Citrus Sinensis ID: 000709

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------1000------1010------1020------1030------1040------1050------1060------1070------1080------1090------1100------1110------1120------1130------1140------1150------1160------1170------1180------1190------1200------1210------1220------1230------1240------1250------1260------1270------1280------1290------1300------1310------1320------1330------134

MLRLKAFRPTNDKIVKIQLHPTHPWLVTADASDHVSVWNWEHRQVIYELKAGGVDQRRLVGAKLEKLAEGELEHKGKPTEAMRGGSVKQVNFYDDDVRFWQLWRNRAAAAEAPTAVSNVTSGFASPPPSTKGRHFLVICCVNKAIFLDLVTMRGRDIPKQELDNKSLVCMEFLSRSAVGDVPLVAFGSSDGVIRVLSMISWKLVRRYTGGHKGSISCLMTFMASSGEALLVSGGSDGLLILWSADHGQDSRELVPKLSLKAHDGGVVAVELSRVMGGSPQLITIGADKTLAIWDTVSFKELRRIKPVPKLACHSVASWCHPRAPNLDILTCVKDSHIWAIEHPTYSALTRPLCELSSLVPPQVLAHHKKLRVYCMVAHSLQPHLVATGTNVGVIISEFDPRSLPAVAPLPTPSGSRDHSAVYIVERELKLVNFQLSSAANPSLGNNGSLSETGRLKGDLPDALQIKQIKKHISTPVPHDSYSILSVSSSGKYLAVVWPDIPYFSVYKVSDWSIVDSGSARLLAWDTCRDRFAILESALTPRLPIIPKGGSSRKAKEAAAAAAAAQAAAASAASSATVQARILLDDGTSNILMRSIGGSSEPVIGLHGGALLGVAYRTSRRISPIAATAISTIQSMPLSGFGSSGLSSFTTFDDGFSSQKSPAEAAPQNFQLYSWETFQPVGGLLPQPEWTAWDQTVEYCAFAYQHYIVISSLCPQYRYLGDVAIPYATGAVWHRRQLFVVTPTTIECVFVDAGVAAIDVETMKMKEEMKLKEVQSRAVAEHGELALIAVESSQTAAQDRIKLRPPMLQVVRLASFQHAASVPPFLTMPKQTKVEGDDSMMPKDIEERKVNEIAVGGGGVAVAVTRFPTEQKRPIGPLVVVGVKDGVLWLIDRYMCAHALSLSHPGIRCRCLAAYGDSVSAVKWASRLGREHHDDLAQFMLGMGYATEALHLPGISKRLEFDLAMQSNDLKRALQCLITMSNSRDIGQDHPGLDLNDILTLTTKKENIVEAVQGIVKFAKEFLDLIDAADATGQANIAREALKRLAAAGSVKGALQGHELRGLALRLANHGELTRLSGLVTNLISLGLGREAAFSAAILGDNALMEKAWQDTGMLAEAVLHAHAHGRPSLKNLVEAWNKMLQKEVDHTPTAKTDAAAAFLASLEEPKLTSLAEAGKKPPIEILPPGMPSLGSITIQKKPVPGSLNSQQQPGKPLAIEGSQQQPSEQLAVEAPPTTTPTEESTPPPGEGSEPTSGDKGPIQSSESNSDLAASASVERAPAASITDEAASEGPSQVTDPQEKPQDPGTPETNVPGTSAAQETNVPATLPAQETTVPATLPIE

ccEEEEcccccccEEEEEEcccccEEEEEcccccEEEEEcccccEEEEEEccccccEEEEEccccEEEccccccccccccEEccccEEEEEEEcccEEEEEccccccccccccEEEEcccccEEccccccccccEEEEEEcccEEEEEcccccEEccccccccccccEEEEEEcccccccccEEEEccccccEEEEEccccEEEEEccccccccEEEEEEEEccccccEEEcccccccEEEEEccccccccccccccccccccccEEEEEEEEEcccccEEEEEEccccEEEEEcccccEEEEEcccccccEEEEEEEcccccccccEEEEEEcccEEEEEcccccccccEEEcccccccccccccccEEEEEEEEEEcccccEEEEEccccEEEEEEccccccccccccccccccccEEEEEEccEEEEEEEEEccccccccccccccccccccccccccccEEccccEEEEcccccccEEEEEEcccccEEEEEccccccEEEEEEcccEEEEcccccEEEEcccccEEEEEEEcccccccccccccccHHHHHHHHHHHHHHHHHHHccccccEEEEEEEEcccccEEEEEccccccccEEccccEEEEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEcccccccccccccccccccccccEEEEEEEcEEEEEEccccEEEEcccccccccccEEEEEEEEEEccccEEEEEEEccccEEEcccccHHHHHHHHHHHHHHHHHcccEEEEEEccccccccccccccccccEEEEcccccccccccccccccccccccccccccccccccccEEEEEEcccccEEEEEEcccccccccccEEEEEEEccEEEEEEccccEEEEcccccccccHHHHHcccHHHHHHHHHHcccHHHHHHHHHHHHcccHHHHcccccccccHHHHHHHcccHHHHHHHHHHHHHcccccccccccccHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHcccHHcccccccHHHHHHHHcccccHHHHHHHHHHHHccccHHHHHHHHHHccHHHHHHHHHHHcHHHHHHHHHHHccccccHHHHHHHHHHHcccccccccccccHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc

ccEEEEEccccccEEEEEEcccccEEEEEccccEEEEEEccccEEEEEEEcccccHHHHHHHHHHHHHHcccccccccccccccccEEEEEEEccccHHHHHcHcccHHHccccHcccccccccccccccccccEEEEEEccEEEEEEEHHccHcccccHHHcccccEEHHHHcccccccccEEEEEccccEEEEEEccccEEEEEccccccccEEEEEEccccccccEEEEEccccEEEEEEcccccccHHHcccEEEEcccccEEEEEEEEccccccEEEEEccccEEEEEEcccHHHHHHcccccHHHHccHHHccccccccccEEEEcccccEEEEEccccccccccHHHHHccccHHHHccccccEEEEEEEccccccEEEEEEccEEEEEEcccccccccccccccccccccEEEEEEEccccccccEcccccccccccccccccccccccccccccEEccccEEEEcccccccccEEEEcccccEEEEEEccccEEEEEEEcccEEEccccccEEEccccHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHcEEEEEEccccccHHHEEEcccccccEEEEcccHHEEEEEEcccccccHcHHHHHcccccccccccccccccccEccccccccccccccccccEEEEEcccccccccccccccEEEEccccEEEEEEEccEEEEEcccccHEEEccccccccccHHHHccEEEEEccccEEEEEEEccccEEEHHcHHHHHHHHHHHHHHHHHHHcccEEEEEEcccccccHHHcccccccEEEEEEHccccccccccEEEccccccccccccccHHHHHHccccEEEEccccEEEEEEcccHccccccccEEEEEccccEEEEEEHccccHEEcccccccEHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHccccccHHHHHHHHHcccHHHHHHHHHHHHHcccccccccccccHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHcccccHHHHHHHHHHHEEccccHHHHHHHHHHccHHHHHHHHHHcccHHHHHHHHHHcccccHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc

mlrlkafrptndkivkiqlhpthpwlvtadasdhvsVWNWEHRQVIYELkaggvdqrRLVGAKLEKLAegelehkgkpteamrggsvkqvnfyddDVRFWQLWRNRAaaaeaptavsnvtsgfaspppstkgrhfLVICCVNKAIFLDLVTmrgrdipkqeldnkslvCMEFlsrsavgdvplvafgssdGVIRVLSMISWKLVRRytgghkgsISCLMTFMASSGEALLVSGGSDGLLILWSAdhgqdsrelvpklslkahdggVVAVELSrvmggspqlitigadktLAIWDTVsfkelrrikpvpklachsvaswchprapnldiltcvkdshiwaiehptysaltrplcelsslvppqvlahhKKLRVYCMVAHSLQPHLVATGTNVGVIisefdprslpavaplptpsgsrdhsaVYIVERELKLVNFQlssaanpslgnngslsetgrlkgdlpdALQIKQIKkhistpvphdsysilsvsssgkylavvwpdipyfsvykvsdwsivdsgsarlLAWDTCRDRFAILEsaltprlpiipkggssRKAKEAAAAAAAAQAAAASAASSATVQARILlddgtsnilmrsiggssepviglhgGALLGVAYrtsrrispiaaTAIStiqsmplsgfgssglssfttfddgfssqkspaeaapqnfqlyswetfqpvggllpqpewtawdqTVEYCAFAYQHYIVISSLcpqyrylgdvaipyatgavwhrrqlfvvtptTIECVFVDAGVAAIDVETMKMKEEMKLKEVQSRAVAEHGELALIAVESSQTAAQdriklrppmLQVVRLASfqhaasvppfltmpkqtkvegddsmmpkdiEERKVNEIAVGGGGVAVAVtrfpteqkrpigplvvvGVKDGVLWLIDRYMCAHalslshpgircrcLAAYGDSVSAVKWASRLGREHHDDLAQFMLGMgyatealhlpgisKRLEFDLAMQSNDLKRALQCLITmsnsrdigqdhpgldlndilTLTTKKENIVEAVQGIVKFAKEFLDLIDAADATGQANIAREALKRLAAAGSVKGALQGHELRGLALRLANHGELTRLSGLVTNLISLGLGREAAFSAAILGDNALMEKAWQDTGMLAEAVLHAHAHGRPSLKNLVEAWNKMLQKEvdhtptakTDAAAAFLASleepkltslaeagkkppieilppgmpslgsitiqkkpvpgslnsqqqpgkplaiegsqqqpseqlaveapptttpteestpppgegseptsgdkgpiqssesnsdlaasasverapaasitdeaasegpsqvtdpqekpqdpgtpetnvpgtsaaqetnvpatlpaqettvpatlpie

mlrlkafrptndkivkiqLHPTHPWLVTADASDHVSVWNWEHRQVIYElkaggvdqrRLVGAKLEKlaegelehkgkpteamrggsvkqvNFYDDDVRFWQLWRNRAAAAEAPTAVSNVTSGFASPPPSTKGRHFLVICCVNKAIFLDLVTMRGRDIPKQELDNKSLVCMEFLSrsavgdvplvafGSSDGVIRVLSMISWKLVRRYTGGHKGSISCLMTFMASSGEALLVSGGSDGLLILWSADHGQDSRELVPKLSLKAHDGGVVAVELsrvmggspqlitigadktlAIWDTVSFKELRRIKPVPKLACHSVASWCHPRAPNLDILTCVKDSHIWAIEHPTYSALTRPLCELSSLVPPQVLAHHKKLRVYCMVAHSLQPHLVATGTNVGVIISEFDPRSLPAVaplptpsgsrdHSAVYIVERELKLVNFQLSSAANPSLGNNGSLSETGRLKGDLPDALQIKQIKkhistpvphdSYSILSVSSSGKYLAVVWPDIPYFSVYKVSDWSIVDSGSARLLAWDTCRDRFAIlesaltprlpiipKGGSSRKAKEAAAAAAAAQAAAASAASSATVQARILLDDGTSNILMRSIGGSSEPVIGLHGGALLGVAYRTSRRISPIAATAISTIQSMPLSGFGSSGLSSFTTFDDGFSSQKSPAEAAPQNFQLYSWETFQPVGGLLPQPEWTAWDQTVEYCAFAYQHYIVISSLCPQYRYLGDVAIPYATGAVWHRRQLFVVTPTTIECVFVDAGVAAIDVETMKMKEEMKLKEVQSRAVAEHGELALIAVESSQTAAQDRIKLRPPMLQVVRLASFqhaasvppfltmpkqtkvegddsmMPKDIEERKVNEIAVGGGGVAVAVTrfpteqkrpigplvvvGVKDGVLWLIDRYMCAHALSLSHPGIRCRCLAAYGDSVSAVKWASRLGREHHDDLAQFMLGMGYATEALHLPGISKRLEFDLAMQSNDLKRALQCLITMSNsrdigqdhpGLDLNDILTLTTKKENIVEAVQGIVKFAKEFLDLIDAADATGQANIAREALKRLAAAGSVKGALQGHELRGLALRLANHGELTRLSGLVTNLISLGLGREAAFSAAILGDNALMEKAWQDTGMLAEAVLHAHAHGRPSLKNLVEAWNKMLQKEVDHTPTAKTDAAAAFLASLEEPKLTSLAEAGKKPPIEILPPGMPSLGSITIQKKPVPGSLNSQQQPGKPLAIEGSQQQPSEQLAVEAPptttpteestpppgegseptsgDKGPIQSSESNSDLAASASVERAPAASitdeaasegpsqvtdpqekpqdpgTPETNVPGTSAAqetnvpatlpaqettvpatlpie

MLRLKAFRPTNDKIVKIQLHPTHPWLVTADASDHVSVWNWEHRQVIYELKAGGVDQRRLVgakleklaegelehkgkPTEAMRGGSVKQVNFYDDDVRFWQLWRNRaaaaeaptaVSNVTSGFASPPPSTKGRHFLVICCVNKAIFLDLVTMRGRDIPKQELDNKSLVCMEFLSRSAVGDVPLVAFGSSDGVIRVLSMISWKLVRRYTGGHKGSISCLMTFMASSGEALLVSGGSDGLLILWSADHGQDSRELVPKLSLKAHDGGVVAVELSRVMGGSPQLITIGADKTLAIWDTVSFKELRRIKPVPKLACHSVASWCHPRAPNLDILTCVKDSHIWAIEHPTYSALTRPLCELSSLVPPQVLAHHKKLRVYCMVAHSLQPHLVATGTNVGVIISEFDPRSLPAVAPLPTPSGSRDHSAVYIVERELKLVNFQLSSAANPSLGNNGSLSETGRLKGDLPDALQIKQIKKHISTPVPHDSYSILSVSSSGKYLAVVWPDIPYFSVYKVSDWSIVDSGSARLLAWDTCRDRFAILESALTPRLPIIPKGGSSRKAKEaaaaaaaaqaaaasaassaTVQARILLDDGTSNILMRSIGGSSEPVIGLHGGALLGVAYRTsrrispiaataistiQSMPlsgfgssglssfttfddgfssQKSPAEAAPQNFQLYSWETFQPVGGLLPQPEWTAWDQTVEYCAFAYQHYIVISSLCPQYRYLGDVAIPYATGAVWHRRQLFVVTPTTIECVFVDAGVAAIDVetmkmkeemklkeVQSRAVAEHGELALIAVESSQTAAQDRIKLRPPMLQVVRLASFQHAASVPPFLTMPKQTKVEGDDSMMPKDIEERKVNEIavggggvavavTRFPTEQKRPIGPLVVVGVKDGVLWLIDRYMCAHALSLSHPGIRCRCLAAYGDSVSAVKWASRLGREHHDDLAQFMLGMGYATEALHLPGISKRLEFDLAMQSNDLKRALQCLITMSNSRDIGQDHPGLDLNDILTLTTKKENIVEAVQGIVKFAKEFLDLIDAADATGQANIAREALKRLAAAGSVKGALQGHELRGLALRLANHGELTRLSGLVTNLISLGLGREAAFSAAILGDNALMEKAWQDTGMLAEAVLHAHAHGRPSLKNLVEAWNKMLQKEVDHtptaktdaaaaflaSLEEPKLTSLAEAGKKPPIEILPPGMPSLGSITIQKKPVPGSLNSQQQPGKPLAIEGSQQQPSEQLAVEApptttpteestpppgegseptsgDKGPIQSSESNSDLaasasverapaasITDEAASEGPSQVTDPQEKPQDPGTPETNVPGTSAAQETNVPATLPAQETTVPATLPIE

**********NDKIVKIQLHPTHPWLVTADASDHVSVWNWEHRQVIYELKAGGVDQRRLVGAKL**********************VKQVNFYDDDVRFWQLWRNRAAAA*********************GRHFLVICCVNKAIFLDLVTMRGRDIPKQELDNKSLVCMEFLSRSAVGDVPLVAFGSSDGVIRVLSMISWKLVRRYTGGHKGSISCLMTFMASSGEALLVSGGSDGLLILWSADHGQDSRELVPKLSLKAHDGGVVAVELSRVMGGSPQLITIGADKTLAIWDTVSFKELRRIKPVPKLACHSVASWCHPRAPNLDILTCVKDSHIWAIEHPTYSALTRPLCELSSLVPPQVLAHHKKLRVYCMVAHSLQPHLVATGTNVGVIISEFDP*******************AVYIVERELKLVNFQL*****************************IKQIKKHISTPVPHDSYSILSVSSSGKYLAVVWPDIPYFSVYKVSDWSIVDSGSARLLAWDTCRDRFAILESALTPRLPII********************************QARILLDDGTSNILMRSIGGSSEPVIGLHGGALLGVAYRTSRRISPIAATAISTIQS*********************************NFQLYSWETFQPVGGLLPQPEWTAWDQTVEYCAFAYQHYIVISSLCPQYRYLGDVAIPYATGAVWHRRQLFVVTPTTIECVFVDAGVAAIDVETM******************HGELALIAV**********IKLRPPMLQVVRLASFQHAA*****************************VNEIAVGGGGVAVAVTRFPTEQKRPIGPLVVVGVKDGVLWLIDRYMCAHALSLSHPGIRCRCLAAYGDSVSAVKWASRLGREHHDDLAQFMLGMGYATEALHLPGISKRLEFDLAMQSNDLKRALQCLITMSNSRDIGQDHPGLDLNDILTLTTKKENIVEAVQGIVKFAKEFLDLIDAADATGQANIAREALKRLAAAGSVKGALQGHELRGLALRLANHGELTRLSGLVTNLISLGLGREAAFSAAILGDNALMEKAWQDTGMLAEAVLHAHAHGRPSLKNLVEAWNKMLQ******************************************************************************************************************************************************************************************************

MLRLKAFRPTNDKIVKIQLHPTHPWLVTADASDHVSVWNWEHRQVIYELKAGGVDQRRLVGAKLEKLAEGELEHKGKPTEAMRGGSVKQVNFYDDDVRFWQLWRNRAAAAEAPTAVSNVTSGFASPPPSTKGRHFLVICCVNKAIFLDLVTMRGRDIPKQELDNKSLVCMEFLSRSAVGDVPLVAFGSSDGVIRVLSMISWKLVRRYTGGHKGSISCLMTFMASSGEALLVSGGSDGLLILWSADHGQDSRELVPKLSLKAHDGGVVAVELSRVMGGSPQLITIGADKTLAIWDTVSFKELRRIKPVPKLACHSVASWCHPRAPNLDILTCVKDSHIWAIEHPTYSALTRPLCELSSL*******HHKKLRVYCMVAHSLQPHLVATGTNVGVIISEFDPRSLPAVAPLP*P*GSRDHSAVYIVERELKLVNFQLSSAANPSLGNNGSLSETG*LKGDLPDALQIKQIKKHISTPVPHDSYSILSVSSSGKYLAVVWPDIPYFSVYKVSDWSIVDSGSARLLAWDTCRDRFAILESALTP***********************AQ**AASAASSATVQARILLDDGTSNILMRSIGGSSEPVIGLHGGALLGVAYRTSRRISP**********************************************QLYSWETFQPVGGLLPQPEWTAWDQTVEYCAFAYQHYIVISSLCPQYRYLGDVAIPYATGAVWHRRQLFVVTPTTIECVFVDAGVAAIDVE*********************GELALIAVE**************PMLQVVRLASFQHAASVPPFLTMPKQTKVEGDDSMMPKDIEERKVNEIAVGGGGVAVAVTRFPTEQKRPIGPLVVVGVKDGVLWLIDRYMCAHALSLSHPGIRCRCLAAYGDSVSAVKWASRLGREHHDDLAQFMLGMGYATEALHLPGISKRLEFDLAMQSNDLKRALQCLITMSNSRD******GLDLNDILTLTTKKENIVEAVQGIVKFAKEFLDLIDAADATGQANIAREALKRLAAAGSVKGALQGHELRGLALRLANHGELTRLSGLVTNLISLGLGREAAFSAAILGDNALMEKAWQDTGMLAEAVLHAHA**********EA************************************************************************************************************************************************************************************************************

MLRLKAFRPTNDKIVKIQLHPTHPWLVTADASDHVSVWNWEHRQVIYELKAGGVDQRRLVGAKLEKLAEGELEHKGKPTEAMRGGSVKQVNFYDDDVRFWQLWRNRAAAAEAPTAVS*************KGRHFLVICCVNKAIFLDLVTMRGRDIPKQELDNKSLVCMEFLSRSAVGDVPLVAFGSSDGVIRVLSMISWKLVRRYTGGHKGSISCLMTFMASSGEALLVSGGSDGLLILWSADHGQDSRELVPKLSLKAHDGGVVAVELSRVMGGSPQLITIGADKTLAIWDTVSFKELRRIKPVPKLACHSVASWCHPRAPNLDILTCVKDSHIWAIEHPTYSALTRPLCELSSLVPPQVLAHHKKLRVYCMVAHSLQPHLVATGTNVGVIISEFDPRSLPAVAPLPTPSGSRDHSAVYIVERELKLVNFQLSSAANPSLGNNGSLSETGRLKGDLPDALQIKQIKKHISTPVPHDSYSILSVSSSGKYLAVVWPDIPYFSVYKVSDWSIVDSGSARLLAWDTCRDRFAILESALTPRLPIIPKG****************************VQARILLDDGTSNILMRSIGGSSEPVIGLHGGALLGVAYRTSRRISPIAATAISTIQSMPLSGFGSSGLSSFTTFDD***********APQNFQLYSWETFQPVGGLLPQPEWTAWDQTVEYCAFAYQHYIVISSLCPQYRYLGDVAIPYATGAVWHRRQLFVVTPTTIECVFVDAGVAAIDVETMKMKEEMKLKEVQSRAVAEHGELALIAVESSQTAAQDRIKLRPPMLQVVRLASFQHAASVPPFLTMPKQTKVEGDDSMMPKDIEERKVNEIAVGGGGVAVAVTRFPTEQKRPIGPLVVVGVKDGVLWLIDRYMCAHALSLSHPGIRCRCLAAYGDSVSAVKWASRLGREHHDDLAQFMLGMGYATEALHLPGISKRLEFDLAMQSNDLKRALQCLITMSNSRDIGQDHPGLDLNDILTLTTKKENIVEAVQGIVKFAKEFLDLIDAADATGQANIAREALKRLAAAGSVKGALQGHELRGLALRLANHGELTRLSGLVTNLISLGLGREAAFSAAILGDNALMEKAWQDTGMLAEAVLHAHAHGRPSLKNLVEAWNKMLQKEVDHTPTAKTDAAAAFLASLEEPKLTSLAEAGKKPPIEILPPGMPSLGSITIQKKP***********************************************************************************************************************ETNVPATLPAQETTVPATLPIE

MLRLKAFRPTNDKIVKIQLHPTHPWLVTADASDHVSVWNWEHRQVIYELKAGGVDQRRLVGAKLEKLAEGE*******T***RGGSVKQVNFYDDDVRFWQLWRNRAAAAE*****************STKGRHFLVICCVNKAIFLDLVTMRGRDIPKQELDNKSLVCMEFLSRSAVGDVPLVAFGSSDGVIRVLSMISWKLVRRYTGGHKGSISCLMTFMASSGEALLVSGGSDGLLILWSADHGQDSRELVPKLSLKAHDGGVVAVELSRVMGGSPQLITIGADKTLAIWDTVSFKELRRIKPVPKLACHSVASWCHPRAPNLDILTCVKDSHIWAIEHPTYSALTRPLCELSSLVPPQVLAHHKKLRVYCMVAHSLQPHLVATGTNVGVIISEFDPRSLPAVAPLPTPSGSRDHSAVYIVERELKLVNFQLSSAANPSLGNNGSLSET*RLKGDLPDALQIKQIKKHISTPVPHDSYSILSVSSSGKYLAVVWPDIPYFSVYKVSDWSIVDSGSARLLAWDTCRDRFAILESALTPRLPIIPKG************************SSATVQARILLDDGTSNILMRSIGGSSEPVIGLHGGALLGVAYRTSRRISPIAATAISTIQ*********************FSS*******APQNFQLYSWETFQPVGGLLPQPEWTAWDQTVEYCAFAYQHYIVISSLCPQYRYLGDVAIPYATGAVWHRRQLFVVTPTTIECVFVDAGVAAIDVETMKMKEEMK**********EHGELALIAVESSQTAAQDRIKLRPPMLQVVRLASFQHAASVPPFLTMPKQ******DSMMPKDIEERKVNEIAVGGGGVAVAVTRFPTEQKRPIGPLVVVGVKDGVLWLIDRYMCAHALSLSHPGIRCRCLAAYGDSVSAVKWASRLGREHHDDLAQFMLGMGYATEALHLPGISKRLEFDLAMQSNDLKRALQCLITMSNSRDIGQDHPGLDLNDILTLTTKKENIVEAVQGIVKFAKEFLDLIDAADATGQANIAREALKRLAAAGSVKGALQGHELRGLALRLANHGELTRLSGLVTNLISLGLGREAAFSAAILGDNALMEKAWQDTGMLAEAVLHAHAHGRPSLKNLVEAWNKMLQKEV***************************************************************************************************************************************************************************************************

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		1339	2.2.26 [Sep-21-2011]
Q8C092		801	Transcription initiation	yes	no	0.077	0.129	0.341	2e-05
Q15542		800	Transcription initiation	yes	no	0.077	0.13	0.333	4e-05
Q54S79		942	WD repeat-containing prot	no	no	0.091	0.130	0.319	0.0001
Q68FJ6		363	p21-activated protein kin	N/A	no	0.073	0.272	0.321	0.0002
Q9NWT1		392	p21-activated protein kin	no	no	0.074	0.255	0.298	0.0005
Q5BDJ5		446	Probable cytosolic iron-s	no	no	0.051	0.154	0.366	0.0005
Q6TNS2		368	p21-activated protein kin	no	no	0.074	0.271	0.298	0.0006
Q922V4		513	Pleiotropic regulator 1 O	no	no	0.117	0.307	0.283	0.0006

>sp\|Q8C092\|TAF5_MOUSE Transcription initiation factor TFIID subunit 5 OS=Mus musculus GN=Taf5 PE=2 SV=1	Back alignment and function desciption

 Score = 52.8 bits (125), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 41/120 (34%), Positives = 63/120 (52%), Gaps = 16/120 (13%)

Query: 184 VAFGSSDGVIRVLSMISWKLVRRYTGGHKGSISCLMTFMASSGEALLVSGGSDGLLILWS 243
           VA GS+D  +R+  +++   VR +TG HKG I  L TF  S     L +G +DG ++LW 
Sbjct: 643 VATGSADRTVRLWDVLNGNCVRIFTG-HKGPIHSL-TF--SPNGRFLATGATDGRVLLWD 698

Query: 244 ADHGQDSRELVPKLSLKAHDGGVVAVELSRVMGGSPQLITIGA-DKTLAIWDTV-SFKEL 301
             HG    E      LK H   V ++  SR      +++  G+ D T+ +WD V +F++L
Sbjct: 699 IGHGLMVGE------LKGHTDTVCSLRFSR----DGEILASGSMDNTVRLWDAVKAFEDL 748

TAFs are components of the transcription factor IID (TFIID) complex, PCAF histone acetylase complex and TBP-free TAFII complex (TFTC). TAFs components-TIIFD are essential for mediating regulation of RNA polymerase transcription. TAF5/TAFII100 interacts strongly with the histone H4-related TAF6/TAFII80 and the histone H3-related TAF9/TAFII31, as well as a stable complex comprised of both TAF5/TAFII80 and TAF6/TAFII31. Apparently weaker interactions of TAF5/TAFII100 with TBP, TAF1/TAFII250, TAF11/TAFII28, and TAF12/TAFII20, but not TAF7/TAFII55, also have been observed.
Mus musculus (taxid: 10090)

>sp\|Q15542\|TAF5_HUMAN Transcription initiation factor TFIID subunit 5 OS=Homo sapiens GN=TAF5 PE=1 SV=3	Back alignment and function description

>sp\|Q54S79\|WDR3_DICDI WD repeat-containing protein 3 homolog OS=Dictyostelium discoideum GN=wdr3 PE=3 SV=1	Back alignment and function description

>sp\|Q68FJ6\|PK1IP_XENLA p21-activated protein kinase-interacting protein 1-like OS=Xenopus laevis GN=pak1ip1 PE=2 SV=1	Back alignment and function description

>sp\|Q9NWT1\|PK1IP_HUMAN p21-activated protein kinase-interacting protein 1 OS=Homo sapiens GN=PAK1IP1 PE=1 SV=2	Back alignment and function description

>sp\|Q5BDJ5\|CIAO1_EMENI Probable cytosolic iron-sulfur protein assembly protein 1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=cia1 PE=3 SV=2	Back alignment and function description

>sp\|Q6TNS2\|PK1IP_DANRE p21-activated protein kinase-interacting protein 1-like OS=Danio rerio GN=pak1ip1 PE=2 SV=1	Back alignment and function description

>sp\|Q922V4\|PLRG1_MOUSE Pleiotropic regulator 1 OS=Mus musculus GN=Plrg1 PE=2 SV=1	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		1339
225439033		1296	PREDICTED: uncharacterized protein LOC10	0.961	0.993	0.844	0.0
449463194		1343	PREDICTED: uncharacterized protein LOC10	0.964	0.961	0.797	0.0
296085801		1340	unnamed protein product [Vitis vinifera]	0.957	0.956	0.845	0.0
255560317		1330	conserved hypothetical protein [Ricinus	0.964	0.971	0.827	0.0
145358405		1377	transducin/WD40 domain-containing protei	0.975	0.948	0.786	0.0
110740051		1377	hypothetical protein [Arabidopsis thalia	0.975	0.948	0.785	0.0
297812667		1376	hypothetical protein ARALYDRAFT_489332 [	0.968	0.942	0.788	0.0
356505707		1352	PREDICTED: uncharacterized protein LOC10	0.963	0.954	0.800	0.0
110741255		1161	hypothetical protein [Arabidopsis thalia	0.865	0.998	0.843	0.0
115438929		1377	Os01g0653800 [Oryza sativa Japonica Grou	0.966	0.939	0.743	0.0

>gi\|225439033\|ref\|XP_002263744.1\| PREDICTED: uncharacterized protein LOC100248418 [Vitis vinifera]	Back alignment and taxonomy information

 Score = 2118 bits (5488), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1110/1315 (84%), Positives = 1198/1315 (91%), Gaps = 28/1315 (2%)

Query: 1    MLRLKAFRPTNDKIVKIQLHPTHPWLVTADASDHVSVWNWEHRQVIYELKAGGVDQRRLV 60
            MLRL+ FRPTNDKIVKIQLHPTHPWLVTADASDHVSVWNWEHRQVIYELKAGG+D+RRLV
Sbjct: 1    MLRLRTFRPTNDKIVKIQLHPTHPWLVTADASDHVSVWNWEHRQVIYELKAGGIDERRLV 60

Query: 61   GAKLEKLAEGELEHKGKPTEAMRGGSVKQVNFYDDDVRFWQLWRNRAAAAEAPTAVSNVT 120
            GAKLEKLAEGE E KGKPTEAMRGGSVKQV+FYDDDVRFWQLWRNR+AAAEAP+AV++VT
Sbjct: 61   GAKLEKLAEGESEPKGKPTEAMRGGSVKQVDFYDDDVRFWQLWRNRSAAAEAPSAVNHVT 120

Query: 121  SGFASPPPSTKGRHFLVICCVNKAIFLDLVTMRGRDIPKQELDNKSLVCMEFLSRSAVGD 180
            S F+SP PSTKGRHFLVICC NKAIFLDLVTMRGRD+PKQELDNKSL+CMEFLSRSA GD
Sbjct: 121  SAFSSPAPSTKGRHFLVICCENKAIFLDLVTMRGRDVPKQELDNKSLLCMEFLSRSAGGD 180

Query: 181  VPLVAFGSSDGVIRVLSMISWKLVRRYTGGHKGSISCLMTFMASSGEALLVSGGSDGLLI 240
             PLVAFG SDGVIRVLSMI+WKLVRRYTGGHKGSISCLMTFMASSGEALL+SG SDGLLI
Sbjct: 181  APLVAFGGSDGVIRVLSMITWKLVRRYTGGHKGSISCLMTFMASSGEALLISGASDGLLI 240

Query: 241  LWSADHGQDSRELVPKLSLKAHDGGVVAVELSRVMGGSPQLITIGADKTLAIWDTVSFKE 300
            LWSADHGQDSRELVPKLSLKAHDGGVVAVELSRV+GG+PQLITIGADKTLAIWDT+SFKE
Sbjct: 241  LWSADHGQDSRELVPKLSLKAHDGGVVAVELSRVIGGAPQLITIGADKTLAIWDTISFKE 300

Query: 301  LRRIKPVPKLACHSVASWCHPRAPNLDILTCVKDSHIWAIEHPTYSALTRPLCELSSLVP 360
            LRRIKPVPKLACHSVASWCHPRAPNLDILTCVKDSHIWAIEHPTYSALTRPLCELSSLVP
Sbjct: 301  LRRIKPVPKLACHSVASWCHPRAPNLDILTCVKDSHIWAIEHPTYSALTRPLCELSSLVP 360

Query: 361  PQVLAHHKKLRVYCMVAHSLQPHLVATGTNVGVIISEFDPRSLPAVAPLPTPSGSRDHSA 420
            PQVLA +KKLRVYCMVAH LQPHLVATGTN+GVI+SEFD RSLPAVA LPTP GSR+HSA
Sbjct: 361  PQVLAPNKKLRVYCMVAHPLQPHLVATGTNIGVIVSEFDARSLPAVAALPTPVGSREHSA 420

Query: 421  VYIVERELKLVNFQLSSAANPSLGNNGSLSETGRLKGDLPDALQIKQIKKHISTPVPHDS 480
            VY+VERELKL+NFQLSS ANPSLG+NGSLSETGR +GD  + L +KQIKKHISTPVPHDS
Sbjct: 421  VYVVERELKLLNFQLSSTANPSLGSNGSLSETGRFRGDSLEPLHVKQIKKHISTPVPHDS 480

Query: 481  YSILSVSSSGKYLAVVWPDIPYFSVYKVSDWSIVDSGSARLLAWDTCRDRFAILESALTP 540
            YS+LS+SSSGKYLA+VWPDIPYFS+YKVSDWSIVDSGSARLLAWDTCRDRFA+LES+L P
Sbjct: 481  YSVLSISSSGKYLAIVWPDIPYFSIYKVSDWSIVDSGSARLLAWDTCRDRFALLESSLPP 540

Query: 541  RLPIIPKGGSSRKAKEAAAAAAAAQAAAASAASSATVQARILLDDGTSNILMRSIGGSSE 600
            R+PIIPKGGS RKAKEAAAAAA A AAAASAAS+ATVQ RILLDDGTSN+ MRSIGG S+
Sbjct: 541  RIPIIPKGGS-RKAKEAAAAAAQAAAAAASAASTATVQLRILLDDGTSNVYMRSIGGRSD 599

Query: 601  PVIGLHGGALLGVAYRTSRRISPIAATAISTIQSMPLSGFGSSGLSSFTTFDDGFSSQKS 660
            PVIGLHGGALLGVAYRTSRRISP+AATAISTIQSMPLSGFGSSGLSSFTT DDGFSS KS
Sbjct: 600  PVIGLHGGALLGVAYRTSRRISPVAATAISTIQSMPLSGFGSSGLSSFTTLDDGFSSHKS 659

Query: 661  PAEAAPQNFQLYSWETFQPVGGLLPQPEWTAWDQTVEYCAFAYQHYIVISSLCPQYRYLG 720
            P EAAPQNFQLYSWETF+PVGGLLPQPEWTAWDQTVEYCAF YQ YIVISSL PQYRYLG
Sbjct: 660  PTEAAPQNFQLYSWETFEPVGGLLPQPEWTAWDQTVEYCAFGYQQYIVISSLRPQYRYLG 719

Query: 721  DVAIPYATGAVWHRRQLFVVTPTTIECVFVDAGVAAIDVETMKMKEEMKLKEVQSRAVAE 780
            DVAIPYATGAVWHRRQLFV TPTTIECVFVDAGVA ID+ET KMKEEMK KE ++RAVAE
Sbjct: 720  DVAIPYATGAVWHRRQLFVATPTTIECVFVDAGVAPIDIETRKMKEEMKSKEARARAVAE 779

Query: 781  HGELALIAVESSQTAAQDRIKLRPPMLQVVRLASFQHAASVPPFLTMPKQTKVEGDDSMM 840
            HGELALI V+  QT A +RI LRPPMLQVVRLASFQH  SVPPFLT+PKQ+KV+GDDS++
Sbjct: 780  HGELALITVDGPQTVANERIALRPPMLQVVRLASFQHPPSVPPFLTLPKQSKVDGDDSVL 839

Query: 841  PKDIEERKVNEIAVGGGGVAVAVTRFPTEQKRPIGPLVVVGVKDGVLWLIDRYMCAHALS 900
             K++EERK NEIAVGGGGV+VAVTRFPTEQ+RP+GPLVVVGV+DGVLWLIDRYMCAHALS
Sbjct: 840  QKEMEERKTNEIAVGGGGVSVAVTRFPTEQRRPVGPLVVVGVRDGVLWLIDRYMCAHALS 899

Query: 901  LSHPGIRCRCLAAYGDSVSAVKWASRLGREHHDDLAQFMLGMGYATEALHLPGISKRLEF 960
            LSHPGIRCRCLAAYGD+VSAVKWASRL REHHDDLAQFMLGMGYATEALHLPGISKRLEF
Sbjct: 900  LSHPGIRCRCLAAYGDAVSAVKWASRLAREHHDDLAQFMLGMGYATEALHLPGISKRLEF 959

Query: 961  DLAMQSNDLKRALQCLITMSNSRDIGQDHPGLDLNDILTLTTKKENIVEAVQGIVKFAKE 1020
            DLAMQSNDLKRALQCL+TMSNSRDIGQ++ GL LNDIL+LTTKKENI++AVQGIVKFAKE
Sbjct: 960  DLAMQSNDLKRALQCLLTMSNSRDIGQENTGLSLNDILSLTTKKENILDAVQGIVKFAKE 1019

Query: 1021 FLDLIDAADATGQANIAREALKRLAAAGSVKGALQGHELRGLALRLANHGELTRLSGLVT 1080
            FLDLIDAADAT QA+IAREALKRLAAAGS+KGALQGHELRGLALRLANHGELT+LSGLV 
Sbjct: 1020 FLDLIDAADATAQADIAREALKRLAAAGSMKGALQGHELRGLALRLANHGELTQLSGLVN 1079

Query: 1081 NLISLGLGREAAFSAAILGDNALMEKAWQDTGMLAEAVLHAHAHGRPSLKNLVEAWNKML 1140
            NLIS+GLGREAAF+AA+LGDNALMEKAWQDTGMLAEAVLHAHAHGRP+LKNLV+AWNKML
Sbjct: 1080 NLISVGLGREAAFAAAVLGDNALMEKAWQDTGMLAEAVLHAHAHGRPTLKNLVQAWNKML 1139

Query: 1141 QKEVDHTPTAKTDAAAAFLASLEEPKLTSLAEAGKKPPIEILPPGMPSLGS-ITIQKKPV 1199
            QKE++HTP+ KTDAAAAFLASLEEPKLTSLAEAGKKPPIEILPPGM SL + I++QKKPV
Sbjct: 1140 QKEIEHTPSTKTDAAAAFLASLEEPKLTSLAEAGKKPPIEILPPGMLSLSAPISVQKKPV 1199

Query: 1200 PGSLNSQQQPGKPLAIEGSQQQPSEQLAVEAPPTTTPTEESTPPPGEGSEPTSGDKGPIQ 1259
            P             AI+GSQQQP + L +EAPPTTT    S P P E SE T+ D  P  
Sbjct: 1200 P-------------AIQGSQQQPGKPLLLEAPPTTTSV--SAPTPSESSEATAEDNNP-- 1242

Query: 1260 SSESNSDLAASASVERAPAASITDEAASEGPSQVTDPQEKPQDPGTPETNVPGTS 1314
             S S +D      V  AP    T  A++ GP     P++ P++P   E +VP T+
Sbjct: 1243 -SSSVTD-PGPDPVALAP----TVPASTSGP---VLPEDAPKEPDIQEMSVPATT 1288

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|449463194\|ref\|XP_004149319.1\| PREDICTED: uncharacterized protein LOC101213309 [Cucumis sativus]	Back alignment and taxonomy information

>gi\|296085801\|emb\|CBI31125.3\| unnamed protein product [Vitis vinifera]	Back alignment and taxonomy information

>gi\|255560317\|ref\|XP_002521175.1\| conserved hypothetical protein [Ricinus communis] gi\|223539622\|gb\|EEF41206.1\| conserved hypothetical protein [Ricinus communis]	Back alignment and taxonomy information

>gi\|145358405\|ref\|NP_197859.4\| transducin/WD40 domain-containing protein [Arabidopsis thaliana] gi\|332005968\|gb\|AED93351.1\| transducin/WD40 domain-containing protein [Arabidopsis thaliana]	Back alignment and taxonomy information

>gi\|110740051\|dbj\|BAF01929.1\| hypothetical protein [Arabidopsis thaliana]	Back alignment and taxonomy information

>gi\|297812667\|ref\|XP_002874217.1\| hypothetical protein ARALYDRAFT_489332 [Arabidopsis lyrata subsp. lyrata] gi\|297320054\|gb\|EFH50476.1\| hypothetical protein ARALYDRAFT_489332 [Arabidopsis lyrata subsp. lyrata]	Back alignment and taxonomy information

>gi\|356505707\|ref\|XP_003521631.1\| PREDICTED: uncharacterized protein LOC100777567 [Glycine max]	Back alignment and taxonomy information

>gi\|110741255\|dbj\|BAF02178.1\| hypothetical protein [Arabidopsis thaliana]	Back alignment and taxonomy information

>gi\|115438929\|ref\|NP_001043744.1\| Os01g0653800 [Oryza sativa Japonica Group] gi\|55296497\|dbj\|BAD68693.1\| WD-40 repeat family protein-like [Oryza sativa Japonica Group] gi\|113533275\|dbj\|BAF05658.1\| Os01g0653800 [Oryza sativa Japonica Group] gi\|218188769\|gb\|EEC71196.1\| hypothetical protein OsI_03104 [Oryza sativa Indica Group]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		1339
TAIR\|locus:2176836		1377	AT5G24710 "AT5G24710" [Arabido	0.985	0.958	0.702	0.0
POMBASE\|SPBC16C6.13c		796	sec27 "coatomer beta' subunit	0.076	0.129	0.298	2.6e-06
FB\|FBgn0025724		914	beta'Cop "beta'-coatomer prote	0.081	0.119	0.282	4.2e-06
UNIPROTKB\|F1S845		542	TAF5 "Uncharacterized protein"	0.077	0.191	0.341	3.9e-05
ASPGD\|ASPL0000006005		853	AN5972 [Emericella nidulans (t	0.029	0.045	0.365	4e-05
UNIPROTKB\|I3LC69		647	WDR81 "Uncharacterized protein	0.073	0.151	0.293	0.00012
ZFIN\|ZDB-GENE-051120-180		756	taf5 "TAF5 RNA polymerase II,	0.073	0.130	0.350	0.00028
SGD\|S000003105		889	SEC27 "Essential beta'-coat pr	0.027	0.041	0.405	0.00048
TAIR\|locus:2012971		407	AT1G71840 "AT1G71840" [Arabido	0.086	0.285	0.272	0.00064
UNIPROTKB\|E1BVN5		516	PLRG1 "Uncharacterized protein	0.131	0.341	0.273	0.00093

TAIR\|locus:2176836 AT5G24710 "AT5G24710" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 4794 (1692.6 bits), Expect = 0., Sum P(2) = 0.
 Identities = 943/1343 (70%), Positives = 1044/1343 (77%)

Query:     1 MLRLKAFRPTNDKIVKIQLHPTHPWLVTADASDHVSVWNWEHRQVIYELKAGGVDQRRLV 60
             MLR +AFR TN KIVKIQ+HPTHPWLVTAD SDHVSVWNWEHRQVIYELKAGGVD+RRLV
Sbjct:     1 MLRARAFRQTNGKIVKIQVHPTHPWLVTADDSDHVSVWNWEHRQVIYELKAGGVDERRLV 60

Query:    61 XXXXXXXXXXXXXXXXXPTEAMRGGSVKQVNFYDDDVRFWQLWRNRXXXXXXXXXVSNVT 120
                              PTEA+RGGSVKQV FYDDDVR+WQLWRNR         V+++T
Sbjct:    61 GAKLEKLAEGESDYKAKPTEAIRGGSVKQVKFYDDDVRYWQLWRNRSAAAESPSAVNHLT 120

Query:   121 SGFASPPPSTKGRHFLVICCVNKAIFLDLVTMRGRDIPKQELDNKSLVCMEFLSRSAVGD 180
             S F SP PSTKGRHFLVICC NKAIFLDLVTMRGRD+PKQELDNKSL+CMEFLSRS+ GD
Sbjct:   121 SAFTSPAPSTKGRHFLVICCENKAIFLDLVTMRGRDVPKQELDNKSLLCMEFLSRSSGGD 180

Query:   181 VPLVAFGSSDGVIRVLSMISWKLVRRYTGGHKGSISCLMTFMASSGEALLVSGGSDGLLI 240
              PLVAFGS+DGVIRVLSMI+WKL RRYTGGHKGSI CLM FMASSGEALLVSGGSDGLL+
Sbjct:   181 GPLVAFGSTDGVIRVLSMITWKLARRYTGGHKGSIYCLMNFMASSGEALLVSGGSDGLLV 240

Query:   241 LWSADHGQDSRELVPKLSLKAHDGGVVAVELSRVMGGSPQLITIGADKTLAIWDTVSFKE 300
             LWSADHG DSRELVPKLSLKAHDGGVVAVELSRV G +PQLITIGADKTLAIWDT++FKE
Sbjct:   241 LWSADHGADSRELVPKLSLKAHDGGVVAVELSRVSGSAPQLITIGADKTLAIWDTMTFKE 300

Query:   301 LRRIKPVPKLACHSVASWCHPRAPNLDILTCVKDSHIWAIEHPTYSALTRPLCELSSLVP 360
             LRRIKPVPKLACHSVASWCHPRAPNLDILTCVKDSHIW+IEHPTYSALTRPLCELSSLVP
Sbjct:   301 LRRIKPVPKLACHSVASWCHPRAPNLDILTCVKDSHIWSIEHPTYSALTRPLCELSSLVP 360

Query:   361 PQVLAHHKKLRVYCMVAHSLQPHLVATGTNVGVIISEFDPRSLPAVAPLPTPSGSRDHSA 420
             PQVLA H+KLRVYCMVAH LQPHLVATGTNVG+I+SEFDPR++P+ APLP   GSR++SA
Sbjct:   361 PQVLATHRKLRVYCMVAHPLQPHLVATGTNVGIIVSEFDPRAIPSAAPLPALPGSRENSA 420

Query:   421 VYIVERELKLVNFQLSSAANPSLGNNGSLSETGRLKGDLPDALQIKQIKKHISTPVPHDS 480
             +YI+ RELKL+NFQLS+ ANPSLGNN +LSE+G  KGD  + L +KQ KK I  PVPHDS
Sbjct:   421 IYILGRELKLLNFQLSNTANPSLGNNSALSESGLSKGDPGEQLTVKQTKKQIVAPVPHDS 480

Query:   481 YSILSVSSSGKYLAVVWPDIPYFSVYKVSDWSIVDSGSARLLAWDTCRDRFAILESALTP 540
             YS+LSVSSSGKY+AVVWPDI YFS+YKVSDWSIVDSGSARLLAWDTCRDRFAILES L  
Sbjct:   481 YSVLSVSSSGKYVAVVWPDILYFSIYKVSDWSIVDSGSARLLAWDTCRDRFAILESVLPH 540

Query:   541 RLPIIPKGGSSRKAKEXXXXXXXXXXXXXXXXXXXTVQARILLDDGTSNILMRSIGGSSE 600
             R+PIIPKGGSSRKAKE                   +VQ RILLDDGTSNILMRS+GG SE
Sbjct:   541 RMPIIPKGGSSRKAKEAAAAAAQAAAAASAASSA-SVQVRILLDDGTSNILMRSVGGRSE 599

Query:   601 PVIGLHGGALLGVAYRTXXXXXXXXXXXXXXXQSMPXXXXXXXXXXXXXXXXXXXXXQKS 660
             PVIGLHGGALLG+ YRT               QSMP                     QKS
Sbjct:   600 PVIGLHGGALLGIGYRTSRRISPVAATAISTIQSMPLSGFGNSNVSSFSSYDDGFSSQKS 659

Query:   661 PAEAAPQNFQLYSWETFQPVGGLLPQPEWTAWDQTVEYCAFAYQHYIVISSLCPQYRYLG 720
              AE+AP N+QLYSWE F+PVGG+LPQPEWTAWDQTVEYCAFAYQ Y+VISSL PQYRYLG
Sbjct:   660 -AESAPLNYQLYSWENFEPVGGMLPQPEWTAWDQTVEYCAFAYQQYMVISSLRPQYRYLG 718

Query:   721 DVAIPYATGAVWHRRQLFVVTPTTIECVFVDAGVAAIDVXXXXXXXXXXXXXVQSRAVAE 780
             DVAI +ATGAVWHRRQLFV TPTTIECVFVDAGV+ ID+              Q+RAVAE
Sbjct:   719 DVAIAHATGAVWHRRQLFVATPTTIECVFVDAGVSEIDIETRKMKEEMKLKEAQARAVAE 778

Query:   781 HGELALIAVESSQTAAQDRIKLRPPMLQVVRLASFQHAASVPPFLTMPKQTKVEGDDSMM 840
             HGELALI VE SQ A Q+RI LRPPMLQVVRLASFQ+A SVPPFL++P+Q++ + DD M 
Sbjct:   779 HGELALITVEGSQAAKQERISLRPPMLQVVRLASFQNAPSVPPFLSLPRQSRGDSDDIM- 837

Query:   841 PKDIEERKVNEIXXXXXXXXXXXTRFPTEQKRPIGPLVVVGVKDGVLWLIDRYMCAHALS 900
                 +ER+VNE+           TRFP EQKRP+GPLVV GV+DGVLWLIDRYMCAHA+S
Sbjct:   838 ----DERRVNEVAVGGGGVSVAVTRFPVEQKRPVGPLVVAGVRDGVLWLIDRYMCAHAIS 893

Query:   901 LSHPGIRCRCLAAYGDSVSAVKWASRLGREHHDDLAQFMLGMGYATEALHLPGISKRLEF 960
             L+HPGIRCRCLAAYGD+VSAVKWASRLGREHHDDLAQFMLGMGYATEALHLPGISKRLEF
Sbjct:   894 LNHPGIRCRCLAAYGDAVSAVKWASRLGREHHDDLAQFMLGMGYATEALHLPGISKRLEF 953

Query:   961 DLAMQSNDLKRALQCLITMSNSRDIGQDHPGLDLNDILTLT-TKKENIVEAVQGIVKFAK 1019
             DLAMQSNDLKRAL CL+TMSNS+DIGQD  GLDL+DIL+LT TKKE++VEAV+GIVKFAK
Sbjct:   954 DLAMQSNDLKRALHCLLTMSNSKDIGQDGVGLDLSDILSLTATKKEDVVEAVEGIVKFAK 1013

Query:  1020 EFLDLIDAADATGQANIAREALKRLAAAGSVKGALQGHELRGLALRLANHGELTRLSGLV 1079
             EFLDLIDAADATG A+IAREALKRLA AGSVKGALQGHELRGL+LRLANHGELTRLSGLV
Sbjct:  1014 EFLDLIDAADATGHADIAREALKRLATAGSVKGALQGHELRGLSLRLANHGELTRLSGLV 1073

Query:  1080 TNLISLGLGREAAFSAAILGDNALMEKAWQDTGMLAEAVLHAHAHGRPSLKNLVEAWNKM 1139
              NLIS+GLGRE+AFSAA+LGDNALMEKAWQDTGMLAEAVLHAHAHGRP+LKNLV+AWNK 
Sbjct:  1074 NNLISIGLGRESAFSAAVLGDNALMEKAWQDTGMLAEAVLHAHAHGRPTLKNLVQAWNKT 1133

Query:  1140 LQKEVDHXXXXXXXXXXXXXXSLEEPKLTSLAEAGKKPPIEILPPGMPSL-GSITIQKKP 1198
             LQKEV+               SLE+PKLTSL++A +KPPIEILPPGM S+  SIT  KKP
Sbjct:  1134 LQKEVEKAPSSKTDAASAFLASLEDPKLTSLSDASRKPPIEILPPGMSSIFASITAPKKP 1193

Query:  1199 VPGSLNSQQQPGKPLAIEGSQQQPSEQLAVEAXXXXXXXXXXXXXXXXXXXXXXX-DKGP 1257
             +     +Q +  KPLA+E    +P++ LA+EA                        +   
Sbjct:  1194 LLTQKTAQPEVAKPLALE----EPTKPLAIEAPPSSEAPQTESAPETAAAAESPAPETAA 1249

Query:  1258 IQSSESNSDLXXXXXXXXXXXXXITD----EAASEGP---SQVTDPQEKPQDPGTPETNV 1310
             +  S +                   D    E  SE P    + T  +EK     TP T  
Sbjct:  1250 VAESPAPGTAAVAEAPASETAAAPVDGPVTETVSEPPPVEKEETSLEEKSDPSSTPNTET 1309

Query:  1311 PGTSAAQETNVPATLPAQETTVP 1333
               TS  + T+   T P   TT P
Sbjct:  1310 -ATST-ENTSQTTTTPESVTTAP 1330

GO:0003674 "molecular_function" evidence=ND

GO:0005737 "cytoplasm" evidence=ISM

GO:0008150 "biological_process" evidence=ND

GO:0005886 "plasma membrane" evidence=IDA

GO:0005829 "cytosol" evidence=RCA

POMBASE\|SPBC16C6.13c sec27 "coatomer beta' subunit (predicted)" [Schizosaccharomyces pombe (taxid:4896)]	Back alignment and assigned GO terms

FB\|FBgn0025724 beta'Cop "beta'-coatomer protein" [Drosophila melanogaster (taxid:7227)]	Back alignment and assigned GO terms

UNIPROTKB\|F1S845 TAF5 "Uncharacterized protein" [Sus scrofa (taxid:9823)]	Back alignment and assigned GO terms

ASPGD\|ASPL0000006005 AN5972 [Emericella nidulans (taxid:162425)]	Back alignment and assigned GO terms

UNIPROTKB\|I3LC69 WDR81 "Uncharacterized protein" [Sus scrofa (taxid:9823)]	Back alignment and assigned GO terms

ZFIN\|ZDB-GENE-051120-180 taf5 "TAF5 RNA polymerase II, TATA box binding protein (TBP)-associated factor" [Danio rerio (taxid:7955)]	Back alignment and assigned GO terms

SGD\|S000003105 SEC27 "Essential beta'-coat protein of the COPI coatomer" [Saccharomyces cerevisiae (taxid:4932)]	Back alignment and assigned GO terms

TAIR\|locus:2012971 AT1G71840 "AT1G71840" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

UNIPROTKB\|E1BVN5 PLRG1 "Uncharacterized protein" [Gallus gallus (taxid:9031)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Your Input:
	GSVIVG00033606001	SubName- Full=Chromosome chr8 scaffold_68, whole genome shotgun sequence; (1271 aa)
		(Vitis vinifera)
Predicted Functional Partners:
		Sorry, there are no predicted associations at the current settings.

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		1339
cd00200		289	cd00200, WD40, WD40 domain, found in a number of e	9e-16
cd00200		289	cd00200, WD40, WD40 domain, found in a number of e	1e-12
COG2319		466	COG2319, COG2319, FOG: WD40 repeat [General functi	3e-12
cd00200		289	cd00200, WD40, WD40 domain, found in a number of e	9e-12
COG2319		466	COG2319, COG2319, FOG: WD40 repeat [General functi	3e-08
PHA03247		3151	PHA03247, PHA03247, large tegument protein UL36; P	2e-04
PRK07994		647	PRK07994, PRK07994, DNA polymerase III subunits ga	0.001
PRK08691		709	PRK08691, PRK08691, DNA polymerase III subunits ga	0.002
PHA03247		3151	PHA03247, PHA03247, large tegument protein UL36; P	0.003
PRK13108		460	PRK13108, PRK13108, prolipoprotein diacylglyceryl	0.004

>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment

Back alignment and domain information

 Score = 78.9 bits (195), Expect = 9e-16
 Identities = 62/322 (19%), Positives = 100/322 (31%), Gaps = 65/322 (20%)

Query: 4   LKAFRPTNDKIVKIQLHPTHPWLVTADASDHVSVWNWEHRQVIYELK--AGGV------- 54
            +  +     +  +   P    L T      + VW+ E  +++  LK   G V       
Sbjct: 2   RRTLKGHTGGVTCVAFSPDGKLLATGSGDGTIKVWDLETGELLRTLKGHTGPVRDVAASA 61

Query: 55  DQRRLVGA------KLEKLAEGELEHKGKPTEAMRG--GSVKQVNFYDDD---------- 96
           D   L         +L  L        G+    + G    V  V F  D           
Sbjct: 62  DGTYLASGSSDKTIRLWDL------ETGECVRTLTGHTSYVSSVAFSPDGRILSSSSRDK 115

Query: 97  -VRFWQLWRNRAAAAEAPTAVSNVTSGFASPPPSTKGRHFLVICCVNKAIFL-DLVTMRG 154
            ++ W +                V S   SP        F+     +  I L DL T + 
Sbjct: 116 TIKVWDV-ETGKCLTTLRGHTDWVNSVAFSPDG-----TFVASSSQDGTIKLWDLRTGK- 168

Query: 155 RDIPKQELD--NKSLVCMEFLSRSAVGDVPLVAFGSSDGVIRVLSMISWKLVRRYTGGHK 212
                  L      +  + F       D   +   SSDG I++  + + K +    G H+
Sbjct: 169 ---CVATLTGHTGEVNSVAFS-----PDGEKLLSSSSDGTIKLWDLSTGKCLGTLRG-HE 219

Query: 213 GSISCLMTFMASSGEALLVSGGSDGLLILWSADHGQDSRELVPKLSLKAHDGGVVAVELS 272
             ++ +     S    LL SG  DG + +W      D R      +L  H   V ++   
Sbjct: 220 NGVNSVAF---SPDGYLLASGSEDGTIRVW------DLRTGECVQTLSGHTNSVTSL--- 267

Query: 273 RVMGGSPQLITIGADKTLAIWD 294
                  +L +  AD T+ IWD
Sbjct: 268 AWSPDGKRLASGSADGTIRIWD 289

Length = 289

Back alignment and domain information

>gnl\|CDD\|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only]	Back alignment and domain information

Back alignment and domain information

>gnl\|CDD\|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only]	Back alignment and domain information

>gnl\|CDD\|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional	Back alignment and domain information

>gnl\|CDD\|236138 PRK07994, PRK07994, DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>gnl\|CDD\|236333 PRK08691, PRK08691, DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>gnl\|CDD\|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional	Back alignment and domain information

>gnl\|CDD\|237284 PRK13108, PRK13108, prolipoprotein diacylglyceryl transferase; Reviewed	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		1339
KOG0276		794	consensus Vesicle coat complex COPI, beta' subunit	100.0
KOG0292		1202	consensus Vesicle coat complex COPI, alpha subunit	100.0
PF04053		443	Coatomer_WDAD: Coatomer WD associated region ; Int	100.0
KOG0271		480	consensus Notchless-like WD40 repeat-containing pr	100.0
KOG0271		480	consensus Notchless-like WD40 repeat-containing pr	100.0
KOG0286		343	consensus G-protein beta subunit [General function	100.0
KOG0272		459	consensus U4/U6 small nuclear ribonucleoprotein Pr	100.0
KOG0292		1202	consensus Vesicle coat complex COPI, alpha subunit	100.0
KOG0318		603	consensus WD40 repeat stress protein/actin interac	100.0
KOG0291		893	consensus WD40-repeat-containing subunit of the 18	100.0
KOG0276		794	consensus Vesicle coat complex COPI, beta' subunit	99.97
KOG0319		775	consensus WD40-repeat-containing subunit of the 18	99.97
KOG0272		459	consensus U4/U6 small nuclear ribonucleoprotein Pr	99.97
KOG0645		312	consensus WD40 repeat protein [General function pr	99.97
KOG0295		406	consensus WD40 repeat-containing protein [Function	99.97
KOG0279		315	consensus G protein beta subunit-like protein [Sig	99.97
KOG0285		460	consensus Pleiotropic regulator 1 [RNA processing	99.96
KOG0273		524	consensus Beta-transducin family (WD-40 repeat) pr	99.96
KOG0319		775	consensus WD40-repeat-containing subunit of the 18	99.96
KOG0315		311	consensus G-protein beta subunit-like protein (con	99.96
KOG0291		893	consensus WD40-repeat-containing subunit of the 18	99.96
KOG0284		464	consensus Polyadenylation factor I complex, subuni	99.96
KOG0263		707	consensus Transcription initiation factor TFIID, s	99.96
KOG0296		399	consensus Angio-associated migratory cell protein	99.96
KOG0318		603	consensus WD40 repeat stress protein/actin interac	99.96
KOG0315		311	consensus G-protein beta subunit-like protein (con	99.96
cd00200		289	WD40 WD40 domain, found in a number of eukaryotic	99.96
KOG0279		315	consensus G protein beta subunit-like protein [Sig	99.96
KOG0281		499	consensus Beta-TrCP (transducin repeats containing	99.95
KOG0266		456	consensus WD40 repeat-containing protein [General	99.95
KOG0265		338	consensus U5 snRNP-specific protein-like factor an	99.94
KOG0263		707	consensus Transcription initiation factor TFIID, s	99.94
PLN00181		793	protein SPA1-RELATED; Provisional	99.94
KOG0306		888	consensus WD40-repeat-containing subunit of the 18	99.94
KOG0273		524	consensus Beta-transducin family (WD-40 repeat) pr	99.94
KOG0281		499	consensus Beta-TrCP (transducin repeats containing	99.94
KOG0282		503	consensus mRNA splicing factor [Function unknown]	99.94
KOG0286		343	consensus G-protein beta subunit [General function	99.94
KOG0295		406	consensus WD40 repeat-containing protein [Function	99.93
KOG0316		307	consensus Conserved WD40 repeat-containing protein	99.93
KOG0293		519	consensus WD40 repeat-containing protein [Function	99.93
KOG0275		508	consensus Conserved WD40 repeat-containing protein	99.93
KOG0313		423	consensus Microtubule binding protein YTM1 (contai	99.93
KOG0306		888	consensus WD40-repeat-containing subunit of the 18	99.93
KOG0284		464	consensus Polyadenylation factor I complex, subuni	99.93
KOG0285		460	consensus Pleiotropic regulator 1 [RNA processing	99.93
KOG2048		691	consensus WD40 repeat protein [General function pr	99.91
KOG0266		456	consensus WD40 repeat-containing protein [General	99.91
KOG0265		338	consensus U5 snRNP-specific protein-like factor an	99.91
KOG0296		399	consensus Angio-associated migratory cell protein	99.91
PLN00181		793	protein SPA1-RELATED; Provisional	99.91
KOG0293		519	consensus WD40 repeat-containing protein [Function	99.91
KOG0645		312	consensus WD40 repeat protein [General function pr	99.91
KOG0274		537	consensus Cdc4 and related F-box and WD-40 protein	99.9
KOG0313		423	consensus Microtubule binding protein YTM1 (contai	99.9
cd00200		289	WD40 WD40 domain, found in a number of eukaryotic	99.89
KOG2106		626	consensus Uncharacterized conserved protein, conta	99.89
KOG0640		430	consensus mRNA cleavage stimulating factor complex	99.89
KOG0282		503	consensus mRNA splicing factor [Function unknown]	99.89
KOG0283		712	consensus WD40 repeat-containing protein [Function	99.89
KOG0641		350	consensus WD40 repeat protein [General function pr	99.89
KOG0274		537	consensus Cdc4 and related F-box and WD-40 protein	99.89
KOG0277		311	consensus Peroxisomal targeting signal type 2 rece	99.89
KOG0643		327	consensus Translation initiation factor 3, subunit	99.88
KOG0278		334	consensus Serine/threonine kinase receptor-associa	99.88
KOG0973		942	consensus Histone transcription regulator HIRA, WD	99.88
KOG0772		641	consensus Uncharacterized conserved protein, conta	99.88
KOG0310		487	consensus Conserved WD40 repeat-containing protein	99.88
KOG0301		745	consensus Phospholipase A2-activating protein (con	99.88
KOG0300		481	consensus WD40 repeat-containing protein [Function	99.88
KOG1539		910	consensus WD repeat protein [General function pred	99.88
KOG0275		508	consensus Conserved WD40 repeat-containing protein	99.88
KOG2096		420	consensus WD40 repeat protein [General function pr	99.87
KOG1407		313	consensus WD40 repeat protein [Function unknown]	99.87
KOG1408		1080	consensus WD40 repeat protein [Function unknown]	99.87
KOG0316		307	consensus Conserved WD40 repeat-containing protein	99.87
PTZ00421		493	coronin; Provisional	99.86
KOG1063		764	consensus RNA polymerase II elongator complex, sub	99.86
KOG0268		433	consensus Sof1-like rRNA processing protein (conta	99.86
PTZ00420		568	coronin; Provisional	99.86
KOG3617		1416	consensus WD40 and TPR repeat-containing protein [	99.86
KOG0308		735	consensus Conserved WD40 repeat-containing protein	99.86
KOG0305		484	consensus Anaphase promoting complex, Cdc20, Cdh1,	99.85
KOG0288		459	consensus WD40 repeat protein TipD [General functi	99.85
PTZ00421		493	coronin; Provisional	99.85
KOG1446		311	consensus Histone H3 (Lys4) methyltransferase comp	99.84
KOG0289		506	consensus mRNA splicing factor [General function p	99.84
KOG1539		910	consensus WD repeat protein [General function pred	99.84
KOG0299		479	consensus U3 snoRNP-associated protein (contains W	99.83
KOG1063		764	consensus RNA polymerase II elongator complex, sub	99.83
KOG0277		311	consensus Peroxisomal targeting signal type 2 rece	99.83
KOG0308		735	consensus Conserved WD40 repeat-containing protein	99.83
KOG0640		430	consensus mRNA cleavage stimulating factor complex	99.83
KOG0310		487	consensus Conserved WD40 repeat-containing protein	99.83
KOG1332		299	consensus Vesicle coat complex COPII, subunit SEC1	99.82
KOG1524		737	consensus WD40 repeat-containing protein CHE-2 [Ge	99.82
KOG0299		479	consensus U3 snoRNP-associated protein (contains W	99.82
KOG0264		422	consensus Nucleosome remodeling factor, subunit CA	99.82
KOG0643		327	consensus Translation initiation factor 3, subunit	99.82
KOG0305		484	consensus Anaphase promoting complex, Cdc20, Cdh1,	99.82
KOG0973		942	consensus Histone transcription regulator HIRA, WD	99.82
KOG0278		334	consensus Serine/threonine kinase receptor-associa	99.81
PTZ00420		568	coronin; Provisional	99.81
KOG0307		1049	consensus Vesicle coat complex COPII, subunit SEC3	99.81
KOG2055		514	consensus WD40 repeat protein [General function pr	99.81
KOG0647		347	consensus mRNA export protein (contains WD40 repea	99.81
KOG0639		705	consensus Transducin-like enhancer of split protei	99.81
KOG0650		733	consensus WD40 repeat nucleolar protein Bop1, invo	99.81
KOG0283		712	consensus WD40 repeat-containing protein [Function	99.81
KOG1407		313	consensus WD40 repeat protein [Function unknown]	99.81
KOG1332		299	consensus Vesicle coat complex COPII, subunit SEC1	99.8
KOG0294		362	consensus WD40 repeat-containing protein [Function	99.8
KOG0264		422	consensus Nucleosome remodeling factor, subunit CA	99.8
KOG2048		691	consensus WD40 repeat protein [General function pr	99.8
KOG1408		1080	consensus WD40 repeat protein [Function unknown]	99.79
KOG0288		459	consensus WD40 repeat protein TipD [General functi	99.79
KOG0289		506	consensus mRNA splicing factor [General function p	99.79
KOG0647		347	consensus mRNA export protein (contains WD40 repea	99.79
KOG1036		323	consensus Mitotic spindle checkpoint protein BUB3,	99.79
KOG0300		481	consensus WD40 repeat-containing protein [Function	99.78
KOG0641		350	consensus WD40 repeat protein [General function pr	99.78
KOG0269		839	consensus WD40 repeat-containing protein [Function	99.78
KOG0646		476	consensus WD40 repeat protein [General function pr	99.78
TIGR03866		300	PQQ_ABC_repeats PQQ-dependent catabolism-associate	99.77
KOG1036		323	consensus Mitotic spindle checkpoint protein BUB3,	99.76
KOG4328		498	consensus WD40 protein [Function unknown]	99.76
KOG0301		745	consensus Phospholipase A2-activating protein (con	99.76
TIGR03866		300	PQQ_ABC_repeats PQQ-dependent catabolism-associate	99.76
KOG1274		933	consensus WD40 repeat protein [General function pr	99.76
KOG0269		839	consensus WD40 repeat-containing protein [Function	99.75
KOG0267		825	consensus Microtubule severing protein katanin p80	99.75
KOG1538		1081	consensus Uncharacterized conserved protein WDR10,	99.75
KOG0294		362	consensus WD40 repeat-containing protein [Function	99.75
KOG1538		1081	consensus Uncharacterized conserved protein WDR10,	99.75
KOG0646		476	consensus WD40 repeat protein [General function pr	99.74
KOG2445		361	consensus Nuclear pore complex component (sc Seh1)	99.73
KOG4283		397	consensus Transcription-coupled repair protein CSA	99.73
KOG2106		626	consensus Uncharacterized conserved protein, conta	99.73
KOG0772		641	consensus Uncharacterized conserved protein, conta	99.73
KOG0302		440	consensus Ribosome Assembly protein [General funct	99.72
KOG0267		825	consensus Microtubule severing protein katanin p80	99.71
KOG1446		311	consensus Histone H3 (Lys4) methyltransferase comp	99.7
KOG2919		406	consensus Guanine nucleotide-binding protein [Gene	99.69
KOG0268		433	consensus Sof1-like rRNA processing protein (conta	99.69
KOG2445		361	consensus Nuclear pore complex component (sc Seh1)	99.69
KOG2096		420	consensus WD40 repeat protein [General function pr	99.69
KOG4378		673	consensus Nuclear protein COP1 [Signal transductio	99.69
KOG0639		705	consensus Transducin-like enhancer of split protei	99.69
KOG1007		370	consensus WD repeat protein TSSC1, WD repeat super	99.68
KOG0321		720	consensus WD40 repeat-containing protein L2DTL [Fu	99.68
KOG1274		933	consensus WD40 repeat protein [General function pr	99.67
KOG1034		385	consensus Transcriptional repressor EED/ESC/FIE, r	99.67
KOG0321		720	consensus WD40 repeat-containing protein L2DTL [Fu	99.66
KOG0302		440	consensus Ribosome Assembly protein [General funct	99.66
KOG0650		733	consensus WD40 repeat nucleolar protein Bop1, invo	99.65
COG2319		466	FOG: WD40 repeat [General function prediction only	99.65
KOG4283		397	consensus Transcription-coupled repair protein CSA	99.65
KOG1273		405	consensus WD40 repeat protein [General function pr	99.65
KOG4378		673	consensus Nuclear protein COP1 [Signal transductio	99.64
KOG1517		1387	consensus Guanine nucleotide binding protein MIP1	99.64
KOG1445		1012	consensus Tumor-specific antigen (contains WD repe	99.63
KOG0270		463	consensus WD40 repeat-containing protein [Function	99.63
KOG1273		405	consensus WD40 repeat protein [General function pr	99.63
KOG0307		1049	consensus Vesicle coat complex COPII, subunit SEC3	99.63
KOG2055		514	consensus WD40 repeat protein [General function pr	99.62
KOG1007		370	consensus WD repeat protein TSSC1, WD repeat super	99.62
KOG0270		463	consensus WD40 repeat-containing protein [Function	99.61
KOG1963		792	consensus WD40 repeat protein [General function pr	99.6
KOG4227		609	consensus WD40 repeat protein [General function pr	99.59
KOG2041		1189	consensus WD40 repeat protein [General function pr	99.57
KOG0322		323	consensus G-protein beta subunit-like protein GNB1	99.57
KOG1034		385	consensus Transcriptional repressor EED/ESC/FIE, r	99.57
KOG1240		1431	consensus Protein kinase containing WD40 repeats [	99.56
KOG0303		472	consensus Actin-binding protein Coronin, contains	99.56
KOG0290		364	consensus Conserved WD40 repeat-containing protein	99.55
KOG4328		498	consensus WD40 protein [Function unknown]	99.53
KOG0644		1113	consensus Uncharacterized conserved protein, conta	99.53
COG2319		466	FOG: WD40 repeat [General function prediction only	99.52
KOG1188		376	consensus WD40 repeat protein [General function pr	99.51
KOG0642		577	consensus Cell-cycle nuclear protein, contains WD-	99.49
KOG1188		376	consensus WD40 repeat protein [General function pr	99.46
KOG0290		364	consensus Conserved WD40 repeat-containing protein	99.45
KOG2919		406	consensus Guanine nucleotide-binding protein [Gene	99.43
KOG1334		559	consensus WD40 repeat protein [General function pr	99.43
KOG0649		325	consensus WD40 repeat protein [General function pr	99.42
KOG4497		447	consensus Uncharacterized conserved protein WDR8,	99.42
KOG1587		555	consensus Cytoplasmic dynein intermediate chain [C	99.41
KOG1963		792	consensus WD40 repeat protein [General function pr	99.4
KOG0644		1113	consensus Uncharacterized conserved protein, conta	99.39
KOG0649		325	consensus WD40 repeat protein [General function pr	99.37
KOG1009		434	consensus Chromatin assembly complex 1 subunit B/C	99.36
KOG1587		555	consensus Cytoplasmic dynein intermediate chain [C	99.36
PRK11028		330	6-phosphogluconolactonase; Provisional	99.35
PRK11028		330	6-phosphogluconolactonase; Provisional	99.34
KOG1310		758	consensus WD40 repeat protein [General function pr	99.33
KOG1310		758	consensus WD40 repeat protein [General function pr	99.33
KOG1517		1387	consensus Guanine nucleotide binding protein MIP1	99.3
KOG0303		472	consensus Actin-binding protein Coronin, contains	99.3
KOG1009		434	consensus Chromatin assembly complex 1 subunit B/C	99.3
KOG1445		1012	consensus Tumor-specific antigen (contains WD repe	99.29
KOG0642		577	consensus Cell-cycle nuclear protein, contains WD-	99.29
KOG1272		545	consensus WD40-repeat-containing subunit of the 18	99.28
PRK01742		429	tolB translocation protein TolB; Provisional	99.26
KOG0771		398	consensus Prolactin regulatory element-binding pro	99.23
KOG4227		609	consensus WD40 repeat protein [General function pr	99.23
KOG4497		447	consensus Uncharacterized conserved protein WDR8,	99.23
PF02239		369	Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO	99.2
KOG2110		391	consensus Uncharacterized conserved protein, conta	99.2
KOG0322		323	consensus G-protein beta subunit-like protein GNB1	99.19
PRK01742		429	tolB translocation protein TolB; Provisional	99.18
KOG0771		398	consensus Prolactin regulatory element-binding pro	99.14
KOG1523		361	consensus Actin-related protein Arp2/3 complex, su	99.14
KOG2139		445	consensus WD40 repeat protein [General function pr	99.12
KOG0974		967	consensus WD-repeat protein WDR6, WD repeat superf	99.12
KOG1240		1431	consensus Protein kinase containing WD40 repeats [	99.12
KOG2111		346	consensus Uncharacterized conserved protein, conta	99.11
KOG1523		361	consensus Actin-related protein Arp2/3 complex, su	99.11
KOG2394		636	consensus WD40 protein DMR-N9 [General function pr	99.1
KOG2110		391	consensus Uncharacterized conserved protein, conta	99.1
KOG2394		636	consensus WD40 protein DMR-N9 [General function pr	99.09
KOG2321		703	consensus WD40 repeat protein [General function pr	99.09
KOG1334		559	consensus WD40 repeat protein [General function pr	99.06
PF04762		928	IKI3: IKI3 family; InterPro: IPR006849 Members of	99.06
KOG3881		412	consensus Uncharacterized conserved protein [Funct	99.06
PRK03629		429	tolB translocation protein TolB; Provisional	99.05
KOG1409		404	consensus Uncharacterized conserved protein, conta	99.04
KOG1272		545	consensus WD40-repeat-containing subunit of the 18	99.01
KOG0974		967	consensus WD-repeat protein WDR6, WD repeat superf	99.0
PRK04922		433	tolB translocation protein TolB; Provisional	99.0
KOG3881		412	consensus Uncharacterized conserved protein [Funct	98.98
KOG2139		445	consensus WD40 repeat protein [General function pr	98.98
KOG1064		2439	consensus RAVE (regulator of V-ATPase assembly) co	98.96
KOG1524		737	consensus WD40 repeat-containing protein CHE-2 [Ge	98.96
KOG2111		346	consensus Uncharacterized conserved protein, conta	98.96
PRK05137		435	tolB translocation protein TolB; Provisional	98.94
PRK02889		427	tolB translocation protein TolB; Provisional	98.93
PF08662		194	eIF2A: Eukaryotic translation initiation factor eI	98.92
PRK03629		429	tolB translocation protein TolB; Provisional	98.91
KOG2041		1189	consensus WD40 repeat protein [General function pr	98.87
PF02239		369	Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO	98.84
PRK04922		433	tolB translocation protein TolB; Provisional	98.82
KOG1354		433	consensus Serine/threonine protein phosphatase 2A,	98.81
KOG0280		339	consensus Uncharacterized conserved protein [Amino	98.8
KOG2321		703	consensus WD40 repeat protein [General function pr	98.76
COG4946		668	Uncharacterized protein related to the periplasmic	98.75
KOG4190		1034	consensus Uncharacterized conserved protein [Funct	98.74
TIGR02800		417	propeller_TolB tol-pal system beta propeller repea	98.73
KOG1354		433	consensus Serine/threonine protein phosphatase 2A,	98.73
KOG4547		541	consensus WD40 repeat-containing protein [General	98.72
KOG0280		339	consensus Uncharacterized conserved protein [Amino	98.7
PRK05137		435	tolB translocation protein TolB; Provisional	98.7
COG2706		346	3-carboxymuconate cyclase [Carbohydrate transport	98.69
PRK02889		427	tolB translocation protein TolB; Provisional	98.69
PF08662		194	eIF2A: Eukaryotic translation initiation factor eI	98.64
PRK04792		448	tolB translocation protein TolB; Provisional	98.64
PRK00178		430	tolB translocation protein TolB; Provisional	98.64
KOG1912		1062	consensus WD40 repeat protein [General function pr	98.59
TIGR02658		352	TTQ_MADH_Hv methylamine dehydrogenase heavy chain.	98.55
PF10282		345	Lactonase: Lactonase, 7-bladed beta-propeller; Int	98.54
PF10282		345	Lactonase: Lactonase, 7-bladed beta-propeller; Int	98.53
KOG4547		541	consensus WD40 repeat-containing protein [General	98.52
TIGR02800		417	propeller_TolB tol-pal system beta propeller repea	98.49
KOG2315		566	consensus Predicted translation initiation factor	98.49
TIGR03300		377	assembly_YfgL outer membrane assembly lipoprotein	98.48
KOG3914		390	consensus WD repeat protein WDR4 [Function unknown	98.46
PRK00178		430	tolB translocation protein TolB; Provisional	98.45
PRK01029		428	tolB translocation protein TolB; Provisional	98.43
KOG2314		698	consensus Translation initiation factor 3, subunit	98.43
PRK04792		448	tolB translocation protein TolB; Provisional	98.38
KOG1064		2439	consensus RAVE (regulator of V-ATPase assembly) co	98.37
KOG2695		425	consensus WD40 repeat protein [General function pr	98.36
COG5354		561	Uncharacterized protein, contains Trp-Asp (WD) rep	98.35
PRK01029		428	tolB translocation protein TolB; Provisional	98.35
KOG1409		404	consensus Uncharacterized conserved protein, conta	98.34
KOG0309		1081	consensus Conserved WD40 repeat-containing protein	98.33
TIGR03300		377	assembly_YfgL outer membrane assembly lipoprotein	98.33
PLN02919		1057	haloacid dehalogenase-like hydrolase family protei	98.32
COG2706		346	3-carboxymuconate cyclase [Carbohydrate transport	98.32
KOG3914		390	consensus WD repeat protein WDR4 [Function unknown	98.3
KOG2315		566	consensus Predicted translation initiation factor	98.27
TIGR02658		352	TTQ_MADH_Hv methylamine dehydrogenase heavy chain.	98.24
KOG1832		1516	consensus HIV-1 Vpr-binding protein [Cell cycle co	98.21
KOG3617		1416	consensus WD40 and TPR repeat-containing protein [	98.19
KOG2314		698	consensus Translation initiation factor 3, subunit	98.19
KOG1912		1062	consensus WD40 repeat protein [General function pr	98.19
KOG0309		1081	consensus Conserved WD40 repeat-containing protein	98.13
PF00400		39	WD40: WD domain, G-beta repeat; InterPro: IPR01978	98.12
KOG1832		1516	consensus HIV-1 Vpr-binding protein [Cell cycle co	98.1
COG5354		561	Uncharacterized protein, contains Trp-Asp (WD) rep	98.09
KOG4532		344	consensus WD40-like repeat containing protein [Gen	98.09
KOG4714		319	consensus Nucleoporin [Nuclear structure]	98.03
PLN02919		1057	haloacid dehalogenase-like hydrolase family protei	98.03
KOG4714		319	consensus Nucleoporin [Nuclear structure]	97.99
PRK11138		394	outer membrane biogenesis protein BamB; Provisiona	97.91
PF08450		246	SGL: SMP-30/Gluconolaconase/LRE-like region; Inter	97.9
COG5170		460	CDC55 Serine/threonine protein phosphatase 2A, reg	97.9
KOG2695		425	consensus WD40 repeat protein [General function pr	97.87
KOG4532		344	consensus WD40-like repeat containing protein [Gen	97.86
KOG2114		933	consensus Vacuolar assembly/sorting protein PEP5/V	97.82
PF04762		928	IKI3: IKI3 family; InterPro: IPR006849 Members of	97.81
PF13360		238	PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A	97.8
COG5170		460	CDC55 Serine/threonine protein phosphatase 2A, reg	97.79
PF15492		282	Nbas_N: Neuroblastoma-amplified sequence, N termin	97.77
KOG1920		1265	consensus IkappaB kinase complex, IKAP component [	97.77
PF07433		305	DUF1513: Protein of unknown function (DUF1513); In	97.7
PRK04043		419	tolB translocation protein TolB; Provisional	97.67
KOG1275		1118	consensus PAB-dependent poly(A) ribonuclease, subu	97.63
PF15492		282	Nbas_N: Neuroblastoma-amplified sequence, N termin	97.62
KOG4190		1034	consensus Uncharacterized conserved protein [Funct	97.61
PRK11138		394	outer membrane biogenesis protein BamB; Provisiona	97.56
PRK04043		419	tolB translocation protein TolB; Provisional	97.55
PF00400		39	WD40: WD domain, G-beta repeat; InterPro: IPR01978	97.55
KOG2066		846	consensus Vacuolar assembly/sorting protein VPS41	97.52
COG4946		668	Uncharacterized protein related to the periplasmic	97.5
KOG1275		1118	consensus PAB-dependent poly(A) ribonuclease, subu	97.47
PF08450		246	SGL: SMP-30/Gluconolaconase/LRE-like region; Inter	97.39
PF13360		238	PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A	97.35
KOG2114		933	consensus Vacuolar assembly/sorting protein PEP5/V	97.34
KOG2066		846	consensus Vacuolar assembly/sorting protein VPS41	97.3
KOG1920		1265	consensus IkappaB kinase complex, IKAP component [	97.27
KOG3621		726	consensus WD40 repeat-containing protein [General	97.26
KOG1645		463	consensus RING-finger-containing E3 ubiquitin liga	97.26
KOG4649		354	consensus PQQ (pyrrolo-quinoline quinone) repeat p	97.25
KOG1008		783	consensus Uncharacterized conserved protein, conta	97.24
KOG0882		558	consensus Cyclophilin-related peptidyl-prolyl cis-	97.19
PF07433		305	DUF1513: Protein of unknown function (DUF1513); In	97.04
PF08596		395	Lgl_C: Lethal giant larvae(Lgl) like, C-terminal;	97.04
PF11768		545	DUF3312: Protein of unknown function (DUF3312); In	97.0
KOG4649		354	consensus PQQ (pyrrolo-quinoline quinone) repeat p	96.89
PRK02888		635	nitrous-oxide reductase; Validated	96.74
PF04053		443	Coatomer_WDAD: Coatomer WD associated region ; Int	96.69
smart00320		40	WD40 WD40 repeats. Note that these repeats are per	96.62
PF06977		248	SdiA-regulated: SdiA-regulated; InterPro: IPR00972	96.47
KOG0882		558	consensus Cyclophilin-related peptidyl-prolyl cis-	96.38
KOG1645		463	consensus RING-finger-containing E3 ubiquitin liga	96.37
PF06433		342	Me-amine-dh_H: Methylamine dehydrogenase heavy cha	96.33
KOG1008		783	consensus Uncharacterized conserved protein, conta	96.32
cd00216		488	PQQ_DH Dehydrogenases with pyrrolo-quinoline quino	96.25
PF00930		353	DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-termin	96.24
PRK02888		635	nitrous-oxide reductase; Validated	96.24
PF11768		545	DUF3312: Protein of unknown function (DUF3312); In	96.11
cd00216		488	PQQ_DH Dehydrogenases with pyrrolo-quinoline quino	96.07
PLN03081		697	pentatricopeptide (PPR) repeat-containing protein;	96.07
PRK11788		389	tetratricopeptide repeat protein; Provisional	96.01
PF00780		275	CNH: CNH domain; InterPro: IPR001180 Based on sequ	95.87
KOG3616		1636	consensus Selective LIM binding factor [Transcript	95.79
KOG3621		726	consensus WD40 repeat-containing protein [General	95.59
KOG3616		1636	consensus Selective LIM binding factor [Transcript	95.57
PLN03218		1060	maturation of RBCL 1; Provisional	95.38
PF00930		353	DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-termin	95.34
PLN03081		697	pentatricopeptide (PPR) repeat-containing protein;	95.21
PLN03218		1060	maturation of RBCL 1; Provisional	95.19
PRK11447		1157	cellulose synthase subunit BcsC; Provisional	95.13
PF13429		280	TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2	95.11
PF08553		794	VID27: VID27 cytoplasmic protein; InterPro: IPR013	95.02
TIGR03075		527	PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methan	94.98
COG0823		425	TolB Periplasmic component of the Tol biopolymer t	94.94
smart00320		40	WD40 WD40 repeats. Note that these repeats are per	94.89
PLN03077		857	Protein ECB2; Provisional	94.86
PF03178		321	CPSF_A: CPSF A subunit region; InterPro: IPR004871	94.85
PF14583		386	Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C	94.72
PF05096		264	Glu_cyclase_2: Glutamine cyclotransferase; InterPr	94.69
PF06977		248	SdiA-regulated: SdiA-regulated; InterPro: IPR00972	94.65
COG3386		307	Gluconolactonase [Carbohydrate transport and metab	94.47
PLN03077		857	Protein ECB2; Provisional	94.45
COG3063		250	PilF Tfp pilus assembly protein PilF [Cell motilit	94.39
PRK09782		987	bacteriophage N4 receptor, outer membrane subunit;	94.37
KOG4441		571	consensus Proteins containing BTB/POZ and Kelch do	94.37
PF06433		342	Me-amine-dh_H: Methylamine dehydrogenase heavy cha	94.18
PF08553		794	VID27: VID27 cytoplasmic protein; InterPro: IPR013	94.01
TIGR02917		899	PEP_TPR_lipo putative PEP-CTERM system TPR-repeat	93.93
PRK11788		389	tetratricopeptide repeat protein; Provisional	93.89
PF14783		111	BBS2_Mid: Ciliary BBSome complex subunit 2, middle	93.82
TIGR02917		899	PEP_TPR_lipo putative PEP-CTERM system TPR-repeat	93.63
TIGR00990		615	3a0801s09 mitochondrial precursor proteins import	93.62
PF03178		321	CPSF_A: CPSF A subunit region; InterPro: IPR004871	93.57
PRK10747		398	putative protoheme IX biogenesis protein; Provisio	93.56
KOG1897		1096	consensus Damage-specific DNA binding complex, sub	93.5
COG0823		425	TolB Periplasmic component of the Tol biopolymer t	93.39
KOG1897		1096	consensus Damage-specific DNA binding complex, sub	93.38
PF04841		410	Vps16_N: Vps16, N-terminal region; InterPro: IPR00	93.31
KOG4640		665	consensus Anaphase-promoting complex (APC), subuni	93.29
PF14583		386	Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C	93.24
COG3391		381	Uncharacterized conserved protein [Function unknow	93.19
PF04841		410	Vps16_N: Vps16, N-terminal region; InterPro: IPR00	93.07
TIGR00990		615	3a0801s09 mitochondrial precursor proteins import	92.99
PHA02713		557	hypothetical protein; Provisional	92.96
TIGR02521		234	type_IV_pilW type IV pilus biogenesis/stability pr	92.93
KOG2079		1206	consensus Vacuolar assembly/sorting protein VPS8 [	92.76
PF02897		414	Peptidase_S9_N: Prolyl oligopeptidase, N-terminal	92.63
KOG2444		238	consensus WD40 repeat protein [General function pr	92.57
PF12894		47	Apc4_WD40: Anaphase-promoting complex subunit 4 WD	92.04
KOG4640		665	consensus Anaphase-promoting complex (APC), subuni	91.95
PF14783		111	BBS2_Mid: Ciliary BBSome complex subunit 2, middle	91.88
KOG2079		1206	consensus Vacuolar assembly/sorting protein VPS8 [	91.85
KOG2076		895	consensus RNA polymerase III transcription factor	91.66
KOG0985		1666	consensus Vesicle coat protein clathrin, heavy cha	91.64
KOG2395		644	consensus Protein involved in vacuole import and d	91.27
PF14655		415	RAB3GAP2_N: Rab3 GTPase-activating protein regulat	91.26
PRK11447		1157	cellulose synthase subunit BcsC; Provisional	91.2
PF10168		717	Nup88: Nuclear pore component; InterPro: IPR019321	90.63
KOG4499		310	consensus Ca2+-binding protein Regucalcin/SMP30 [I	90.57
TIGR02521		234	type_IV_pilW type IV pilus biogenesis/stability pr	90.53
COG3204		316	Uncharacterized protein conserved in bacteria [Fun	90.52
PRK10370		198	formate-dependent nitrite reductase complex subuni	90.47
COG3386		307	Gluconolactonase [Carbohydrate transport and metab	90.44
COG5010		257	TadD Flp pilus assembly protein TadD, contains TPR	90.41
PRK10049		765	pgaA outer membrane protein PgaA; Provisional	90.3
PRK10747		398	putative protoheme IX biogenesis protein; Provisio	90.02
COG3490		366	Uncharacterized protein conserved in bacteria [Fun	89.99
COG3391		381	Uncharacterized conserved protein [Function unknow	89.97
KOG2003		840	consensus TPR repeat-containing protein [General f	89.94
PRK12370		553	invasion protein regulator; Provisional	89.9
PRK15174		656	Vi polysaccharide export protein VexE; Provisional	89.87
KOG2395		644	consensus Protein involved in vacuole import and d	89.71
PRK15174		656	Vi polysaccharide export protein VexE; Provisional	89.7
KOG4441		571	consensus Proteins containing BTB/POZ and Kelch do	89.45
KOG1924		1102	consensus RhoA GTPase effector DIA/Diaphanous [Sig	89.35
PHA02713		557	hypothetical protein; Provisional	89.14
COG3490		366	Uncharacterized protein conserved in bacteria [Fun	88.85
PF12234		631	Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR0	88.72
TIGR03075		527	PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methan	88.47
PF00780		275	CNH: CNH domain; InterPro: IPR001180 Based on sequ	88.08
PF05694		461	SBP56: 56kDa selenium binding protein (SBP56); Int	87.68
PF08728		717	CRT10: CRT10; InterPro: IPR014839 CRT10 is a trans	87.38
KOG0566		1080	consensus Inositol-1,4,5-triphosphate 5-phosphatas	87.36
PF09976		145	TPR_21: Tetratricopeptide repeat; InterPro: IPR018	87.02
PF12894		47	Apc4_WD40: Anaphase-promoting complex subunit 4 WD	86.85
COG3823		262	Glutamine cyclotransferase [Posttranslational modi	86.7
PF05096		264	Glu_cyclase_2: Glutamine cyclotransferase; InterPr	86.64
PRK12370		553	invasion protein regulator; Provisional	86.4
PF15390		671	DUF4613: Domain of unknown function (DUF4613)	86.28
PF14870		302	PSII_BNR: Photosynthesis system II assembly factor	86.21
PRK13616		591	lipoprotein LpqB; Provisional	85.97
TIGR00540		409	hemY_coli hemY protein. This is an uncharacterized	85.72
PF02897		414	Peptidase_S9_N: Prolyl oligopeptidase, N-terminal	85.67
PRK13616		591	lipoprotein LpqB; Provisional	85.38
KOG0547		606	consensus Translocase of outer mitochondrial membr	84.92
PF12234		631	Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR0	84.89
PRK15179		694	Vi polysaccharide biosynthesis protein TviE; Provi	84.75
COG2956		389	Predicted N-acetylglucosaminyl transferase [Carboh	84.7
PRK09782		987	bacteriophage N4 receptor, outer membrane subunit;	84.07
KOG2444		238	consensus WD40 repeat protein [General function pr	84.0
PRK14950		585	DNA polymerase III subunits gamma and tau; Provisi	83.99
PRK15359		144	type III secretion system chaperone protein SscB;	83.01
PF13429		280	TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2	82.67
TIGR02552		135	LcrH_SycD type III secretion low calcium response	82.46
PF13414		69	TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A	82.44
PHA03098		534	kelch-like protein; Provisional	82.32
KOG1916		1283	consensus Nuclear protein, contains WD40 repeats [	82.26
KOG0550		486	consensus Molecular chaperone (DnaJ superfamily) [	81.41
KOG1916		1283	consensus Nuclear protein, contains WD40 repeats [	81.35
PF08596		395	Lgl_C: Lethal giant larvae(Lgl) like, C-terminal;	81.03
KOG2076		895	consensus RNA polymerase III transcription factor	80.68
KOG1126		638	consensus DNA-binding cell division cycle control	80.58
PF07995		331	GSDH: Glucose / Sorbosone dehydrogenase; InterPro:	80.51
PF10168		717	Nup88: Nuclear pore component; InterPro: IPR019321	80.44
COG4235		287	Cytochrome c biogenesis factor [Posttranslational	80.22
PRK10049		765	pgaA outer membrane protein PgaA; Provisional	80.2
PHA03247		3151	large tegument protein UL36; Provisional	80.17

>KOG0276 consensus Vesicle coat complex COPI, beta' subunit [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

Probab=100.00  E-value=1.2e-116  Score=1009.01  Aligned_cols=768  Identities=21%  Similarity=0.294  Sum_probs=640.7

Q ss_pred             eEEecCCCCCEEEEEEcCCCCEEEEEeCCCeEEEEECCCCcEEEEEeccCccceEEeccccceeEeeccccCCCcccccc
Q 000709            4 LKAFRPTNDKIVKIQLHPTHPWLVTADASDHVSVWNWEHRQVIYELKAGGVDQRRLVGAKLEKLAEGELEHKGKPTEAMR   83 (1339)
Q Consensus         4 l~~L~gHs~~V~~vafSPdg~~LaSgs~DGtIrIWDl~tg~~l~~~~~~~~~~i~~vs~d~~~Lasgs~d~~gk~~~~l~   83 (1339)
                      -++|..|+++|.++.|||..+|++++-.+|.|+|||+++...+++|+..                               
T Consensus         6 krk~~~rSdRVKsVd~HPtePw~la~LynG~V~IWnyetqtmVksfeV~-------------------------------   54 (794)
T KOG0276|consen    6 KRKFQSRSDRVKSVDFHPTEPWILAALYNGDVQIWNYETQTMVKSFEVS-------------------------------   54 (794)
T ss_pred             hhHhhccCCceeeeecCCCCceEEEeeecCeeEEEecccceeeeeeeec-------------------------------
Confidence            3577889999999999999999999999999999999999999888733                               


Q ss_pred             CCceEEEEEcCCeEEEEEcCCccccccccccccccCCCCeeeeeeCCCCCeEEEEEecCcEEEE-EecCCceeecccccc
Q 000709           84 GGSVKQVNFYDDDVRFWQLWRNRAAAAEAPTAVSNVTSGFASPPPSTKGRHFLVICCVNKAIFL-DLVTMRGRDIPKQEL  162 (1339)
Q Consensus        84 ~g~V~sVaF~Dg~IrlWDl~~~~~l~~~~~~~~~~~~~~V~slafspdg~~lLasgs~dg~I~w-D~~t~~~~~v~~~~~  162 (1339)
                                                          +-+|++..|-...+ ++++|++|..|++ ++++++  .+..++.
T Consensus        55 ------------------------------------~~PvRa~kfiaRkn-Wiv~GsDD~~IrVfnynt~e--kV~~FeA   95 (794)
T KOG0276|consen   55 ------------------------------------EVPVRAAKFIARKN-WIVTGSDDMQIRVFNYNTGE--KVKTFEA   95 (794)
T ss_pred             ------------------------------------ccchhhheeeeccc-eEEEecCCceEEEEecccce--eeEEeec
Confidence                                                22345555666565 9999999999976 999885  4778999


Q ss_pred             CCCCeEEEEEeeccccCCCCEEEEEECCCcEEEEECCC-CeEEEEEecCCCCCeeEEEEeeeCCCCCEEEEEeCCCcEEE
Q 000709          163 DNKSLVCMEFLSRSAVGDVPLVAFGSSDGVIRVLSMIS-WKLVRRYTGGHKGSISCLMTFMASSGEALLVSGGSDGLLIL  241 (1339)
Q Consensus       163 h~~~V~~vaf~P~s~Spdg~~LasGs~DgtIrIWDl~t-~~~i~~l~~gH~~~V~sl~wf~~spdg~~LaSgS~DgtVrV  241 (1339)
                      |.++|+|++.|     |..++++++|+|.+|++||++. +.+.+++. ||.++|++++  +.+.|.+.|+|+|.|++|+|
T Consensus        96 H~DyIR~iavH-----Pt~P~vLtsSDDm~iKlW~we~~wa~~qtfe-GH~HyVMqv~--fnPkD~ntFaS~sLDrTVKV  167 (794)
T KOG0276|consen   96 HSDYIRSIAVH-----PTLPYVLTSSDDMTIKLWDWENEWACEQTFE-GHEHYVMQVA--FNPKDPNTFASASLDRTVKV  167 (794)
T ss_pred             cccceeeeeec-----CCCCeEEecCCccEEEEeeccCceeeeeEEc-CcceEEEEEE--ecCCCccceeeeeccccEEE
Confidence            99999999995     5789999999999999999974 67888887 9999999998  37778999999999999999


Q ss_pred             EeCCCCCccceecccccccccccceEEEEeeccCCCCCEEEEEeCCCcEEEEECCCCeeEEEecCCCcccccCCceeEEE
Q 000709          242 WSADHGQDSRELVPKLSLKAHDGGVVAVELSRVMGGSPQLITIGADKTLAIWDTVSFKELRRIKPVPKLACHSVASWCHP  321 (1339)
Q Consensus       242 WDl~tg~~~~~~~~~~~l~gH~~~V~svafsp~~~dg~~LaSgs~Dg~IrIWDl~t~~~l~~~~~~~~l~~H~~~V~sva  321 (1339)
                      |.+.+..      +.+++.||..+|+|++|-+. +|.++|+||++|.+|+|||+++..|+++      +.||..+|+++.
T Consensus       168 Wslgs~~------~nfTl~gHekGVN~Vdyy~~-gdkpylIsgaDD~tiKvWDyQtk~CV~T------LeGHt~Nvs~v~  234 (794)
T KOG0276|consen  168 WSLGSPH------PNFTLEGHEKGVNCVDYYTG-GDKPYLISGADDLTIKVWDYQTKSCVQT------LEGHTNNVSFVF  234 (794)
T ss_pred             EEcCCCC------CceeeeccccCcceEEeccC-CCcceEEecCCCceEEEeecchHHHHHH------hhcccccceEEE
Confidence            9998775      45668999999999999983 5678999999999999999999999888      799999999999


Q ss_pred             eCCCCCE-EEEecCCe--EEEccCCcccccccCccccCCCCCCeEEccCCcccEEEEEEecCCCcEEEEEECCCeEEEEe
Q 000709          322 RAPNLDI-LTCVKDSH--IWAIEHPTYSALTRPLCELSSLVPPQVLAHHKKLRVYCMVAHSLQPHLVATGTNVGVIISEF  398 (1339)
Q Consensus       322 fspdg~i-Ls~s~Dg~--LWDi~t~~~~~~~~~l~~~~~~~~~~tl~~~~~~~I~~la~sp~~~~lLatGs~DG~IlriW  398 (1339)
                      |+|.-.+ ++||+||+  ||+..+-.               ...++..... ++||++..+ +...++.|.++|.|. +=
T Consensus       235 fhp~lpiiisgsEDGTvriWhs~Ty~---------------lE~tLn~gle-RvW~I~~~k-~~~~i~vG~Deg~i~-v~  296 (794)
T KOG0276|consen  235 FHPELPIIISGSEDGTVRIWNSKTYK---------------LEKTLNYGLE-RVWCIAAHK-GDGKIAVGFDEGSVT-VK  296 (794)
T ss_pred             ecCCCcEEEEecCCccEEEecCccee---------------hhhhhhcCCc-eEEEEeecC-CCCeEEEeccCCcEE-EE
Confidence            9999885 58999997  89876531               1223333344 899999999 566699999999974 33


Q ss_pred             cCCCCCCccccCCCCCCCCceEEEEecCeEEEEEeeeccCCCCCCCCCcccccCCcccCCCchhhHHHhhcccccccCCC
Q 000709          399 DPRSLPAVAPLPTPSGSRDHSAVYIVERELKLVNFQLSSAANPSLGNNGSLSETGRLKGDLPDALQIKQIKKHISTPVPH  478 (1339)
Q Consensus       399 d~~~~p~i~~~~~~~~s~~~s~~~~~~~~l~l~~f~l~~~~n~~lg~~~~~S~~G~~~~~~~~~l~v~~~~r~i~t~~~~  478 (1339)
                      -.++.|.+      +.+....++|...+++...+...-..               ..+...++.+.  ...|++.+.--+
T Consensus       297 lgreeP~v------sMd~~gKIiwa~~~ei~~~~~ks~~~---------------~~ev~DgErL~--LsvKeLgs~eiy  353 (794)
T KOG0276|consen  297 LGREEPAV------SMDSNGKIIWAVHSEIQAVNLKSVGA---------------QKEVTDGERLP--LSVKELGSVEIY  353 (794)
T ss_pred             ccCCCCce------eecCCccEEEEcCceeeeeeceeccC---------------cccccCCcccc--chhhhccccccc
Confidence            23333333      23334568888888875433321100               00222333331  123334443322


Q ss_pred             CCccEEEEcCCCCEEEEEECCCCEEEEEEeCCceeeecCceeEEEeccCCCeEEEEeccCCCCcCCCCCCCCchhHHHHH
Q 000709          479 DSYSILSVSSSGKYLAVVWPDIPYFSVYKVSDWSIVDSGSARLLAWDTCRDRFAILESALTPRLPIIPKGGSSRKAKEAA  558 (1339)
Q Consensus       479 e~~s~l~~SpdGrylaV~~~~~g~~~Vy~i~~~~~i~~G~~~~~aWs~~~~~fAvl~~~~~~~i~~~~k~~~~~k~ke~a  558 (1339)
                      +  ..+.+||+|||++||  ++|+|+||+...|+++.+|+++.|+|+.+++.|||++++-.  +.      .+|++|+. 
T Consensus       354 P--q~L~hsPNGrfV~Vc--gdGEyiIyTala~RnK~fG~~~eFvw~~dsne~avRes~~~--vk------i~knfke~-  420 (794)
T KOG0276|consen  354 P--QTLAHSPNGRFVVVC--GDGEYIIYTALALRNKAFGSGLEFVWAADSNEFAVRESNGN--VK------IFKNFKEH-  420 (794)
T ss_pred             h--HHhccCCCCcEEEEe--cCccEEEEEeeehhhcccccceeEEEcCCCCeEEEEecCCc--eE------EEecceec-
Confidence            2  279999999999887  89999999999999999999999999999999999987532  11      12333443 


Q ss_pred             HHHHHHHHHHHHHhhccceeeeeeccCCCcceeEeecCCCCCCeeeeeccceeeeEeeccccccccccccccccccCCCC
Q 000709          559 AAAAAAQAAAASAASSATVQARILLDDGTSNILMRSIGGSSEPVIGLHGGALLGVAYRTSRRISPIAATAISTIQSMPLS  638 (1339)
Q Consensus       559 ~aaa~~~aaa~aaa~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~gg~llgv~~~~~~~~~~~~~~~~~~~~~~~~~  638 (1339)
                                                        +++... ...++++||.||||+.+                      
T Consensus       421 ----------------------------------ksi~~~-~~~e~i~gg~Llg~~ss----------------------  443 (794)
T KOG0276|consen  421 ----------------------------------KSIRPD-MSAEGIFGGPLLGVRSS----------------------  443 (794)
T ss_pred             ----------------------------------cccccc-cceeeecCCceEEEEeC----------------------
Confidence                                              455432 34688999999999766                      


Q ss_pred             CCCCCCCCCccccCCCCCCCCCCCCCCCCcEEEeecccccccccCCCCCceEEECCCccEEEEEeeeEEEEeecCccccc
Q 000709          639 GFGSSGLSSFTTFDDGFSSQKSPAEAAPQNFQLYSWETFQPVGGLLPQPEWTAWDQTVEYCAFAYQHYIVISSLCPQYRY  718 (1339)
Q Consensus       639 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ydw~~~~~v~~~~~~~~~~~w~~~~~~~a~~~~~~i~i~~~~~~~~~  718 (1339)
                                                  +++|||||+++++|+||+..++.++|+++|++||+++.+.+||++++.+.-.
T Consensus       444 ----------------------------~~~~fydW~~~~lVrrI~v~~k~v~w~d~g~lVai~~d~Sfyil~~n~d~v~  495 (794)
T KOG0276|consen  444 ----------------------------DFLCFYDWESGELVRRIEVTSKHVYWSDNGELVAIAGDDSFYILKFNADAVA  495 (794)
T ss_pred             ----------------------------CeEEEEEcccceEEEEEeeccceeEEecCCCEEEEEecCceeEEEecHHHHH
Confidence                                        5799999999999999999999999999999999999999999998643211


Q ss_pred             cccccccccccceeeeeeeEEeCCCcceEEeecccccchhhhhhHHHHHHHHHhhhhhhhhccccceehhhccchhhhhh
Q 000709          719 LGDVAIPYATGAVWHRRQLFVVTPTTIECVFVDAGVAAIDVETMKMKEEMKLKEVQSRAVAEHGELALIAVESSQTAAQD  798 (1339)
Q Consensus       719 ~~~~~~~~~~s~~w~~~~~f~~t~~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  798 (1339)
                            ..+.+|.       ..|++||+.+|..-                .+..+.++++.|+|||++||.         
T Consensus       496 ------~a~e~g~-------~v~eeGiedAfevL----------------gE~sE~v~tg~WvgD~fiytt---------  537 (794)
T KOG0276|consen  496 ------NAVEQGI-------EVTEEGIEDAFEVL----------------GEVSESVKTGKWVGDCFIYTT---------  537 (794)
T ss_pred             ------HHHhcCC-------CCcchhHHHHHHHH----------------hhhhhheeeceeeeeEEEEee---------
Confidence                  1122221       25778888877652                234567999999999966664         


Q ss_pred             ccccCCCchhhhhhhcccccCCCCCcccCCCCccccCCCCCCcccccccccceeeecCCceeeEEeccCCCCCCCCcceE
Q 000709          799 RIKLRPPMLQVVRLASFQHAASVPPFLTMPKQTKVEGDDSMMPKDIEERKVNEIAVGGGGVAVAVTRFPTEQKRPIGPLV  878 (1339)
Q Consensus       799 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~l~~~~~~~~~~~~  878 (1339)
                                                                       ..||++|++||++.++.|+++       +||
T Consensus       538 -------------------------------------------------s~nrlnY~vgGe~~~v~h~~~-------~my  561 (794)
T KOG0276|consen  538 -------------------------------------------------SNNRLNYLVGGETYTVAHLDR-------IMY  561 (794)
T ss_pred             -------------------------------------------------cccceeEEcCCceEEEEEecc-------chh
Confidence                                                             346777999999999999997       999


Q ss_pred             EEEE--eCcEEEEEcCCCcEEEEecChhHHHhHHHHhcCCHHHHHHHHHhcCchhhHHHHHHHHhCCcchhhcccccccC
Q 000709          879 VVGV--KDGVLWLIDRYMCAHALSLSHPGIRCRCLAAYGDSVSAVKWASRLGREHHDDLAQFMLGMGYATEALHLPGISK  956 (1339)
Q Consensus       879 l~g~--~~~~l~~~d~~~~~~~~~l~~~~~~~~~~~~~~~~~~a~~~~~~i~~~~~~~~a~fL~~~G~~e~Al~~~~d~~  956 (1339)
                      +|||  +++++||.||+.+|++|+|.+..++||++++|||++.|.+.+++||+++|.++|+|||++||+|+||++.+| +
T Consensus       562 lLgy~~~~~rvYL~Dke~nVi~y~l~l~vleyqt~vmrrd~~~a~~vLp~I~k~~rt~va~Fle~~g~~e~AL~~s~D-~  640 (794)
T KOG0276|consen  562 LLGYVANDNRVYLHDKELNVISYKILLEVLEYQTLVLRRDLEVADGVLPTIPKEIRTKVAHFLESQGMKEQALELSTD-P  640 (794)
T ss_pred             heeeeecCCEEEEeecccceEeEeeehHHHHHHHHhhhccccccccccccCchhhhhhHHhHhhhccchHhhhhcCCC-h
Confidence            9999  999999999999999999999999999999999999999999999999999999999999999999999999 5


Q ss_pred             ccEEEeecccccHHHHHHHHHhccCCCccCCCCCCCCcccccccccccchhhhhhhhhhhhHHHHHHHHHHHHHcCCHHH
Q 000709          957 RLEFDLAMQSNDLKRALQCLITMSNSRDIGQDHPGLDLNDILTLTTKKENIVEAVQGIVKFAKEFLDLIDAADATGQANI 1036 (1339)
Q Consensus       957 ~~~f~La~~~g~l~~a~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~w~~l~~~al~~g~~~~ 1036 (1339)
                      ++|||||+|+|+|++|.++|.+.++      +                              .||++||++|+..|++.+
T Consensus       641 d~rFelal~lgrl~iA~~la~e~~s------~------------------------------~Kw~~Lg~~al~~~~l~l  684 (794)
T KOG0276|consen  641 DQRFELALKLGRLDIAFDLAVEANS------E------------------------------VKWRQLGDAALSAGELPL  684 (794)
T ss_pred             hhhhhhhhhcCcHHHHHHHHHhhcc------h------------------------------HHHHHHHHHHhhcccchh
Confidence            9999999999999999999975322      2                              699999999999999999


Q ss_pred             HHHHHHHHHhcCCccccccccchhhhHHHhHhcCChhHHHHHHHHHHHcCCChHHHHHH-HHcCCHHHHHHHHHHcCCch
Q 000709         1037 AREALKRLAAAGSVKGALQGHELRGLALRLANHGELTRLSGLVTNLISLGLGREAAFSA-AILGDNALMEKAWQDTGMLA 1115 (1339)
Q Consensus      1037 a~~~~~~~~~~~~~~~~~~~~d~~~l~ll~~~~g~~~~l~~l~~~a~~~~~~~~~af~~-~~lgd~~~~~~~l~~~~~~~ 1115 (1339)
                      |.|||+|+   .         ||.+|+|||++.|+.+.|.+|++.|+++|++ |.||.| +++||+++|.++|++|+|+|
T Consensus       685 A~EC~~~a---~---------d~~~LlLl~t~~g~~~~l~~la~~~~~~g~~-N~AF~~~~l~g~~~~C~~lLi~t~r~p  751 (794)
T KOG0276|consen  685 ASECFLRA---R---------DLGSLLLLYTSSGNAEGLAVLASLAKKQGKN-NLAFLAYFLSGDYEECLELLISTQRLP  751 (794)
T ss_pred             HHHHHHhh---c---------chhhhhhhhhhcCChhHHHHHHHHHHhhccc-chHHHHHHHcCCHHHHHHHHHhcCcCc
Confidence            99999999   7         9999999999999999999999999999999 889999 69999999999999999999


Q ss_pred             HHHHHHHHhCCCChHHHHHHHHHHHhhhcC
Q 000709         1116 EAVLHAHAHGRPSLKNLVEAWNKMLQKEVD 1145 (1339)
Q Consensus      1116 ~A~~~A~t~~~~~~~~~~~~w~~~l~~~~~ 1145 (1339)
                      ||+||||||+|++++++|++||++|.+..+
T Consensus       752 eAal~ArtYlps~vs~iv~~wk~~l~k~~~  781 (794)
T KOG0276|consen  752 EAALFARTYLPSQVSRIVELWKEDLSKVSE  781 (794)
T ss_pred             HHHHHHhhhChHHHHHHHHHHHHHhhhhhh
Confidence            999999999999999999999999995533

>KOG0292 consensus Vesicle coat complex COPI, alpha subunit [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment	Back alignment and domain information

>KOG0271 consensus Notchless-like WD40 repeat-containing protein [Function unknown]	Back alignment and domain information

>KOG0271 consensus Notchless-like WD40 repeat-containing protein [Function unknown]	Back alignment and domain information

>KOG0286 consensus G-protein beta subunit [General function prediction only]	Back alignment and domain information

>KOG0272 consensus U4/U6 small nuclear ribonucleoprotein Prp4 (contains WD40 repeats) [RNA processing and modification]	Back alignment and domain information

>KOG0292 consensus Vesicle coat complex COPI, alpha subunit [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG0318 consensus WD40 repeat stress protein/actin interacting protein [Cytoskeleton]	Back alignment and domain information

>KOG0291 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification]	Back alignment and domain information

>KOG0276 consensus Vesicle coat complex COPI, beta' subunit [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG0319 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification]	Back alignment and domain information

>KOG0272 consensus U4/U6 small nuclear ribonucleoprotein Prp4 (contains WD40 repeats) [RNA processing and modification]	Back alignment and domain information

>KOG0645 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>KOG0295 consensus WD40 repeat-containing protein [Function unknown]	Back alignment and domain information

>KOG0279 consensus G protein beta subunit-like protein [Signal transduction mechanisms]	Back alignment and domain information

>KOG0285 consensus Pleiotropic regulator 1 [RNA processing and modification]	Back alignment and domain information

>KOG0273 consensus Beta-transducin family (WD-40 repeat) protein [Chromatin structure and dynamics]	Back alignment and domain information

>KOG0319 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification]	Back alignment and domain information

>KOG0315 consensus G-protein beta subunit-like protein (contains WD40 repeats) [General function prediction only]	Back alignment and domain information

>KOG0291 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification]	Back alignment and domain information

>KOG0284 consensus Polyadenylation factor I complex, subunit PFS2 [RNA processing and modification]	Back alignment and domain information

>KOG0263 consensus Transcription initiation factor TFIID, subunit TAF5 (also component of histone acetyltransferase SAGA) [Transcription]	Back alignment and domain information

>KOG0296 consensus Angio-associated migratory cell protein (contains WD40 repeats) [Function unknown]	Back alignment and domain information

>KOG0318 consensus WD40 repeat stress protein/actin interacting protein [Cytoskeleton]	Back alignment and domain information

>KOG0315 consensus G-protein beta subunit-like protein (contains WD40 repeats) [General function prediction only]	Back alignment and domain information

>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto

Back alignment and domain information

>KOG0279 consensus G protein beta subunit-like protein [Signal transduction mechanisms]	Back alignment and domain information

>KOG0281 consensus Beta-TrCP (transducin repeats containing)/Slimb proteins [Function unknown]	Back alignment and domain information

>KOG0266 consensus WD40 repeat-containing protein [General function prediction only]	Back alignment and domain information

>KOG0265 consensus U5 snRNP-specific protein-like factor and related proteins [RNA processing and modification]	Back alignment and domain information

>KOG0263 consensus Transcription initiation factor TFIID, subunit TAF5 (also component of histone acetyltransferase SAGA) [Transcription]	Back alignment and domain information

>PLN00181 protein SPA1-RELATED; Provisional	Back alignment and domain information

>KOG0306 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification]	Back alignment and domain information

>KOG0273 consensus Beta-transducin family (WD-40 repeat) protein [Chromatin structure and dynamics]	Back alignment and domain information

>KOG0281 consensus Beta-TrCP (transducin repeats containing)/Slimb proteins [Function unknown]	Back alignment and domain information

>KOG0282 consensus mRNA splicing factor [Function unknown]	Back alignment and domain information

>KOG0286 consensus G-protein beta subunit [General function prediction only]	Back alignment and domain information

>KOG0295 consensus WD40 repeat-containing protein [Function unknown]	Back alignment and domain information

>KOG0316 consensus Conserved WD40 repeat-containing protein [Function unknown]	Back alignment and domain information

>KOG0293 consensus WD40 repeat-containing protein [Function unknown]	Back alignment and domain information

>KOG0275 consensus Conserved WD40 repeat-containing protein [General function prediction only]	Back alignment and domain information

>KOG0313 consensus Microtubule binding protein YTM1 (contains WD40 repeats) [Cytoskeleton]	Back alignment and domain information

>KOG0306 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification]	Back alignment and domain information

>KOG0284 consensus Polyadenylation factor I complex, subunit PFS2 [RNA processing and modification]	Back alignment and domain information

>KOG0285 consensus Pleiotropic regulator 1 [RNA processing and modification]	Back alignment and domain information

>KOG2048 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>KOG0266 consensus WD40 repeat-containing protein [General function prediction only]	Back alignment and domain information

>KOG0265 consensus U5 snRNP-specific protein-like factor and related proteins [RNA processing and modification]	Back alignment and domain information

>KOG0296 consensus Angio-associated migratory cell protein (contains WD40 repeats) [Function unknown]	Back alignment and domain information

>PLN00181 protein SPA1-RELATED; Provisional	Back alignment and domain information

>KOG0293 consensus WD40 repeat-containing protein [Function unknown]	Back alignment and domain information

>KOG0645 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>KOG0274 consensus Cdc4 and related F-box and WD-40 proteins [General function prediction only]	Back alignment and domain information

>KOG0313 consensus Microtubule binding protein YTM1 (contains WD40 repeats) [Cytoskeleton]	Back alignment and domain information

Back alignment and domain information

>KOG2106 consensus Uncharacterized conserved protein, contains HELP and WD40 domains [Function unknown]	Back alignment and domain information

>KOG0640 consensus mRNA cleavage stimulating factor complex; subunit 1 [RNA processing and modification]	Back alignment and domain information

>KOG0282 consensus mRNA splicing factor [Function unknown]	Back alignment and domain information

>KOG0283 consensus WD40 repeat-containing protein [Function unknown]	Back alignment and domain information

>KOG0641 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>KOG0274 consensus Cdc4 and related F-box and WD-40 proteins [General function prediction only]	Back alignment and domain information

>KOG0277 consensus Peroxisomal targeting signal type 2 receptor [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG0643 consensus Translation initiation factor 3, subunit i (eIF-3i)/TGF-beta receptor-interacting protein (TRIP-1) [Translation, ribosomal structure and biogenesis; Signal transduction mechanisms]	Back alignment and domain information

>KOG0278 consensus Serine/threonine kinase receptor-associated protein [Lipid transport and metabolism]	Back alignment and domain information

>KOG0973 consensus Histone transcription regulator HIRA, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning; Transcription]	Back alignment and domain information

>KOG0772 consensus Uncharacterized conserved protein, contains WD40 repeat [Function unknown]	Back alignment and domain information

>KOG0310 consensus Conserved WD40 repeat-containing protein [Function unknown]	Back alignment and domain information

>KOG0301 consensus Phospholipase A2-activating protein (contains WD40 repeats) [Lipid transport and metabolism]	Back alignment and domain information

>KOG0300 consensus WD40 repeat-containing protein [Function unknown]	Back alignment and domain information

>KOG1539 consensus WD repeat protein [General function prediction only]	Back alignment and domain information

>KOG0275 consensus Conserved WD40 repeat-containing protein [General function prediction only]	Back alignment and domain information

>KOG2096 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>KOG1407 consensus WD40 repeat protein [Function unknown]	Back alignment and domain information

>KOG1408 consensus WD40 repeat protein [Function unknown]	Back alignment and domain information

>KOG0316 consensus Conserved WD40 repeat-containing protein [Function unknown]	Back alignment and domain information

>PTZ00421 coronin; Provisional	Back alignment and domain information

>KOG1063 consensus RNA polymerase II elongator complex, subunit ELP2, WD repeat superfamily [Chromatin structure and dynamics; Transcription]	Back alignment and domain information

>KOG0268 consensus Sof1-like rRNA processing protein (contains WD40 repeats) [RNA processing and modification]	Back alignment and domain information

>PTZ00420 coronin; Provisional	Back alignment and domain information

>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only]	Back alignment and domain information

>KOG0308 consensus Conserved WD40 repeat-containing protein [Function unknown]	Back alignment and domain information

>KOG0305 consensus Anaphase promoting complex, Cdc20, Cdh1, and Ama1 subunits [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0288 consensus WD40 repeat protein TipD [General function prediction only]	Back alignment and domain information

>PTZ00421 coronin; Provisional	Back alignment and domain information

>KOG1446 consensus Histone H3 (Lys4) methyltransferase complex and RNA cleavage factor II complex, subunit SWD2 [RNA processing and modification; Chromatin structure and dynamics; Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0289 consensus mRNA splicing factor [General function prediction only]	Back alignment and domain information

>KOG1539 consensus WD repeat protein [General function prediction only]	Back alignment and domain information

>KOG0299 consensus U3 snoRNP-associated protein (contains WD40 repeats) [RNA processing and modification]	Back alignment and domain information

>KOG1063 consensus RNA polymerase II elongator complex, subunit ELP2, WD repeat superfamily [Chromatin structure and dynamics; Transcription]	Back alignment and domain information

>KOG0277 consensus Peroxisomal targeting signal type 2 receptor [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG0308 consensus Conserved WD40 repeat-containing protein [Function unknown]	Back alignment and domain information

>KOG0640 consensus mRNA cleavage stimulating factor complex; subunit 1 [RNA processing and modification]	Back alignment and domain information

>KOG0310 consensus Conserved WD40 repeat-containing protein [Function unknown]	Back alignment and domain information

>KOG1332 consensus Vesicle coat complex COPII, subunit SEC13 [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG1524 consensus WD40 repeat-containing protein CHE-2 [General function prediction only]	Back alignment and domain information

>KOG0299 consensus U3 snoRNP-associated protein (contains WD40 repeats) [RNA processing and modification]	Back alignment and domain information

>KOG0264 consensus Nucleosome remodeling factor, subunit CAF1/NURF55/MSI1 [Chromatin structure and dynamics]	Back alignment and domain information

>KOG0643 consensus Translation initiation factor 3, subunit i (eIF-3i)/TGF-beta receptor-interacting protein (TRIP-1) [Translation, ribosomal structure and biogenesis; Signal transduction mechanisms]	Back alignment and domain information

>KOG0305 consensus Anaphase promoting complex, Cdc20, Cdh1, and Ama1 subunits [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0973 consensus Histone transcription regulator HIRA, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning; Transcription]	Back alignment and domain information

>KOG0278 consensus Serine/threonine kinase receptor-associated protein [Lipid transport and metabolism]	Back alignment and domain information

>PTZ00420 coronin; Provisional	Back alignment and domain information

>KOG0307 consensus Vesicle coat complex COPII, subunit SEC31 [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG2055 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>KOG0647 consensus mRNA export protein (contains WD40 repeats) [RNA processing and modification]	Back alignment and domain information

>KOG0639 consensus Transducin-like enhancer of split protein (contains WD40 repeats) [Chromatin structure and dynamics]	Back alignment and domain information

>KOG0650 consensus WD40 repeat nucleolar protein Bop1, involved in ribosome biogenesis [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>KOG0283 consensus WD40 repeat-containing protein [Function unknown]	Back alignment and domain information

>KOG1407 consensus WD40 repeat protein [Function unknown]	Back alignment and domain information

>KOG1332 consensus Vesicle coat complex COPII, subunit SEC13 [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG0294 consensus WD40 repeat-containing protein [Function unknown]	Back alignment and domain information

>KOG0264 consensus Nucleosome remodeling factor, subunit CAF1/NURF55/MSI1 [Chromatin structure and dynamics]	Back alignment and domain information

>KOG2048 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>KOG1408 consensus WD40 repeat protein [Function unknown]	Back alignment and domain information

>KOG0288 consensus WD40 repeat protein TipD [General function prediction only]	Back alignment and domain information

>KOG0289 consensus mRNA splicing factor [General function prediction only]	Back alignment and domain information

>KOG0647 consensus mRNA export protein (contains WD40 repeats) [RNA processing and modification]	Back alignment and domain information

>KOG1036 consensus Mitotic spindle checkpoint protein BUB3, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>KOG0300 consensus WD40 repeat-containing protein [Function unknown]	Back alignment and domain information

>KOG0641 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>KOG0269 consensus WD40 repeat-containing protein [Function unknown]	Back alignment and domain information

>KOG0646 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein	Back alignment and domain information

>KOG1036 consensus Mitotic spindle checkpoint protein BUB3, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>KOG4328 consensus WD40 protein [Function unknown]	Back alignment and domain information

>KOG0301 consensus Phospholipase A2-activating protein (contains WD40 repeats) [Lipid transport and metabolism]	Back alignment and domain information

>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein	Back alignment and domain information

>KOG1274 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>KOG0269 consensus WD40 repeat-containing protein [Function unknown]	Back alignment and domain information

>KOG0267 consensus Microtubule severing protein katanin p80 subunit B (contains WD40 repeats) [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only]	Back alignment and domain information

>KOG0294 consensus WD40 repeat-containing protein [Function unknown]	Back alignment and domain information

>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only]	Back alignment and domain information

>KOG0646 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>KOG2445 consensus Nuclear pore complex component (sc Seh1) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG4283 consensus Transcription-coupled repair protein CSA, contains WD40 domain [Transcription; Replication, recombination and repair]	Back alignment and domain information

>KOG2106 consensus Uncharacterized conserved protein, contains HELP and WD40 domains [Function unknown]	Back alignment and domain information

>KOG0772 consensus Uncharacterized conserved protein, contains WD40 repeat [Function unknown]	Back alignment and domain information

>KOG0302 consensus Ribosome Assembly protein [General function prediction only]	Back alignment and domain information

>KOG0267 consensus Microtubule severing protein katanin p80 subunit B (contains WD40 repeats) [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>KOG1446 consensus Histone H3 (Lys4) methyltransferase complex and RNA cleavage factor II complex, subunit SWD2 [RNA processing and modification; Chromatin structure and dynamics; Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG2919 consensus Guanine nucleotide-binding protein [General function prediction only]	Back alignment and domain information

>KOG0268 consensus Sof1-like rRNA processing protein (contains WD40 repeats) [RNA processing and modification]	Back alignment and domain information

>KOG2445 consensus Nuclear pore complex component (sc Seh1) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG2096 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>KOG4378 consensus Nuclear protein COP1 [Signal transduction mechanisms]	Back alignment and domain information

>KOG0639 consensus Transducin-like enhancer of split protein (contains WD40 repeats) [Chromatin structure and dynamics]	Back alignment and domain information

>KOG1007 consensus WD repeat protein TSSC1, WD repeat superfamily [Function unknown]	Back alignment and domain information

>KOG0321 consensus WD40 repeat-containing protein L2DTL [Function unknown]	Back alignment and domain information

>KOG1274 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>KOG1034 consensus Transcriptional repressor EED/ESC/FIE, required for transcriptional silencing, WD repeat superfamily [Transcription]	Back alignment and domain information

>KOG0321 consensus WD40 repeat-containing protein L2DTL [Function unknown]	Back alignment and domain information

>KOG0302 consensus Ribosome Assembly protein [General function prediction only]	Back alignment and domain information

>KOG0650 consensus WD40 repeat nucleolar protein Bop1, involved in ribosome biogenesis [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>COG2319 FOG: WD40 repeat [General function prediction only]	Back alignment and domain information

>KOG4283 consensus Transcription-coupled repair protein CSA, contains WD40 domain [Transcription; Replication, recombination and repair]	Back alignment and domain information

>KOG1273 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>KOG4378 consensus Nuclear protein COP1 [Signal transduction mechanisms]	Back alignment and domain information

>KOG1517 consensus Guanine nucleotide binding protein MIP1 [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>KOG1445 consensus Tumor-specific antigen (contains WD repeats) [Cytoskeleton]	Back alignment and domain information

>KOG0270 consensus WD40 repeat-containing protein [Function unknown]	Back alignment and domain information

>KOG1273 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>KOG0307 consensus Vesicle coat complex COPII, subunit SEC31 [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG2055 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>KOG1007 consensus WD repeat protein TSSC1, WD repeat superfamily [Function unknown]	Back alignment and domain information

>KOG0270 consensus WD40 repeat-containing protein [Function unknown]	Back alignment and domain information

>KOG1963 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>KOG4227 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>KOG2041 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>KOG0322 consensus G-protein beta subunit-like protein GNB1L, contains WD repeats [General function prediction only]	Back alignment and domain information

>KOG1034 consensus Transcriptional repressor EED/ESC/FIE, required for transcriptional silencing, WD repeat superfamily [Transcription]	Back alignment and domain information

>KOG1240 consensus Protein kinase containing WD40 repeats [Signal transduction mechanisms]	Back alignment and domain information

>KOG0303 consensus Actin-binding protein Coronin, contains WD40 repeats [Cytoskeleton]	Back alignment and domain information

>KOG0290 consensus Conserved WD40 repeat-containing protein AN11 [Function unknown]	Back alignment and domain information

>KOG4328 consensus WD40 protein [Function unknown]	Back alignment and domain information

>KOG0644 consensus Uncharacterized conserved protein, contains WD40 repeat and BROMO domains [General function prediction only]	Back alignment and domain information

>COG2319 FOG: WD40 repeat [General function prediction only]	Back alignment and domain information

>KOG1188 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>KOG0642 consensus Cell-cycle nuclear protein, contains WD-40 repeats [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>KOG1188 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>KOG0290 consensus Conserved WD40 repeat-containing protein AN11 [Function unknown]	Back alignment and domain information

>KOG2919 consensus Guanine nucleotide-binding protein [General function prediction only]	Back alignment and domain information

>KOG1334 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>KOG0649 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>KOG4497 consensus Uncharacterized conserved protein WDR8, contains WD repeats [General function prediction only]	Back alignment and domain information

>KOG1587 consensus Cytoplasmic dynein intermediate chain [Cytoskeleton]	Back alignment and domain information

>KOG1963 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>KOG0644 consensus Uncharacterized conserved protein, contains WD40 repeat and BROMO domains [General function prediction only]	Back alignment and domain information

>KOG0649 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>KOG1009 consensus Chromatin assembly complex 1 subunit B/CAC2 (contains WD40 repeats) [Chromatin structure and dynamics; Replication, recombination and repair]	Back alignment and domain information

>KOG1587 consensus Cytoplasmic dynein intermediate chain [Cytoskeleton]	Back alignment and domain information

>PRK11028 6-phosphogluconolactonase; Provisional	Back alignment and domain information

>PRK11028 6-phosphogluconolactonase; Provisional	Back alignment and domain information

>KOG1310 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>KOG1310 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>KOG1517 consensus Guanine nucleotide binding protein MIP1 [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>KOG0303 consensus Actin-binding protein Coronin, contains WD40 repeats [Cytoskeleton]	Back alignment and domain information

>KOG1009 consensus Chromatin assembly complex 1 subunit B/CAC2 (contains WD40 repeats) [Chromatin structure and dynamics; Replication, recombination and repair]	Back alignment and domain information

>KOG1445 consensus Tumor-specific antigen (contains WD repeats) [Cytoskeleton]	Back alignment and domain information

>KOG0642 consensus Cell-cycle nuclear protein, contains WD-40 repeats [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>KOG1272 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification]	Back alignment and domain information

>PRK01742 tolB translocation protein TolB; Provisional	Back alignment and domain information

>KOG0771 consensus Prolactin regulatory element-binding protein/Protein transport protein SEC12p [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG4227 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>KOG4497 consensus Uncharacterized conserved protein WDR8, contains WD repeats [General function prediction only]	Back alignment and domain information

>PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A	Back alignment and domain information

>KOG2110 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown]	Back alignment and domain information

>KOG0322 consensus G-protein beta subunit-like protein GNB1L, contains WD repeats [General function prediction only]	Back alignment and domain information

>PRK01742 tolB translocation protein TolB; Provisional	Back alignment and domain information

>KOG0771 consensus Prolactin regulatory element-binding protein/Protein transport protein SEC12p [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG1523 consensus Actin-related protein Arp2/3 complex, subunit ARPC1/p41-ARC [Cytoskeleton]	Back alignment and domain information

>KOG2139 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>KOG0974 consensus WD-repeat protein WDR6, WD repeat superfamily [General function prediction only]	Back alignment and domain information

>KOG1240 consensus Protein kinase containing WD40 repeats [Signal transduction mechanisms]	Back alignment and domain information

>KOG2111 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown]	Back alignment and domain information

>KOG1523 consensus Actin-related protein Arp2/3 complex, subunit ARPC1/p41-ARC [Cytoskeleton]	Back alignment and domain information

>KOG2394 consensus WD40 protein DMR-N9 [General function prediction only]	Back alignment and domain information

>KOG2110 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown]	Back alignment and domain information

>KOG2394 consensus WD40 protein DMR-N9 [General function prediction only]	Back alignment and domain information

>KOG2321 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>KOG1334 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>PF04762 IKI3: IKI3 family; InterPro: IPR006849 Members of this family are components of the elongator multi-subunit component of a novel RNA polymerase II holoenzyme for transcriptional elongation []	Back alignment and domain information

>KOG3881 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>PRK03629 tolB translocation protein TolB; Provisional	Back alignment and domain information

>KOG1409 consensus Uncharacterized conserved protein, contains WD40 repeats and FYVE domains [Function unknown]	Back alignment and domain information

>KOG1272 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification]	Back alignment and domain information

>KOG0974 consensus WD-repeat protein WDR6, WD repeat superfamily [General function prediction only]	Back alignment and domain information

>PRK04922 tolB translocation protein TolB; Provisional	Back alignment and domain information

>KOG3881 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG2139 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>KOG1064 consensus RAVE (regulator of V-ATPase assembly) complex subunit RAV1/DMX protein, WD repeat superfamily [General function prediction only]	Back alignment and domain information

>KOG1524 consensus WD40 repeat-containing protein CHE-2 [General function prediction only]	Back alignment and domain information

>KOG2111 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown]	Back alignment and domain information

>PRK05137 tolB translocation protein TolB; Provisional	Back alignment and domain information

>PRK02889 tolB translocation protein TolB; Provisional	Back alignment and domain information

>PF08662 eIF2A: Eukaryotic translation initiation factor eIF2A; InterPro: IPR013979 This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins	Back alignment and domain information

>PRK03629 tolB translocation protein TolB; Provisional	Back alignment and domain information

>KOG2041 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A	Back alignment and domain information

>PRK04922 tolB translocation protein TolB; Provisional	Back alignment and domain information

>KOG1354 consensus Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms]	Back alignment and domain information

>KOG0280 consensus Uncharacterized conserved protein [Amino acid transport and metabolism]	Back alignment and domain information

>KOG2321 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>COG4946 Uncharacterized protein related to the periplasmic component of the Tol biopolymer transport system [Function unknown]	Back alignment and domain information

>KOG4190 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB	Back alignment and domain information

>KOG1354 consensus Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms]	Back alignment and domain information

>KOG4547 consensus WD40 repeat-containing protein [General function prediction only]	Back alignment and domain information

>KOG0280 consensus Uncharacterized conserved protein [Amino acid transport and metabolism]	Back alignment and domain information

>PRK05137 tolB translocation protein TolB; Provisional	Back alignment and domain information

>COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism]	Back alignment and domain information

>PRK02889 tolB translocation protein TolB; Provisional	Back alignment and domain information

>PF08662 eIF2A: Eukaryotic translation initiation factor eIF2A; InterPro: IPR013979 This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins	Back alignment and domain information

>PRK04792 tolB translocation protein TolB; Provisional	Back alignment and domain information

>PRK00178 tolB translocation protein TolB; Provisional	Back alignment and domain information

>KOG1912 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain	Back alignment and domain information

>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3	Back alignment and domain information

>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3	Back alignment and domain information

>KOG4547 consensus WD40 repeat-containing protein [General function prediction only]	Back alignment and domain information

>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB	Back alignment and domain information

>KOG2315 consensus Predicted translation initiation factor related to eIF-3a [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL	Back alignment and domain information

>KOG3914 consensus WD repeat protein WDR4 [Function unknown]	Back alignment and domain information

>PRK00178 tolB translocation protein TolB; Provisional	Back alignment and domain information

>PRK01029 tolB translocation protein TolB; Provisional	Back alignment and domain information

>KOG2314 consensus Translation initiation factor 3, subunit b (eIF-3b) [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>PRK04792 tolB translocation protein TolB; Provisional	Back alignment and domain information

>KOG1064 consensus RAVE (regulator of V-ATPase assembly) complex subunit RAV1/DMX protein, WD repeat superfamily [General function prediction only]	Back alignment and domain information

>KOG2695 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>COG5354 Uncharacterized protein, contains Trp-Asp (WD) repeat [General function prediction only]	Back alignment and domain information

>PRK01029 tolB translocation protein TolB; Provisional	Back alignment and domain information

>KOG1409 consensus Uncharacterized conserved protein, contains WD40 repeats and FYVE domains [Function unknown]	Back alignment and domain information

>KOG0309 consensus Conserved WD40 repeat-containing protein [Function unknown]	Back alignment and domain information

>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL	Back alignment and domain information

>PLN02919 haloacid dehalogenase-like hydrolase family protein	Back alignment and domain information

>COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism]	Back alignment and domain information

>KOG3914 consensus WD repeat protein WDR4 [Function unknown]	Back alignment and domain information

>KOG2315 consensus Predicted translation initiation factor related to eIF-3a [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain	Back alignment and domain information

>KOG1832 consensus HIV-1 Vpr-binding protein [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only]	Back alignment and domain information

>KOG2314 consensus Translation initiation factor 3, subunit b (eIF-3b) [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>KOG1912 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>KOG0309 consensus Conserved WD40 repeat-containing protein [Function unknown]	Back alignment and domain information

>PF00400 WD40: WD domain, G-beta repeat; InterPro: IPR019781 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide	Back alignment and domain information

>KOG1832 consensus HIV-1 Vpr-binding protein [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>COG5354 Uncharacterized protein, contains Trp-Asp (WD) repeat [General function prediction only]	Back alignment and domain information

>KOG4532 consensus WD40-like repeat containing protein [General function prediction only]	Back alignment and domain information

>KOG4714 consensus Nucleoporin [Nuclear structure]	Back alignment and domain information

>PLN02919 haloacid dehalogenase-like hydrolase family protein	Back alignment and domain information

>KOG4714 consensus Nucleoporin [Nuclear structure]	Back alignment and domain information

>PRK11138 outer membrane biogenesis protein BamB; Provisional	Back alignment and domain information

>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species	Back alignment and domain information

>COG5170 CDC55 Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms]	Back alignment and domain information

>KOG2695 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>KOG4532 consensus WD40-like repeat containing protein [General function prediction only]	Back alignment and domain information

>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>PF04762 IKI3: IKI3 family; InterPro: IPR006849 Members of this family are components of the elongator multi-subunit component of a novel RNA polymerase II holoenzyme for transcriptional elongation []	Back alignment and domain information

>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A	Back alignment and domain information

>COG5170 CDC55 Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms]	Back alignment and domain information

>PF15492 Nbas_N: Neuroblastoma-amplified sequence, N terminal	Back alignment and domain information

>KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription]	Back alignment and domain information

>PF07433 DUF1513: Protein of unknown function (DUF1513); InterPro: IPR008311 There are currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function	Back alignment and domain information

>PRK04043 tolB translocation protein TolB; Provisional	Back alignment and domain information

>KOG1275 consensus PAB-dependent poly(A) ribonuclease, subunit PAN2 [Replication, recombination and repair]	Back alignment and domain information

>PF15492 Nbas_N: Neuroblastoma-amplified sequence, N terminal	Back alignment and domain information

>KOG4190 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>PRK11138 outer membrane biogenesis protein BamB; Provisional	Back alignment and domain information

>PRK04043 tolB translocation protein TolB; Provisional	Back alignment and domain information

>PF00400 WD40: WD domain, G-beta repeat; InterPro: IPR019781 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide	Back alignment and domain information

>KOG2066 consensus Vacuolar assembly/sorting protein VPS41 [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>COG4946 Uncharacterized protein related to the periplasmic component of the Tol biopolymer transport system [Function unknown]	Back alignment and domain information

>KOG1275 consensus PAB-dependent poly(A) ribonuclease, subunit PAN2 [Replication, recombination and repair]	Back alignment and domain information

>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species	Back alignment and domain information

>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A	Back alignment and domain information

>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG2066 consensus Vacuolar assembly/sorting protein VPS41 [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription]	Back alignment and domain information

>KOG3621 consensus WD40 repeat-containing protein [General function prediction only]	Back alignment and domain information

>KOG1645 consensus RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG4649 consensus PQQ (pyrrolo-quinoline quinone) repeat protein [Secondary metabolites biosynthesis, transport and catabolism]	Back alignment and domain information

>KOG1008 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown]	Back alignment and domain information

>KOG0882 consensus Cyclophilin-related peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF07433 DUF1513: Protein of unknown function (DUF1513); InterPro: IPR008311 There are currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function	Back alignment and domain information

>PF08596 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; InterPro: IPR013905 The Lethal giant larvae (Lgl) tumour suppressor protein is conserved from yeast to mammals	Back alignment and domain information

>PF11768 DUF3312: Protein of unknown function (DUF3312); InterPro: IPR024511 This is a eukaryotic family of uncharacterised proteins that contain WD40 repeats	Back alignment and domain information

>KOG4649 consensus PQQ (pyrrolo-quinoline quinone) repeat protein [Secondary metabolites biosynthesis, transport and catabolism]	Back alignment and domain information

>PRK02888 nitrous-oxide reductase; Validated	Back alignment and domain information

>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment	Back alignment and domain information

>smart00320 WD40 WD40 repeats	Back alignment and domain information

>PF06977 SdiA-regulated: SdiA-regulated; InterPro: IPR009722 This entry represents a conserved region approximately 100 residues long within a number of hypothetical bacterial proteins that may be regulated by SdiA, a member of the LuxR family of transcriptional regulators []	Back alignment and domain information

>KOG0882 consensus Cyclophilin-related peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG1645 consensus RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF06433 Me-amine-dh_H: Methylamine dehydrogenase heavy chain (MADH); InterPro: IPR009451 Methylamine dehydrogenase (1	Back alignment and domain information

>KOG1008 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown]	Back alignment and domain information

>cd00216 PQQ_DH Dehydrogenases with pyrrolo-quinoline quinone (PQQ) as cofactor, like ethanol, methanol, and membrane bound glucose dehydrogenases	Back alignment and domain information

>PF00930 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-terminal region; InterPro: IPR002469 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families	Back alignment and domain information

>PRK02888 nitrous-oxide reductase; Validated	Back alignment and domain information

>PF11768 DUF3312: Protein of unknown function (DUF3312); InterPro: IPR024511 This is a eukaryotic family of uncharacterised proteins that contain WD40 repeats	Back alignment and domain information

>cd00216 PQQ_DH Dehydrogenases with pyrrolo-quinoline quinone (PQQ) as cofactor, like ethanol, methanol, and membrane bound glucose dehydrogenases	Back alignment and domain information

>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional	Back alignment and domain information

>PRK11788 tetratricopeptide repeat protein; Provisional	Back alignment and domain information

>PF00780 CNH: CNH domain; InterPro: IPR001180 Based on sequence similarities a domain of homology has been identified in the following proteins []: Citron and Citron kinase	Back alignment and domain information

>KOG3616 consensus Selective LIM binding factor [Transcription]	Back alignment and domain information

>KOG3621 consensus WD40 repeat-containing protein [General function prediction only]	Back alignment and domain information

>KOG3616 consensus Selective LIM binding factor [Transcription]	Back alignment and domain information

>PLN03218 maturation of RBCL 1; Provisional	Back alignment and domain information

>PF00930 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-terminal region; InterPro: IPR002469 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families	Back alignment and domain information

>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional	Back alignment and domain information

>PLN03218 maturation of RBCL 1; Provisional	Back alignment and domain information

>PRK11447 cellulose synthase subunit BcsC; Provisional	Back alignment and domain information

>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B	Back alignment and domain information

>PF08553 VID27: VID27 cytoplasmic protein; InterPro: IPR013863 This entry represents fungal and plant proteins and contains many hypothetical proteins	Back alignment and domain information

>TIGR03075 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methanol/ethanol family	Back alignment and domain information

>COG0823 TolB Periplasmic component of the Tol biopolymer transport system [Intracellular trafficking and secretion]	Back alignment and domain information

>smart00320 WD40 WD40 repeats	Back alignment and domain information

>PLN03077 Protein ECB2; Provisional	Back alignment and domain information

>PF03178 CPSF_A: CPSF A subunit region; InterPro: IPR004871 This family includes a region that lies towards the C terminus of the cleavage and polyadenylation specificity factor (CPSF) A (160 kDa) subunit	Back alignment and domain information

>PF14583 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C5M_C 3PE7_A	Back alignment and domain information

>PF05096 Glu_cyclase_2: Glutamine cyclotransferase; InterPro: IPR007788 This family of enzymes 2	Back alignment and domain information

>PF06977 SdiA-regulated: SdiA-regulated; InterPro: IPR009722 This entry represents a conserved region approximately 100 residues long within a number of hypothetical bacterial proteins that may be regulated by SdiA, a member of the LuxR family of transcriptional regulators []	Back alignment and domain information

>COG3386 Gluconolactonase [Carbohydrate transport and metabolism]	Back alignment and domain information

>PLN03077 Protein ECB2; Provisional	Back alignment and domain information

>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion]	Back alignment and domain information

>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional	Back alignment and domain information

>KOG4441 consensus Proteins containing BTB/POZ and Kelch domains, involved in regulatory/signal transduction processes [Signal transduction mechanisms; General function prediction only]	Back alignment and domain information

>PF06433 Me-amine-dh_H: Methylamine dehydrogenase heavy chain (MADH); InterPro: IPR009451 Methylamine dehydrogenase (1	Back alignment and domain information

>PF08553 VID27: VID27 cytoplasmic protein; InterPro: IPR013863 This entry represents fungal and plant proteins and contains many hypothetical proteins	Back alignment and domain information

>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein	Back alignment and domain information

>PRK11788 tetratricopeptide repeat protein; Provisional	Back alignment and domain information

>PF14783 BBS2_Mid: Ciliary BBSome complex subunit 2, middle region	Back alignment and domain information

>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein	Back alignment and domain information

>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70)	Back alignment and domain information

>PF03178 CPSF_A: CPSF A subunit region; InterPro: IPR004871 This family includes a region that lies towards the C terminus of the cleavage and polyadenylation specificity factor (CPSF) A (160 kDa) subunit	Back alignment and domain information

>PRK10747 putative protoheme IX biogenesis protein; Provisional	Back alignment and domain information

>KOG1897 consensus Damage-specific DNA binding complex, subunit DDB1 [Replication, recombination and repair]	Back alignment and domain information

>COG0823 TolB Periplasmic component of the Tol biopolymer transport system [Intracellular trafficking and secretion]	Back alignment and domain information

>KOG1897 consensus Damage-specific DNA binding complex, subunit DDB1 [Replication, recombination and repair]	Back alignment and domain information

>PF04841 Vps16_N: Vps16, N-terminal region; InterPro: IPR006926 This protein forms part of the Class C vacuolar protein sorting (Vps) complex	Back alignment and domain information

>KOG4640 consensus Anaphase-promoting complex (APC), subunit 4 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF14583 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C5M_C 3PE7_A	Back alignment and domain information

>COG3391 Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>PF04841 Vps16_N: Vps16, N-terminal region; InterPro: IPR006926 This protein forms part of the Class C vacuolar protein sorting (Vps) complex	Back alignment and domain information

>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70)	Back alignment and domain information

>PHA02713 hypothetical protein; Provisional	Back alignment and domain information

>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW	Back alignment and domain information

>KOG2079 consensus Vacuolar assembly/sorting protein VPS8 [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>PF02897 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal beta-propeller domain; InterPro: IPR004106 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families	Back alignment and domain information

>KOG2444 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>PF12894 Apc4_WD40: Anaphase-promoting complex subunit 4 WD40 domain	Back alignment and domain information

>KOG4640 consensus Anaphase-promoting complex (APC), subunit 4 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF14783 BBS2_Mid: Ciliary BBSome complex subunit 2, middle region	Back alignment and domain information

>KOG2079 consensus Vacuolar assembly/sorting protein VPS8 [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription]	Back alignment and domain information

>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG2395 consensus Protein involved in vacuole import and degradation [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>PF14655 RAB3GAP2_N: Rab3 GTPase-activating protein regulatory subunit N-terminus	Back alignment and domain information

>PRK11447 cellulose synthase subunit BcsC; Provisional	Back alignment and domain information

>PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs	Back alignment and domain information

>KOG4499 consensus Ca2+-binding protein Regucalcin/SMP30 [Inorganic ion transport and metabolism; Signal transduction mechanisms]	Back alignment and domain information

>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW	Back alignment and domain information

>COG3204 Uncharacterized protein conserved in bacteria [Function unknown]	Back alignment and domain information

>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional	Back alignment and domain information

>COG3386 Gluconolactonase [Carbohydrate transport and metabolism]	Back alignment and domain information

>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion]	Back alignment and domain information

>PRK10049 pgaA outer membrane protein PgaA; Provisional	Back alignment and domain information

>PRK10747 putative protoheme IX biogenesis protein; Provisional	Back alignment and domain information

>COG3490 Uncharacterized protein conserved in bacteria [Function unknown]	Back alignment and domain information

>COG3391 Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG2003 consensus TPR repeat-containing protein [General function prediction only]	Back alignment and domain information

>PRK12370 invasion protein regulator; Provisional	Back alignment and domain information

>PRK15174 Vi polysaccharide export protein VexE; Provisional	Back alignment and domain information

>KOG2395 consensus Protein involved in vacuole import and degradation [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>PRK15174 Vi polysaccharide export protein VexE; Provisional	Back alignment and domain information

>KOG4441 consensus Proteins containing BTB/POZ and Kelch domains, involved in regulatory/signal transduction processes [Signal transduction mechanisms; General function prediction only]	Back alignment and domain information

>KOG1924 consensus RhoA GTPase effector DIA/Diaphanous [Signal transduction mechanisms; Cytoskeleton]	Back alignment and domain information

>PHA02713 hypothetical protein; Provisional	Back alignment and domain information

>COG3490 Uncharacterized protein conserved in bacteria [Function unknown]	Back alignment and domain information

>PF12234 Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR022033 This domain family is found in eukaryotes, and is typically between 621 and 644 amino acids in length	Back alignment and domain information

>TIGR03075 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methanol/ethanol family	Back alignment and domain information

>PF00780 CNH: CNH domain; InterPro: IPR001180 Based on sequence similarities a domain of homology has been identified in the following proteins []: Citron and Citron kinase	Back alignment and domain information

>PF05694 SBP56: 56kDa selenium binding protein (SBP56); InterPro: IPR008826 This family consists of several eukaryotic selenium binding proteins as well as three sequences from archaea	Back alignment and domain information

>PF08728 CRT10: CRT10; InterPro: IPR014839 CRT10 is a transcriptional regulator of ribonucleotide reductase (RNR) genes []	Back alignment and domain information

>KOG0566 consensus Inositol-1,4,5-triphosphate 5-phosphatase (synaptojanin), INP51/INP52/INP53 family [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function	Back alignment and domain information

>PF12894 Apc4_WD40: Anaphase-promoting complex subunit 4 WD40 domain	Back alignment and domain information

>COG3823 Glutamine cyclotransferase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF05096 Glu_cyclase_2: Glutamine cyclotransferase; InterPro: IPR007788 This family of enzymes 2	Back alignment and domain information

>PRK12370 invasion protein regulator; Provisional	Back alignment and domain information

>PF15390 DUF4613: Domain of unknown function (DUF4613)	Back alignment and domain information

>PF14870 PSII_BNR: Photosynthesis system II assembly factor YCF48; PDB: 2XBG_A	Back alignment and domain information

>PRK13616 lipoprotein LpqB; Provisional	Back alignment and domain information

>TIGR00540 hemY_coli hemY protein	Back alignment and domain information

>PF02897 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal beta-propeller domain; InterPro: IPR004106 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families	Back alignment and domain information

>PRK13616 lipoprotein LpqB; Provisional	Back alignment and domain information

>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>PF12234 Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR022033 This domain family is found in eukaryotes, and is typically between 621 and 644 amino acids in length	Back alignment and domain information

>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional	Back alignment and domain information

>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism]	Back alignment and domain information

>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional	Back alignment and domain information

>KOG2444 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>PRK14950 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK15359 type III secretion system chaperone protein SscB; Provisional	Back alignment and domain information

>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B	Back alignment and domain information

>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD	Back alignment and domain information

>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A	Back alignment and domain information

>PHA03098 kelch-like protein; Provisional	Back alignment and domain information

>KOG1916 consensus Nuclear protein, contains WD40 repeats [General function prediction only]	Back alignment and domain information

>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG1916 consensus Nuclear protein, contains WD40 repeats [General function prediction only]	Back alignment and domain information

>PF08596 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; InterPro: IPR013905 The Lethal giant larvae (Lgl) tumour suppressor protein is conserved from yeast to mammals	Back alignment and domain information

>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription]	Back alignment and domain information

>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>PF07995 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: IPR012938 Proteins containing this domain are thought to be glucose/sorbosone dehydrogenases	Back alignment and domain information

>PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs	Back alignment and domain information

>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK10049 pgaA outer membrane protein PgaA; Provisional	Back alignment and domain information

>PHA03247 large tegument protein UL36; Provisional	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

No hit with probability above 80.00

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	E-value
Query		1339
d1vyhc1		317	b.69.4.1 (C:92-408) Platelet-activating factor ace	2e-15
d1vyhc1		317	b.69.4.1 (C:92-408) Platelet-activating factor ace	2e-06
d1vyhc1		317	b.69.4.1 (C:92-408) Platelet-activating factor ace	0.001
d1p22a2		293	b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (be	3e-11
d1p22a2		293	b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (be	0.003
d1tbga_		340	b.69.4.1 (A:) beta1-subunit of the signal-transduc	5e-10
d1erja_		388	b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yea	1e-09
d1erja_		388	b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yea	2e-08
d1erja_		388	b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yea	0.004
d1sq9a_		393	b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Bake	6e-08
d1sq9a_		393	b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Bake	8e-06
d1sq9a_		393	b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Bake	8e-06
d1nr0a2		299	b.69.4.1 (A:313-611) Actin interacting protein 1 {	6e-08
d1nr0a2		299	b.69.4.1 (A:313-611) Actin interacting protein 1 {	1e-04
d1nr0a2		299	b.69.4.1 (A:313-611) Actin interacting protein 1 {	8e-04
d2ovrb2		342	b.69.4.1 (B:2365-2706) F-box/WD repeat-containing	3e-07
d2ovrb2		342	b.69.4.1 (B:2365-2706) F-box/WD repeat-containing	1e-05
d2ovrb2		342	b.69.4.1 (B:2365-2706) F-box/WD repeat-containing	0.001
d1nexb2		355	b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker'	4e-07
d1nexb2		355	b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker'	3e-05
d1nexb2		355	b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker'	4e-05
d1nexb2		355	b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker'	0.002
d1pgua1		325	b.69.4.1 (A:2-326) Actin interacting protein 1 {Ba	8e-07
d1pgua1		325	b.69.4.1 (A:2-326) Actin interacting protein 1 {Ba	6e-05
d1pgua1		325	b.69.4.1 (A:2-326) Actin interacting protein 1 {Ba	4e-04
d1pgua2		287	b.69.4.1 (A:327-613) Actin interacting protein 1 {	1e-06
d1pgua2		287	b.69.4.1 (A:327-613) Actin interacting protein 1 {	2e-05
d1k8kc_		371	b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1	5e-06
d1k8kc_		371	b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1	7e-06
d1k8kc_		371	b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1	0.002
d1nr0a1		311	b.69.4.1 (A:2-312) Actin interacting protein 1 {Ne	5e-06
d1nr0a1		311	b.69.4.1 (A:2-312) Actin interacting protein 1 {Ne	0.003
d1gxra_		337	b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Hum	6e-06
d1gxra_		337	b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Hum	4e-05
d1gxra_		337	b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Hum	6e-05
d1yfqa_		342	b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Bake	9e-06
d1yfqa_		342	b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Bake	2e-05
d1jmxb_		346	b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase	1e-04
d1pbyb_		337	b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase	2e-04
d2bbkh_		355	b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {	0.001
d1k32a3		360	b.69.9.1 (A:320-679) Tricorn protease domain 2 {Ar	0.002

>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317	Back information, alignment and structure


class: All beta proteins
fold: 7-bladed beta-propeller
superfamily: WD40 repeat-like
family: WD40-repeat
domain: Platelet-activating factor acetylhydrolase IB subunit alpha
species: Mouse (Mus musculus) [TaxId: 10090]

 Score = 76.7 bits (187), Expect = 2e-15
 Identities = 35/314 (11%), Positives = 85/314 (27%), Gaps = 43/314 (13%)

Query: 11  NDKIVKIQLHPTHPWLVTADASDHVSVWNWEHRQVIYELKA--GGVDQRRLVGAKLEKLA 68
              + ++  HP    +V+A     + VW++E       LK     V       +     +
Sbjct: 17  RSPVTRVIFHPVFSVMVSASEDATIKVWDYETGDFERTLKGHTDSVQDISFDHSGKLLAS 76

Query: 69  EGELEHKGKPTEAMRGGSVKQVNFYDDDVRFWQLWRNRAAAAEAPTAVSNV--------- 119
                                     +      +       + +      +         
Sbjct: 77  CSADMTIKLWDFQGFECIRTMHGHDHNVSSVSIMPNGDHIVSASRDKTIKMWEVQTGYCV 136

Query: 120 ------TSGFASPPPSTKGRHFLVICCVNKAIFLDLVTMRGR-------------DIPKQ 160
                         P+  G                + T   +                 +
Sbjct: 137 KTFTGHREWVRMVRPNQDGTLIASCSNDQTVRVWVVATKECKAELREHRHVVECISWAPE 196

Query: 161 ELDNKSLVCMEFLSRSAVGDVPLVAFGSSDGVIRVLSMISWKLVRRYTGGHKGSISCLMT 220
              +         ++ +    P +  GS D  I++  + +   +    G H   +  ++ 
Sbjct: 197 SSYSSISEATGSETKKSGKPGPFLLSGSRDKTIKMWDVSTGMCLMTLVG-HDNWVRGVLF 255

Query: 221 FMASSGEALLVSGGSDGLLILWSADHGQDSRELVPKLSLKAHDGGVVAVELSRVMGGSPQ 280
               SG   ++S   D  L +W   + +         +L AH+  V +++  +    +P 
Sbjct: 256 ---HSGGKFILSCADDKTLRVWDYKNKR------CMKTLNAHEHFVTSLDFHK---TAPY 303

Query: 281 LITIGADKTLAIWD 294
           ++T   D+T+ +W+
Sbjct: 304 VVTGSVDQTVKVWE 317

PyMOL of d1vyhc1

>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317	Back information, alignment and structure

>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317	Back information, alignment and structure

>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 293	Back information, alignment and structure

>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 293	Back information, alignment and structure

>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Length = 340	Back information, alignment and structure

>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 388	Back information, alignment and structure

>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 388	Back information, alignment and structure

>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 388	Back information, alignment and structure

>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 393	Back information, alignment and structure

>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 393	Back information, alignment and structure

>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 393	Back information, alignment and structure

>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 299	Back information, alignment and structure

>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 299	Back information, alignment and structure

>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 299	Back information, alignment and structure

>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Length = 342	Back information, alignment and structure

>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Length = 342	Back information, alignment and structure

>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Length = 342	Back information, alignment and structure

>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 355	Back information, alignment and structure

>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 355	Back information, alignment and structure

>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 355	Back information, alignment and structure

>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 355	Back information, alignment and structure

>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 325	Back information, alignment and structure

>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 325	Back information, alignment and structure

>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 325	Back information, alignment and structure

>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 287	Back information, alignment and structure

>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 287	Back information, alignment and structure

>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Length = 371	Back information, alignment and structure

>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Length = 371	Back information, alignment and structure

>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Length = 371	Back information, alignment and structure

>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 311	Back information, alignment and structure

>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 311	Back information, alignment and structure

>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 337	Back information, alignment and structure

>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 337	Back information, alignment and structure

>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 337	Back information, alignment and structure

>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 342	Back information, alignment and structure

>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 342	Back information, alignment and structure

>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Length = 346	Back information, alignment and structure

>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Length = 337	Back information, alignment and structure

>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Length = 355	Back information, alignment and structure

>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 360	Back information, alignment and structure

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		1339
d1gxra_		337	Groucho/tle1, C-terminal domain {Human (Homo sapie	100.0
d1vyhc1		317	Platelet-activating factor acetylhydrolase IB subu	100.0
d1erja_		388	Tup1, C-terminal domain {Baker's yeast (Saccharomy	100.0
d1tbga_		340	beta1-subunit of the signal-transducing G protein	100.0
d1k8kc_		371	Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur	100.0
d1nr0a2		299	Actin interacting protein 1 {Nematode (Caenorhabdi	100.0
d1nexb2		355	Cdc4 propeller domain {Baker's yeast (Saccharomyce	100.0
d1nr0a1		311	Actin interacting protein 1 {Nematode (Caenorhabdi	100.0
d1nr0a1		311	Actin interacting protein 1 {Nematode (Caenorhabdi	100.0
d2ovrb2		342	F-box/WD repeat-containing protein 7, FBXW7 {Human	100.0
d1gxra_		337	Groucho/tle1, C-terminal domain {Human (Homo sapie	100.0
d1erja_		388	Tup1, C-terminal domain {Baker's yeast (Saccharomy	100.0
d1tbga_		340	beta1-subunit of the signal-transducing G protein	100.0
d1sq9a_		393	Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac	100.0
d1k8kc_		371	Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur	100.0
d1pgua2		287	Actin interacting protein 1 {Baker's yeast (Saccha	100.0
d1nr0a2		299	Actin interacting protein 1 {Nematode (Caenorhabdi	100.0
d1vyhc1		317	Platelet-activating factor acetylhydrolase IB subu	100.0
d1nexb2		355	Cdc4 propeller domain {Baker's yeast (Saccharomyce	100.0
d1pgua1		325	Actin interacting protein 1 {Baker's yeast (Saccha	100.0
d1pgua1		325	Actin interacting protein 1 {Baker's yeast (Saccha	100.0
d1p22a2		293	F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom	99.98
d1yfqa_		342	Cell cycle arrest protein BUB3 {Baker's yeast (Sac	99.97
d2ovrb2		342	F-box/WD repeat-containing protein 7, FBXW7 {Human	99.97
d1sq9a_		393	Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac	99.97
d1yfqa_		342	Cell cycle arrest protein BUB3 {Baker's yeast (Sac	99.96
d1p22a2		293	F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom	99.96
d1pgua2		287	Actin interacting protein 1 {Baker's yeast (Saccha	99.95
d1k32a3		360	Tricorn protease domain 2 {Archaeon Thermoplasma a	99.94
d1hzua2		426	C-terminal (heme d1) domain of cytochrome cd1-nitr	99.93
d1qksa2		432	C-terminal (heme d1) domain of cytochrome cd1-nitr	99.93
d1hzua2		426	C-terminal (heme d1) domain of cytochrome cd1-nitr	99.93
d1qksa2		432	C-terminal (heme d1) domain of cytochrome cd1-nitr	99.92
d1k32a3		360	Tricorn protease domain 2 {Archaeon Thermoplasma a	99.91
d1l0qa2		301	Surface layer protein {Archaeon Methanosarcina maz	99.89
d1l0qa2		301	Surface layer protein {Archaeon Methanosarcina maz	99.89
d1jmxb_		346	Quinohemoprotein amine dehydrogenase B chain {Pseu	99.86
d1pbyb_		337	Quinohemoprotein amine dehydrogenase B chain {Para	99.85
d1pbyb_		337	Quinohemoprotein amine dehydrogenase B chain {Para	99.82
d2madh_		373	Methylamine dehydrogenase, H-chain {Gram negative	99.8
d2madh_		373	Methylamine dehydrogenase, H-chain {Gram negative	99.79
d1ri6a_		333	Putative isomerase YbhE {Escherichia coli [TaxId:	99.77
d1jmxb_		346	Quinohemoprotein amine dehydrogenase B chain {Pseu	99.77
d1ri6a_		333	Putative isomerase YbhE {Escherichia coli [TaxId:	99.76
d2bbkh_		355	Methylamine dehydrogenase, H-chain {Paracoccus den	99.72
d2bbkh_		355	Methylamine dehydrogenase, H-chain {Paracoccus den	99.68
d2bgra1		470	Dipeptidyl peptidase IV/CD26, N-terminal domain {P	99.53
d1mdah_		368	Methylamine dehydrogenase, H-chain {Paracoccus den	99.46
d1qnia2		441	Nitrous oxide reductase, N-terminal domain {Pseudo	99.45
d1mdah_		368	Methylamine dehydrogenase, H-chain {Paracoccus den	99.41
d2bgra1		470	Dipeptidyl peptidase IV/CD26, N-terminal domain {P	99.29
d1qnia2		441	Nitrous oxide reductase, N-terminal domain {Pseudo	99.0
d1jofa_		365	3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu	98.97
d1jofa_		365	3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu	98.9
d1rwia_		260	Serine/threonine-protein kinase PknD {Mycobacteriu	98.89
d1q7fa_		279	Brain tumor cg10719-pa {Fruit fly (Drosophila mela	98.85
d1pjxa_		314	Diisopropylfluorophosphatase (phosphotriesterase,	98.77
d1rwia_		260	Serine/threonine-protein kinase PknD {Mycobacteriu	98.71
d2hqsa1		269	TolB, C-terminal domain {Escherichia coli [TaxId:	98.69
d1xfda1		465	Dipeptidyl aminopeptidase-like protein 6, DPP6, N-	98.68
d2dg1a1		319	Lactonase Drp35 {Staphylococcus aureus [TaxId: 128	98.54
d2p4oa1		302	Hypothetical protein All0351 homologue {Nostoc pun	98.48
d2p4oa1		302	Hypothetical protein All0351 homologue {Nostoc pun	98.42
d1pjxa_		314	Diisopropylfluorophosphatase (phosphotriesterase,	98.17
d1q7fa_		279	Brain tumor cg10719-pa {Fruit fly (Drosophila mela	98.16
d2hqsa1		269	TolB, C-terminal domain {Escherichia coli [TaxId:	98.1
d2ghsa1		295	Regucalcin {Agrobacterium tumefaciens [TaxId: 358]	98.0
d1xfda1		465	Dipeptidyl aminopeptidase-like protein 6, DPP6, N-	97.32
d2dg1a1		319	Lactonase Drp35 {Staphylococcus aureus [TaxId: 128	96.77
d1fwxa2		459	Nitrous oxide reductase, N-terminal domain {Paraco	96.49
d2ghsa1		295	Regucalcin {Agrobacterium tumefaciens [TaxId: 358]	95.51
d1utca2		327	Clathrin heavy-chain terminal domain {Rat (Rattus	95.45
d1k32a2		281	Tricorn protease N-terminal domain {Archaeon Therm	95.1
d1k3ia3		387	Galactose oxidase, central domain {Fungi (Fusarium	95.08
d1fwxa2		459	Nitrous oxide reductase, N-terminal domain {Paraco	94.87
d1k32a2		281	Tricorn protease N-terminal domain {Archaeon Therm	94.59
d1kb0a2		573	Quinoprotein alcohol dehydrogenase, N-terminal dom	94.14
d2ad6a1		571	Methanol dehydrogenase, heavy chain {Methylophilus	93.69
d1kv9a2		560	Quinoprotein alcohol dehydrogenase, N-terminal dom	93.28
d1w6sa_		596	Methanol dehydrogenase, heavy chain {Methylobacter	92.91
d1w3ba_		388	O-GlcNAc transferase p110 subunit, OGT {Human (Hom	92.47
d1fcha_		323	Peroxin pex5 (peroxisomal targeting signal 1 (PTS1	91.22
d1w3ba_		388	O-GlcNAc transferase p110 subunit, OGT {Human (Hom	90.61
d1flga_		582	Ethanol dehydrogenase {Pseudomonas aeruginosa [Tax	83.66
d1a17a_		159	Protein phosphatase 5 {Human (Homo sapiens) [TaxId	83.15
d1b89a_		336	Clathrin heavy chain proximal leg segment {Cow (Bo	80.97

>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

class: All beta proteins
fold: 7-bladed beta-propeller
superfamily: WD40 repeat-like
family: WD40-repeat
domain: Groucho/tle1, C-terminal domain
species: Human (Homo sapiens) [TaxId: 9606]

Probab=100.00  E-value=5.6e-39  Score=266.90  Aligned_cols=287  Identities=14%  Similarity=0.163  Sum_probs=231.8

Q ss_pred             EEEECCCCCCEEEEEECCCCCEEEEEECCCEEEEEECCCCCEEEEEECCCCCCEEEECCCCCEEEEECCCCCCCCCCCCC
Q ss_conf             67926899988999993899999999689909999779880999981367553277535666368402355798530025
Q 000709            4 LKAFRPTNDKIVKIQLHPTHPWLVTADASDHVSVWNWEHRQVIYELKAGGVDQRRLVGAKLEKLAEGELEHKGKPTEAMR   83 (1339)
Q Consensus         4 l~~L~gHs~~V~sIafSPdg~~LaSgs~DGtI~IWDl~tg~~i~~l~~~~~~~i~~vs~d~~~Lasgs~d~~gk~~~~l~   83 (1339)
                      ++++ +|.+.|+|++|+|++++|++|+ ||.|+|||+.++....                                    
T Consensus        45 ~~~~-~H~~~V~~v~fs~~g~~latg~-dg~V~iWd~~~~~~~~------------------------------------   86 (337)
T d1gxra_          45 INTL-NHGEVVCAVTISNPTRHVYTGG-KGCVKVWDISHPGNKS------------------------------------   86 (337)
T ss_dssp             EEEE-CCSSCCCEEEECSSSSEEEEEC-BSEEEEEETTSTTCCS------------------------------------
T ss_pred             EEEC-CCCCCEEEEEECCCCCEEEEEE-CCEEEEEECCCCCCCC------------------------------------
T ss_conf             9987-9999289999989999999997-9988997736776331------------------------------------


Q ss_pred             CCCEEEEEECCCEEEEEECCCCCCCCCCCCCCCCCCCCCEEEEEECCCCCEEEEEEECCCEE-EEEECCCCEEECCCCCC
Q ss_conf             98437998709929999867764113356510246888866421079999299999569499-99910896000241124
Q 000709           84 GGSVKQVNFYDDDVRFWQLWRNRAAAAEAPTAVSNVTSGFASPPPSTKGRHFLVICCVNKAI-FLDLVTMRGRDIPKQEL  162 (1339)
Q Consensus        84 ~g~V~sVaF~Dg~IrIWDl~~~~~i~~~~~~~~~~~~~~V~siafspdg~~lLvsgs~dg~I-~wD~~t~~~~~i~~~~~  162 (1339)
                                  .+..             ....+| ...|.+++|+|+++ +|++++.|+.+ +||+.............
T Consensus        87 ------------~~~~-------------~~~~~h-~~~I~~v~~s~dg~-~l~s~~~dg~i~iwd~~~~~~~~~~~~~~  139 (337)
T d1gxra_          87 ------------PVSQ-------------LDCLNR-DNYIRSCKLLPDGC-TLIVGGEASTLSIWDLAAPTPRIKAELTS  139 (337)
T ss_dssp             ------------CSEE-------------EECSCT-TSBEEEEEECTTSS-EEEEEESSSEEEEEECCCC--EEEEEEEC
T ss_pred             ------------EEEE-------------EEECCC-CCCEEEEEECCCCC-EEEEEECCCCCCCCCCCCCCCCCCCCCCC
T ss_conf             ------------1687-------------640488-99689999867998-89886123321111111111111111111


Q ss_pred             CCCCEEEEEEEECCCCCCCCEEEEEECCCCEEEEECCCCEEEEEEECCCCCCEEEEEEEEECCCCCEEEEEECCCCEEEE
Q ss_conf             89983799991123269999999998899199997799859999906888780599986628999999999489919999
Q 000709          163 DNKSLVCMEFLSRSAVGDVPLVAFGSSDGVIRVLSMISWKLVRRYTGGHKGSISCLMTFMASSGEALLVSGGSDGLLILW  242 (1339)
Q Consensus       163 h~~~V~~Iaf~P~s~Spdg~~LvsGs~DgtIrIWDl~t~~~i~~l~~gH~~~V~sI~wf~~spdg~~LaSgS~DgtIrVW  242 (1339)
                      |...+.++.|     ++++.++++++.|+.|++|++.++++..... +|...+.+++   +++++..+++++.|+.|++|
T Consensus       140 ~~~~v~~~~~-----~~~~~~l~s~~~d~~i~~~~~~~~~~~~~~~-~~~~~v~~l~---~s~~~~~~~~~~~d~~v~i~  210 (337)
T d1gxra_         140 SAPACYALAI-----SPDSKVCFSCCSDGNIAVWDLHNQTLVRQFQ-GHTDGASCID---ISNDGTKLWTGGLDNTVRSW  210 (337)
T ss_dssp             SSSCEEEEEE-----CTTSSEEEEEETTSCEEEEETTTTEEEEEEC-CCSSCEEEEE---ECTTSSEEEEEETTSEEEEE
T ss_pred             CCCCCCCCCC-----CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-CCCCCCCCCC---CCCCCCCCCCCCCCCCCCCC
T ss_conf             1111111111-----1111111111111111111111111111111-1111111012---34443211223566553211


Q ss_pred             ECCCCCCCCEECCCCCCCCCCCCEEEEEEECCCCCCCEEEEEECCCCEEEEECCCCEEEEEECCCCCCCCCCCCEEEEEE
Q ss_conf             58999852000142012235666599995102799999999969991999989997268884687854566776049874
Q 000709          243 SADHGQDSRELVPKLSLKAHDGGVVAVELSRVMGGSPQLITIGADKTLAIWDTVSFKELRRIKPVPKLACHSVASWCHPR  322 (1339)
Q Consensus       243 Di~sg~~i~~~~~~~~l~gH~~~V~siafsp~~~dg~~LvSgs~DgtIkIWDl~s~~~l~~l~~~~~l~~H~~~V~siaf  322 (1339)
                      |+++++.+..       ..|...|.+++|+|   ++.++++++.|+.+++||++.......       ..|...|+++.|
T Consensus       211 d~~~~~~~~~-------~~~~~~i~~l~~~~---~~~~l~~~~~d~~i~i~d~~~~~~~~~-------~~~~~~i~~v~~  273 (337)
T d1gxra_         211 DLREGRQLQQ-------HDFTSQIFSLGYCP---TGEWLAVGMESSNVEVLHVNKPDKYQL-------HLHESCVLSLKF  273 (337)
T ss_dssp             ETTTTEEEEE-------EECSSCEEEEEECT---TSSEEEEEETTSCEEEEETTSSCEEEE-------CCCSSCEEEEEE
T ss_pred             CCCCCEEECC-------CCCCCCEEEEEECC---CCCCCCEECCCCCCCCCCCCCCCCCCC-------CCCCCCCCEEEE
T ss_conf             1111000002-------46666157999715---303000000256421111111110000-------124565416999


Q ss_pred             CCCCCEE-EEECCCE--EEECCCCCCCCCCCCCCCCCCCCCCEEECCCCCCCEEEEEEECCCCCEEEEEECCCEEEEEEC
Q ss_conf             7999899-9841972--998357864556667435578889827705886258999990399919999978994999945
Q 000709          323 APNLDIL-TCVKDSH--IWAIEHPTYSALTRPLCELSSLVPPQVLAHHKKLRVYCMVAHSLQPHLVATGTNVGVIISEFD  399 (1339)
Q Consensus       323 spdg~iL-s~s~Dg~--IWDi~t~~~~~~~~~l~~~~~~~~~~tl~~~~~~~I~~ia~sp~~~~lIatGs~DG~IlriWd  399 (1339)
                      +|++.++ +++.|+.  +|++.++..               ...+ .|.. .|++++|+| ++.+|++|+.||.| ++||
T Consensus       274 s~~g~~l~s~s~Dg~i~iwd~~~~~~---------------~~~~-~~~~-~v~~~~~s~-d~~~l~t~s~D~~I-~vWd  334 (337)
T d1gxra_         274 AYCGKWFVSTGKDNLLNAWRTPYGAS---------------IFQS-KESS-SVLSCDISV-DDKYIVTGSGDKKA-TVYE  334 (337)
T ss_dssp             CTTSSEEEEEETTSEEEEEETTTCCE---------------EEEE-ECSS-CEEEEEECT-TSCEEEEEETTSCE-EEEE
T ss_pred             CCCCCEEEEEECCCEEEEEECCCCCE---------------EEEC-CCCC-CEEEEEEEC-CCCEEEEEECCCEE-EEEE
T ss_conf             89999999994899699998999979---------------9992-6999-879999927-99999999089969-9997


Q ss_pred             C
Q ss_conf             8
Q 000709          400 P  400 (1339)
Q Consensus       400 ~  400 (1339)
                      +
T Consensus       335 l  335 (337)
T d1gxra_         335 V  335 (337)
T ss_dssp             E
T ss_pred             E
T ss_conf             7

PyMOL of d1gxra_

>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]}	Back information, alignment and structure

>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]}	Back information, alignment and structure

>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]}	Back information, alignment and structure

>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]}	Back information, alignment and structure

>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]}	Back information, alignment and structure

>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]}	Back information, alignment and structure

>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]}	Back information, alignment and structure

>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]}	Back information, alignment and structure

>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]}	Back information, alignment and structure

>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]}	Back information, alignment and structure

>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]}	Back information, alignment and structure

>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]}	Back information, alignment and structure

>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]}	Back information, alignment and structure

>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]}	Back information, alignment and structure

>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]}	Back information, alignment and structure

>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]}	Back information, alignment and structure

>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]}	Back information, alignment and structure

>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]}	Back information, alignment and structure

>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]}	Back information, alignment and structure

>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]}	Back information, alignment and structure

>d2bgra1 b.70.3.1 (A:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]}	Back information, alignment and structure

>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]}	Back information, alignment and structure

>d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]}	Back information, alignment and structure

>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]}	Back information, alignment and structure

>d2bgra1 b.70.3.1 (A:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]}	Back information, alignment and structure

>d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]}	Back information, alignment and structure

>d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]}	Back information, alignment and structure

>d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]}	Back information, alignment and structure

>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}	Back information, alignment and structure

>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]}	Back information, alignment and structure

>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

>d2hqsa1 b.68.4.1 (A:163-431) TolB, C-terminal domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1xfda1 b.70.3.1 (A:127-591) Dipeptidyl aminopeptidase-like protein 6, DPP6, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]}	Back information, alignment and structure

>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]}	Back information, alignment and structure

>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]}	Back information, alignment and structure

>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]}	Back information, alignment and structure

>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}	Back information, alignment and structure

>d2hqsa1 b.68.4.1 (A:163-431) TolB, C-terminal domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]}	Back information, alignment and structure

>d1xfda1 b.70.3.1 (A:127-591) Dipeptidyl aminopeptidase-like protein 6, DPP6, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]}	Back information, alignment and structure

>d1fwxa2 b.69.3.1 (A:8-451) Nitrous oxide reductase, N-terminal domain {Paracoccus denitrificans [TaxId: 266]}	Back information, alignment and structure

>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]}	Back information, alignment and structure

>d1utca2 b.69.6.1 (A:4-330) Clathrin heavy-chain terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1k32a2 b.68.7.1 (A:39-319) Tricorn protease N-terminal domain {Archaeon Thermoplasma acidophilum [TaxId: 2303]}	Back information, alignment and structure

>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]}	Back information, alignment and structure

>d1fwxa2 b.69.3.1 (A:8-451) Nitrous oxide reductase, N-terminal domain {Paracoccus denitrificans [TaxId: 266]}	Back information, alignment and structure

>d1k32a2 b.68.7.1 (A:39-319) Tricorn protease N-terminal domain {Archaeon Thermoplasma acidophilum [TaxId: 2303]}	Back information, alignment and structure

>d1kb0a2 b.70.1.1 (A:1-573) Quinoprotein alcohol dehydrogenase, N-terminal domain {Comamonas testosteroni [TaxId: 285]}	Back information, alignment and structure

>d2ad6a1 b.70.1.1 (A:1-571) Methanol dehydrogenase, heavy chain {Methylophilus methylotrophus, w3a1 [TaxId: 17]}	Back information, alignment and structure

>d1kv9a2 b.70.1.1 (A:1-560) Quinoprotein alcohol dehydrogenase, N-terminal domain {Pseudomonas putida, hk5 [TaxId: 303]}	Back information, alignment and structure

>d1w6sa_ b.70.1.1 (A:) Methanol dehydrogenase, heavy chain {Methylobacterium extorquens [TaxId: 408]}	Back information, alignment and structure

>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1flga_ b.70.1.1 (A:) Ethanol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]}	Back information, alignment and structure

>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure