA,B. This group of r | 96.06 | |
| TIGR01425 | 429 | SRP54_euk signal recognition particle protein SRP5 | 96.01 | |
| PRK14722 | 374 | flhF flagellar biosynthesis regulator FlhF; Provis | 95.97 | |
| cd01133 | 274 | F1-ATPase_beta F1 ATP synthase beta subunit, nucle | 95.97 | |
| TIGR03346 | 852 | chaperone_ClpB ATP-dependent chaperone ClpB. Membe | 95.96 | |
| COG2884 | 223 | FtsE Predicted ATPase involved in cell division [C | 95.94 | |
| PRK04132 | 846 | replication factor C small subunit; Provisional | 95.93 | |
| PRK06526 | 254 | transposase; Provisional | 95.92 | |
| COG2812 | 515 | DnaX DNA polymerase III, gamma/tau subunits [DNA r | 95.9 | |
| PRK00771 | 437 | signal recognition particle protein Srp54; Provisi | 95.89 | |
| PRK11889 | 436 | flhF flagellar biosynthesis regulator FlhF; Provis | 95.86 | |
| PRK09183 | 259 | transposase/IS protein; Provisional | 95.85 | |
| PF01695 | 178 | IstB_IS21: IstB-like ATP binding protein; InterPro | 95.85 | |
| PRK09270 | 229 | nucleoside triphosphate hydrolase domain-containin | 95.83 | |
| COG5238 | 388 | RNA1 Ran GTPase-activating protein (RanGAP) involv | 95.82 | |
| TIGR02902 | 531 | spore_lonB ATP-dependent protease LonB. Members of | 95.8 | |
| PRK06696 | 223 | uridine kinase; Validated | 95.79 | |
| KOG0727 | 408 | consensus 26S proteasome regulatory complex, ATPas | 95.78 | |
| KOG0734 | 752 | consensus AAA+-type ATPase containing the peptidas | 95.77 | |
| KOG0735 | 952 | consensus AAA+-type ATPase [Posttranslational modi | 95.75 | |
| PRK08699 | 325 | DNA polymerase III subunit delta'; Validated | 95.69 | |
| PRK07952 | 244 | DNA replication protein DnaC; Validated | 95.66 | |
| CHL00095 | 821 | clpC Clp protease ATP binding subunit | 95.66 | |
| TIGR02012 | 321 | tigrfam_recA protein RecA. This model describes or | 95.65 | |
| COG0470 | 325 | HolB ATPase involved in DNA replication [DNA repli | 95.62 | |
| PRK12727 | 559 | flagellar biosynthesis regulator FlhF; Provisional | 95.61 | |
| KOG0736 | 953 | consensus Peroxisome assembly factor 2 containing | 95.61 | |
| PRK10867 | 433 | signal recognition particle protein; Provisional | 95.59 | |
| KOG0733 | 802 | consensus Nuclear AAA ATPase (VCP subfamily) [Post | 95.56 | |
| cd01393 | 226 | recA_like RecA is a bacterial enzyme which has rol | 95.54 | |
| COG1484 | 254 | DnaC DNA replication protein [DNA replication, rec | 95.51 | |
| PRK11034 | 758 | clpA ATP-dependent Clp protease ATP-binding subuni | 95.51 | |
| PF07693 | 325 | KAP_NTPase: KAP family P-loop domain; InterPro: IP | 95.49 | |
| TIGR02238 | 313 | recomb_DMC1 meiotic recombinase Dmc1. This model d | 95.46 | |
| cd01120 | 165 | RecA-like_NTPases RecA-like NTPases. This family i | 95.4 | |
| cd00983 | 325 | recA RecA is a bacterial enzyme which has roles in | 95.39 | |
| PRK09361 | 225 | radB DNA repair and recombination protein RadB; Pr | 95.39 | |
| COG1618 | 179 | Predicted nucleotide kinase [Nucleotide transport | 95.39 | |
| PF08423 | 256 | Rad51: Rad51; InterPro: IPR013632 This domain is f | 95.38 | |
| PRK05541 | 176 | adenylylsulfate kinase; Provisional | 95.37 | |
| COG0542 | 786 | clpA ATP-binding subunits of Clp protease and DnaK | 95.36 | |
| cd02025 | 220 | PanK Pantothenate kinase (PanK) catalyzes the phos | 95.35 | |
| PRK09354 | 349 | recA recombinase A; Provisional | 95.33 | |
| PRK12724 | 432 | flagellar biosynthesis regulator FlhF; Provisional | 95.32 | |
| TIGR00554 | 290 | panK_bact pantothenate kinase, bacterial type. Sho | 95.3 | |
| KOG2123 | 388 | consensus Uncharacterized conserved protein [Funct | 95.24 | |
| PF03215 | 519 | Rad17: Rad17 cell cycle checkpoint protein | 95.2 | |
| KOG1532 | 366 | consensus GTPase XAB1, interacts with DNA repair p | 95.14 | |
| PRK06835 | 329 | DNA replication protein DnaC; Validated | 95.12 | |
| TIGR02858 | 270 | spore_III_AA stage III sporulation protein AA. Mem | 95.11 | |
| PLN03187 | 344 | meiotic recombination protein DMC1 homolog; Provis | 95.07 | |
| PRK08533 | 230 | flagellar accessory protein FlaH; Reviewed | 95.05 | |
| KOG2739 | 260 | consensus Leucine-rich acidic nuclear protein [Cel | 95.02 | |
| KOG1969 | 877 | consensus DNA replication checkpoint protein CHL12 | 95.0 | |
| PRK04296 | 190 | thymidine kinase; Provisional | 94.98 | |
| TIGR01359 | 183 | UMP_CMP_kin_fam UMP-CMP kinase family. This subfam | 94.98 | |
| PRK06547 | 172 | hypothetical protein; Provisional | 94.98 | |
| PF00485 | 194 | PRK: Phosphoribulokinase / Uridine kinase family; | 94.95 | |
| cd03115 | 173 | SRP The signal recognition particle (SRP) mediates | 94.95 | |
| PRK12723 | 388 | flagellar biosynthesis regulator FlhF; Provisional | 94.94 | |
| COG0194 | 191 | Gmk Guanylate kinase [Nucleotide transport and met | 94.88 | |
| PRK15455 | 644 | PrkA family serine protein kinase; Provisional | 94.87 | |
| KOG0728 | 404 | consensus 26S proteasome regulatory complex, ATPas | 94.84 | |
| PRK10733 | 644 | hflB ATP-dependent metalloprotease; Reviewed | 94.82 | |
| PRK12726 | 407 | flagellar biosynthesis regulator FlhF; Provisional | 94.82 | |
| PF00006 | 215 | ATP-synt_ab: ATP synthase alpha/beta family, nucle | 94.81 | |
| PF00560 | 22 | LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le | 94.81 | |
| PRK07667 | 193 | uridine kinase; Provisional | 94.79 | |
| PLN00020 | 413 | ribulose bisphosphate carboxylase/oxygenase activa | 94.78 | |
| TIGR00959 | 428 | ffh signal recognition particle protein. This mode | 94.77 | |
| TIGR02239 | 316 | recomb_RAD51 DNA repair protein RAD51. This eukary | 94.76 | |
| TIGR03877 | 237 | thermo_KaiC_1 KaiC domain protein, Ph0284 family. | 94.75 | |
| PRK07132 | 299 | DNA polymerase III subunit delta'; Validated | 94.72 | |
| COG0464 | 494 | SpoVK ATPases of the AAA+ class [Posttranslational | 94.69 | |
| PRK05703 | 424 | flhF flagellar biosynthesis regulator FlhF; Valida | 94.69 | |
| PRK14974 | 336 | cell division protein FtsY; Provisional | 94.68 | |
| KOG3864 | 221 | consensus Uncharacterized conserved protein [Funct | 94.66 | |
| COG0541 | 451 | Ffh Signal recognition particle GTPase [Intracellu | 94.65 | |
| KOG2228 | 408 | consensus Origin recognition complex, subunit 4 [R | 94.62 | |
| KOG0738 | 491 | consensus AAA+-type ATPase [Posttranslational modi | 94.61 | |
| cd03247 | 178 | ABCC_cytochrome_bd The CYD subfamily implicated in | 94.6 | |
| TIGR02236 | 310 | recomb_radA DNA repair and recombination protein R | 94.6 | |
| cd01121 | 372 | Sms Sms (bacterial radA) DNA repair protein. This | 94.6 | |
| COG3640 | 255 | CooC CO dehydrogenase maturation factor [Cell divi | 94.58 | |
| PLN03186 | 342 | DNA repair protein RAD51 homolog; Provisional | 94.57 | |
| PRK05439 | 311 | pantothenate kinase; Provisional | 94.56 | |
| cd01394 | 218 | radB RadB. The archaeal protein radB shares simila | 94.55 | |
| PTZ00035 | 337 | Rad51 protein; Provisional | 94.51 | |
| COG1102 | 179 | Cmk Cytidylate kinase [Nucleotide transport and me | 94.5 | |
| COG1419 | 407 | FlhF Flagellar GTP-binding protein [Cell motility | 94.49 | |
| KOG0729 | 435 | consensus 26S proteasome regulatory complex, ATPas | 94.46 | |
| cd02019 | 69 | NK Nucleoside/nucleotide kinase (NK) is a protein | 94.44 | |
| PRK04301 | 317 | radA DNA repair and recombination protein RadA; Va | 94.43 | |
| KOG0744 | 423 | consensus AAA+-type ATPase [Posttranslational modi | 94.42 | |
| COG2607 | 287 | Predicted ATPase (AAA+ superfamily) [General funct | 94.39 | |
| cd01135 | 276 | V_A-ATPase_B V/A-type ATP synthase (non-catalytic) | 94.37 | |
| cd01131 | 198 | PilT Pilus retraction ATPase PilT. PilT is a nucle | 94.36 | |
| PF13238 | 129 | AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB | 94.35 | |
| PRK06995 | 484 | flhF flagellar biosynthesis regulator FlhF; Valida | 94.32 | |
| PRK14721 | 420 | flhF flagellar biosynthesis regulator FlhF; Provis | 94.3 | |
| cd03281 | 213 | ABC_MSH5_euk MutS5 homolog in eukaryotes. The MutS | 94.3 | |
| COG0468 | 279 | RecA RecA/RadA recombinase [DNA replication, recom | 94.26 | |
| TIGR00064 | 272 | ftsY signal recognition particle-docking protein F | 94.25 | |
| PF13481 | 193 | AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C. | 94.23 | |
| COG1428 | 216 | Deoxynucleoside kinases [Nucleotide transport and | 94.17 | |
| PF00560 | 22 | LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le | 94.16 | |
| PRK14723 | 767 | flhF flagellar biosynthesis regulator FlhF; Provis | 94.14 | |
| PRK05480 | 209 | uridine/cytidine kinase; Provisional | 94.13 | |
| TIGR00235 | 207 | udk uridine kinase. Model contains a number of lon | 94.13 | |
| COG0572 | 218 | Udk Uridine kinase [Nucleotide transport and metab | 94.11 | |
| COG4088 | 261 | Predicted nucleotide kinase [Nucleotide transport | 94.08 | |
| PRK04328 | 249 | hypothetical protein; Provisional | 94.08 | |
| PF01583 | 156 | APS_kinase: Adenylylsulphate kinase; InterPro: IPR | 94.07 | |
| PRK08233 | 182 | hypothetical protein; Provisional | 94.06 | |
| PTZ00301 | 210 | uridine kinase; Provisional | 94.04 | |
| cd03221 | 144 | ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is | 93.99 | |
| PF07728 | 139 | AAA_5: AAA domain (dynein-related subfamily); Inte | 93.98 | |
| PF13306 | 129 | LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ | 93.97 | |
| PF13306 | 129 | LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ | 93.96 | |
| PF03205 | 140 | MobB: Molybdopterin guanine dinucleotide synthesis | 93.94 | |
| cd03238 | 176 | ABC_UvrA The excision repair protein UvrA; Nucleot | 93.89 | |
| TIGR03305 | 449 | alt_F1F0_F1_bet alternate F1F0 ATPase, F1 subunit | 93.88 | |
| PRK12597 | 461 | F0F1 ATP synthase subunit beta; Provisional | 93.85 | |
| COG0563 | 178 | Adk Adenylate kinase and related kinases [Nucleoti | 93.8 | |
| PF13671 | 143 | AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1 | 93.8 | |
| PRK06762 | 166 | hypothetical protein; Provisional | 93.79 | |
| PRK13948 | 182 | shikimate kinase; Provisional | 93.75 | |
| PRK08972 | 444 | fliI flagellum-specific ATP synthase; Validated | 93.73 | |
| cd03216 | 163 | ABC_Carb_Monos_I This family represents the domain | 93.7 | |
| cd03222 | 177 | ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibi | 93.7 | |
| cd03223 | 166 | ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cass | 93.65 | |
| PRK05917 | 290 | DNA polymerase III subunit delta'; Validated | 93.65 | |
| TIGR01360 | 188 | aden_kin_iso1 adenylate kinase, isozyme 1 subfamil | 93.63 | |
| PF08433 | 270 | KTI12: Chromatin associated protein KTI12 ; InterP | 93.63 | |
| COG1066 | 456 | Sms Predicted ATP-dependent serine protease [Postt | 93.59 | |
| PRK03839 | 180 | putative kinase; Provisional | 93.59 | |
| KOG1514 | 767 | consensus Origin recognition complex, subunit 1, a | 93.58 | |
| PRK13230 | 279 | nitrogenase reductase-like protein; Reviewed | 93.57 | |
| cd03214 | 180 | ABC_Iron-Siderophores_B12_Hemin ABC transporters, | 93.55 | |
| TIGR01069 | 771 | mutS2 MutS2 family protein. Function of MutS2 is u | 93.55 | |
| KOG0737 | 386 | consensus AAA+-type ATPase [Posttranslational modi | 93.54 | |
| PRK13236 | 296 | nitrogenase reductase; Reviewed | 93.52 | |
| PRK08927 | 442 | fliI flagellum-specific ATP synthase; Validated | 93.51 | |
| PRK06067 | 234 | flagellar accessory protein FlaH; Validated | 93.49 | |
| PF00154 | 322 | RecA: recA bacterial DNA recombination protein; In | 93.49 | |
| PRK09280 | 463 | F0F1 ATP synthase subunit beta; Validated | 93.47 | |
| PF00910 | 107 | RNA_helicase: RNA helicase; InterPro: IPR000605 He | 93.46 | |
| cd02027 | 149 | APSK Adenosine 5'-phosphosulfate kinase (APSK) cat | 93.44 | |
| PRK13949 | 169 | shikimate kinase; Provisional | 93.42 | |
| cd03228 | 171 | ABCC_MRP_Like The MRP (Mutidrug Resistance Protein | 93.42 | |
| TIGR03575 | 340 | selen_PSTK_euk L-seryl-tRNA(Sec) kinase, eukaryoti | 93.36 | |
| COG0465 | 596 | HflB ATP-dependent Zn proteases [Posttranslational | 93.36 | |
| PRK00625 | 173 | shikimate kinase; Provisional | 93.35 | |
| CHL00206 | 2281 | ycf2 Ycf2; Provisional | 93.35 | |
| PRK04040 | 188 | adenylate kinase; Provisional | 93.33 | |
| PRK13531 | 498 | regulatory ATPase RavA; Provisional | 93.32 | |
| cd03283 | 199 | ABC_MutS-like MutS-like homolog in eukaryotes. The | 93.3 | |
| KOG3347 | 176 | consensus Predicted nucleotide kinase/nuclear prot | 93.3 | |
| COG4608 | 268 | AppF ABC-type oligopeptide transport system, ATPas | 93.28 | |
| COG0467 | 260 | RAD55 RecA-superfamily ATPases implicated in signa | 93.24 | |
| cd01124 | 187 | KaiC KaiC is a circadian clock protein primarily f | 93.24 | |
| cd03246 | 173 | ABCC_Protease_Secretion This family represents the | 93.23 | |
| PRK06851 | 367 | hypothetical protein; Provisional | 93.2 | |
| PTZ00088 | 229 | adenylate kinase 1; Provisional | 93.16 | |
| PRK13232 | 273 | nifH nitrogenase reductase; Reviewed | 93.13 | |
| PRK10751 | 173 | molybdopterin-guanine dinucleotide biosynthesis pr | 93.12 | |
| PRK13235 | 274 | nifH nitrogenase reductase; Reviewed | 93.1 | |
| PF12775 | 272 | AAA_7: P-loop containing dynein motor region D3; P | 93.07 | |
| PF03308 | 266 | ArgK: ArgK protein; InterPro: IPR005129 Bacterial | 93.05 | |
| TIGR02655 | 484 | circ_KaiC circadian clock protein KaiC. Members of | 93.0 | |
| PF14532 | 138 | Sigma54_activ_2: Sigma-54 interaction domain; PDB: | 92.99 | |
| TIGR00390 | 441 | hslU ATP-dependent protease HslVU, ATPase subunit. | 92.96 | |
| ) proteins. It has been suggested that torsins play a role in effectively managing protein folding and that possible breakdown in a neuroprotective mechanism that is, in part, mediated by torsins may be responsible for the neuronal dysfunction associated with dystonia [].; GO: 0005524 ATP binding, 0051085 chaperone mediated protein folding requiring cofactor" target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=PF06309">PF06309 | 127 | Torsin: Torsin; InterPro: IPR010448 This family co | 92.81 | |
| cd02024 | 187 | NRK1 Nicotinamide riboside kinase (NRK) is an enzy | 92.81 | |
| TIGR01040 | 466 | V-ATPase_V1_B V-type (H+)-ATPase V1, B subunit. Th | 92.77 | |
| PRK12678 | 672 | transcription termination factor Rho; Provisional | 92.71 | |
| TIGR03878 | 259 | thermo_KaiC_2 KaiC domain protein, AF_0795 family. | 92.7 | |
| PRK13768 | 253 | GTPase; Provisional | 92.69 | |
| PRK10463 | 290 | hydrogenase nickel incorporation protein HypB; Pro | 92.67 | |
| PRK13765 | 637 | ATP-dependent protease Lon; Provisional | 92.65 | |
| KOG3864 | 221 | consensus Uncharacterized conserved protein [Funct | 92.65 | |
| PRK11823 | 446 | DNA repair protein RadA; Provisional | 92.65 | |
| TIGR01041 | 458 | ATP_syn_B_arch ATP synthase archaeal, B subunit. A | 92.64 | |
| cd00544 | 169 | CobU Adenosylcobinamide kinase / adenosylcobinamid | 92.64 | |
| TIGR01039 | 461 | atpD ATP synthase, F1 beta subunit. The sequences | 92.63 | |
| PRK00279 | 215 | adk adenylate kinase; Reviewed | 92.63 | |
| cd02023 | 198 | UMPK Uridine monophosphate kinase (UMPK, EC 2.7.1. | 92.62 | |
| PRK08149 | 428 | ATP synthase SpaL; Validated | 92.62 | |
| PRK00131 | 175 | aroK shikimate kinase; Reviewed | 92.57 | |
| PRK00889 | 175 | adenylylsulfate kinase; Provisional | 92.54 | |
| PRK00409 | 782 | recombination and DNA strand exchange inhibitor pr | 92.51 | |
| PRK10416 | 318 | signal recognition particle-docking protein FtsY; | 92.44 | |
| cd02020 | 147 | CMPK Cytidine monophosphate kinase (CMPK) catalyze | 92.43 | |
| TIGR02030 | 337 | BchI-ChlI magnesium chelatase ATPase subunit I. Th | 92.42 | |
| TIGR02322 | 179 | phosphon_PhnN phosphonate metabolism protein/1,5-b | 92.42 | |
| PF07726 | 131 | AAA_3: ATPase family associated with various cellu | 92.38 | |
| PRK06217 | 183 | hypothetical protein; Validated | 92.37 | |
| PHA02774 | 613 | E1; Provisional | 92.37 | |
| cd01134 | 369 | V_A-ATPase_A V/A-type ATP synthase catalytic subun | 92.35 | |
| cd02028 | 179 | UMPK_like Uridine monophosphate kinase_like (UMPK_ | 92.34 | |
| TIGR00176 | 155 | mobB molybdopterin-guanine dinucleotide biosynthes | 92.32 | |
| TIGR00416 | 454 | sms DNA repair protein RadA. The gene protuct code | 92.32 | |
| TIGR00150 | 133 | HI0065_YjeE ATPase, YjeE family. Members of this f | 92.31 | |
| PRK09519 | 790 | recA DNA recombination protein RecA; Reviewed | 92.31 | |
| PRK05342 | 412 | clpX ATP-dependent protease ATP-binding subunit Cl | 92.29 | |
| PF06745 | 226 | KaiC: KaiC; InterPro: IPR014774 This entry represe | 92.28 | |
| COG0003 | 322 | ArsA Predicted ATPase involved in chromosome parti | 92.26 | |
| PLN02200 | 234 | adenylate kinase family protein | 92.2 | |
| cd00267 | 157 | ABC_ATPase ABC (ATP-binding cassette) transporter | 92.18 | |
| PRK13234 | 295 | nifH nitrogenase reductase; Reviewed | 92.08 | |
| CHL00081 | 350 | chlI Mg-protoporyphyrin IX chelatase | 92.07 | |
| cd01132 | 274 | F1_ATPase_alpha F1 ATP synthase alpha, central dom | 92.06 | |
| PRK14532 | 188 | adenylate kinase; Provisional | 92.06 | |
| PRK06936 | 439 | type III secretion system ATPase; Provisional | 92.04 | |
| TIGR01817 | 534 | nifA Nif-specific regulatory protein. This model r | 92.04 | |
| KOG1051 | 898 | consensus Chaperone HSP104 and related ATP-depende | 92.04 | |
| cd02029 | 277 | PRK_like Phosphoribulokinase-like (PRK-like) is a | 92.03 | |
| cd01125 | 239 | repA Hexameric Replicative Helicase RepA. RepA is | 92.01 | |
| PF00625 | 183 | Guanylate_kin: Guanylate kinase; InterPro: IPR0081 | 91.98 | |
| KOG0735 | 952 | consensus AAA+-type ATPase [Posttranslational modi | 91.97 | |
| PRK06002 | 450 | fliI flagellum-specific ATP synthase; Validated | 91.97 | |
| PRK13695 | 174 | putative NTPase; Provisional | 91.97 | |
| CHL00060 | 494 | atpB ATP synthase CF1 beta subunit | 91.97 | |
| PRK13947 | 171 | shikimate kinase; Provisional | 91.96 | |
| PRK11608 | 326 | pspF phage shock protein operon transcriptional ac | 91.95 | |
| COG1936 | 180 | Predicted nucleotide kinase (related to CMP and AM | 91.93 | |
| COG3854 | 308 | SpoIIIAA ncharacterized protein conserved in bacte | 91.9 | |
| cd02021 | 150 | GntK Gluconate kinase (GntK) catalyzes the phospho | 91.9 | |
| KOG0927 | 614 | consensus Predicted transporter (ABC superfamily) | 91.86 | |
| cd00227 | 175 | CPT Chloramphenicol (Cm) phosphotransferase (CPT). | 91.86 | |
| PRK04196 | 460 | V-type ATP synthase subunit B; Provisional | 91.85 | |
| cd00561 | 159 | CobA_CobO_BtuR ATP:corrinoid adenosyltransferase B | 91.84 | |
| TIGR00073 | 207 | hypB hydrogenase accessory protein HypB. HypB is i | 91.81 | |
| COG0488 | 530 | Uup ATPase components of ABC transporters with dup | 91.81 | |
| COG0529 | 197 | CysC Adenylylsulfate kinase and related kinases [I | 91.73 | |
| PTZ00185 | 574 | ATPase alpha subunit; Provisional | 91.73 | |
| PF13245 | 76 | AAA_19: Part of AAA domain | 91.68 | |
| PRK13975 | 196 | thymidylate kinase; Provisional | 91.68 | |
| COG1703 | 323 | ArgK Putative periplasmic protein kinase ArgK and | 91.62 | |
| cd00464 | 154 | SK Shikimate kinase (SK) is the fifth enzyme in th | 91.6 | |
| PRK15453 | 290 | phosphoribulokinase; Provisional | 91.59 | |
| COG0237 | 201 | CoaE Dephospho-CoA kinase [Coenzyme metabolism] | 91.56 | |
| PRK14530 | 215 | adenylate kinase; Provisional | 91.52 | |
| PRK15429 | 686 | formate hydrogenlyase transcriptional activator Fh | 91.52 | |
| TIGR03263 | 180 | guanyl_kin guanylate kinase. Members of this famil | 91.52 | |
| PRK03846 | 198 | adenylylsulfate kinase; Provisional | 91.5 | |
| KOG0652 | 424 | consensus 26S proteasome regulatory complex, ATPas | 91.49 | |
| cd01136 | 326 | ATPase_flagellum-secretory_path_III Flagellum-spec | 91.48 | |
| TIGR03881 | 229 | KaiC_arch_4 KaiC domain protein, PAE1156 family. M | 91.47 | |
| COG1124 | 252 | DppF ABC-type dipeptide/oligopeptide/nickel transp | 91.46 | |
| PF03266 | 168 | NTPase_1: NTPase; InterPro: IPR004948 This entry r | 91.44 | |
| PRK05057 | 172 | aroK shikimate kinase I; Reviewed | 91.44 | |
| TIGR00764 | 608 | lon_rel lon-related putative ATP-dependent proteas | 91.4 | |
| TIGR00750 | 300 | lao LAO/AO transport system ATPase. Mutations have | 91.38 | |
| PF03029 | 238 | ATP_bind_1: Conserved hypothetical ATP binding pro | 91.38 | |
| PF13504 | 17 | LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO | 91.37 | |
| cd00820 | 107 | PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPC | 91.36 | |
| cd00071 | 137 | GMPK Guanosine monophosphate kinase (GMPK, EC 2.7. | 91.33 | |
| KOG0473 | 326 | consensus Leucine-rich repeat protein [Function un | 91.28 | |
| COG2019 | 189 | AdkA Archaeal adenylate kinase [Nucleotide transpo | 91.27 | |
| COG1763 | 161 | MobB Molybdopterin-guanine dinucleotide biosynthes | 91.24 | |
| PRK00300 | 205 | gmk guanylate kinase; Provisional | 91.17 | |
| TIGR00382 | 413 | clpX endopeptidase Clp ATP-binding regulatory subu | 91.13 | |
| PF00406 | 151 | ADK: Adenylate kinase; InterPro: IPR000850 Adenyla | 91.13 | |
| cd01122 | 271 | GP4d_helicase GP4d_helicase is a homohexameric 5'- | 91.08 | |
| PRK12339 | 197 | 2-phosphoglycerate kinase; Provisional | 91.03 | |
| COG4240 | 300 | Predicted kinase [General function prediction only | 91.0 | |
| PRK13407 | 334 | bchI magnesium chelatase subunit I; Provisional | 90.99 |
| >KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
Probab=100.00 E-value=8.1e-86 Score=812.61 Aligned_cols=627 Identities=28% Similarity=0.432 Sum_probs=488.9
Q ss_pred ccccchhchhhhHHHHHHHHHHHHHHHHHHHHHHHHHHhcCccchHHHHHHHHHHHHHHHHHhhhhhchhhh--------
Q 000704 5 KQFGYFCCYKSNFDHLTKEVEKLRERRESVQHRVDFAKENGEEIEQSVENWLISVDKIVEEAGKFVEDDEEA-------- 76 (1342)
Q Consensus 5 ~~~~~l~~~~~~~~~~~~~~~~l~~~l~~i~~~l~~a~~~~~~~~~~v~~wl~~v~~~~~d~~~~~~~~~~~-------- 76 (1342)
+...++..+...+.+.++.+..+++.+..++.++++|+++ +.....+..|...+++++|++++.++.+.-.
T Consensus 11 ~~~~~l~~~~~~~~~~~~~i~~Lk~~L~~l~~~l~d~~a~-~~~~~~~~~~~e~~~~~~~~~e~~~~~~~v~~~~~~~~~ 89 (889)
T KOG4658|consen 11 KLDQLLNRESECLDGKDNYILELKENLKALQSALEDLDAK-RDDLERRVNWEEDVGDLVYLAEDIIWLFLVEEIERKAND 89 (889)
T ss_pred hHHHHHHHHHHHHhchHHHHHHHHHHHHHHHHHHHHHHhh-cchHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhH
Confidence 3445677788899999999999999999999999999988 5567889999999999999999877643210
Q ss_pred ---------CCCccCCCC-CChhHHhHHHHHHHHHHHHHHHHhhcCCCcceeccccccccccccccccCCCcccccchHH
Q 000704 77 ---------NNPCFKVLC-PNLKNRHHLSKKAAKEVKAIVELQDEGNFDRVSVRGISRDRLVAYTESYNEGHEFIESRES 146 (1342)
Q Consensus 77 ---------~~~~~~~~~-~~~~~r~~~~~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~gr~~ 146 (1342)
+.-|+...+ .....-+.+++++.++.+.++.+..++.|..+..... ........+...... +|.+.
T Consensus 90 ~l~~~~~~~~~~c~~~~~~~~~~~~~~~~~rv~~~l~~ve~l~~~~~~~~~~~~~~---~~~~~e~~~~~~~~~-VG~e~ 165 (889)
T KOG4658|consen 90 LLSTRSVERQRLCLCGFCSKNVSDSYKYGKRVSKVLREVESLGSKGVFEVVGESLD---PREKVETRPIQSESD-VGLET 165 (889)
T ss_pred HhhhhHHHHHHHhhhhhHhHhhhhhHhHHHHHHHHHHHHHHhccccceeccccccc---chhhcccCCCCcccc-ccHHH
Confidence 001211222 2233345566777777777777766655543332111 111222233333333 89999
Q ss_pred HHHHHHHHHcCCCeEEEEEEcCCCCcHHHHHHHHHHHHh-cCCCcceEEEEEecCCcCHHHHHHHHHHHhCCCCCCC---
Q 000704 147 ILNDILDALRGPYVYMIGVYGMAGIGKTTLVKEVARLAK-EGRIFDEVVFAEVSQTPDLKRIRREIADQLGLNFCEE--- 222 (1342)
Q Consensus 147 ~~~~l~~~l~~~~~~vi~I~G~gG~GKTtLa~~v~~~~~-~~~~F~~~~wv~vs~~~~~~~~~~~i~~~l~~~~~~~--- 222 (1342)
.++++.+.|.+++..+++|+||||+||||||++++|+.. ++.+||.++||+||+.++.++++++|++.++......
T Consensus 166 ~~~kl~~~L~~d~~~iv~i~GMGGvGKTTL~~qi~N~~~~v~~~Fd~~iWV~VSk~f~~~~iq~~Il~~l~~~~~~~~~~ 245 (889)
T KOG4658|consen 166 MLEKLWNRLMEDDVGIVGIYGMGGVGKTTLARQIFNKFDEVGNHFDGVIWVVVSKEFTTRKIQQTILERLGLLDEEWEDK 245 (889)
T ss_pred HHHHHHHHhccCCCCEEEEECCCcccHHHHHHHHhcccchhcccCceEEEEEEcccccHHhHHHHHHHHhccCCcccchh
Confidence 999999999987779999999999999999999999998 9999999999999999999999999999988744332
Q ss_pred ChHHHHHHHHHHHhcCCcEEEEEcCCCCcccccccCCCCCCCCCCcEEEEEecchhhhhhhcCcCccEEecCCCHHHHHH
Q 000704 223 SDSERIMMLCNRLKREKKILVILDDIWTSLDLERTGIPFGDVHRGCKILVTSRRRDVLVSEMHCQNNYCVSVLNKEEAWS 302 (1342)
Q Consensus 223 ~~~~~~~~l~~~l~~~k~~LlvlDdv~~~~~~~~l~~~l~~~~~gs~iliTtr~~~v~~~~~~~~~~~~l~~L~~~~~~~ 302 (1342)
.....+..+.+.|. +|||+|||||||+..+|+.++.|+|...+||||++|||++.||..+|++...++++.|+++|||.
T Consensus 246 ~~~~~~~~i~~~L~-~krfllvLDDIW~~~dw~~I~~~~p~~~~g~KvvlTTRs~~V~~~~m~~~~~~~v~~L~~~eaW~ 324 (889)
T KOG4658|consen 246 EEDELASKLLNLLE-GKRFLLVLDDIWEEVDWDKIGVPFPSRENGSKVVLTTRSEEVCGRAMGVDYPIEVECLTPEEAWD 324 (889)
T ss_pred hHHHHHHHHHHHhc-cCceEEEEecccccccHHhcCCCCCCccCCeEEEEEeccHhhhhccccCCccccccccCccccHH
Confidence 22455666666665 89999999999999999999999999999999999999999999668888999999999999999
Q ss_pred HHHHHhCCC--CCCccHHHHHHHHHHHhCCChHHHHHHHHHhcCCChhH-HHHHHHHHhhc-ccCCcchH-HHHHhHHHH
Q 000704 303 LFSKVVGNC--VEDPDLQTVAIQVANECGGLPIAILTVARTLRNKPLFV-WKKALQELRFS-ARNFTGLE-ALLGSTIEL 377 (1342)
Q Consensus 303 lf~~~~~~~--~~~~~~~~~~~~i~~~c~glPlai~~i~~~l~~~~~~~-w~~~l~~l~~~-~~~~~~~~-~~~~~~l~~ 377 (1342)
||++.||.. ...+.++++|++|+++|+|+|||++++|++|+.|.... |+++.+.+.+. ....++++ .++ ++|++
T Consensus 325 LF~~~v~~~~~~~~~~i~~lak~v~~kC~GLPLAl~viG~~ma~K~t~~eW~~~~~~l~s~~~~~~~~~~~~i~-~iLkl 403 (889)
T KOG4658|consen 325 LFQKKVGPNTLGSHPDIEELAKEVAEKCGGLPLALNVLGGLLACKKTVQEWRRALNVLKSSLAADFSGMEESIL-PILKL 403 (889)
T ss_pred HHHHhhccccccccccHHHHHHHHHHHhCChHHHHHHHHHHhcCCCcHHHHHHHHccccccccCCCCchhhhhH-Hhhhc
Confidence 999999743 34456999999999999999999999999999998774 99999999865 33344444 488 99999
Q ss_pred HhcccCcchhHHHHHhhccCCCCCCccHHHHHHHhhccccccccccHHHHHHHHHHHHHhHhhccccccCC---ccchhh
Q 000704 378 IYNYLEGEELKLTFLLCSLMKHPCDAPIMDLLKYGTGLGLFEDIYTMQERRDRVYALVRGLKDTCLLHDDD---TADWFS 454 (1342)
Q Consensus 378 sy~~L~~~~lk~cfl~~s~fp~~~~~~i~~li~~w~~~g~~~~~~~~~~~~~~~~~~~~~L~~~~l~~~~~---~~~~~~ 454 (1342)
||++||++ +|.||+|||+||++|.++++.||.+|+||||+.+....+.+.+.+++|+++|++|+|++... ...+|+
T Consensus 404 Syd~L~~~-lK~CFLycalFPED~~I~~e~Li~yWiaEGfi~~~~~~~~~~d~G~~~i~~LV~~~Ll~~~~~~~~~~~~k 482 (889)
T KOG4658|consen 404 SYDNLPEE-LKSCFLYCALFPEDYEIKKEKLIEYWIAEGFIDPLDGGETAEDVGYDYIEELVRASLLIEERDEGRKETVK 482 (889)
T ss_pred cHhhhhHH-HHHHHHhhccCCcccccchHHHHHHHHhccCcCccccccchhcchHHHHHHHHHHHHHhhcccccceeEEE
Confidence 99999965 99999999999995444559999999999999774444555666777899999999998764 346899
Q ss_pred hhhHHHHHHHHhhhc------ccEEecc-ccccCCccccccCceEEEecccCCCCCCCcCCCCCccEEEccCCCC-CCCC
Q 000704 455 MLGFVRNVAISIASI------NLMVRND-ALIEWPNKDMLKNCIAIFLHDINTGELPEGLEYPHLTSLCMNPKDP-FLHI 526 (1342)
Q Consensus 455 mhdlv~~~a~~~~~~------~~~~~~~-~~~~~~~~~~~~~~r~lsl~~~~~~~l~~~~~~~~Lr~L~l~~~~~-~~~~ 526 (1342)
|||+|||+|.++|++ ++++..+ +....+....+..+|+++++++.+..++....+++|++|.+.+|.. ...+
T Consensus 483 mHDvvRe~al~ias~~~~~~e~~iv~~~~~~~~~~~~~~~~~~rr~s~~~~~~~~~~~~~~~~~L~tLll~~n~~~l~~i 562 (889)
T KOG4658|consen 483 MHDVVREMALWIASDFGKQEENQIVSDGVGLSEIPQVKSWNSVRRMSLMNNKIEHIAGSSENPKLRTLLLQRNSDWLLEI 562 (889)
T ss_pred eeHHHHHHHHHHhccccccccceEEECCcCccccccccchhheeEEEEeccchhhccCCCCCCccceEEEeecchhhhhc
Confidence 999999999999993 4333332 3333455555678999999999999999888999999999999874 5788
Q ss_pred ChhhhcCCCCccEEEecCC-CCCcCCccCCCCCCCCEEEccCCCCCCCccccCCCCCCEEEccCCCCcccCcccCCCCcc
Q 000704 527 PDNFFAGMPKLRVLVLTRM-KLLTLPSSFCHLPNLESLCLDQCILGDIAIIGNLKNLEILSLCCSDIEQLPREIGELTQL 605 (1342)
Q Consensus 527 ~~~~f~~l~~Lr~L~L~~~-~i~~lp~~i~~L~~Lr~L~L~~~~i~~l~~i~~L~~L~~L~Ls~~~i~~LP~~i~~L~~L 605 (1342)
+..+|..++.||||||++| .+.++|++|+.|.|||||+|++ +.+..||.++++|+.|
T Consensus 563 s~~ff~~m~~LrVLDLs~~~~l~~LP~~I~~Li~LryL~L~~----------------------t~I~~LP~~l~~Lk~L 620 (889)
T KOG4658|consen 563 SGEFFRSLPLLRVLDLSGNSSLSKLPSSIGELVHLRYLDLSD----------------------TGISHLPSGLGNLKKL 620 (889)
T ss_pred CHHHHhhCcceEEEECCCCCccCcCChHHhhhhhhhcccccC----------------------CCccccchHHHHHHhh
Confidence 8889999999999999976 5568898887777777665555 5566677777777777
Q ss_pred cEEeccCCCCCCccCccccCCCCCCCEEEccCCcccccccccccccCCCChhhhcCCCCCCEEEee
Q 000704 606 KLLDLSNCSKLKVIPPNVISSLSQLEELYLGNTSVEWEFEGLNLERNNASLQELSILSHLTTLEIH 671 (1342)
Q Consensus 606 ~~L~L~~~~~l~~lp~~~l~~L~~L~~L~l~~~~~~~~~~~~~~~~~~~~~~~L~~L~~L~~L~l~ 671 (1342)
.+|++..+..+..+| +++..|++||+|.+..... ......+.++.+|.+|+.+.+.
T Consensus 621 ~~Lnl~~~~~l~~~~-~i~~~L~~Lr~L~l~~s~~---------~~~~~~l~el~~Le~L~~ls~~ 676 (889)
T KOG4658|consen 621 IYLNLEVTGRLESIP-GILLELQSLRVLRLPRSAL---------SNDKLLLKELENLEHLENLSIT 676 (889)
T ss_pred heecccccccccccc-chhhhcccccEEEeecccc---------ccchhhHHhhhcccchhhheee
Confidence 777777665554443 3355577777777654431 1123345666666666666654
|
|
| >PLN03210 Resistant to P | Back alignment and domain information |
|---|
| >PF00931 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is the NB-ARC domain, a novel signalling motif found in bacteria and eukaryotes, shared by plant resistance gene products and regulators of cell death in animals [] | Back alignment and domain information |
|---|
| >PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
| >PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
| >KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PLN03210 Resistant to P | Back alignment and domain information |
|---|
| >KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0472 consensus Leucine-rich repeat protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0472 consensus Leucine-rich repeat protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK04841 transcriptional regulator MalT; Provisional | Back alignment and domain information |
|---|
| >PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional | Back alignment and domain information |
|---|
| >PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional | Back alignment and domain information |
|---|
| >COG2909 MalT ATP-dependent transcriptional regulator [Transcription] | Back alignment and domain information |
|---|
| >PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional | Back alignment and domain information |
|---|
| >KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG4341 consensus F-box protein containing LRR [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4341 consensus F-box protein containing LRR [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily | Back alignment and domain information |
|---|
| >PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional | Back alignment and domain information |
|---|
| >PRK00411 cdc6 cell division control protein 6; Reviewed | Back alignment and domain information |
|---|
| >PF01637 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 This domain has been found in a number of bacterial and archaeal proteins, all of which contain a conserved P-loop motif that is involved in binding ATP | Back alignment and domain information |
|---|
| >PF05729 NACHT: NACHT domain | Back alignment and domain information |
|---|
| >PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A | Back alignment and domain information |
|---|
| >KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A | Back alignment and domain information |
|---|
| >TIGR02928 orc1/cdc6 family replication initiation protein | Back alignment and domain information |
|---|
| >KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] | Back alignment and domain information |
|---|
| >TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit | Back alignment and domain information |
|---|
| >PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed | Back alignment and domain information |
|---|
| >KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] | Back alignment and domain information |
|---|
| >cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily | Back alignment and domain information |
|---|
| >cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily | Back alignment and domain information |
|---|
| >KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK13342 recombination factor protein RarA; Reviewed | Back alignment and domain information |
|---|
| >COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PTZ00112 origin recognition complex 1 protein; Provisional | Back alignment and domain information |
|---|
| >KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] | Back alignment and domain information |
|---|
| >PRK06893 DNA replication initiation factor; Validated | Back alignment and domain information |
|---|
| >PF13173 AAA_14: AAA domain | Back alignment and domain information |
|---|
| >COG4886 Leucine-rich repeat (LRR) protein [Function unknown] | Back alignment and domain information |
|---|
| >PRK05564 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PRK14961 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PTZ00202 tuzin; Provisional | Back alignment and domain information |
|---|
| >PRK14949 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda | Back alignment and domain information |
|---|
| >KOG2028 consensus ATPase related to the helicase subunit of the Holliday junction resolvase [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PRK12323 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK12402 replication factor C small subunit 2; Reviewed | Back alignment and domain information |
|---|
| >PRK07003 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >cd01128 rho_factor Transcription termination factor rho is a bacterial ATP-dependent RNA/DNA helicase | Back alignment and domain information |
|---|
| >COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR02903 spore_lon_C ATP-dependent protease, Lon family | Back alignment and domain information |
|---|
| >PRK06645 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK09376 rho transcription termination factor Rho; Provisional | Back alignment and domain information |
|---|
| >PRK14960 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >COG4886 Leucine-rich repeat (LRR) protein [Function unknown] | Back alignment and domain information |
|---|
| >PRK14957 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK14963 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B | Back alignment and domain information |
|---|
| >PLN03025 replication factor C subunit; Provisional | Back alignment and domain information |
|---|
| >PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair | Back alignment and domain information |
|---|
| >PRK14956 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >COG3899 Predicted ATPase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK04195 replication factor C large subunit; Provisional | Back alignment and domain information |
|---|
| >PRK14962 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold | Back alignment and domain information |
|---|
| >PRK15386 type III secretion protein GogB; Provisional | Back alignment and domain information |
|---|
| >PRK00440 rfc replication factor C small subunit; Reviewed | Back alignment and domain information |
|---|
| >PRK15386 type III secretion protein GogB; Provisional | Back alignment and domain information |
|---|
| >PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A | Back alignment and domain information |
|---|
| >PRK14951 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PLN03150 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK05896 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PLN03150 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed | Back alignment and domain information |
|---|
| >PRK08727 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK07994 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >TIGR00678 holB DNA polymerase III, delta' subunit | Back alignment and domain information |
|---|
| >PRK07940 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A | Back alignment and domain information |
|---|
| >PRK14964 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK08691 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK09112 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PRK14958 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR02397 dnaX_nterm DNA polymerase III, subunit gamma and tau | Back alignment and domain information |
|---|
| >PRK07471 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PRK14969 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK14955 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >TIGR00767 rho transcription termination factor Rho | Back alignment and domain information |
|---|
| >PRK08084 DNA replication initiation factor; Provisional | Back alignment and domain information |
|---|
| >COG3903 Predicted ATPase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK09087 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] | Back alignment and domain information |
|---|
| >PF13191 AAA_16: AAA ATPase domain; PDB: 2V1U_A | Back alignment and domain information |
|---|
| >PRK07764 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK14954 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >TIGR01242 26Sp45 26S proteasome subunit P45 family | Back alignment and domain information |
|---|
| >PRK14970 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK14971 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK14959 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK09111 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B | Back alignment and domain information |
|---|
| >KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK07133 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PF14516 AAA_35: AAA-like domain | Back alignment and domain information |
|---|
| >PRK14952 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK08451 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >KOG2227 consensus Pre-initiation complex, subunit CDC6, AAA+ superfamily ATPase [Replication, recombination and repair; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] | Back alignment and domain information |
|---|
| >PRK14950 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PF05621 TniB: Bacterial TniB protein; InterPro: IPR008868 This family consists of several bacterial TniB NTP-binding proteins | Back alignment and domain information |
|---|
| >KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK14953 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK11331 5-methylcytosine-specific restriction enzyme subunit McrB; Provisional | Back alignment and domain information |
|---|
| >PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication | Back alignment and domain information |
|---|
| >PRK06305 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK14087 dnaA chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >PRK03992 proteasome-activating nucleotidase; Provisional | Back alignment and domain information |
|---|
| >KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] | Back alignment and domain information |
|---|
| >PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B | Back alignment and domain information |
|---|
| >PRK05642 DNA replication initiation factor; Validated | Back alignment and domain information |
|---|
| >KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0989 consensus Replication factor C, subunit RFC4 [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PHA02544 44 clamp loader, small subunit; Provisional | Back alignment and domain information |
|---|
| >KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >TIGR02881 spore_V_K stage V sporulation protein K | Back alignment and domain information |
|---|
| >COG2255 RuvB Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK14948 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK06647 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK08903 DnaA regulatory inactivator Hda; Validated | Back alignment and domain information |
|---|
| >CHL00181 cbbX CbbX; Provisional | Back alignment and domain information |
|---|
| >COG1373 Predicted ATPase (AAA+ superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR03689 pup_AAA proteasome ATPase | Back alignment and domain information |
|---|
| >TIGR00362 DnaA chromosomal replication initiator protein DnaA | Back alignment and domain information |
|---|
| >TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA | Back alignment and domain information |
|---|
| >KOG2982 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PRK14965 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK07399 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX | Back alignment and domain information |
|---|
| >TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family | Back alignment and domain information |
|---|
| >CHL00095 clpC Clp protease ATP binding subunit | Back alignment and domain information |
|---|
| >KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK05563 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK00149 dnaA chromosomal replication initiation protein; Reviewed | Back alignment and domain information |
|---|
| >PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] | Back alignment and domain information |
|---|
| >PRK14086 dnaA chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >PRK05707 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >KOG2543 consensus Origin recognition complex, subunit 5 [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PRK06620 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK14088 dnaA chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >PTZ00361 26 proteosome regulatory subunit 4-like protein; Provisional | Back alignment and domain information |
|---|
| >PRK10536 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF05673 DUF815: Protein of unknown function (DUF815); InterPro: IPR008533 This domain consists of several bacterial proteins of unknown function | Back alignment and domain information |
|---|
| >CHL00176 ftsH cell division protein; Validated | Back alignment and domain information |
|---|
| >smart00382 AAA ATPases associated with a variety of cellular activities | Back alignment and domain information |
|---|
| >TIGR00602 rad24 checkpoint protein rad24 | Back alignment and domain information |
|---|
| >PRK08118 topology modulation protein; Reviewed | Back alignment and domain information |
|---|
| >TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB | Back alignment and domain information |
|---|
| >PRK10865 protein disaggregation chaperone; Provisional | Back alignment and domain information |
|---|
| >PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport | Back alignment and domain information |
|---|
| >KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK08058 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >TIGR01241 FtsH_fam ATP-dependent metalloprotease FtsH | Back alignment and domain information |
|---|
| >PRK12422 chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >KOG0991 consensus Replication factor C, subunit RFC2 [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PF13177 DNA_pol3_delta2: DNA polymerase III, delta subunit; PDB: 1NJF_B 3GLG_G 1XXH_I 1NJG_A 3GLF_B 3GLI_G 1IQP_E 2GNO_A 1SXJ_E 1A5T_A | Back alignment and domain information |
|---|
| >PRK12608 transcription termination factor Rho; Provisional | Back alignment and domain information |
|---|
| >PRK08769 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >KOG0741 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG1222 RPT1 ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK06090 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >COG0466 Lon ATP-dependent Lon protease, bacterial type [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG0593 DnaA ATPase involved in DNA replication initiation [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK08116 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >KOG2982 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0731 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK06871 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] | Back alignment and domain information |
|---|
| >PF04665 Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 This entry contains uncharacterised proteins belonging to the B354L family which include the pox virus A32 protein | Back alignment and domain information |
|---|
| >COG1223 Predicted ATPase (AAA+ superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] | Back alignment and domain information |
|---|
| >PRK07261 topology modulation protein; Provisional | Back alignment and domain information |
|---|
| >KOG2004 consensus Mitochondrial ATP-dependent protease PIM1/LON [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0733 consensus Nuclear AAA ATPase (VCP subfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PHA00729 NTP-binding motif containing protein | Back alignment and domain information |
|---|
| >COG3267 ExeA Type II secretory pathway, component ExeA (predicted ATPase) [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >TIGR00763 lon ATP-dependent protease La | Back alignment and domain information |
|---|
| >KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] | Back alignment and domain information |
|---|
| >PRK10865 protein disaggregation chaperone; Provisional | Back alignment and domain information |
|---|
| >PRK06964 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >CHL00195 ycf46 Ycf46; Provisional | Back alignment and domain information |
|---|
| >PF02562 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH is a cytoplasmic protein and predicted ATPase that is induced by phosphate starvation and belongings to the phosphate regulon (pho) in Escherichia coli [] | Back alignment and domain information |
|---|
| >PRK07993 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2035 consensus Replication factor C, subunit RFC3 [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] | Back alignment and domain information |
|---|
| >TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN | Back alignment and domain information |
|---|
| >COG0542 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR02237 recomb_radB DNA repair and recombination protein RadB | Back alignment and domain information |
|---|
| >PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] | Back alignment and domain information |
|---|
| >TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily | Back alignment and domain information |
|---|
| >KOG0743 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK08181 transposase; Validated | Back alignment and domain information |
|---|
| >PRK12377 putative replication protein; Provisional | Back alignment and domain information |
|---|
| >PRK08939 primosomal protein DnaI; Reviewed | Back alignment and domain information |
|---|
| >PF10443 RNA12: RNA12 protein; InterPro: IPR018850 Mitochondrial escape protein 2 (also known as RNA12) plays a role in maintaining the mitochondrial genome and in controlling mtDNA escape [, ] | Back alignment and domain information |
|---|
| >KOG0730 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG1875 NYN ribonuclease and ATPase of PhoH family domains [General function prediction only] | Back alignment and domain information |
|---|
| >PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A | Back alignment and domain information |
|---|
| >TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family | Back alignment and domain information |
|---|
| >smart00763 AAA_PrkA PrkA AAA domain | Back alignment and domain information |
|---|
| >PRK06921 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG0739 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK10787 DNA-binding ATP-dependent protease La; Provisional | Back alignment and domain information |
|---|
| >TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily | Back alignment and domain information |
|---|
| >TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA | Back alignment and domain information |
|---|
| >TIGR03499 FlhF flagellar biosynthetic protein FlhF | Back alignment and domain information |
|---|
| >KOG2123 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] | Back alignment and domain information |
|---|
| >cd01123 Rad51_DMC1_radA Rad51_DMC1_radA,B | Back alignment and domain information |
|---|
| >TIGR01425 SRP54_euk signal recognition particle protein SRP54 | Back alignment and domain information |
|---|
| >PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >cd01133 F1-ATPase_beta F1 ATP synthase beta subunit, nucleotide-binding domain | Back alignment and domain information |
|---|
| >TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB | Back alignment and domain information |
|---|
| >COG2884 FtsE Predicted ATPase involved in cell division [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PRK04132 replication factor C small subunit; Provisional | Back alignment and domain information |
|---|
| >PRK06526 transposase; Provisional | Back alignment and domain information |
|---|
| >COG2812 DnaX DNA polymerase III, gamma/tau subunits [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK00771 signal recognition particle protein Srp54; Provisional | Back alignment and domain information |
|---|
| >PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >PRK09183 transposase/IS protein; Provisional | Back alignment and domain information |
|---|
| >PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif | Back alignment and domain information |
|---|
| >PRK09270 nucleoside triphosphate hydrolase domain-containing protein; Reviewed | Back alignment and domain information |
|---|
| >COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] | Back alignment and domain information |
|---|
| >TIGR02902 spore_lonB ATP-dependent protease LonB | Back alignment and domain information |
|---|
| >PRK06696 uridine kinase; Validated | Back alignment and domain information |
|---|
| >KOG0727 consensus 26S proteasome regulatory complex, ATPase RPT3 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0734 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0735 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK08699 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PRK07952 DNA replication protein DnaC; Validated | Back alignment and domain information |
|---|
| >CHL00095 clpC Clp protease ATP binding subunit | Back alignment and domain information |
|---|
| >TIGR02012 tigrfam_recA protein RecA | Back alignment and domain information |
|---|
| >COG0470 HolB ATPase involved in DNA replication [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK12727 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >KOG0736 consensus Peroxisome assembly factor 2 containing the AAA+-type ATPase domain [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK10867 signal recognition particle protein; Provisional | Back alignment and domain information |
|---|
| >KOG0733 consensus Nuclear AAA ATPase (VCP subfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd01393 recA_like RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response | Back alignment and domain information |
|---|
| >COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PF07693 KAP_NTPase: KAP family P-loop domain; InterPro: IPR011646 The KAP (after Kidins220/ARMS and PifA) family of predicted NTPases are sporadically distributed across a wide phylogenetic range in bacteria and in animals | Back alignment and domain information |
|---|
| >TIGR02238 recomb_DMC1 meiotic recombinase Dmc1 | Back alignment and domain information |
|---|
| >cd01120 RecA-like_NTPases RecA-like NTPases | Back alignment and domain information |
|---|
| >cd00983 recA RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response | Back alignment and domain information |
|---|
| >PRK09361 radB DNA repair and recombination protein RadB; Provisional | Back alignment and domain information |
|---|
| >COG1618 Predicted nucleotide kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PF08423 Rad51: Rad51; InterPro: IPR013632 This domain is found at the C terminus of the DNA repair and recombination protein Rad51 | Back alignment and domain information |
|---|
| >PRK05541 adenylylsulfate kinase; Provisional | Back alignment and domain information |
|---|
| >COG0542 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd02025 PanK Pantothenate kinase (PanK) catalyzes the phosphorylation of pantothenic acid to form 4'-phosphopantothenic, which is the first of five steps in coenzyme A (CoA) biosynthetic pathway | Back alignment and domain information |
|---|
| >PRK09354 recA recombinase A; Provisional | Back alignment and domain information |
|---|
| >PRK12724 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >TIGR00554 panK_bact pantothenate kinase, bacterial type | Back alignment and domain information |
|---|
| >KOG2123 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF03215 Rad17: Rad17 cell cycle checkpoint protein | Back alignment and domain information |
|---|
| >KOG1532 consensus GTPase XAB1, interacts with DNA repair protein XPA [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PRK06835 DNA replication protein DnaC; Validated | Back alignment and domain information |
|---|
| >TIGR02858 spore_III_AA stage III sporulation protein AA | Back alignment and domain information |
|---|
| >PLN03187 meiotic recombination protein DMC1 homolog; Provisional | Back alignment and domain information |
|---|
| >PRK08533 flagellar accessory protein FlaH; Reviewed | Back alignment and domain information |
|---|
| >KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] | Back alignment and domain information |
|---|
| >KOG1969 consensus DNA replication checkpoint protein CHL12/CTF18 [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PRK04296 thymidine kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR01359 UMP_CMP_kin_fam UMP-CMP kinase family | Back alignment and domain information |
|---|
| >PRK06547 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF00485 PRK: Phosphoribulokinase / Uridine kinase family; InterPro: IPR006083 Phosphoribulokinase (PRK) 2 | Back alignment and domain information |
|---|
| >cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes | Back alignment and domain information |
|---|
| >PRK12723 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >COG0194 Gmk Guanylate kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PRK15455 PrkA family serine protein kinase; Provisional | Back alignment and domain information |
|---|
| >KOG0728 consensus 26S proteasome regulatory complex, ATPase RPT6 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK10733 hflB ATP-dependent metalloprotease; Reviewed | Back alignment and domain information |
|---|
| >PRK12726 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >PF00006 ATP-synt_ab: ATP synthase alpha/beta family, nucleotide-binding domain This Pfam entry corresponds to chains a,b,c,d,e and f; InterPro: IPR000194 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane | Back alignment and domain information |
|---|
| >PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] | Back alignment and domain information |
|---|
| >PRK07667 uridine kinase; Provisional | Back alignment and domain information |
|---|
| >PLN00020 ribulose bisphosphate carboxylase/oxygenase activase -RuBisCO activase (RCA); Provisional | Back alignment and domain information |
|---|
| >TIGR00959 ffh signal recognition particle protein | Back alignment and domain information |
|---|
| >TIGR02239 recomb_RAD51 DNA repair protein RAD51 | Back alignment and domain information |
|---|
| >TIGR03877 thermo_KaiC_1 KaiC domain protein, Ph0284 family | Back alignment and domain information |
|---|
| >PRK07132 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >COG0464 SpoVK ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated | Back alignment and domain information |
|---|
| >PRK14974 cell division protein FtsY; Provisional | Back alignment and domain information |
|---|
| >KOG3864 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >COG0541 Ffh Signal recognition particle GTPase [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >KOG2228 consensus Origin recognition complex, subunit 4 [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG0738 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd03247 ABCC_cytochrome_bd The CYD subfamily implicated in cytochrome bd biogenesis | Back alignment and domain information |
|---|
| >TIGR02236 recomb_radA DNA repair and recombination protein RadA | Back alignment and domain information |
|---|
| >cd01121 Sms Sms (bacterial radA) DNA repair protein | Back alignment and domain information |
|---|
| >COG3640 CooC CO dehydrogenase maturation factor [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PLN03186 DNA repair protein RAD51 homolog; Provisional | Back alignment and domain information |
|---|
| >PRK05439 pantothenate kinase; Provisional | Back alignment and domain information |
|---|
| >cd01394 radB RadB | Back alignment and domain information |
|---|
| >PTZ00035 Rad51 protein; Provisional | Back alignment and domain information |
|---|
| >COG1102 Cmk Cytidylate kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >COG1419 FlhF Flagellar GTP-binding protein [Cell motility and secretion] | Back alignment and domain information |
|---|
| >KOG0729 consensus 26S proteasome regulatory complex, ATPase RPT1 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd02019 NK Nucleoside/nucleotide kinase (NK) is a protein superfamily consisting of multiple families of enzymes that share structural similarity and are functionally related to the catalysis of the reversible phosphate group transfer from nucleoside triphosphates to nucleosides/nucleotides, nucleoside monophosphates, or sugars | Back alignment and domain information |
|---|
| >PRK04301 radA DNA repair and recombination protein RadA; Validated | Back alignment and domain information |
|---|
| >KOG0744 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG2607 Predicted ATPase (AAA+ superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >cd01135 V_A-ATPase_B V/A-type ATP synthase (non-catalytic) subunit B | Back alignment and domain information |
|---|
| >cd01131 PilT Pilus retraction ATPase PilT | Back alignment and domain information |
|---|
| >PF13238 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB_A 3IIM_A 2AXP_A 3KB2_A 1KHT_A 1NKS_A 3H86_C | Back alignment and domain information |
|---|
| >PRK06995 flhF flagellar biosynthesis regulator FlhF; Validated | Back alignment and domain information |
|---|
| >PRK14721 flhF flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >cd03281 ABC_MSH5_euk MutS5 homolog in eukaryotes | Back alignment and domain information |
|---|
| >COG0468 RecA RecA/RadA recombinase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >TIGR00064 ftsY signal recognition particle-docking protein FtsY | Back alignment and domain information |
|---|
| >PF13481 AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C | Back alignment and domain information |
|---|
| >COG1428 Deoxynucleoside kinases [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] | Back alignment and domain information |
|---|
| >PRK14723 flhF flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >PRK05480 uridine/cytidine kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR00235 udk uridine kinase | Back alignment and domain information |
|---|
| >COG0572 Udk Uridine kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >COG4088 Predicted nucleotide kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PRK04328 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF01583 APS_kinase: Adenylylsulphate kinase; InterPro: IPR002891 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases | Back alignment and domain information |
|---|
| >PRK08233 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PTZ00301 uridine kinase; Provisional | Back alignment and domain information |
|---|
| >cd03221 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth | Back alignment and domain information |
|---|
| >PF07728 AAA_5: AAA domain (dynein-related subfamily); InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] | Back alignment and domain information |
|---|
| >PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A | Back alignment and domain information |
|---|
| >PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A | Back alignment and domain information |
|---|
| >PF03205 MobB: Molybdopterin guanine dinucleotide synthesis protein B; PDB: 2F1R_B 1P9N_A 1NP6_B 2NPI_A 1XJC_A | Back alignment and domain information |
|---|
| >cd03238 ABC_UvrA The excision repair protein UvrA; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion | Back alignment and domain information |
|---|
| >TIGR03305 alt_F1F0_F1_bet alternate F1F0 ATPase, F1 subunit beta | Back alignment and domain information |
|---|
| >PRK12597 F0F1 ATP synthase subunit beta; Provisional | Back alignment and domain information |
|---|
| >COG0563 Adk Adenylate kinase and related kinases [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PF13671 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B | Back alignment and domain information |
|---|
| >PRK06762 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK13948 shikimate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK08972 fliI flagellum-specific ATP synthase; Validated | Back alignment and domain information |
|---|
| >cd03216 ABC_Carb_Monos_I This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos) | Back alignment and domain information |
|---|
| >cd03222 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor (RLI) is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids | Back alignment and domain information |
|---|
| >cd03223 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette transporter (Pat) is involved in the import of very long-chain fatty acids (VLCFA) into the peroxisome | Back alignment and domain information |
|---|
| >PRK05917 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >TIGR01360 aden_kin_iso1 adenylate kinase, isozyme 1 subfamily | Back alignment and domain information |
|---|
| >PF08433 KTI12: Chromatin associated protein KTI12 ; InterPro: IPR013641 This is a family of chromatin associated proteins which interact with the Elongator complex, a component of the elongating form of RNA polymerase II [] | Back alignment and domain information |
|---|
| >COG1066 Sms Predicted ATP-dependent serine protease [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK03839 putative kinase; Provisional | Back alignment and domain information |
|---|
| >KOG1514 consensus Origin recognition complex, subunit 1, and related proteins [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PRK13230 nitrogenase reductase-like protein; Reviewed | Back alignment and domain information |
|---|
| >cd03214 ABC_Iron-Siderophores_B12_Hemin ABC transporters, involved in the uptake of siderophores, heme, and vitamin B12, are widely conserved in bacteria and archaea | Back alignment and domain information |
|---|
| >TIGR01069 mutS2 MutS2 family protein | Back alignment and domain information |
|---|
| >KOG0737 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK13236 nitrogenase reductase; Reviewed | Back alignment and domain information |
|---|
| >PRK08927 fliI flagellum-specific ATP synthase; Validated | Back alignment and domain information |
|---|
| >PRK06067 flagellar accessory protein FlaH; Validated | Back alignment and domain information |
|---|
| >PF00154 RecA: recA bacterial DNA recombination protein; InterPro: IPR013765 The recA gene product is a multifunctional enzyme that plays a role in homologous recombination, DNA repair and induction of the SOS response [] | Back alignment and domain information |
|---|
| >PRK09280 F0F1 ATP synthase subunit beta; Validated | Back alignment and domain information |
|---|
| >PF00910 RNA_helicase: RNA helicase; InterPro: IPR000605 Helicases have been classified in 5 superfamilies (SF1-SF5) | Back alignment and domain information |
|---|
| >cd02027 APSK Adenosine 5'-phosphosulfate kinase (APSK) catalyzes the phosphorylation of adenosine 5'-phosphosulfate to form 3'-phosphoadenosine 5'-phosphosulfate (PAPS) | Back alignment and domain information |
|---|
| >PRK13949 shikimate kinase; Provisional | Back alignment and domain information |
|---|
| >cd03228 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-like transporters are involved in drug, peptide, and lipid export | Back alignment and domain information |
|---|
| >TIGR03575 selen_PSTK_euk L-seryl-tRNA(Sec) kinase, eukaryotic | Back alignment and domain information |
|---|
| >COG0465 HflB ATP-dependent Zn proteases [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK00625 shikimate kinase; Provisional | Back alignment and domain information |
|---|
| >CHL00206 ycf2 Ycf2; Provisional | Back alignment and domain information |
|---|
| >PRK04040 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK13531 regulatory ATPase RavA; Provisional | Back alignment and domain information |
|---|
| >cd03283 ABC_MutS-like MutS-like homolog in eukaryotes | Back alignment and domain information |
|---|
| >KOG3347 consensus Predicted nucleotide kinase/nuclear protein involved oxidative stress response [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >COG4608 AppF ABC-type oligopeptide transport system, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >COG0467 RAD55 RecA-superfamily ATPases implicated in signal transduction [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs | Back alignment and domain information |
|---|
| >cd03246 ABCC_Protease_Secretion This family represents the ABC component of the protease secretion system PrtD, a 60-kDa integral membrane protein sharing 37% identity with HlyB, the ABC component of the alpha-hemolysin secretion pathway, in the C-terminal domain | Back alignment and domain information |
|---|
| >PRK06851 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PTZ00088 adenylate kinase 1; Provisional | Back alignment and domain information |
|---|
| >PRK13232 nifH nitrogenase reductase; Reviewed | Back alignment and domain information |
|---|
| >PRK10751 molybdopterin-guanine dinucleotide biosynthesis protein B; Provisional | Back alignment and domain information |
|---|
| >PRK13235 nifH nitrogenase reductase; Reviewed | Back alignment and domain information |
|---|
| >PF12775 AAA_7: P-loop containing dynein motor region D3; PDB: 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A 3VKH_A 3VKG_A | Back alignment and domain information |
|---|
| >PF03308 ArgK: ArgK protein; InterPro: IPR005129 Bacterial periplasmic transport systems require the function of a specific substrate-binding protein, located in the periplasm, and several cytoplasmic membrane transport components | Back alignment and domain information |
|---|
| >TIGR02655 circ_KaiC circadian clock protein KaiC | Back alignment and domain information |
|---|
| >PF14532 Sigma54_activ_2: Sigma-54 interaction domain; PDB: 3CO5_B 3N70_H | Back alignment and domain information |
|---|
| >TIGR00390 hslU ATP-dependent protease HslVU, ATPase subunit | Back alignment and domain information |
|---|
| >PF06309 Torsin: Torsin; InterPro: IPR010448 This family consists of several eukaryotic torsin proteins | Back alignment and domain information |
|---|
| >cd02024 NRK1 Nicotinamide riboside kinase (NRK) is an enzyme involved in the metabolism of nicotinamide adenine dinucleotide (NAD+) | Back alignment and domain information |
|---|
| >TIGR01040 V-ATPase_V1_B V-type (H+)-ATPase V1, B subunit | Back alignment and domain information |
|---|
| >PRK12678 transcription termination factor Rho; Provisional | Back alignment and domain information |
|---|
| >TIGR03878 thermo_KaiC_2 KaiC domain protein, AF_0795 family | Back alignment and domain information |
|---|
| >PRK13768 GTPase; Provisional | Back alignment and domain information |
|---|
| >PRK10463 hydrogenase nickel incorporation protein HypB; Provisional | Back alignment and domain information |
|---|
| >PRK13765 ATP-dependent protease Lon; Provisional | Back alignment and domain information |
|---|
| >KOG3864 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PRK11823 DNA repair protein RadA; Provisional | Back alignment and domain information |
|---|
| >TIGR01041 ATP_syn_B_arch ATP synthase archaeal, B subunit | Back alignment and domain information |
|---|
| >cd00544 CobU Adenosylcobinamide kinase / adenosylcobinamide phosphate guanyltransferase (CobU) | Back alignment and domain information |
|---|
| >TIGR01039 atpD ATP synthase, F1 beta subunit | Back alignment and domain information |
|---|
| >PRK00279 adk adenylate kinase; Reviewed | Back alignment and domain information |
|---|
| >cd02023 UMPK Uridine monophosphate kinase (UMPK, EC 2 | Back alignment and domain information |
|---|
| >PRK08149 ATP synthase SpaL; Validated | Back alignment and domain information |
|---|
| >PRK00131 aroK shikimate kinase; Reviewed | Back alignment and domain information |
|---|
| >PRK00889 adenylylsulfate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK00409 recombination and DNA strand exchange inhibitor protein; Reviewed | Back alignment and domain information |
|---|
| >PRK10416 signal recognition particle-docking protein FtsY; Provisional | Back alignment and domain information |
|---|
| >cd02020 CMPK Cytidine monophosphate kinase (CMPK) catalyzes the reversible phosphorylation of cytidine monophosphate (CMP) to produce cytidine diphosphate (CDP), using ATP as the preferred phosphoryl donor | Back alignment and domain information |
|---|
| >TIGR02030 BchI-ChlI magnesium chelatase ATPase subunit I | Back alignment and domain information |
|---|
| >TIGR02322 phosphon_PhnN phosphonate metabolism protein/1,5-bisphosphokinase (PRPP-forming) PhnN | Back alignment and domain information |
|---|
| >PF07726 AAA_3: ATPase family associated with various cellular activities (AAA); InterPro: IPR011703 This entry includes some of the AAA proteins not detected by the IPR003959 from INTERPRO model | Back alignment and domain information |
|---|
| >PRK06217 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PHA02774 E1; Provisional | Back alignment and domain information |
|---|
| >cd01134 V_A-ATPase_A V/A-type ATP synthase catalytic subunit A | Back alignment and domain information |
|---|
| >cd02028 UMPK_like Uridine monophosphate kinase_like (UMPK_like) is a family of proteins highly similar to the uridine monophosphate kinase (UMPK, EC 2 | Back alignment and domain information |
|---|
| >TIGR00176 mobB molybdopterin-guanine dinucleotide biosynthesis protein MobB | Back alignment and domain information |
|---|
| >TIGR00416 sms DNA repair protein RadA | Back alignment and domain information |
|---|
| >TIGR00150 HI0065_YjeE ATPase, YjeE family | Back alignment and domain information |
|---|
| >PRK09519 recA DNA recombination protein RecA; Reviewed | Back alignment and domain information |
|---|
| >PRK05342 clpX ATP-dependent protease ATP-binding subunit ClpX; Provisional | Back alignment and domain information |
|---|
| >PF06745 KaiC: KaiC; InterPro: IPR014774 This entry represents a domain within bacterial and archaeal proteins, most of which are hypothetical | Back alignment and domain information |
|---|
| >COG0003 ArsA Predicted ATPase involved in chromosome partitioning [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PLN02200 adenylate kinase family protein | Back alignment and domain information |
|---|
| >cd00267 ABC_ATPase ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules | Back alignment and domain information |
|---|
| >PRK13234 nifH nitrogenase reductase; Reviewed | Back alignment and domain information |
|---|
| >CHL00081 chlI Mg-protoporyphyrin IX chelatase | Back alignment and domain information |
|---|
| >cd01132 F1_ATPase_alpha F1 ATP synthase alpha, central domain | Back alignment and domain information |
|---|
| >PRK14532 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK06936 type III secretion system ATPase; Provisional | Back alignment and domain information |
|---|
| >TIGR01817 nifA Nif-specific regulatory protein | Back alignment and domain information |
|---|
| >KOG1051 consensus Chaperone HSP104 and related ATP-dependent Clp proteases [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd02029 PRK_like Phosphoribulokinase-like (PRK-like) is a family of proteins similar to phosphoribulokinase (PRK), the enzyme involved in the Benson-Calvin cycle in chloroplasts or photosynthetic prokaryotes | Back alignment and domain information |
|---|
| >cd01125 repA Hexameric Replicative Helicase RepA | Back alignment and domain information |
|---|
| >PF00625 Guanylate_kin: Guanylate kinase; InterPro: IPR008144 Guanylate kinase (2 | Back alignment and domain information |
|---|
| >KOG0735 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK06002 fliI flagellum-specific ATP synthase; Validated | Back alignment and domain information |
|---|
| >PRK13695 putative NTPase; Provisional | Back alignment and domain information |
|---|
| >CHL00060 atpB ATP synthase CF1 beta subunit | Back alignment and domain information |
|---|
| >PRK13947 shikimate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK11608 pspF phage shock protein operon transcriptional activator; Provisional | Back alignment and domain information |
|---|
| >COG1936 Predicted nucleotide kinase (related to CMP and AMP kinases) [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >COG3854 SpoIIIAA ncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >cd02021 GntK Gluconate kinase (GntK) catalyzes the phosphoryl transfer from ATP to gluconate | Back alignment and domain information |
|---|
| >KOG0927 consensus Predicted transporter (ABC superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >cd00227 CPT Chloramphenicol (Cm) phosphotransferase (CPT) | Back alignment and domain information |
|---|
| >PRK04196 V-type ATP synthase subunit B; Provisional | Back alignment and domain information |
|---|
| >cd00561 CobA_CobO_BtuR ATP:corrinoid adenosyltransferase BtuR/CobO/CobP | Back alignment and domain information |
|---|
| >TIGR00073 hypB hydrogenase accessory protein HypB | Back alignment and domain information |
|---|
| >COG0488 Uup ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] | Back alignment and domain information |
|---|
| >COG0529 CysC Adenylylsulfate kinase and related kinases [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PTZ00185 ATPase alpha subunit; Provisional | Back alignment and domain information |
|---|
| >PF13245 AAA_19: Part of AAA domain | Back alignment and domain information |
|---|
| >PRK13975 thymidylate kinase; Provisional | Back alignment and domain information |
|---|
| >COG1703 ArgK Putative periplasmic protein kinase ArgK and related GTPases of G3E family [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >cd00464 SK Shikimate kinase (SK) is the fifth enzyme in the shikimate pathway, a seven-step biosynthetic pathway which converts erythrose-4-phosphate to chorismic acid, found in bacteria, fungi and plants | Back alignment and domain information |
|---|
| >PRK15453 phosphoribulokinase; Provisional | Back alignment and domain information |
|---|
| >COG0237 CoaE Dephospho-CoA kinase [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PRK14530 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK15429 formate hydrogenlyase transcriptional activator FhlA; Provisional | Back alignment and domain information |
|---|
| >TIGR03263 guanyl_kin guanylate kinase | Back alignment and domain information |
|---|
| >PRK03846 adenylylsulfate kinase; Provisional | Back alignment and domain information |
|---|
| >KOG0652 consensus 26S proteasome regulatory complex, ATPase RPT5 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd01136 ATPase_flagellum-secretory_path_III Flagellum-specific ATPase/type III secretory pathway virulence-related protein | Back alignment and domain information |
|---|
| >TIGR03881 KaiC_arch_4 KaiC domain protein, PAE1156 family | Back alignment and domain information |
|---|
| >COG1124 DppF ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PF03266 NTPase_1: NTPase; InterPro: IPR004948 This entry represents a family of nucleoside-triphosphatases which have activity towards ATP, GTP, CTP, TTP and UTP and may hydrolyse nucleoside diphosphates with lower efficiency [] | Back alignment and domain information |
|---|
| >PRK05057 aroK shikimate kinase I; Reviewed | Back alignment and domain information |
|---|
| >TIGR00764 lon_rel lon-related putative ATP-dependent protease | Back alignment and domain information |
|---|
| >TIGR00750 lao LAO/AO transport system ATPase | Back alignment and domain information |
|---|
| >PF03029 ATP_bind_1: Conserved hypothetical ATP binding protein; InterPro: IPR004130 Members of this family are found in a range of archaea and eukaryotes and have hypothesised ATP binding activity | Back alignment and domain information |
|---|
| >PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D | Back alignment and domain information |
|---|
| >cd00820 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPCK), a critical gluconeogenic enzyme, catalyzes the first committed step in the diversion of tricarboxylic acid cycle intermediates toward gluconeogenesis | Back alignment and domain information |
|---|
| >cd00071 GMPK Guanosine monophosphate kinase (GMPK, EC 2 | Back alignment and domain information |
|---|
| >KOG0473 consensus Leucine-rich repeat protein [Function unknown] | Back alignment and domain information |
|---|
| >COG2019 AdkA Archaeal adenylate kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >COG1763 MobB Molybdopterin-guanine dinucleotide biosynthesis protein [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PRK00300 gmk guanylate kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR00382 clpX endopeptidase Clp ATP-binding regulatory subunit (clpX) | Back alignment and domain information |
|---|
| >PF00406 ADK: Adenylate kinase; InterPro: IPR000850 Adenylate kinases (ADK) are phosphotransferases that catalyse the reversible reaction |
Back alignment and domain information |
|---|
| >cd01122 GP4d_helicase GP4d_helicase is a homohexameric 5'-3' helicases | Back alignment and domain information |
|---|
| >PRK12339 2-phosphoglycerate kinase; Provisional | Back alignment and domain information |
|---|
| >COG4240 Predicted kinase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK13407 bchI magnesium chelatase subunit I; Provisional | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST
Original result of BLAST against Protein Data Bank
| ID | Alignment Graph | Length |
Definition |
E-value | |
| Query | 1342 | ||||
| 1z6t_A | 591 | Structure Of The Apoptotic Protease-activating Fact | 1e-08 | ||
| 3iza_B | 1263 | Structure Of An Apoptosome-Procaspase-9 Card Comple | 2e-08 | ||
| 3sfz_A | 1249 | Crystal Structure Of Full-Length Murine Apaf-1 Leng | 1e-07 | ||
| 3shf_A | 1256 | Crystal Structure Of The R265s Mutant Of Full-Lengt | 7e-07 | ||
| 1p8v_A | 279 | Crystal Structure Of The Complex Of Platelet Recept | 1e-05 | ||
| 1gwb_B | 281 | Structure Of Glycoprotein 1b Length = 281 | 1e-05 | ||
| 1sq0_B | 288 | Crystal Structure Of The Complex Of The Wild-Type V | 2e-05 | ||
| 1m0z_A | 290 | Crystal Structure Of The Von Willebrand Factor Bind | 2e-05 | ||
| 1m10_B | 290 | Crystal Structure Of The Complex Of Glycoprotein Ib | 2e-05 | ||
| 3p72_A | 269 | Structure Of Platelet Glycoprotein 1b Alpha With A | 2e-05 | ||
| 1u0n_D | 265 | The Ternary Von Willebrand Factor A1-Glycoprotein I | 2e-05 | ||
| 1p9a_G | 290 | Crystal Structure Of N-terminal Domain Of Human Pla | 5e-05 | ||
| 1ook_G | 290 | Crystal Structure Of The Complex Of Platelet Recept | 6e-05 | ||
| 3pmh_G | 290 | Mechanism Of Sulfotyrosine-Mediated Glycoprotein Ib | 6e-05 | ||
| 2o6q_A | 270 | Structural Diversity Of The Hagfish Variable Lympho | 8e-05 | ||
| 3e6j_A | 229 | Crystal Structure Of Variable Lymphocyte Receptor ( | 1e-04 | ||
| 2omz_A | 466 | Crystal Structure Of Inla Y369a/hec1 Complex Length | 8e-04 | ||
| 2omy_A | 461 | Crystal Structure Of Inla S192n/hec1 Complex Length | 8e-04 | ||
| 2omv_A | 461 | Crystal Structure Of Inla S192n Y369s/hec1 Complex | 8e-04 | ||
| 2omx_A | 462 | Crystal Structure Of Inla S192n G194s+sHEC1 COMPLEX | 9e-04 |
| >pdb|1Z6T|A Chain A, Structure Of The Apoptotic Protease-activating Factor 1 Bound To Adp Length = 591 | Back alignment and structure |
|
| >pdb|3SFZ|A Chain A, Crystal Structure Of Full-Length Murine Apaf-1 Length = 1249 | Back alignment and structure |
| >pdb|3SHF|A Chain A, Crystal Structure Of The R265s Mutant Of Full-Length Murine Apaf-1 Length = 1256 | Back alignment and structure |
| >pdb|1P8V|A Chain A, Crystal Structure Of The Complex Of Platelet Receptor Gpib-alpha And Alpha-thrombin At 2.6a Length = 279 | Back alignment and structure |
| >pdb|1GWB|B Chain B, Structure Of Glycoprotein 1b Length = 281 | Back alignment and structure |
| >pdb|1SQ0|B Chain B, Crystal Structure Of The Complex Of The Wild-Type Von Willebrand Factor A1 Domain And Glycoprotein Ib Alpha At 2.6 Angstrom Resolution Length = 288 | Back alignment and structure |
| >pdb|1M0Z|A Chain A, Crystal Structure Of The Von Willebrand Factor Binding Domain Of Glycoprotein Ib Alpha Length = 290 | Back alignment and structure |
| >pdb|1M10|B Chain B, Crystal Structure Of The Complex Of Glycoprotein Ib Alpha And The Von Willebrand Factor A1 Domain Length = 290 | Back alignment and structure |
| >pdb|3P72|A Chain A, Structure Of Platelet Glycoprotein 1b Alpha With A Bound Peptide Inhibitor Length = 269 | Back alignment and structure |
| >pdb|1U0N|D Chain D, The Ternary Von Willebrand Factor A1-Glycoprotein Ibalpha- Botrocetin Complex Length = 265 | Back alignment and structure |
| >pdb|1P9A|G Chain G, Crystal Structure Of N-terminal Domain Of Human Platelet Receptor Glycoprotein Ib-alpha At 1.7 Angstrom Resolution Length = 290 | Back alignment and structure |
| >pdb|1OOK|G Chain G, Crystal Structure Of The Complex Of Platelet Receptor Gpib-alpha And Human Alpha-thrombin Length = 290 | Back alignment and structure |
| >pdb|3PMH|G Chain G, Mechanism Of Sulfotyrosine-Mediated Glycoprotein Ib Interaction With Two Distinct Alpha-Thrombin Sites Length = 290 | Back alignment and structure |
| >pdb|2O6Q|A Chain A, Structural Diversity Of The Hagfish Variable Lymphocyte Receptors A29 Length = 270 | Back alignment and structure |
| >pdb|3E6J|A Chain A, Crystal Structure Of Variable Lymphocyte Receptor (Vlr) Rbc36 In Complex With H-Trisaccharide Length = 229 | Back alignment and structure |
| >pdb|2OMZ|A Chain A, Crystal Structure Of Inla Y369a/hec1 Complex Length = 466 | Back alignment and structure |
| >pdb|2OMY|A Chain A, Crystal Structure Of Inla S192n/hec1 Complex Length = 461 | Back alignment and structure |
| >pdb|2OMV|A Chain A, Crystal Structure Of Inla S192n Y369s/hec1 Complex Length = 461 | Back alignment and structure |
| >pdb|2OMX|A Chain A, Crystal Structure Of Inla S192n G194s+sHEC1 COMPLEX Length = 462 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST
Original result of RPS-BLAST against PDB70 database
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
Score = 186 bits (472), Expect = 9e-48
Identities = 100/639 (15%), Positives = 207/639 (32%), Gaps = 136/639 (21%)
Query: 19 HLTKEVEKLRER-RESVQHRVD-FAKE-NGEEIEQSVENWLIS--VDKIVEEAGKFVEDD 73
H+ E + + + ++ + D F + ++++ ++ L +D I+ +D
Sbjct: 6 HMDFETGEHQYQYKDILSVFEDAFVDNFDCKDVQDMPKSILSKEEIDHIIMS-----KDA 60
Query: 74 EEANNPCFKVLCPNLKNRHHLSKKAAKEVKAIVELQDEGNFD------RVSVRGISRDRL 127
F L K + V+ VE N+ + R S
Sbjct: 61 VSGTLRLFWTLL----------SKQEEMVQKFVEEVLRINYKFLMSPIKTEQRQPSMMT- 109
Query: 128 VAYTES----YNEGHEFIE---SRESILNDILDALR----GPYVYMIGVYGMAGIGKTTL 176
Y E YN+ F + SR + AL V + G+ G GKT +
Sbjct: 110 RMYIEQRDRLYNDNQVFAKYNVSRLQPYLKLRQALLELRPAKNV---LIDGVLGSGKTWV 166
Query: 177 VKEVARLAKEGRIFDEVVF----AEVSQTPDLKRIRREIADQLGLNFCEESD-SERIMML 231
+V K D +F + + + +++ Q+ N+ SD S I +
Sbjct: 167 ALDVCLSYKVQCKMDFKIFWLNLKNCNSPETVLEMLQKLLYQIDPNWTSRSDHSSNIKLR 226
Query: 232 CNRLKREKKI----------LVILDDIWTSLDLERTGIPFGDVHRGCKILVTSRRRDVL- 280
+ ++ E + L++L ++ + F ++ CKIL+T+R + V
Sbjct: 227 IHSIQAELRRLLKSKPYENCLLVLLNVQNAKAWN----AF-NL--SCKILLTTRFKQVTD 279
Query: 281 ----VSEMHCQNNYCVSVLNKEEAWSLFSKVVGNCVEDPDLQTVAIQVANECGGLPIAIL 336
+ H ++ L +E SL K + DL P +
Sbjct: 280 FLSAATTTHISLDHHSMTLTPDEVKSLLLKYLD--CRPQDLPREV------LTTNPRRLS 331
Query: 337 TVARTLRNKPLFVWKKALQELRFSARNFTGLEALLGSTIELIYNYLEGEELKLTFLLCSL 396
+A ++R+ W + N L + IE N LE E + F S+
Sbjct: 332 IIAESIRDGLA-TWD------NWKHVNCDKLT----TIIESSLNVLEPAEYRKMFDRLSV 380
Query: 397 MKHPCDAPI-MDLLKYGTGLGLFEDIYTMQERRDRVYALVRGLKDTCLLHDDDTADWFSM 455
P A I LL + + V +V L L+ S+
Sbjct: 381 F--PPSAHIPTILLS----------LIWFDVIKSDVMVVVNKLHKYSLVEKQPKESTISI 428
Query: 456 LGFVRNVAISIASINLMVRNDALIE-------WPNKDMLKNCIA--IFLHDINTGELPEG 506
+ + + N + ++++ + + D++ + + H
Sbjct: 429 PSIYLELKVKLE--NEYALHRSIVDHYNIPKTFDSDDLIPPYLDQYFYSH---------- 476
Query: 507 LEYPHLTSLCMNPKD---PFLHIPDNFFAGMPKLRVLVLTRMKLLTLPSSFCHLPNLESL 563
+ + HL ++ + + + F K+R ++ ++ L +
Sbjct: 477 IGH-HLKNIEHPERMTLFRMVFLDFRFLEQ--KIRHDSTAWNASGSILNTLQQLKFYKPY 533
Query: 564 CLDQC-----ILGDIAIIGNLKNLEILSLCC--SDIEQL 595
D ++ I+ L +E +C +D+ ++
Sbjct: 534 ICDNDPKYERLVNA--ILDFLPKIEENLICSKYTDLLRI 570
|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Length = 549 | Back alignment and structure |
|---|
| >1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Length = 591 | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 | Back alignment and structure |
|---|
| >3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Length = 1249 | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 | Back alignment and structure |
|---|
| >2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 | Back alignment and structure |
|---|
| >2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 | Back alignment and structure |
|---|
| >1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 | Back alignment and structure |
|---|
| >1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 | Back alignment and structure |
|---|
| >3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 | Back alignment and structure |
|---|
| >3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 | Back alignment and structure |
|---|
| >3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 | Back alignment and structure |
|---|
| >3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 | Back alignment and structure |
|---|
| >2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 | Back alignment and structure |
|---|
| >2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 | Back alignment and structure |
|---|
| >1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 | Back alignment and structure |
|---|
| >1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 | Back alignment and structure |
|---|
| >4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 | Back alignment and structure |
|---|
| >4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 | Back alignment and structure |
|---|
| >2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 | Back alignment and structure |
|---|
| >2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 | Back alignment and structure |
|---|
| >2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 | Back alignment and structure |
|---|
| >1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 | Back alignment and structure |
|---|
| >1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 | Back alignment and structure |
|---|
| >1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 | Back alignment and structure |
|---|
| >1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 | Back alignment and structure |
|---|
| >1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 | Back alignment and structure |
|---|
| >1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 | Back alignment and structure |
|---|
| >1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 | Back alignment and structure |
|---|
| >3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 | Back alignment and structure |
|---|
| >3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 | Back alignment and structure |
|---|
| >3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 | Back alignment and structure |
|---|
| >3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 | Back alignment and structure |
|---|
| >2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 | Back alignment and structure |
|---|
| >2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 | Back alignment and structure |
|---|
| >2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 | Back alignment and structure |
|---|
| >2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 | Back alignment and structure |
|---|
| >2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 | Back alignment and structure |
|---|
| >2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 | Back alignment and structure |
|---|
| >2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 | Back alignment and structure |
|---|
| >2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 | Back alignment and structure |
|---|
| >2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 | Back alignment and structure |
|---|
| >2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 | Back alignment and structure |
|---|
| >1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 | Back alignment and structure |
|---|
| >1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 | Back alignment and structure |
|---|
| >1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 | Back alignment and structure |
|---|
| >1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 | Back alignment and structure |
|---|
| >2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 | Back alignment and structure |
|---|
| >2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 | Back alignment and structure |
|---|
| >2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 | Back alignment and structure |
|---|
| >1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 | Back alignment and structure |
|---|
| >1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 | Back alignment and structure |
|---|
| >1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 | Back alignment and structure |
|---|
| >3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 | Back alignment and structure |
|---|
| >3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 | Back alignment and structure |
|---|
| >1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 | Back alignment and structure |
|---|
| >1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 | Back alignment and structure |
|---|
| >1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 | Back alignment and structure |
|---|
| >1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 | Back alignment and structure |
|---|
| >1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 | Back alignment and structure |
|---|
| >2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 | Back alignment and structure |
|---|
| >2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 | Back alignment and structure |
|---|
| >1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 | Back alignment and structure |
|---|
| >1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 | Back alignment and structure |
|---|
| >2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 | Back alignment and structure |
|---|
| >3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 | Back alignment and structure |
|---|
| >1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 | Back alignment and structure |
|---|
| >1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 | Back alignment and structure |
|---|
| >1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 | Back alignment and structure |
|---|
| >3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 | Back alignment and structure |
|---|
| >1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 | Back alignment and structure |
|---|
| >1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 | Back alignment and structure |
|---|
| >2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 | Back alignment and structure |
|---|
| >2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 | Back alignment and structure |
|---|
| >3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 | Back alignment and structure |
|---|
| >2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 | Back alignment and structure |
|---|
| >2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 | Back alignment and structure |
|---|
| >3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 | Back alignment and structure |
|---|
| >1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 Length = 389 | Back alignment and structure |
|---|
| >2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 | Back alignment and structure |
|---|
| >2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 | Back alignment and structure |
|---|
| >2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 | Back alignment and structure |
|---|
| >2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 | Back alignment and structure |
|---|
| >2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 | Back alignment and structure |
|---|
| >1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 | Back alignment and structure |
|---|
| >2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 | Back alignment and structure |
|---|
| >2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 | Back alignment and structure |
|---|
| >2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 | Back alignment and structure |
|---|
| >2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 | Back alignment and structure |
|---|
| >2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 | Back alignment and structure |
|---|
| >2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Length = 384 | Back alignment and structure |
|---|
| >2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 | Back alignment and structure |
|---|
| >3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Length = 176 | Back alignment and structure |
|---|
| >3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} Length = 318 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch
Original result of HHsearch against PDB70 database
No hit with probability above 80.00
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST
Original result of RPS-BLAST against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
E-value |
| 1342 | ||||
| d2a5yb3 | 277 | c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenor | 1e-31 | |
| d2omza2 | 384 | c.10.2.1 (A:33-416) Internalin A {Listeria monocyt | 5e-10 | |
| d2omza2 | 384 | c.10.2.1 (A:33-416) Internalin A {Listeria monocyt | 6e-09 | |
| d2omza2 | 384 | c.10.2.1 (A:33-416) Internalin A {Listeria monocyt | 1e-08 | |
| d2omza2 | 384 | c.10.2.1 (A:33-416) Internalin A {Listeria monocyt | 0.004 | |
| d2omza2 | 384 | c.10.2.1 (A:33-416) Internalin A {Listeria monocyt | 0.004 | |
| d1xkua_ | 305 | c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 | 6e-06 | |
| d1dcea3 | 124 | c.10.2.2 (A:444-567) Rab geranylgeranyltransferase | 1e-05 | |
| d1jl5a_ | 353 | c.10.2.6 (A:) Leucine rich effector protein YopM { | 1e-05 | |
| d1a9na_ | 162 | c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom | 8e-05 | |
| d1h6ua2 | 227 | c.10.2.1 (A:36-262) Internalin H {Listeria monocyt | 2e-04 | |
| d1h6ua2 | 227 | c.10.2.1 (A:36-262) Internalin H {Listeria monocyt | 3e-04 | |
| d1h6ua2 | 227 | c.10.2.1 (A:36-262) Internalin H {Listeria monocyt | 0.001 | |
| d1z7xw1 | 460 | c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( | 3e-04 | |
| d1z7xw1 | 460 | c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( | 0.004 | |
| d2astb2 | 284 | c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 | 0.001 | |
| d1koha1 | 162 | c.10.2.3 (A:201-362) mRNA export factor tap {Human | 0.001 | |
| d1ogqa_ | 313 | c.10.2.8 (A:) Polygalacturonase inhibiting protein | 0.002 | |
| d1h6ta2 | 210 | c.10.2.1 (A:31-240) Internalin B {Listeria monocyt | 0.002 | |
| d1p9ag_ | 266 | c.10.2.7 (G:) von Willebrand factor binding domain | 0.002 | |
| d2fnaa2 | 283 | c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfo | 0.004 | |
| d1m9la_ | 198 | c.10.3.1 (A:) Outer arm dynein light chain 1 {Gree | 0.004 |
| >d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Length = 277 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: P-loop containing nucleoside triphosphate hydrolases superfamily: P-loop containing nucleoside triphosphate hydrolases family: Extended AAA-ATPase domain domain: CED-4, NB-ARC domain species: Caenorhabditis elegans [TaxId: 6239]
Score = 123 bits (309), Expect = 1e-31
Identities = 34/230 (14%), Positives = 73/230 (31%), Gaps = 21/230 (9%)
Query: 144 RESILNDILDALR---GPYVYMIGVYGMAGIGKTTLVKEVARLAKE--GRIFDEVVFAEV 198
RE ++ ++ L + + ++G AG GK+ + + + + G +D +V+ +
Sbjct: 25 REYHVDRVIKKLDEMCDLDSFFLFLHGRAGSGKSVIASQALSKSDQLIGINYDSIVWLKD 84
Query: 199 SQTPDLKRIRREIADQLGLNFCEES----------DSERIMMLCNRLKREKKILVILDDI 248
S T L L ++ M+CN L L + DD+
Sbjct: 85 SGTAPKSTFDLFTDILLMLKSEDDLLNFPSVEHVTSVVLKRMICNALIDRPNTLFVFDDV 144
Query: 249 WTSLDLERTGIPFGDVHRGCKILVTSRRRDVLVSEMHCQNNYCVSVLNKEEAWSLFSKVV 308
+ + LVT+R ++ + V+ L +E +
Sbjct: 145 VQEETIRW------AQELRLRCLVTTRDVEISNAASQTCEFIEVTSLEIDECYDFLEAYG 198
Query: 309 GNCVEDPDLQTVAIQVANECGGLPIAILTVARTLRNKPLFVWKKALQELR 358
+ V + G P ++ ++ K + +L
Sbjct: 199 MPMPVGEKEEDVLNKTIELSSGNPATLMMFFKSCEPKTFEKMAQLNNKLE 248
|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 | Back information, alignment and structure |
|---|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 | Back information, alignment and structure |
|---|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 | Back information, alignment and structure |
|---|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 | Back information, alignment and structure |
|---|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 | Back information, alignment and structure |
|---|
| >d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 | Back information, alignment and structure |
|---|
| >d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 | Back information, alignment and structure |
|---|
| >d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 | Back information, alignment and structure |
|---|
| >d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 | Back information, alignment and structure |
|---|
| >d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 | Back information, alignment and structure |
|---|
| >d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 | Back information, alignment and structure |
|---|
| >d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 | Back information, alignment and structure |
|---|
| >d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 | Back information, alignment and structure |
|---|
| >d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 | Back information, alignment and structure |
|---|
| >d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 | Back information, alignment and structure |
|---|
| >d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 | Back information, alignment and structure |
|---|
| >d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Length = 283 | Back information, alignment and structure |
|---|
| >d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Length = 198 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch
Original result of HHsearch against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 1342 | |||
| d2a5yb3 | 277 | CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI | 100.0 | |
| d2omza2 | 384 | Internalin A {Listeria monocytogenes [TaxId: 1639] | 99.91 | |
| d2omza2 | 384 | Internalin A {Listeria monocytogenes [TaxId: 1639] | 99.91 | |
| d1xkua_ | 305 | Decorin {Cow (Bos taurus) [TaxId: 9913]} | 99.84 | |
| d1p9ag_ | 266 | von Willebrand factor binding domain of glycoprote | 99.84 | |
| d1jl5a_ | 353 | Leucine rich effector protein YopM {Yersinia pesti | 99.81 | |
| d1jl5a_ | 353 | Leucine rich effector protein YopM {Yersinia pesti | 99.79 | |
| d1xkua_ | 305 | Decorin {Cow (Bos taurus) [TaxId: 9913]} | 99.79 | |
| d1ozna_ | 284 | Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma | 99.79 | |
| d1p9ag_ | 266 | von Willebrand factor binding domain of glycoprote | 99.78 | |
| d1ogqa_ | 313 | Polygalacturonase inhibiting protein PGIP {Kidney | 99.77 | |
| d1ozna_ | 284 | Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma | 99.77 | |
| d1ogqa_ | 313 | Polygalacturonase inhibiting protein PGIP {Kidney | 99.75 | |
| d1h6ta2 | 210 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 99.75 | |
| d2omxa2 | 199 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 99.74 | |
| d2omxa2 | 199 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 99.71 | |
| d2astb2 | 284 | Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa | 99.68 | |
| d1h6ta2 | 210 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 99.67 | |
| d1h6ua2 | 227 | Internalin H {Listeria monocytogenes [TaxId: 1639] | 99.67 | |
| d1h6ua2 | 227 | Internalin H {Listeria monocytogenes [TaxId: 1639] | 99.64 | |
| d1xwdc1 | 242 | Follicle-stimulating hormone receptor {Human (Homo | 99.53 | |
| d1xwdc1 | 242 | Follicle-stimulating hormone receptor {Human (Homo | 99.52 | |
| d1a9na_ | 162 | Splicesomal U2A' protein {Human (Homo sapiens) [Ta | 99.52 | |
| d2fnaa2 | 283 | Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ | 99.5 | |
| d1w8aa_ | 192 | Slit {Fruit fly (Drosophila melanogaster) [TaxId: | 99.49 | |
| d1w8aa_ | 192 | Slit {Fruit fly (Drosophila melanogaster) [TaxId: | 99.48 | |
| d1a9na_ | 162 | Splicesomal U2A' protein {Human (Homo sapiens) [Ta | 99.47 | |
| d1dcea3 | 124 | Rab geranylgeranyltransferase alpha-subunit, C-ter | 99.46 | |
| d1dcea3 | 124 | Rab geranylgeranyltransferase alpha-subunit, C-ter | 99.44 | |
| d1z7xw1 | 460 | Ribonuclease inhibitor {Human (Homo sapiens) [TaxI | 99.36 | |
| d1z7xw1 | 460 | Ribonuclease inhibitor {Human (Homo sapiens) [TaxI | 99.28 | |
| d1fnna2 | 276 | CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T | 99.26 | |
| d1sxjc2 | 227 | Replication factor C3 {Baker's yeast (Saccharomyce | 99.26 | |
| d1sxjb2 | 224 | Replication factor C4 {Baker's yeast (Saccharomyce | 99.24 | |
| d1m9la_ | 198 | Outer arm dynein light chain 1 {Green algae (Chlam | 99.17 | |
| d1m9la_ | 198 | Outer arm dynein light chain 1 {Green algae (Chlam | 99.15 | |
| d1r6bx2 | 268 | ClpA, an Hsp100 chaperone, AAA+ modules {Escherich | 99.14 | |
| d1njfa_ | 239 | delta prime subunit of DNA polymerase III, N-domai | 99.14 | |
| d1iqpa2 | 231 | Replication factor C {Archaeon Pyrococcus furiosus | 99.13 | |
| d1sxjd2 | 237 | Replication factor C2 {Baker's yeast (Saccharomyce | 99.12 | |
| d1w5sa2 | 287 | CDC6-like protein APE0152, N-terminal domain {Aero | 99.09 | |
| d1sxje2 | 252 | Replication factor C5 {Baker's yeast (Saccharomyce | 99.08 | |
| d2ifga3 | 156 | High affinity nerve growth factor receptor, N-term | 99.04 | |
| d2ifga3 | 156 | High affinity nerve growth factor receptor, N-term | 98.95 | |
| d1qvra2 | 387 | ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 | 98.87 | |
| d1sxja2 | 253 | Replication factor C1 {Baker's yeast (Saccharomyce | 98.85 | |
| d1ixza_ | 247 | AAA domain of cell division protein FtsH {Thermus | 98.82 | |
| d1lv7a_ | 256 | AAA domain of cell division protein FtsH {Escheric | 98.79 | |
| d1in4a2 | 238 | Holliday junction helicase RuvB {Thermotoga mariti | 98.79 | |
| d1a5ta2 | 207 | delta prime subunit of DNA polymerase III, N-domai | 98.77 | |
| d2ca6a1 | 344 | Rna1p (RanGAP1), N-terminal domain {Fission yeast | 98.76 | |
| d1ixsb2 | 239 | Holliday junction helicase RuvB {Thermus thermophi | 98.73 | |
| d1d2na_ | 246 | Hexamerization domain of N-ethylmalemide-sensitive | 98.73 | |
| d1e32a2 | 258 | Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu | 98.72 | |
| d1jbka_ | 195 | ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} | 98.7 | |
| d1r7ra3 | 265 | Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu | 98.48 | |
| d1l8qa2 | 213 | Chromosomal replication initiation factor DnaA {Aq | 98.4 | |
| d2gnoa2 | 198 | gamma subunit of DNA polymerase III, N-domain {The | 97.97 | |
| d1koha1 | 162 | mRNA export factor tap {Human (Homo sapiens) [TaxI | 97.74 | |
| d1koha1 | 162 | mRNA export factor tap {Human (Homo sapiens) [TaxI | 97.6 | |
| d1mo6a1 | 269 | RecA protein, ATPase-domain {Mycobacterium tubercu | 97.49 | |
| d1r6bx3 | 315 | ClpA, an Hsp100 chaperone, AAA+ modules {Escherich | 97.44 | |
| d1xp8a1 | 268 | RecA protein, ATPase-domain {Deinococcus radiodura | 97.41 | |
| d1qvra3 | 315 | ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 | 97.4 | |
| d2qy9a2 | 211 | GTPase domain of the signal recognition particle r | 97.33 | |
| d1okkd2 | 207 | GTPase domain of the signal recognition particle r | 97.3 | |
| d1ihua2 | 279 | Arsenite-translocating ATPase ArsA {Escherichia co | 97.25 | |
| d1ofha_ | 309 | HslU {Haemophilus influenzae [TaxId: 727]} | 97.24 | |
| d1u94a1 | 263 | RecA protein, ATPase-domain {Escherichia coli [Tax | 97.24 | |
| d1ls1a2 | 207 | GTPase domain of the signal sequence recognition p | 97.21 | |
| d1tf7a2 | 242 | Circadian clock protein KaiC {Synechococcus sp. st | 97.2 | |
| d1j8yf2 | 211 | GTPase domain of the signal sequence recognition p | 97.18 | |
| d2jdid3 | 276 | Central domain of beta subunit of F1 ATP synthase | 97.15 | |
| d1m8pa3 | 183 | ATP sulfurylase C-terminal domain {Fungus (Penicil | 97.14 | |
| d1vmaa2 | 213 | GTPase domain of the signal recognition particle r | 97.11 | |
| d1gvnb_ | 273 | Plasmid maintenance system epsilon/zeta, toxin zet | 97.09 | |
| d1lw7a2 | 192 | Transcriptional regulator NadR, ribosylnicotinamid | 97.09 | |
| d1bifa1 | 213 | 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata | 97.04 | |
| d1rz3a_ | 198 | Hypothetical protein rbstp0775 {Bacillus stearothe | 97.04 | |
| d2qm8a1 | 323 | Metallochaperone MeaB {Methylobacterium extorquens | 97.02 | |
| d1ihua1 | 296 | Arsenite-translocating ATPase ArsA {Escherichia co | 96.98 | |
| d1cp2a_ | 269 | Nitrogenase iron protein {Clostridium pasteurianum | 96.96 | |
| d1sq5a_ | 308 | Pantothenate kinase PanK {Escherichia coli [TaxId: | 96.95 | |
| d2p67a1 | 327 | LAO/AO transport system kinase ArgK {Escherichia c | 96.92 | |
| d2i3ba1 | 189 | Cancer-related NTPase, C1orf57 {Human (Homo sapien | 96.91 | |
| d1np6a_ | 170 | Molybdopterin-guanine dinucleotide biosynthesis pr | 96.91 | |
| d1kaga_ | 169 | Shikimate kinase (AroK) {Escherichia coli [TaxId: | 96.89 | |
| d1g8pa_ | 333 | ATPase subunit of magnesium chelatase, BchI {Rhodo | 96.86 | |
| d1xpua3 | 289 | Transcription termination factor Rho, ATPase domai | 96.85 | |
| d2bdta1 | 176 | Hypothetical protein BH3686 {Bacillus halodurans [ | 96.85 | |
| d1qf9a_ | 194 | UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 | 96.77 | |
| d1w44a_ | 321 | NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} | 96.75 | |
| d1rkba_ | 173 | Adenylate kinase {Human (Homo sapiens), isoenzyme | 96.68 | |
| d1pgva_ | 167 | Tropomodulin C-terminal domain {nematode (Caenorha | 96.66 | |
| d1ly1a_ | 152 | Polynucleotide kinase, kinase domain {Bacteriophag | 96.65 | |
| d2afhe1 | 289 | Nitrogenase iron protein {Azotobacter vinelandii [ | 96.61 | |
| d1x6va3 | 195 | Adenosine-5'phosphosulfate kinase (APS kinase) {Hu | 96.61 | |
| d1khta_ | 190 | Adenylate kinase {Archaeon Methanococcus voltae [T | 96.57 | |
| d1ukza_ | 196 | Uridylate kinase {Baker's yeast (Saccharomyces cer | 96.54 | |
| d1xjca_ | 165 | Molybdopterin-guanine dinucleotide biosynthesis pr | 96.52 | |
| d1knqa_ | 171 | Gluconate kinase {Escherichia coli [TaxId: 562]} | 96.52 | |
| d1viaa_ | 161 | Shikimate kinase (AroK) {Campylobacter jejuni [Tax | 96.5 | |
| d1y63a_ | 174 | Probable kinase LmjF30.1890 {Leishmania major [Tax | 96.39 | |
| d1szpa2 | 251 | DNA repair protein Rad51, catalytic domain {Baker' | 96.39 | |
| d2iyva1 | 165 | Shikimate kinase (AroK) {Mycobacterium tuberculosi | 96.39 | |
| d1ckea_ | 225 | CMP kinase {Escherichia coli [TaxId: 562]} | 96.38 | |
| d1nksa_ | 194 | Adenylate kinase {Archaeon Sulfolobus acidocaldari | 96.35 | |
| d1qhxa_ | 178 | Chloramphenicol phosphotransferase {Streptomyces v | 96.35 | |
| d1q3ta_ | 223 | CMP kinase {Streptococcus pneumoniae [TaxId: 1313] | 96.28 | |
| d1e6ca_ | 170 | Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax | 96.28 | |
| d1m7ga_ | 208 | Adenosine-5'phosphosulfate kinase (APS kinase) {Fu | 96.26 | |
| d1svma_ | 362 | Papillomavirus large T antigen helicase domain {Si | 96.22 | |
| d1uj2a_ | 213 | Uridine-cytidine kinase 2 {Human (Homo sapiens) [T | 96.18 | |
| d1teva_ | 194 | UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] | 96.15 | |
| d1zp6a1 | 176 | Hypothetical protein Atu3015 {Agrobacterium tumefa | 96.14 | |
| d1um8a_ | 364 | ClpX {Helicobacter pylori [TaxId: 210]} | 96.11 | |
| d1ye8a1 | 178 | Hypothetical kinase-like protein Aq_1292 {Aquifex | 96.1 | |
| d1hyqa_ | 232 | Cell division regulator MinD {Archaeon Archaeoglob | 96.06 | |
| d1yj5a2 | 172 | 5' polynucleotide kinase-3' phosphatase, C-termina | 96.04 | |
| d1pzna2 | 254 | DNA repair protein Rad51, catalytic domain {Archae | 95.99 | |
| d1a7ja_ | 288 | Phosphoribulokinase {Rhodobacter sphaeroides [TaxI | 95.98 | |
| d1odfa_ | 286 | Hypothetical protein Ygr205W {Baker's yeast (Sacch | 95.88 | |
| d1ak2a1 | 190 | Adenylate kinase {Cow (Bos taurus), mitochondrial | 95.8 | |
| d1nn5a_ | 209 | Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 | 95.67 | |
| d1fx0a3 | 276 | Central domain of alpha subunit of F1 ATP synthase | 95.61 | |
| d1io0a_ | 166 | Tropomodulin C-terminal domain {Chicken (Gallus ga | 95.59 | |
| d1g3qa_ | 237 | Cell division regulator MinD {Archaeon Pyrococcus | 95.59 | |
| d1lvga_ | 190 | Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 | 95.58 | |
| d1zina1 | 182 | Adenylate kinase {Bacillus stearothermophilus [Tax | 95.47 | |
| d1gkya_ | 186 | Guanylate kinase {Baker's yeast (Saccharomyces cer | 95.41 | |
| d1ny5a2 | 247 | Transcriptional activator sigm54 (NtrC1), C-termin | 95.41 | |
| d1v5wa_ | 258 | Meiotic recombination protein DMC1/LIM15 homolog { | 95.39 | |
| d2ocpa1 | 241 | Deoxyguanosine kinase {Human (Homo sapiens) [TaxId | 95.38 | |
| d1yrba1 | 244 | ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss | 95.37 | |
| d1zaka1 | 189 | Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} | 95.37 | |
| d3adka_ | 194 | Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} | 95.36 | |
| d2jdia3 | 285 | Central domain of alpha subunit of F1 ATP synthase | 95.32 | |
| d2cdna1 | 181 | Adenylate kinase {Mycobacterium tuberculosis [TaxI | 95.31 | |
| d4tmka_ | 210 | Thymidylate kinase {Escherichia coli [TaxId: 562]} | 95.27 | |
| d1znwa1 | 182 | Guanylate kinase {Mycobacterium tuberculosis [TaxI | 95.26 | |
| d2ak3a1 | 189 | Adenylate kinase {Cow (Bos taurus), mitochondrial | 95.23 | |
| d2i1qa2 | 258 | DNA repair protein Rad51, catalytic domain {Archae | 95.19 | |
| d1wb9a2 | 234 | DNA repair protein MutS, the C-terminal domain {Es | 95.18 | |
| d1g41a_ | 443 | HslU {Haemophilus influenzae [TaxId: 727]} | 95.17 | |
| d1s3ga1 | 182 | Adenylate kinase {Bacillus globisporus [TaxId: 145 | 95.14 | |
| d1kgda_ | 178 | Guanylate kinase-like domain of Cask {Human (Homo | 95.08 | |
| d1uf9a_ | 191 | Dephospho-CoA kinase {Thermus thermophilus [TaxId: | 94.96 | |
| d1gsia_ | 208 | Thymidylate kinase {Mycobacterium tuberculosis [Ta | 94.92 | |
| d1akya1 | 180 | Adenylate kinase {Baker's yeast (Saccharomyces cer | 94.81 | |
| d1tmka_ | 214 | Thymidylate kinase {Baker's yeast (Saccharomyces c | 94.75 | |
| d2vp4a1 | 197 | Deoxyribonucleoside kinase {Fruit fly (Drosophila | 94.68 | |
| d1e4va1 | 179 | Adenylate kinase {Escherichia coli [TaxId: 562]} | 94.64 | |
| d1tf7a1 | 242 | Circadian clock protein KaiC {Synechococcus sp. st | 94.5 | |
| d1s96a_ | 205 | Guanylate kinase {Escherichia coli [TaxId: 562]} | 94.47 | |
| d1p5zb_ | 241 | Deoxycytidine kinase {Human (Homo sapiens) [TaxId: | 94.11 | |
| d1w36d1 | 359 | Exodeoxyribonuclease V alpha chain (RecD) {Escheri | 94.04 | |
| d1cr2a_ | 277 | Gene 4 protein (g4p, DNA primase), helicase domain | 93.97 | |
| d1vhta_ | 208 | Dephospho-CoA kinase {Escherichia coli [TaxId: 562 | 93.94 | |
| d1deka_ | 241 | Deoxynucleoside monophosphate kinase {Bacteriophag | 93.77 | |
| d1n0wa_ | 242 | DNA repair protein Rad51, catalytic domain {Human | 93.74 | |
| d1nija1 | 222 | Hypothetical protein YjiA, N-terminal domain {Esch | 93.73 | |
| d1g2912 | 240 | Maltose transport protein MalK, N-terminal domain | 93.72 | |
| d1svsa1 | 195 | Transducin (alpha subunit) {Rat (Rattus norvegicus | 93.72 | |
| d1nlfa_ | 274 | Hexameric replicative helicase repA {Escherichia c | 93.71 | |
| d1zj6a1 | 177 | ADP-ribosylation factor {Human (Homo sapiens), ARL | 93.69 | |
| d1htwa_ | 158 | Hypothetical protein HI0065 {Haemophilus influenza | 93.69 | |
| d1byia_ | 224 | Dethiobiotin synthetase {Escherichia coli [TaxId: | 93.66 | |
| d1r0wa_ | 281 | Cystic fibrosis transmembrane conductance regulato | 93.6 | |
| d1b0ua_ | 258 | ATP-binding subunit of the histidine permease {Sal | 93.53 | |
| d1r8sa_ | 160 | ADP-ribosylation factor {Human (Homo sapiens), ARF | 93.46 | |
| d1jjva_ | 205 | Dephospho-CoA kinase {Haemophilus influenzae [TaxI | 93.39 | |
| d3b60a1 | 253 | Multidrug resistance ABC transporter MsbA, C-termi | 93.33 | |
| d2pmka1 | 241 | Haemolysin B ATP-binding protein {Escherichia coli | 93.28 | |
| d1f6ba_ | 186 | SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: | 93.28 | |
| d1mv5a_ | 242 | Multidrug resistance ABC transporter LmrA, C-termi | 93.2 | |
| d1l2ta_ | 230 | MJ0796 {Archaeon Methanococcus jannaschii [TaxId: | 93.15 | |
| d2awna2 | 232 | Maltose transport protein MalK, N-terminal domain | 93.09 | |
| d1jj7a_ | 251 | Peptide transporter Tap1, C-terminal ABC domain {H | 93.07 | |
| d3dhwc1 | 240 | Methionine import ATP-binding protein MetN {Escher | 93.02 | |
| d1v43a3 | 239 | Hypothetical protein PH0022, N-terminal domain {Py | 93.01 | |
| d2a5ja1 | 173 | Rab2b {Human (Homo sapiens) [TaxId: 9606]} | 92.98 | |
| d1z06a1 | 165 | Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} | 92.97 | |
| d1svia_ | 195 | Probable GTPase EngB {Bacillus subtilis [TaxId: 14 | 92.91 | |
| d2onka1 | 240 | Molybdate/tungstate import ATP-binding protein Wtp | 92.9 | |
| d1z0fa1 | 166 | Rab14 {Human (Homo sapiens) [TaxId: 9606]} | 92.88 | |
| d1upta_ | 169 | ADP-ribosylation factor {Human (Homo sapiens), ARL | 92.74 | |
| d1z2aa1 | 164 | Rab23 {Mouse (Mus musculus) [TaxId: 10090]} | 92.72 | |
| d1sgwa_ | 200 | Putative ABC transporter PF0895 {Pyrococcus furios | 92.67 | |
| d1ewqa2 | 224 | DNA repair protein MutS, the C-terminal domain {Th | 92.58 | |
| d1z08a1 | 167 | Rab21 {Human (Homo sapiens) [TaxId: 9606]} | 92.58 | |
| d3d31a2 | 229 | Sulfate/molybdate ABC transporter, ATP-binding pro | 92.56 | |
| d1z0ja1 | 167 | Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} | 92.46 | |
| d1yzqa1 | 164 | Rab6 {Human (Homo sapiens) [TaxId: 9606]} | 92.39 | |
| d3raba_ | 169 | Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} | 92.38 | |
| d1r2qa_ | 170 | Rab5a {Human (Homo sapiens) [TaxId: 9606]} | 92.37 | |
| d1kaoa_ | 167 | Rap2a {Human (Homo sapiens) [TaxId: 9606]} | 92.36 | |
| d2ew1a1 | 171 | Rab30 {Human (Homo sapiens) [TaxId: 9606]} | 92.36 | |
| d2fn4a1 | 173 | r-Ras {Human (Homo sapiens) [TaxId: 9606]} | 92.34 | |
| d2f7sa1 | 186 | Rab27b {Human (Homo sapiens) [TaxId: 9606]} | 92.31 | |
| d2erxa1 | 171 | di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} | 92.29 | |
| d1p6xa_ | 333 | Thymidine kinase {Equine herpesvirus type 4 [TaxId | 92.28 | |
| d2atva1 | 168 | Ras-like estrogen-regulated growth inhibitor, RERG | 92.27 | |
| d1ky3a_ | 175 | Rab-related protein ypt7p {Baker's yeast (Saccharo | 92.17 | |
| d2bmea1 | 174 | Rab4a {Human (Homo sapiens) [TaxId: 9606]} | 92.09 | |
| d2bcgy1 | 194 | GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisi | 92.07 | |
| d1g16a_ | 166 | Rab-related protein Sec4 {Baker's yeast (Saccharom | 92.04 | |
| d2gjsa1 | 168 | Rad {Human (Homo sapiens) [TaxId: 9606]} | 91.96 | |
| d1kmqa_ | 177 | RhoA {Human (Homo sapiens) [TaxId: 9606]} | 91.95 | |
| d1c1ya_ | 167 | Rap1A {Human (Homo sapiens) [TaxId: 9606]} | 91.94 | |
| d1xtqa1 | 167 | GTP-binding protein RheB {Human (Homo sapiens) [Ta | 91.92 | |
| d1mh1a_ | 183 | Rac {Human (Homo sapiens) [TaxId: 9606]} | 91.91 | |
| d1ji0a_ | 240 | Branched chain aminoacid ABC transporter {Thermoto | 91.91 | |
| d1vpla_ | 238 | Putative ABC transporter TM0544 {Thermotoga mariti | 91.9 | |
| d2atxa1 | 185 | RhoQ {Human (Homo sapiens) [TaxId: 9606]} | 91.89 | |
| d2f9la1 | 175 | Rab11b {Human (Homo sapiens) [TaxId: 9606]} | 91.88 | |
| d1g6ha_ | 254 | MJ1267 {Archaeon Methanococcus jannaschii [TaxId: | 91.87 | |
| d2fh5b1 | 207 | Signal recognition particle receptor beta-subunit | 91.85 | |
| d1nrjb_ | 209 | Signal recognition particle receptor beta-subunit | 91.84 | |
| d2g6ba1 | 170 | Rab26 {Human (Homo sapiens) [TaxId: 9606]} | 91.81 | |
| d2erya1 | 171 | r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} | 91.77 | |
| d2bcjq2 | 200 | Transducin (alpha subunit) {Mouse (Mus musculus) [ | 91.73 | |
| d1ek0a_ | 170 | Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [T | 91.71 | |
| d1wf3a1 | 178 | GTPase Era, N-terminal domain {Thermus thermophilu | 91.71 | |
| d1ksha_ | 165 | ADP-ribosylation factor {Mouse (Mus musculus), ARL | 91.67 | |
| d1zcba2 | 200 | Transducin (alpha subunit) {Mouse (Mus musculus) [ | 91.66 | |
| d2bv3a2 | 276 | Elongation factor G (EF-G), N-terminal (G) domain | 91.57 | |
| d1azta2 | 221 | Transducin (alpha subunit) {Cow (Bos taurus) [TaxI | 91.51 | |
| d1egaa1 | 179 | GTPase Era, N-terminal domain {Escherichia coli [T | 91.45 | |
| d1fzqa_ | 176 | ADP-ribosylation factor {Mouse (Mus musculus), ARL | 91.42 | |
| d1ctqa_ | 166 | cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 | 91.39 | |
| d1mkya1 | 171 | Probable GTPase Der, N-terminal and middle domains | 91.37 | |
| d1vg8a_ | 184 | Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} | 91.37 | |
| d1oxxk2 | 242 | Glucose transport protein GlcV, N-terminal domain | 91.37 | |
| d2ngra_ | 191 | CDC42 {Human (Homo sapiens) [TaxId: 9606]} | 91.36 | |
| d1m7ba_ | 179 | RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} | 91.13 | |
| d1pjra1 | 318 | DEXX box DNA helicase {Bacillus stearothermophilus | 91.08 | |
| d2g3ya1 | 172 | GTP-binding protein GEM {Human (Homo sapiens) [Tax | 91.04 | |
| d1x3sa1 | 177 | Rab18 {Human (Homo sapiens) [TaxId: 9606]} | 91.0 | |
| d1wmsa_ | 174 | Rab9a {Human (Homo sapiens) [TaxId: 9606]} | 90.86 | |
| d1u8za_ | 168 | Ras-related protein RalA {Cotton-top tamarin (Sagu | 90.83 | |
| d2bmja1 | 175 | Centaurin gamma 1, G domain {Human (Homo sapiens) | 90.8 | |
| d2hyda1 | 255 | Putative multidrug export ATP-binding/permease pro | 90.73 | |
| d1x1ra1 | 169 | Ras-related protein M-Ras (XRas) {Mouse (Mus muscu | 90.68 | |
| d1uaaa1 | 306 | DEXX box DNA helicase {Escherichia coli, RepD [Tax | 90.59 | |
| d1zd9a1 | 164 | ADP-ribosylation factor {Human (Homo sapiens), ARL | 90.58 | |
| d1osna_ | 331 | Thymidine kinase {Varicella-zoster virus [TaxId: 1 | 90.54 | |
| d1udxa2 | 180 | Obg GTP-binding protein middle domain {Thermus the | 90.5 | |
| d2qtvb1 | 166 | SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta | 90.5 | |
| d1l7vc_ | 231 | ABC transporter involved in vitamin B12 uptake, Bt | 90.43 | |
| d2dy1a2 | 267 | Elongation factor G (EF-G), N-terminal (G) domain | 90.19 | |
| d1e0sa_ | 173 | ADP-ribosylation factor {Human (Homo sapiens), ARF | 90.19 | |
| d1u0la2 | 225 | Probable GTPase EngC (YjeQ), C-terminal domain {Th | 90.17 | |
| d1i2ma_ | 170 | Ran {Human (Homo sapiens) [TaxId: 9606]} | 89.83 | |
| d1kkma_ | 176 | HPr kinase HprK C-terminal domain {Lactobacillus c | 89.77 | |
| d1lnza2 | 185 | Obg GTP-binding protein middle domain {Bacillus su | 89.76 | |
| d1e2ka_ | 329 | Thymidine kinase {Herpes simplex virus type 1, dif | 89.57 | |
| d2cxxa1 | 184 | GTP-binding protein engB {Pyrococcus horikoshii [T | 89.04 | |
| d1moza_ | 182 | ADP-ribosylation factor {Baker's yeast (Saccharomy | 88.88 | |
| d2fu5c1 | 173 | Rab8a {Mouse (Mus musculus) [TaxId: 10090]} | 88.85 | |
| d1tuea_ | 205 | Replication protein E1 helicase domain {Human papi | 88.75 | |
| d1mkya2 | 186 | Probable GTPase Der, N-terminal and middle domains | 88.73 | |
| d1h65a_ | 257 | Chloroplast protein translocon GTPase Toc34 {Garde | 88.48 | |
| d1puia_ | 188 | Probable GTPase EngB {Escherichia coli [TaxId: 562 | 88.26 | |
| d2gj8a1 | 161 | Probable tRNA modification GTPase TrmE (MnmE), G d | 88.23 | |
| d1f5na2 | 277 | Interferon-induced guanylate-binding protein 1 (GB | 88.17 | |
| d1ko7a2 | 169 | HPr kinase HprK C-terminal domain {Staphylococcus | 87.88 | |
| d1knxa2 | 177 | HPr kinase HprK C-terminal domain {Mycoplasma pneu | 87.61 | |
| d1u0ja_ | 267 | Rep 40 protein helicase domain {Adeno-associated v | 87.57 | |
| g1f2t.1 | 292 | Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} | 86.76 | |
| d2eyqa3 | 233 | Transcription-repair coupling factor, TRCF {Escher | 86.45 | |
| d1n0ua2 | 341 | Elongation factor 2 (eEF-2), N-terminal (G) domain | 86.18 | |
| d1g6oa_ | 323 | Hexameric traffic ATPase, HP0525 {Helicobacter pyl | 85.97 | |
| d1g7sa4 | 227 | Initiation factor IF2/eIF5b, N-terminal (G) domain | 85.77 | |
| d1tq4a_ | 400 | Interferon-inducible GTPase {Mouse (Mus musculus) | 85.56 | |
| d1xzpa2 | 160 | TrmE GTPase domain {Thermotoga maritima [TaxId: 23 | 84.72 | |
| d1p9ra_ | 401 | Extracellular secretion NTPase EpsE {Vibrio choler | 84.39 |
| >d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: P-loop containing nucleoside triphosphate hydrolases superfamily: P-loop containing nucleoside triphosphate hydrolases family: Extended AAA-ATPase domain domain: CED-4, NB-ARC domain species: Caenorhabditis elegans [TaxId: 6239]
Probab=100.00 E-value=0 Score=302.70 Aligned_cols=244 Identities=16% Similarity=0.148 Sum_probs=192.6
Q ss_pred CCCCCCHHHHHHHHHHHHC---CCCEEEEEEECCCCCCHHHHHHHHHHHHH--CCCCCCEEEEEEECCCCCHHHHHHHHH
Q ss_conf 5433216999999999973---99959999993999808899999999984--079843299999257969899999999
Q 000704 138 HEFIESRESILNDILDALR---GPYVYMIGVYGMAGIGKTTLVKEVARLAK--EGRIFDEVVFAEVSQTPDLKRIRREIA 212 (1342)
Q Consensus 138 ~~~~~gr~~~~~~l~~~L~---~~~~~vi~I~G~gG~GKTtLa~~~~~~~~--~~~~F~~~~wv~~~~~~~~~~~~~~i~ 212 (1342)
...++||+.++++|+++|. +.+.++|+|+||||+||||||+++|++.. .+.+|++++|+++++.++...+...+.
T Consensus 19 ~~~~~gR~~~~~~i~~~L~~~~~~~~~~v~I~GmgGiGKTtLA~~v~~~~~~~~~~~f~~~~Wv~vs~~~~~~~l~~~~~ 98 (277)
T d2a5yb3 19 QMTCYIREYHVDRVIKKLDEMCDLDSFFLFLHGRAGSGKSVIASQALSKSDQLIGINYDSIVWLKDSGTAPKSTFDLFTD 98 (277)
T ss_dssp CCCSCCCHHHHHHHHHHHHHHTTSSSEEEEEECSTTSSHHHHHHHHHHHCSSTBTTTBSEEEEEECCCCSTTHHHHHHHH
T ss_pred CCCEECCHHHHHHHHHHHHHCCCCCCEEEEEECCCCCCHHHHHHHHHHHHHHHHHHCCCEEEEEEECCCCCHHHHHHHHH
T ss_conf 88623739999999999873468784089997799788899999999855655401276489999368777778999999
Q ss_pred HHH---CCCCC-------CCCHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCEEEEEECCHHHHHH
Q ss_conf 983---89878-------88929999999999862781999991888821100007877889999189998162345542
Q 000704 213 DQL---GLNFC-------EESDSERIMMLCNRLKREKKILVILDDIWTSLDLERTGIPFGDVHRGCKILVTSRRRDVLVS 282 (1342)
Q Consensus 213 ~~l---~~~~~-------~~~~~~~~~~~~~~l~~~~~~LlVlDdv~~~~~~~~l~~~~~~~~~gs~iiiTtR~~~~~~~ 282 (1342)
..+ +.... .................++++|+|+||||+..+|+.+. ..|||||||||+..++..
T Consensus 99 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~L~~kr~LlVLDDv~~~~~~~~~~------~~~srilvTTR~~~v~~~ 172 (277)
T d2a5yb3 99 ILLMLKSEDDLLNFPSVEHVTSVVLKRMICNALIDRPNTLFVFDDVVQEETIRWAQ------ELRLRCLVTTRDVEISNA 172 (277)
T ss_dssp HHHHHTTTSCCTTCCCCTTCCHHHHHHHHHHHHTTSTTEEEEEEEECCHHHHHHHH------HTTCEEEEEESBGGGGGG
T ss_pred HHHHHHCCHHHCCCCCCHHHHHHHHHHHHHHHHHCCCCEEEECCHHHHHHHHHHHC------CCCCEEEEEEEHHHHHHH
T ss_conf 99987220220278632123369999999999844688167525066776655520------457559999644899986
Q ss_pred HCCCCCCEEECCCCHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHCCCHHHHHHHHHHHCCCCHHHHHHHHHHHHHCCC
Q ss_conf 13757409921799788999999882899999608999999999948991899999999639992689999999862016
Q 000704 283 EMHCQNNYCVSVLNKEEAWSLFSKVVGNCVEDPDLQTVAIQVANECGGLPIAILTVARTLRNKPLFVWKKALQELRFSAR 362 (1342)
Q Consensus 283 ~~~~~~~~~l~~L~~~~~~~lf~~~~~~~~~~~~~~~~~~~i~~~~~g~Plai~~~~~~l~~~~~~~w~~~l~~l~~~~~ 362 (1342)
.......|++++|+.+|||+||.++++.....+..++++++|+++|+|+|||++++|+.++.++...|....+.+...
T Consensus 173 ~~~~~~~~~l~~L~~~ea~~Lf~~~~~~~~~~~~~~~~~~~iv~~c~GlPLAl~~ig~~l~~k~~~~~~~~~~~L~~~-- 250 (277)
T d2a5yb3 173 ASQTCEFIEVTSLEIDECYDFLEAYGMPMPVGEKEEDVLNKTIELSSGNPATLMMFFKSCEPKTFEKMAQLNNKLESR-- 250 (277)
T ss_dssp CCSCEEEEECCCCCHHHHHHHHHHTSCCCC--CHHHHHHHHHHHHHTTCHHHHHHHHTTCCSSSHHHHHHHHHHHHHH--
T ss_pred CCCCCCEEECCCCCHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHCCCHHHHHHHHHHHCCCCHHHHHHHHHHHHCC--
T ss_conf 378871687788997999999999847766742567999999999589989999999986559899999999997348--
Q ss_pred CCCCHHHHHHHHHHHHHCCCCCCHHHHHHHHH
Q ss_conf 87305788875899985055854137888761
Q 000704 363 NFTGLEALLGSTIELIYNYLEGEELKLTFLLC 394 (1342)
Q Consensus 363 ~~~~~~~~~~~~l~~sy~~L~~~~lk~~fl~~ 394 (1342)
...++. .++.+||+.||++ +|+||.++
T Consensus 251 ---~~~~v~-~il~~sY~~L~~~-lk~c~~~l 277 (277)
T d2a5yb3 251 ---GLVGVE-CITPYSYKSLAMA-LQRCVEVL 277 (277)
T ss_dssp ---CSSTTC-CCSSSSSSSHHHH-HHHHHHTS
T ss_pred ---CHHHHH-HHHHHHHHCCCHH-HHHHHHHC
T ss_conf ---678899-9999988512699-99999739
|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} | Back information, alignment and structure |
|---|
| >d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} | Back information, alignment and structure |
|---|
| >d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} | Back information, alignment and structure |
|---|
| >d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} | Back information, alignment and structure |
|---|
| >d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} | Back information, alignment and structure |
|---|
| >d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} | Back information, alignment and structure |
|---|
| >d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} | Back information, alignment and structure |
|---|
| >d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]} | Back information, alignment and structure |
|---|
| >d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d1ihua2 c.37.1.10 (A:308-586) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} | Back information, alignment and structure |
|---|
| >d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} | Back information, alignment and structure |
|---|
| >d2jdid3 c.37.1.11 (D:82-357) Central domain of beta subunit of F1 ATP synthase {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} | Back information, alignment and structure |
|---|
| >d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} | Back information, alignment and structure |
|---|
| >d1ihua1 c.37.1.10 (A:1-296) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1cp2a_ c.37.1.10 (A:) Nitrogenase iron protein {Clostridium pasteurianum [TaxId: 1501]} | Back information, alignment and structure |
|---|
| >d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} | Back information, alignment and structure |
|---|
| >d1xpua3 c.37.1.11 (A:129-417) Transcription termination factor Rho, ATPase domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} | Back information, alignment and structure |
|---|
| >d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} | Back information, alignment and structure |
|---|
| >d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} | Back information, alignment and structure |
|---|
| >d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} | Back information, alignment and structure |
|---|
| >d2afhe1 c.37.1.10 (E:1-289) Nitrogenase iron protein {Azotobacter vinelandii [TaxId: 354]} | Back information, alignment and structure |
|---|
| >d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} | Back information, alignment and structure |
|---|
| >d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} | Back information, alignment and structure |
|---|
| >d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} | Back information, alignment and structure |
|---|
| >d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} | Back information, alignment and structure |
|---|
| >d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} | Back information, alignment and structure |
|---|
| >d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} | Back information, alignment and structure |
|---|
| >d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} | Back information, alignment and structure |
|---|
| >d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} | Back information, alignment and structure |
|---|
| >d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1hyqa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]} | Back information, alignment and structure |
|---|
| >d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fx0a3 c.37.1.11 (A:97-372) Central domain of alpha subunit of F1 ATP synthase {Spinach (Spinacia oleracea), chloroplast [TaxId: 3562]} | Back information, alignment and structure |
|---|
| >d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1g3qa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1ny5a2 c.37.1.20 (A:138-384) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ocpa1 c.37.1.1 (A:37-277) Deoxyguanosine kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} | Back information, alignment and structure |
|---|
| >d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} | Back information, alignment and structure |
|---|
| >d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d2jdia3 c.37.1.11 (A:95-379) Central domain of alpha subunit of F1 ATP synthase {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} | Back information, alignment and structure |
|---|
| >d1wb9a2 c.37.1.12 (A:567-800) DNA repair protein MutS, the C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} | Back information, alignment and structure |
|---|
| >d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1tmka_ c.37.1.1 (A:) Thymidylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} | Back information, alignment and structure |
|---|
| >d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1p5zb_ c.37.1.1 (B:) Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} | Back information, alignment and structure |
|---|
| >d1vhta_ c.37.1.1 (A:) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1deka_ c.37.1.1 (A:) Deoxynucleoside monophosphate kinase {Bacteriophage T4 [TaxId: 10665]} | Back information, alignment and structure |
|---|
| >d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nija1 c.37.1.10 (A:2-223) Hypothetical protein YjiA, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} | Back information, alignment and structure |
|---|
| >d1svsa1 c.37.1.8 (A:32-60,A:182-347) Transducin (alpha subunit) {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1htwa_ c.37.1.18 (A:) Hypothetical protein HI0065 {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1byia_ c.37.1.10 (A:) Dethiobiotin synthetase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jjva_ c.37.1.1 (A:) Dephospho-CoA kinase {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} | Back information, alignment and structure |
|---|
| >d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} | Back information, alignment and structure |
|---|
| >d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1ewqa2 c.37.1.12 (A:542-765) DNA repair protein MutS, the C-terminal domain {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} | Back information, alignment and structure |
|---|
| >d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1p6xa_ c.37.1.1 (A:) Thymidine kinase {Equine herpesvirus type 4 [TaxId: 10331]} | Back information, alignment and structure |
|---|
| >d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2bcjq2 c.37.1.8 (Q:38-66,Q:184-354) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2bv3a2 c.37.1.8 (A:7-282) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1azta2 c.37.1.8 (A:35-65,A:202-391) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} | Back information, alignment and structure |
|---|
| >d2bmja1 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1osna_ c.37.1.1 (A:) Thymidine kinase {Varicella-zoster virus [TaxId: 10335]} | Back information, alignment and structure |
|---|
| >d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2dy1a2 c.37.1.8 (A:8-274) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus, EF-G-2 [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1i2ma_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kkma_ c.91.1.2 (A:) HPr kinase HprK C-terminal domain {Lactobacillus casei [TaxId: 1582]} | Back information, alignment and structure |
|---|
| >d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1e2ka_ c.37.1.1 (A:) Thymidine kinase {Herpes simplex virus type 1, different strains [TaxId: 10298]} | Back information, alignment and structure |
|---|
| >d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1tuea_ c.37.1.20 (A:) Replication protein E1 helicase domain {Human papillomavirus type 18 [TaxId: 333761]} | Back information, alignment and structure |
|---|
| >d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} | Back information, alignment and structure |
|---|
| >d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1f5na2 c.37.1.8 (A:7-283) Interferon-induced guanylate-binding protein 1 (GBP1), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ko7a2 c.91.1.2 (A:130-298) HPr kinase HprK C-terminal domain {Staphylococcus xylosus [TaxId: 1288]} | Back information, alignment and structure |
|---|
| >d1knxa2 c.91.1.2 (A:133-309) HPr kinase HprK C-terminal domain {Mycoplasma pneumoniae [TaxId: 2104]} | Back information, alignment and structure |
|---|
| >d1u0ja_ c.37.1.20 (A:) Rep 40 protein helicase domain {Adeno-associated virus 2, AAV2 [TaxId: 10804]} | Back information, alignment and structure |
|---|
| >d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1n0ua2 c.37.1.8 (A:3-343) Elongation factor 2 (eEF-2), N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d1g7sa4 c.37.1.8 (A:1-227) Initiation factor IF2/eIF5b, N-terminal (G) domain {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d1tq4a_ c.37.1.8 (A:) Interferon-inducible GTPase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|