Citrus Sinensis ID: 000711

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------1000------1010------1020------1030------1040------1050------1060------1070------1080------1090------1100------1110------1120------1130------1140------1150------1160------1170------1180------1190------1200------1210------1220------1230------1240------1250------1260------1270------1280------1290------1300------1310------1320------1330------134
MPSLQSLPLTEHGRGILSSRRKTILLASGILVAGGTAAYLKSRFSSKKPDAFGHYNGLGDSERKPDKAVANRSNIKKANQKKGGLKSLQVLAAILLSEMGKMGARDLLALVGIVVLRTALSNRLAKVQGFLFRAAFLRRVPLFFQLISENILLCFLLSTMHSTSKYITGTLSLQFRKIVTKLIHTRYFENMAYYKISHVDGRITHPEQRLASDVPRFCSELSELVQDDLTAVTDGLLYTWRLCSYASPKYVFWILAYVLGAGTMMRNFSPAFGKLMSKEQQLEGEYRQLHSRLRTHAESIAFYGGENKEESHIQQKFKALTRHMRVVLHDHWWFGMIQDFLLKYLGATVAVILIIEPFFAGNLKPDTSTLGRAKMLSNLRYHTSVIISLFQSLGTLSISSRRLNRLSGYADRIHELMVISRELSIEDKSPQRNGSRNYFSEANYIEFSGVKVVTPTGNVLVENLTLKVEPGSNLLITGPNGSGKSSLFRVLGGLWPLVSGHIAKPGVGSDLNKEIFYVPQRPYTAVGTLRDQLIYPLTSDQEVEPLTHGGMVELLKNVDLEYLLDRYPPEKEINWGDELSLGEQQRLGMARLFYHKPKFAILDECTSAVTTDMEERFCAKVRAMGTSCITISHRPALVAFHDVVLSLDGEGEWRVHDKRDGSSVVTKSGINMIKSSETDRQSDAMAVEQAFVTAKKDSAFSNPKAQSYVSEVIAASPIADHNVPLPVFPQLKSAPRILPLRVADMFKVLVPTVFDKQGAQLLAVAFLVVSRTWISDRIASLNGTTVKYVLEQDKASFVRLIGVSVLQSAASSFIAPSIRHLTARLALGWRIRMTQHLLKSYLRKNSFYKVFNMSSKSIDADQRITHDLEKLTTDLSGLVTGMVKPSVDILWFTWRMKALTGQRGVAILYAYMLLGLGFLRSVTPEFGDLTSREQQLEGTFRFMHERLRAHAESVAFFGGGAREKAMIESRFRELLEHSLLLLKKKWLFGILDDFVTKQLPHNVTWGLSLLYAMEHKGDRALVSTQGELAHALRFLASVVSQSFLAFGDILELHRKFVELSGGINRIFELEELLDAAQPGDDEISGSSQHKWNSTDYQDSISFSKLDIITPSQKLLARQLTFEIVPGKSLLVTGPNGSGKSSVFRVLRGLWPVVSGSLTKPSQHIDEEAGSGCGIFYVPQRPYTCLGTLRDQIIYPLSREEAELRALKLHGKGEKLVDTTNILDSYLKTILEGVRLSYLLEREEVGWDANLNWEDILSLGEQQRLGMARLFFHKPKFGILDECTNATSVDVEEQLYRLAKDMGITFVTSSQRPALIPFHSLELRLIDGEGNWELRTISS
cccccccHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccHHHHcccccccccccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccEEEEcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHcccHHHHcHHHHHHHcHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccEEEEccEEEcccccEEEEcccEEEEcccEEEEEccccccHHHHHHHHHccccccccEEEcccccccccccEEEEccccccccccHHHHHccccccccccccccHHHHHHHHHHccccHHHHcccccccccccccccHHHHHHHHHHHHHHccccEEEEEcccccccHHHHHHHHHHHHHcccEEEEEccccHHHHHHHHEEEEcccccEEEEEcccccccccccccccccccccHHHHHHHHHHHHHHccccccccccccccccHHHHHccccccccccccccccccccccccHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccEEEEccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHccccHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccEEEEccEEEccccccccccccEEEEcccEEEEEccccccHHHHHHHHHccccccccEEEcccccccccccccccEEEEccccccccccHHHHHcccccHHHHHHHHHHHccccccccccccccHHHHHHHHHHcccccccccccccccccccccccccHHHHHHHHHHHHHHccccEEEEEcccccccHHHHHHHHHHHHHcccEEEEEccccccHHHHHHEEEEEcccccEEEEEccc
ccHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHcccHEEEccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccEEEEEEEEEEEcccccHHHcccEEEEccccEEEEEccccccHHHHHHHHHHHccccccEEEEcccccHHHHHEEEEccccEEEHHHHHHHHHcccccccccccccHHHHHHHHHHHcHHHHHHHccccccccccHcccccHHHHHHHHHHHHHcccEEEEccHHHHHcHHHHHHHHHHHHHccccEEEEEEEHHHHccccEEEEEEcccccEEEEEccHHHHHHccccEEEEEEEEcccccHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccHccEEEEEEEEEEEcccccHHHcccEEEEccccEEEEEccccccHHHHHHHHHHHccccccEEEEccccHHHHcHHHHEEEEEccccEEEccHHHHHHHcccccccccHHHHHHHHHHHcHHHHHHHccHHHHHHHHHHcHHHHHHHcccccccEcccccccccHHHHHHHHHHHHHccccEEEEcHHHHHHcHHHHHHHHHHHHHccccEEEEEEcccccccccEEEEEEccccccEEEEEcc
mpslqslpltehgrgiLSSRRKTILLASGILVAGGTAAYLKSRfsskkpdafghynglgdserkpdkavanrsnikkanqkkgglKSLQVLAAILLSEMGKMGARDLLALVGIVVLRTALSNRLAKVQGFLFRAAFLRRVPLFFQLISENILLCFLLSTmhstskyitgTLSLQFRKIVTKLIHTRYFENMAYYKishvdgrithpeqrlasdvpRFCSELSELVQDDLTAVTDGLLYTWRlcsyaspkYVFWILAYVLGAGtmmrnfspaFGKLMSKEQQLEGEYRQLHSRLRTHAESIAfyggenkeeSHIQQKFKALTRHMRVVLHDHWWFGMIQDFLLKYLGATVAVILIIEpffagnlkpdtstlGRAKMLSNLRYHTSVIISLFQSLGTLSISSRRLNRLSGYADRIHELMVISRELsiedkspqrngsrnyfseanyiefsgvkvvtptgnvlvenltlkvepgsnllitgpngsgksSLFRVLGglwplvsghiakpgvgsdlnkeifyvpqrpytavgtlrdqliypltsdqeveplthggmVELLKnvdleylldryppekeinwgdelslgeQQRLGMARlfyhkpkfaildeCTSAVTTDMEERFCAKVRAMGtscitishrpalvAFHDVVLSldgegewrvhdkrdgssvvtkSGINmikssetdrqsDAMAVEQAFVTAkkdsafsnpkaqsyVSEViaaspiadhnvplpvfpqlksaprilplrVADMFKVLVPTVFDKQGAQLLAVAFLVVSRTWISDRIASLNGTTVKYVLEQDKASFVRLIGVSVLQSaassfiapSIRHLTARLALGWRIRMTQHLLKSYLRKNSFYKVFNmssksidadQRITHDLEKLTTDLsglvtgmvkpsVDILWFTWRMKALTGQRGVAILYAYMLLGLGFlrsvtpefgdltSREQQLEGTFRFMHERLRAHAESvaffgggaREKAMIESRFRELLEHSLLLLKKKWLFGilddfvtkqlphnvtWGLSLLYAMEHKGDRALVSTQGELAHALRFLASVVSQSFLAFGDILELHRKFVELSGGINRIFELEELldaaqpgddeisgssqhkwnstdyqdsisfskldiiTPSQKLLARQLtfeivpgksllvtgpngsgksSVFRVLRGlwpvvsgsltkpsqhideeagsgcgifyvpqrpytclgtlrdqiiyPLSREEAELRALKLhgkgeklvdTTNILDSYLKTILEGVRLSYLLEReevgwdanlnweDILSLGEQQRLGMARlffhkpkfgildectnatsVDVEEQLYRLAKDMGitfvtssqrpalipfhslELRLIdgegnwelrtiss
mpslqslpltehgRGILSSRRKTILLASGILVAGGTAAYLKSRFSSKKPDAFGHYnglgdserkpdkaVANRSnikkanqkkgglksLQVLAAILLSEMGKMGARDLLALVGIVVLRTALSNRLAKVQGFLFRAAFLRRVPLFFQLISENILLCFLLSTMHSTSKYitgtlslqfRKIVTKLIHTRYFENMAYYKISHVDGRITHPEQRLASDVPRFCSELSELVQDDLTAVTDGLLYTWRLCSYASPKYVFWILAYVLGAGTMMRNFSPAFGKLMSKEQQLEGEYRQLHSRLRTHAESIAFYGGENKEESHIQQKFKALTRHMRVVLHDHWWFGMIQDFLLKYLGATVAVILIIEPFFAGNLKPDTSTLGRAKMLSNLRYHTSVIISLFQslgtlsissRRLNRLSGYADRIHELMVISRelsiedkspqrngSRNYFSEANYIEFSGVKVVTPTGNVLVENLtlkvepgsnlLITGPNGSGKSSLFRVLGGLWPLVSGHIAKPGVGSDLNKEIFYVPQRPYTAVGTLRDQLIYPLTSDQEVEPLTHGGMVELLKNVDLEYLLDRYPPEKEINWGDELSLGEQQRLGMARLFYHKPKFAILDECTSAVTTDMEERFCAKVRAMGTSCITISHRPALVAFHDVVLSLDGEgewrvhdkrdgssvvtksginmikssetdrqsdAMAVEQAFVTakkdsafsnpKAQSYVSEVIAASPIADHNVPLPVFPQLKSAPRILPLRVADMFKVLVPTVFDKQGAQLLAVAFLVVSRTWISDRIASLNGTTVKYVLEQDKASFVRLIGVSVLQSAASSFIAPSIRHLTARLALGWRIRMTQHLLKSYLRKNSFYKVFNMSSKSIDADQRITHDLEKLTtdlsglvtgMVKPSVDILWFTWRMKALTGQRGVAILYAYMLLGLGFLRSVTPEFGDLTSREQQLEGTFRFMHERLRAHAESVAFFGGGAREKAMIESRFRELLEHSLLLLKKKWLFGILDDFVTKQLPHNVTWGLSLLYAMEHKGDRALVSTQGELAHALRFLASVVSQSFLAFGDILELHRKFVELSGGINRIFELEELLDAAQPGDDEISGSSQHKWNSTDYQDSISFSKLDIITPSQKLLARQLTFEIVPgksllvtgpngsgKSSVFRVLRGLWPVVSGSLTKPSQHIDEEAGSGCGIFYVPQRPYTCLGTLRDQIIYPLSREEAELRALKlhgkgeklvdttNILDSYLKTILEGVRLSYLLEREEVGWDANLNWEDILSLGEQQRLGMARLFFHKPKFGILDECTNATSVDVEEQLYRLAKDMGITFvtssqrpalipfhslelrlidgegnwelrtiss
MPSLQSLPLTEHGRGILSSRRKTILLASGILVAGGTAAYLKSRFSSKKPDAFGHYNGLGDSERKPDKAVANRSNIKKANQKKGGLKSLQVLAAILLSEMGKMGARDLLALVGIVVLRTALSNRLAKVQGFLFRAAFLRRVPLFFQLISENILLCFLLSTMHSTSKYITGTLSLQFRKIVTKLIHTRYFENMAYYKISHVDGRITHPEQRLASDVPRFCSELSELVQDDLTAVTDGLLYTWRLCSYASPKYVFWILAYVLGAGTMMRNFSPAFGKLMSKEQQLEGEYRQLHSRLRTHAESIAFYGGENKEESHIQQKFKALTRHMRVVLHDHWWFGMIQDFLLKYLGATVAVILIIEPFFAGNLKPDTSTLGRAKMLSNLRYHTSVIISLFQSLGTlsissrrlnrlsGYADRIHELMVISRELSIEDKSPQRNGSRNYFSEANYIEFSGVKVVTPTGNVLVENLTLKVEPGSNLLITGPNGSGKSSLFRVLGGLWPLVSGHIAKPGVGSDLNKEIFYVPQRPYTAVGTLRDQLIYPLTSDQEVEPLTHGGMVELLKNVDLEYLLDRYPPEKEINWGDELSLGEQQRLGMARLFYHKPKFAILDECTSAVTTDMEERFCAKVRAMGTSCITISHRPALVAFHDVVLSLDGEGEWRVHDKRDGSSVVTKSGINMIKSSETDRQSDAMAVEQAFVTAKKDSAFSNPKAQSYVSEVIAASPIADHNVPLPVFPQLKSAPRILPLRVADMFKVLVPTVFDKQGAQLLAVAFLVVSRTWISDRIASLNGTTVKYVLEQDKASFVRLIGVSVLQSAASSFIAPSIRHLTARLALGWRIRMTQHLLKSYLRKNSFYKVFNMSSKSIDADQRITHDLEKLTTDLSGLVTGMVKPSVDILWFTWRMKALTGQRGVAILYAYMLLGLGFLRSVTPEFGDLTSREQQLEGTFRFMHERLRAHAESVAFFGGGAREKAMIESRFREllehsllllkkkwlfgilDDFVTKQLPHNVTWGLSLLYAMEHKGDRALVSTQGELAHALRFLASVVSQSFLAFGDILELHRKFVELSGGINRIFELEELLDAAQPGDDEISGSSQHKWNSTDYQDSISFSKLDIITPSQKLLARQLTFEIVPGKSLLVTGPNGSGKSSVFRVLRGLWPVVSGSLTKPSQHIDEEAGSGCGIFYVPQRPYTCLGTLRDQIIYPLSREEAELRALKLHGKGEKLVDTTNILDSYLKTILEGVRLSYLLEREEVGWDANLNWEDILSLGEQQRLGMARLFFHKPKFGILDECTNATSVDVEEQLYRLAKDMGITFVTSSQRPALIPFHSLELRLIDGEGNWELRTISS
****************L*SRRKTILLASGILVAGGTAAYLKS*******************************************KSLQVLAAILLSEMGKMGARDLLALVGIVVLRTALSNRLAKVQGFLFRAAFLRRVPLFFQLISENILLCFLLSTMHSTSKYITGTLSLQFRKIVTKLIHTRYFENMAYYKISHVDGRITHPEQRLASDVPRFCSELSELVQDDLTAVTDGLLYTWRLCSYASPKYVFWILAYVLGAGTMMRNFSPAFGKL*******************THAESIAFYGG******HIQQKFKALTRHMRVVLHDHWWFGMIQDFLLKYLGATVAVILIIEPFFAGNLKPDTSTLGRAKMLSNLRYHTSVIISLFQSLGTLSISSRRLNRLSGYADRIHELMVISRE**************NYFSEANYIEFSGVKVVTPTGNVLVENLTLKVEPGSNLLITGPNGSGKSSLFRVLGGLWPLVSGHIAKPGVGSDLNKEIFYVPQRPYTAVGTLRDQLIYPLTSDQEVEPLTHGGMVELLKNVDLEYLLDRYPPEKEINWGDELSLGEQQRLGMARLFYHKPKFAILDECTSAVTTDMEERFCAKVRAMGTSCITISHRPALVAFHDVVLSLDGEGEWRVH***************************************************YVSEVIAASPIADHNVPLPVFPQLKSAPRILPLRVADMFKVLVPTVFDKQGAQLLAVAFLVVSRTWISDRIASLNGTTVKYVLEQDKASFVRLIGVSVLQSAASSFIAPSIRHLTARLALGWRIRMTQHLLKSYLRKNSFYKVFNMSSKSIDADQRITHDLEKLTTDLSGLVTGMVKPSVDILWFTWRMKALTGQRGVAILYAYMLLGLGFLRSVTPEFGDLTSREQQLEGTFRFMHERLRAHAESVAFFGGGAREKAMIESRFRELLEHSLLLLKKKWLFGILDDFVTKQLPHNVTWGLSLLYAMEHKGDRALVSTQGELAHALRFLASVVSQSFLAFGDILELHRKFVELSGGINRIFELEELLD***********************DSISFSKLDIITPSQKLLARQLTFEIVPGKSLLVTGPNGSGKSSVFRVLRGLWPVVSGSLTK***HIDEEAGSGCGIFYVPQRPYTCLGTLRDQIIYPLSREEAELRALKLHGKGEKLVDTTNILDSYLKTILEGVRLSYLLEREEVGWDANLNWEDILSLGEQQRLGMARLFFHKPKFGILDECTNATSVDVEEQLYRLAKDMGITFVTSSQRPALIPFHSLELRLIDGEGNWEL*****
*****************SSRRKTILLASGILVAGGTAAY********************************************GLKSLQVLAAILLSEMGKMGARDLLALVGIVVLRTALSNRLAKVQGFLFRAAFLRRVPLFFQLISENILLCFLLSTMHSTSKYITGTLSLQFRKIVTKLIHTRYFENMAYYKISHVDGRITHPEQRLASDVPRFCSELSELVQDDLTAVTDGLLYTWRLCSYASPKYVFWILAYVLGAGTMMRNFSPAFGKLMSKEQQLEGEYRQLHSRLRTHAESIAFYGGENKEESHIQQKFKALTRHMRVVLHDHWWFGMIQDFLLKYLGATVAVILIIEPFFAGNLKPDTSTLGRAKMLSNLRYHTSVIISLFQSLGTLSISSRRLNRLSGYADRIHELM**********************SEANYIEFSGVKVVTPTGNVLVENLTLKVEPGSNLLITGPNGSGKSSLFRVLGGLWPLVSGHIAKPGVGSDLNKEIFYVPQRPYTAVGTLRDQLIYPLTSDQEVEPLTHGGMVELLKNVDLEYLLDRYPPEKEINWGDELSLGEQQRLGMARLFYHKPKFAILDECTSAVTTDMEERFCAKVRAMGTSCITISHRPALVAFHDVVLSLDGEGEWRVHDKRDG*************************************************************************PRILPLRVADMFKVLVPTVFDKQGAQLLAVAFLVVSRTWISDRIASLNGTTVKYVLEQDKASFVRLIGVSVLQSAASSFIAPSIRHLTARLALGWRIRMTQHLLKSYLRKNSFYKVFNMSSKSIDADQRITHDLEKLTTDLSGLVTGMVKPSVDILWFTWRMKALTGQRGVAILYAYMLLGLGFLRSVTPEFGDLTSREQQLEGTFRFMHERLRAHAESVAFFGGGAREKAMIESRFRELLEHSLLLLKKKWLFGILDDFVTKQLPHNVTWGLSLLYAMEHKGDRALVSTQGELAHALRFLASVVSQSFLAFGDILELHRKFVELSGGINRIFELEELLD***********************DSISFSKLDIITPSQKLLARQLTFEIVPGKSLLVTGPNGSGKSSVFRVLRGLWPVVSGSLTKPSQHIDEEAGSGCGIFYVPQRPYTCLGTLRDQIIYPLSREEAELRALKLHGKGEKLVDTTNILDSYLKTILEGVRLSYLLEREEVGWDANLNWEDILSLGEQQRLGMARLFFHKPKFGILDECTNATSVDVEEQLYRLAKDMGITFVTSSQRPALIPFHSLELRLIDGEGNWELRTI**
MPSLQSLPLTEHGRGILSSRRKTILLASGILVAGGTAAYLKSRFSSKKPDAFGHYNGLGDSERKPDKAVANRSNIKKANQKKGGLKSLQVLAAILLSEMGKMGARDLLALVGIVVLRTALSNRLAKVQGFLFRAAFLRRVPLFFQLISENILLCFLLSTMHSTSKYITGTLSLQFRKIVTKLIHTRYFENMAYYKISHVDGRITHPEQRLASDVPRFCSELSELVQDDLTAVTDGLLYTWRLCSYASPKYVFWILAYVLGAGTMMRNFSPAFGKLMSKEQQLEGEYRQLHSRLRTHAESIAFYGGE********QKFKALTRHMRVVLHDHWWFGMIQDFLLKYLGATVAVILIIEPFFAGNLKPDTSTLGRAKMLSNLRYHTSVIISLFQSLGTLSISSRRLNRLSGYADRIHELMVISRELSIEDKSPQRNGSRNYFSEANYIEFSGVKVVTPTGNVLVENLTLKVEPGSNLLITGPNGSGKSSLFRVLGGLWPLVSGHIAKPGVGSDLNKEIFYVPQRPYTAVGTLRDQLIYPLTSDQEVEPLTHGGMVELLKNVDLEYLLDRYPPEKEINWGDELSLGEQQRLGMARLFYHKPKFAILDECTSAVTTDMEERFCAKVRAMGTSCITISHRPALVAFHDVVLSLDGEGEWRVHDKRDGSSVVTKSGINMIKSS********MAVEQAFVTAKKDSAFSNPKAQSYVSEVIAASPIADHNVPLPVFPQLKSAPRILPLRVADMFKVLVPTVFDKQGAQLLAVAFLVVSRTWISDRIASLNGTTVKYVLEQDKASFVRLIGVSVLQSAASSFIAPSIRHLTARLALGWRIRMTQHLLKSYLRKNSFYKVFNMSSKSIDADQRITHDLEKLTTDLSGLVTGMVKPSVDILWFTWRMKALTGQRGVAILYAYMLLGLGFLRSVTPEFGDLTSREQQLEGTFRFMHERLRAHAESVAFFGGGAREKAMIESRFRELLEHSLLLLKKKWLFGILDDFVTKQLPHNVTWGLSLLYAMEHKGDRALVSTQGELAHALRFLASVVSQSFLAFGDILELHRKFVELSGGINRIFELEELLDAAQ***************STDYQDSISFSKLDIITPSQKLLARQLTFEIVPGKSLLVTGPNGSGKSSVFRVLRGLWPVVSGSLTKPSQHIDEEAGSGCGIFYVPQRPYTCLGTLRDQIIYPLSREEAELRALKLHGKGEKLVDTTNILDSYLKTILEGVRLSYLLEREEVGWDANLNWEDILSLGEQQRLGMARLFFHKPKFGILDECTNATSVDVEEQLYRLAKDMGITFVTSSQRPALIPFHSLELRLIDGEGNWELRTISS
*PSLQSLPLTEHGRGILSSRRKTILLASGILVAGGTAAYLK******************************************GLKSLQVLAAILLSEMGKMGARDLLALVGIVVLRTALSNRLAKVQGFLFRAAFLRRVPLFFQLISENILLCFLLSTMHSTSKYITGTLSLQFRKIVTKLIHTRYFENMAYYKISHVDGRITHPEQRLASDVPRFCSELSELVQDDLTAVTDGLLYTWRLCSYASPKYVFWILAYVLGAGTMMRNFSPAFGKLMSKEQQLEGEYRQLHSRLRTHAESIAFYGGENKEESHIQQKFKALTRHMRVVLHDHWWFGMIQDFLLKYLGATVAVILIIEPFFAGNLKPDTSTLGRAKMLSNLRYHTSVIISLFQSLGTLSISSRRLNRLSGYADRIHELMVISREL***********SRNYFSEANYIEFSGVKVVTPTGNVLVENLTLKVEPGSNLLITGPNGSGKSSLFRVLGGLWPLVSGHIAKPGVGSDLNKEIFYVPQRPYTAVGTLRDQLIYPLTSDQEVEPLTHGGMVELLKNVDLEYLLDRYPPEKEINWGDELSLGEQQRLGMARLFYHKPKFAILDECTSAVTTDMEERFCAKVRAMGTSCITISHRPALVAFHDVVLSLDGEGEWRVHDKRDGSSVVTKSGINMIKSSETDRQ**********************************************************LRVADMFKVLVPTVFDKQGAQLLAVAFLVVSRTWISDRIASLNGTTVKYVLEQDKASFVRLIGVSVLQSAASSFIAPSIRHLTARLALGWRIRMTQHLLKSYLRKNSFYKVFNMSSKSIDADQRITHDLEKLTTDLSGLVTGMVKPSVDILWFTWRMKALTGQRGVAILYAYMLLGLGFLRSVTPEFGDLTSREQQLEGTFRFMHERLRAHAESVAFFGGGAREKAMIESRFRELLEHSLLLLKKKWLFGILDDFVTKQLPHNVTWGLSLLYAMEHKGDRALVSTQGELAHALRFLASVVSQSFLAFGDILELHRKFVELSGGINRIFELEELLDAA**GDDEISGSSQHKWNSTDYQDSISFSKLDIITPSQKLLARQLTFEIVPGKSLLVTGPNGSGKSSVFRVLRGLWPVVSGSLTKPSQHIDEEAGSGCGIFYVPQRPYTCLGTLRDQIIYPLSREEAELRALKLHGKGEKLVDTTNILDSYLKTILEGVRLSYLLEREEVGWDANLNWEDILSLGEQQRLGMARLFFHKPKFGILDECTNATSVDVEEQLYRLAKDMGITFVTSSQRPALIPFHSLELRLIDGEGNWELRTIS*
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHooooHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPSLQSLPLTEHGRGILSSRRKTILLASGILVAGGTAAYLKSRFSSKKPDAFGHYNGLGDSERKPDKAVANRSNIKKANQKKGGLKSLQVLAAILLSEMGKMGARDLLALVGIVVLRTALSNRLAKVQGFLFRAAFLRRVPLFFQLISENILLCFLLSTMHSTSKYITGTLSLQFRKIVTKLIHTRYFENMAYYKISHVDGRITHPEQRLASDVPRFCSELSELVQDDLTAVTDGLLYTWRLCSYASPKYVFWILAYVLGAGTMMRNFSPAFGKLMSKEQQLEGEYRQLHSRLRTHAESIAFYGGENKEESHIQQKFKALTRHMRVVLHDHWWFGMIQDFLLKYLGATVAVILIIEPFFAGNLKPDTSTLGRAKMLSNLRYHTSVIISLFQSLGTLSISSRRLNRLSGYADRIHELMVISRELSIEDKSPQRNGSRNYFSEANYIEFSGVKVVTPTGNVLVENLTLKVEPGSNLLITGPNGSGKSSLFRVLGGLWPLVSGHIAKPGVGSDLNKEIFYVPQRPYTAVGTLRDQLIYPLTSDQEVEPLTHGGMVELLKNVDLEYLLDRYPPEKEINWGDELSLGEQQRLGMARLFYHKPKFAILDECTSAVTTDMEERFCAKVRAMGTSCITISHRPALVAFHDVVLSLDGEGEWRVHDKRDGSSVVTKSGINMIKSSETDRQSDAMAVEQAFVTAKKDSAFSNPKAQSYVSEVIAASPIADHNVPLPVFPQLKSAPRILPLRVADMFKVLVPTVFDKQGAQLLAVAFLVVSRTWISDRIASLNGTTVKYVLEQDKASFVRLIGVSVLQSAASSFIAPSIRHLTARLALGWRIRMTQHLLKSYLRKNSFYKVFNMSSKSIDADQRITHDLEKLTTDLSGLVTGMVKPSVDILWFTWRMKALTGQRGVAILYAYMLLGLGFLRSVTPEFGDLTSREQQLEGTFRFMHERLRAHAESVAFFGGGAREKAMIESRFRELLEHSLLLLKKKWLFGILDDFVTKQLPHNVTWGLSLLYAMEHKGDRALVSTQGELAHALRFLASVVSQSFLAFGDILELHRKFVELSGGINRIFELEELLDAAQPGDDEISGSSQHKWNSTDYQDSISFSKLDIITPSQKLLARQLTFEIVPGKSLLVTGPNGSGKSSVFRVLRGLWPVVSGSLTKPSQHIDEEAGSGCGIFYVPQRPYTCLGTLRDQIIYPLSREEAELRALKLHGKGEKLVDTTNILDSYLKTILEGVRLSYLLEREEVGWDANLNWEDILSLGEQQRLGMARLFFHKPKFGILDECTNATSVDVEEQLYRLAKDMGITFVTSSQRPALIPFHSLELRLIDGEGNWELRTISS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query1338 2.2.26 [Sep-21-2011]
Q94FB91337 ABC transporter D family yes no 0.993 0.994 0.794 0.0
P55096659 ATP-binding cassette sub- yes no 0.426 0.864 0.344 7e-94
P16970659 ATP-binding cassette sub- yes no 0.426 0.864 0.342 1e-93
P28288659 ATP-binding cassette sub- yes no 0.426 0.864 0.340 3e-93
Q9UBJ2740 ATP-binding cassette sub- no no 0.424 0.767 0.305 4e-89
Q9QY44741 ATP-binding cassette sub- no no 0.448 0.809 0.303 8e-88
Q61285741 ATP-binding cassette sub- no no 0.438 0.792 0.301 1e-86
Q8T8P3741 ABC transporter D family yes no 0.387 0.699 0.324 7e-85
P33897745 ATP-binding cassette sub- no no 0.402 0.723 0.324 2e-84
P48410736 ATP-binding cassette sub- no no 0.434 0.789 0.305 9e-84
>sp|Q94FB9|AB1D_ARATH ABC transporter D family member 1 OS=Arabidopsis thaliana GN=ABCC1 PE=1 SV=1 Back     alignment and function desciption
 Score = 2180 bits (5650), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1064/1339 (79%), Positives = 1187/1339 (88%), Gaps = 10/1339 (0%)

Query: 1    MPSLQSLPLTEHGRGILSSRRKTILLASGILVAGGTAAYLKSRFSSKKPDAFGHYNGLGD 60
            MPSLQ L LTE GRG+++SRRK+ILLA+GI+ AGGTA YLKSR +S++PD+    NG  D
Sbjct: 1    MPSLQLLQLTERGRGLVASRRKSILLAAGIVAAGGTAVYLKSRVASRRPDSSRLCNGQSD 60

Query: 61   SERKPDKAVANRSN--IKKANQKKGGLKSLQVLAAILLSEMGKMGARDLLALVGIVVLRT 118
             +   +K  A   N  I    +K GGLKSLQVL AILLS+MGKMGARDLLALV  VV RT
Sbjct: 61   DDETLEKLTATDQNAKITTKKKKGGGLKSLQVLTAILLSQMGKMGARDLLALVATVVFRT 120

Query: 119  ALSNRLAKVQGFLFRAAFLRRVPLFFQLISENILLCFLLSTMHSTSKYITGTLSLQFRKI 178
            ALSNRLAKVQGFLFRAAFLRR PLF +LISENI+LCF+LST+HSTSKYITG LSL+FRKI
Sbjct: 121  ALSNRLAKVQGFLFRAAFLRRAPLFLRLISENIMLCFMLSTLHSTSKYITGALSLRFRKI 180

Query: 179  VTKLIHTRYFENMAYYKISHVDGRITHPEQRLASDVPRFCSELSELVQDDLTAVTDGLLY 238
            +TK+IH+ YFENM YYKISHVDGRITHPEQR+ASDVPRF SELS+L+ DDLTAVTDG+LY
Sbjct: 181  LTKIIHSHYFENMVYYKISHVDGRITHPEQRIASDVPRFSSELSDLILDDLTAVTDGILY 240

Query: 239  TWRLCSYASPKYVFWILAYVLGAGTMMRNFSPAFGKLMSKEQQLEGEYRQLHSRLRTHAE 298
             WRLCSYASPKY+FWILAYVLGAGT +RNFSP+FGKLMSKEQQLEGEYRQLHSRLRTH+E
Sbjct: 241  AWRLCSYASPKYIFWILAYVLGAGTAIRNFSPSFGKLMSKEQQLEGEYRQLHSRLRTHSE 300

Query: 299  SIAFYGGENKEESHIQQKFKALTRHMRVVLHDHWWFGMIQDFLLKYLGATVAVILIIEPF 358
            SIAFYGGE +EESHIQQKFK L  HM  VLHDHWWFGMIQDFLLKYLGATVAVILIIEPF
Sbjct: 301  SIAFYGGETREESHIQQKFKNLVSHMSHVLHDHWWFGMIQDFLLKYLGATVAVILIIEPF 360

Query: 359  FAGNLKPDTSTLGRAKMLSNLRYHTSVIISLFQSLGTLSISSRRLNRLSGYADRIHELMV 418
            F+G+L+PD STLGRA+MLSN+RYHTSVIISLFQ+LGTLSISSRRLNRLSGYADRIHELM 
Sbjct: 361  FSGHLRPDDSTLGRAEMLSNIRYHTSVIISLFQALGTLSISSRRLNRLSGYADRIHELMA 420

Query: 419  ISRELSIEDKSP-QRNGSRNYFSEANYIEFSGVKVVTPTGNVLVENLTLKVEPGSNLLIT 477
            +SRELS +DKS  QRN SRNY SEANY+EFS VKVVTPTGNVLVE+LTL+VE GSNLLIT
Sbjct: 421  VSRELSGDDKSSFQRNRSRNYLSEANYVEFSDVKVVTPTGNVLVEDLTLRVEQGSNLLIT 480

Query: 478  GPNGSGKSSLFRVLGGLWPLVSGHIAKPGVGSDLNKEIFYVPQRPYTAVGTLRDQLIYPL 537
            GPNGSGKSSLFRVLGGLWPLVSGHI KPGVGSDLNKEIFYVPQRPY AVGTLRDQLIYPL
Sbjct: 481  GPNGSGKSSLFRVLGGLWPLVSGHIVKPGVGSDLNKEIFYVPQRPYMAVGTLRDQLIYPL 540

Query: 538  TSDQEVEPLTHGGMVELLKNVDLEYLLDRYPPEKEINWGDELSLGEQQRLGMARLFYHKP 597
            TS QE E LT  GMVELLKNVDLEYLLDRY PEKE+NWGDELSLGEQQRLGMARLFYHKP
Sbjct: 541  TSGQESELLTEIGMVELLKNVDLEYLLDRYQPEKEVNWGDELSLGEQQRLGMARLFYHKP 600

Query: 598  KFAILDECTSAVTTDMEERFCAKVRAMGTSCITISHRPALVAFHDVVLSLDGEGEWRVHD 657
            KFAILDECTSAVTTDMEERF AKVRAMGTSCITISHRPALVAFHDVVLSLDGEG W VH 
Sbjct: 601  KFAILDECTSAVTTDMEERFAAKVRAMGTSCITISHRPALVAFHDVVLSLDGEGGWSVHY 660

Query: 658  KRDGSSVVTKSGINMIKSSETDRQSDAMAVEQAFVTAKKDSAFSNPKAQSYVSEVIAASP 717
            KRD S+++T + I+ +KSS+TDRQ+DAM V++AF  A+K+SA +N KAQSY +++IA SP
Sbjct: 661  KRDDSALLTDAEIDSVKSSDTDRQNDAMVVQRAFAAARKESA-TNSKAQSYQTQLIARSP 719

Query: 718  IADHNVPLPVFPQLKSAPRILPLRVADMFKVLVPTVFDKQGAQLLAVAFLVVSRTWISDR 777
            + D +V LP FPQ +++ R LP RVA M  VL+PT+FDKQGAQLLAVA LVVSRT ISDR
Sbjct: 720  VVDKSVVLPRFPQPQTSQRALPSRVAAMLNVLIPTIFDKQGAQLLAVACLVVSRTLISDR 779

Query: 778  IASLNGTTVKYVLEQDKASFVRLIGVSVLQSAASSFIAPSIRHLTARLALGWRIRMTQHL 837
            IASLNGTTVKYVLEQDKA+FVRLIG+SVLQS ASS IAPS+RHLT RLALGWRIR+TQHL
Sbjct: 780  IASLNGTTVKYVLEQDKAAFVRLIGLSVLQSGASSIIAPSLRHLTQRLALGWRIRLTQHL 839

Query: 838  LKSYLRKNSFYKVFNMSSKSIDADQRITHDLEKLTTDLSGLVTGMVKPSVDILWFTWRMK 897
            L++YLR N+FYKVF+MS  SIDADQR+T DLEKLT DLSGL+TGMVKPSVDILWFTWRMK
Sbjct: 840  LRNYLRNNAFYKVFHMSGNSIDADQRLTRDLEKLTADLSGLLTGMVKPSVDILWFTWRMK 899

Query: 898  ALTGQRGVAILYAYMLLGLGFLRSVTPEFGDLTSREQQLEGTFRFMHERLRAHAESVAFF 957
             LTGQRGVAILY YMLLGLGFLR V P+FGDL   EQQLEG FRFMHERL  HAES+AFF
Sbjct: 900  LLTGQRGVAILYTYMLLGLGFLRRVAPDFGDLAGEEQQLEGKFRFMHERLNTHAESIAFF 959

Query: 958  GGGAREKAMIESRFRELLEHSLLLLKKKWLFGILDDFVTKQLPHNVTWGLSLLYAMEHKG 1017
            GGGAREKAM++ +FR LL+HSL+LL+KKWL+GILDDFVTKQLP+NVTWGLSLLYA+EHKG
Sbjct: 960  GGGAREKAMVDKKFRALLDHSLMLLRKKWLYGILDDFVTKQLPNNVTWGLSLLYALEHKG 1019

Query: 1018 DRALVSTQGELAHALRFLASVVSQSFLAFGDILELHRKFVELSGGINRIFELEELLDAAQ 1077
            DRALVSTQGELAHALR+LASVVSQSF+AFGDILELH+KF+ELSGGINRIFEL+E LDA+Q
Sbjct: 1020 DRALVSTQGELAHALRYLASVVSQSFMAFGDILELHKKFLELSGGINRIFELDEFLDASQ 1079

Query: 1078 PGDDEISGSSQHKWNSTDYQDSISFSKLDIITPSQKLLARQLTFEIVPGKSLLVTGPNGS 1137
             G      +S+++ +  D QD +SFS++DIITP+QKL+A +L+ EIV GKSLLVTGPNGS
Sbjct: 1080 SG-----VTSENQTSRLDSQDLLSFSEVDIITPAQKLMASKLSCEIVSGKSLLVTGPNGS 1134

Query: 1138 GKSSVFRVLRGLWPVVSGSLTKPSQHIDEEAGSGCGIFYVPQRPYTCLGTLRDQIIYPLS 1197
            GK+SVFRVLR +WP V G LTKPS  I +E GSG G+F+VPQRPYTCLGTLRDQIIYPLS
Sbjct: 1135 GKTSVFRVLRDIWPTVCGRLTKPSLDI-KELGSGNGMFFVPQRPYTCLGTLRDQIIYPLS 1193

Query: 1198 REEAELRALKLHGKGEKLVDTTNILDSYLKTILEGVRLSYLLEREEVGWDANLNWEDILS 1257
            +EEAE RA KL+  GE   +  +ILDS+LKTILE VRL YLLER+  GWDA  NWEDILS
Sbjct: 1194 KEEAEKRAAKLYTSGESSTEAGSILDSHLKTILENVRLVYLLERDVGGWDATTNWEDILS 1253

Query: 1258 LGEQQRLGMARLFFHKPKFGILDECTNATSVDVEEQLYRLAKDMGITFVTSSQRPALIPF 1317
            LGEQQRLGMARLFFH+PKFG+LDECTNATSVDVEEQLYR+A+DMG+TF+TSSQRPALIPF
Sbjct: 1254 LGEQQRLGMARLFFHRPKFGVLDECTNATSVDVEEQLYRVARDMGVTFITSSQRPALIPF 1313

Query: 1318 HSLELRLIDGEGNWELRTI 1336
            HSLELRLIDGEGNWELR+I
Sbjct: 1314 HSLELRLIDGEGNWELRSI 1332
Contributes to the transport of fatty acids and their derivatives (acyl CoAs) across the peroxisomal membrane. Provides acetate to the glyoxylate cycle in developing seedlings. Involved in pollen tube elongation, ovule fertilization, and seeds germination after imbibition (controls the switch between the opposing developmental programs of dormancy and germination), probably by promoting beta-oxidation of storage lipids during gluconeogenesis. Required for biosynthesis of jasmonic acid and conversion of indole butyric acid to indole acetic acid. Confers sensitivity to monofluoroacetic acid (FAc), a toxic acetate analog, and to 2,4-dichlorophenoxybutyric acid (2,4-DB) and indole-3-butyric acid (IBA), two precursors of auxin after beta-oxidation.
Arabidopsis thaliana (taxid: 3702)
EC: 3EC: .EC: 6EC: .EC: 3EC: .EC: 4EC: 7
>sp|P55096|ABCD3_MOUSE ATP-binding cassette sub-family D member 3 OS=Mus musculus GN=Abcd3 PE=1 SV=2 Back     alignment and function description
>sp|P16970|ABCD3_RAT ATP-binding cassette sub-family D member 3 OS=Rattus norvegicus GN=Abcd3 PE=1 SV=3 Back     alignment and function description
>sp|P28288|ABCD3_HUMAN ATP-binding cassette sub-family D member 3 OS=Homo sapiens GN=ABCD3 PE=1 SV=1 Back     alignment and function description
>sp|Q9UBJ2|ABCD2_HUMAN ATP-binding cassette sub-family D member 2 OS=Homo sapiens GN=ABCD2 PE=1 SV=1 Back     alignment and function description
>sp|Q9QY44|ABCD2_RAT ATP-binding cassette sub-family D member 2 OS=Rattus norvegicus GN=Abcd2 PE=2 SV=1 Back     alignment and function description
>sp|Q61285|ABCD2_MOUSE ATP-binding cassette sub-family D member 2 OS=Mus musculus GN=Abcd2 PE=1 SV=1 Back     alignment and function description
>sp|Q8T8P3|ABCD2_DICDI ABC transporter D family member 2 OS=Dictyostelium discoideum GN=abcD2 PE=3 SV=1 Back     alignment and function description
>sp|P33897|ABCD1_HUMAN ATP-binding cassette sub-family D member 1 OS=Homo sapiens GN=ABCD1 PE=1 SV=2 Back     alignment and function description
>sp|P48410|ABCD1_MOUSE ATP-binding cassette sub-family D member 1 OS=Mus musculus GN=Abcd1 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1338
2240837011309 peroxisomal membrane ABC transporter fam 0.976 0.997 0.815 0.0
3565402931339 PREDICTED: ABC transporter D family memb 0.993 0.992 0.816 0.0
3565402951354 PREDICTED: ABC transporter D family memb 0.993 0.981 0.807 0.0
3565284751342 PREDICTED: ABC transporter D family memb 0.997 0.994 0.810 0.0
3574633711349 ABC transporter D family member [Medicag 0.994 0.985 0.799 0.0
3565127071319 PREDICTED: ABC transporter D family memb 0.977 0.991 0.808 0.0
3574633691356 ABC transporter D family member [Medicag 0.994 0.980 0.795 0.0
184785101337 peroxisomal ABC transporter [Arabidopsis 0.993 0.994 0.794 0.0
184205461337 ABC transporter D family member 1 [Arabi 0.993 0.994 0.794 0.0
2555495481339 peroxisomal abc transporter, putative [R 0.981 0.980 0.816 0.0
>gi|224083701|ref|XP_002307090.1| peroxisomal membrane ABC transporter family, PMP family [Populus trichocarpa] gi|222856539|gb|EEE94086.1| peroxisomal membrane ABC transporter family, PMP family [Populus trichocarpa] Back     alignment and taxonomy information
 Score = 2245 bits (5818), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1090/1337 (81%), Positives = 1196/1337 (89%), Gaps = 31/1337 (2%)

Query: 1    MPSLQSLPLTEHGRGILSSRRKTILLASGILVAGGTAAYLKSRFSSKKPDAFGHYNGLGD 60
            MPSLQ L LTEHGRGIL+SRRK++L A+GIL AGGTA Y++SR  SKK D+F +YNG+ D
Sbjct: 1    MPSLQLLQLTEHGRGILASRRKSLLFAAGILAAGGTAVYVQSRIRSKKSDSFLYYNGIKD 60

Query: 61   SERKPDKAVANRSNIKKANQKKGGLKSLQVLAAILLSEMGKMGARDLLALVGIVVLRTAL 120
             ++  DK V N    KK  QKKGGLK+LQ+LA++LLS MGK GA+DLLA++ I VL+T L
Sbjct: 61   DKKISDKLVTNG---KKTVQKKGGLKALQILASVLLSHMGKTGAKDLLAMIAIAVLKTTL 117

Query: 121  SNRLAKVQGFLFRAAFLRRVPLFFQLISENILLCFLLSTMHSTSKYITGTLSLQFRKIVT 180
            SNRLAKVQGFLFRAAFL+RVPLFF+LISENILLCFLLST++STSKY+TGTLSL FRKI+T
Sbjct: 118  SNRLAKVQGFLFRAAFLQRVPLFFRLISENILLCFLLSTINSTSKYVTGTLSLCFRKILT 177

Query: 181  KLIHTRYFENMAYYKISHVDGRITHPEQRLASDVPRFCSELSELVQDDLTAVTDGLLYTW 240
            K+IH  YFENMAYYKISHVDGRIT+PEQR+ASDVPRFCSELSELV DDLTAVTDGLLYTW
Sbjct: 178  KVIHAHYFENMAYYKISHVDGRITNPEQRIASDVPRFCSELSELVLDDLTAVTDGLLYTW 237

Query: 241  RLCSYASPKYVFWILAYVLGAGTMMRNFSPAFGKLMSKEQQLEGEYRQLHSRLRTHAESI 300
            RLCSYASPKY+FW++AYVLGAGT++RNFSPAFGKLMSKEQQLEGEYRQLHSRLRTHAESI
Sbjct: 238  RLCSYASPKYLFWMVAYVLGAGTLIRNFSPAFGKLMSKEQQLEGEYRQLHSRLRTHAESI 297

Query: 301  AFYGGENKEESHIQQKFKALTRHMRVVLHDHWWFGMIQDFLLKYLGATVAVILIIEPFFA 360
            AFYGGEN+EE HIQQKFK L  HMR VLHDHWWFGMIQDFLLKY GATVAVILIIEPFFA
Sbjct: 298  AFYGGENREEFHIQQKFKTLIGHMRTVLHDHWWFGMIQDFLLKYFGATVAVILIIEPFFA 357

Query: 361  GNLKPDTSTLGRAKMLSNLRYHTSVIISLFQSLGTLSISSRRLNRLSGYADRIHELMVIS 420
            G L+PD STLGRA+MLSNLRYHTSVIISLFQSLGTLSISSRRLNRLSGYADRIHEL+ +S
Sbjct: 358  GQLRPDASTLGRAEMLSNLRYHTSVIISLFQSLGTLSISSRRLNRLSGYADRIHELIAVS 417

Query: 421  RELSIEDKSP-QRNGSRNYFSEANYIEFSGVKVVTPTGNVLVENLTLKVEPGSNLLITGP 479
            RELS  DKS  QR+GSRNYFSEANY+EF GVKVVTP+GNVLV++LTLKV+ GSNLLITGP
Sbjct: 418  RELSNGDKSSLQRSGSRNYFSEANYVEFFGVKVVTPSGNVLVQDLTLKVDSGSNLLITGP 477

Query: 480  NGSGKSSLFRVLGGLWPLVSGHIAKPGVGSDLNKEIFYVPQRPYTAVGTLRDQLIYPLTS 539
            NGSGKSSLFRVLGGLWPLVSGHI KPGVGSDLNKEIFYVPQRPYTAVGTLRDQLIYPLT+
Sbjct: 478  NGSGKSSLFRVLGGLWPLVSGHIVKPGVGSDLNKEIFYVPQRPYTAVGTLRDQLIYPLTA 537

Query: 540  DQEVEPLTHGGMVELLKNVDLEYLLDRYPPEKEINWGDELSLGEQQRLGMARLFYHKPKF 599
            DQE+EPLTH GMVELLKNVDLEYLLDRYPPEKE+NWG+ELSLGEQQRLGMARLFYHKPKF
Sbjct: 538  DQEIEPLTHSGMVELLKNVDLEYLLDRYPPEKEVNWGEELSLGEQQRLGMARLFYHKPKF 597

Query: 600  AILDECTSAVTTDMEERFCAKVRAMGTSCITISHRPALVAFHDVVLSLDGEGEWRVHDKR 659
            AILDECTSAVTTDMEERFCA+V+AMGTSCITISHRPALVAFHDVVLSLDGEG W V+ K 
Sbjct: 598  AILDECTSAVTTDMEERFCAQVQAMGTSCITISHRPALVAFHDVVLSLDGEGGWLVNYKG 657

Query: 660  DGSSVVTKSGINMIKSSETDRQSDAMAVEQAFVTAKKDSAFSNPKAQSYVSEVIAASPIA 719
              S  +T++G ++    ET+R++DAM V++AF T+ K +        SY+SEVIAASP  
Sbjct: 658  KDSPALTEAGGDLTGDFETERKNDAMIVQKAFSTSDKAT-------HSYISEVIAASPNI 710

Query: 720  DHNVPLPVFPQLKSAPRILPLRVADMFKVLVPTVFDKQGAQLLAVAFLVVSRTWISDRIA 779
            DHNV LP+ P L+ APR LPLRVA MFK+LVPT+ DKQGA LLAVAFLV+SRT++SDRIA
Sbjct: 711  DHNVLLPIVPPLQRAPRALPLRVAAMFKILVPTILDKQGAHLLAVAFLVISRTFVSDRIA 770

Query: 780  SLNGTTVKYVLEQDKASFVRLIGVSVLQSAASSFIAPSIRHLTARLALGWRIRMTQHLLK 839
            SLNGTTVK+VLEQDKASFVRLIGVSVLQSAASSFIAPS+RHLT RLALGWRIR+TQHLLK
Sbjct: 771  SLNGTTVKFVLEQDKASFVRLIGVSVLQSAASSFIAPSLRHLTTRLALGWRIRLTQHLLK 830

Query: 840  SYLRKNSFYKVFNMSSKSIDADQRITHDLEKLTTDLSGLVTGMVKPSVDILWFTWRMKAL 899
            +YLR N+FYKVF+MSSK+IDADQRITHDLEKLTTDLSGLVTGMVKP VDILWFTWRMK L
Sbjct: 831  NYLRNNTFYKVFHMSSKNIDADQRITHDLEKLTTDLSGLVTGMVKPLVDILWFTWRMKLL 890

Query: 900  TGQRGVAILYAYMLLGLGFLRSVTPEFGDLTSREQQLEGTFRFMHERLRAHAESVAFFGG 959
            TGQRGVAILY YMLLGLGFLR+VTP+FGDL S EQQLEGTFRFMHERLR HAESVAFFGG
Sbjct: 891  TGQRGVAILYTYMLLGLGFLRAVTPDFGDLASEEQQLEGTFRFMHERLRTHAESVAFFGG 950

Query: 960  GAREKAMIESRFRELLEHSLLLLKKKWLFGILDDFVTKQLPHNVTWGLSLLYAMEHKGDR 1019
            G REKAMIESRFRELL+HS+LLLKKKW +GILDDFVTKQLPHNVTWGLSLLYAMEHKGDR
Sbjct: 951  GKREKAMIESRFRELLDHSMLLLKKKWSYGILDDFVTKQLPHNVTWGLSLLYAMEHKGDR 1010

Query: 1020 ALVSTQGELAHALRFLASVVSQSFLAFGDILELHRKFVELSGGINRIFELEELLDAAQPG 1079
            A+ STQGELAHALRFLASVVSQSFLAFGDILELH+KF ELSG INRIFELEELLDAAQ  
Sbjct: 1011 AMTSTQGELAHALRFLASVVSQSFLAFGDILELHKKFAELSGSINRIFELEELLDAAQ-- 1068

Query: 1080 DDEISGSSQHKWNSTDYQDSISFSKLDIITPSQKLLARQLTFEIVPGKSLLVTGPNGSGK 1139
                              D+ISF ++DIITP+QKLLARQLTF+I   KSLL+TGPNGSGK
Sbjct: 1069 -----------------SDAISFMEVDIITPAQKLLARQLTFDIEQRKSLLLTGPNGSGK 1111

Query: 1140 SSVFRVLRGLWPVVSGSLTKPSQHIDEEAGSGCGIFYVPQRPYTCLGTLRDQIIYPLSRE 1199
            SSVFRVLRGLWP+ SG + KPSQHI +E GSGC +FYVPQRPYTCLGTLRDQIIYPLSR+
Sbjct: 1112 SSVFRVLRGLWPIASGRIAKPSQHISKETGSGCAVFYVPQRPYTCLGTLRDQIIYPLSRD 1171

Query: 1200 EAELRALKLHGKGEKLVDTTNILDSYLKTILEGVRLSYLLEREEVGWDANLNWEDILSLG 1259
            EAE+  L+L+ KG+   + TN+LDS LK ILE VRL+YLLERE  GWDAN+NWED LSLG
Sbjct: 1172 EAEVMTLELYEKGKLSTEITNMLDSCLKNILENVRLNYLLEREG-GWDANMNWEDTLSLG 1230

Query: 1260 EQQRLGMARLFFHKPKFGILDECTNATSVDVEEQLYRLAKDMGITFVTSSQRPALIPFHS 1319
            EQQRLGMARLFFHKPKF ILDECTNATSVDVEEQLYRLA DMGITF+TSSQRPALIPFHS
Sbjct: 1231 EQQRLGMARLFFHKPKFAILDECTNATSVDVEEQLYRLASDMGITFITSSQRPALIPFHS 1290

Query: 1320 LELRLIDGEGNWELRTI 1336
            LELRLIDGEG+WELR I
Sbjct: 1291 LELRLIDGEGHWELRAI 1307

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|356540293|ref|XP_003538624.1| PREDICTED: ABC transporter D family member 1-like isoform 1 [Glycine max] Back     alignment and taxonomy information
>gi|356540295|ref|XP_003538625.1| PREDICTED: ABC transporter D family member 1-like isoform 2 [Glycine max] Back     alignment and taxonomy information
>gi|356528475|ref|XP_003532828.1| PREDICTED: ABC transporter D family member 1-like [Glycine max] Back     alignment and taxonomy information
>gi|357463371|ref|XP_003601967.1| ABC transporter D family member [Medicago truncatula] gi|355491015|gb|AES72218.1| ABC transporter D family member [Medicago truncatula] Back     alignment and taxonomy information
>gi|356512707|ref|XP_003525058.1| PREDICTED: ABC transporter D family member 1-like [Glycine max] Back     alignment and taxonomy information
>gi|357463369|ref|XP_003601966.1| ABC transporter D family member [Medicago truncatula] gi|355491014|gb|AES72217.1| ABC transporter D family member [Medicago truncatula] Back     alignment and taxonomy information
>gi|18478510|dbj|BAB84550.1| peroxisomal ABC transporter [Arabidopsis thaliana] gi|18478515|dbj|BAB84551.1| peroxisomal ABC transporter [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|18420546|ref|NP_568072.1| ABC transporter D family member 1 [Arabidopsis thaliana] gi|75332181|sp|Q94FB9.1|AB1D_ARATH RecName: Full=ABC transporter D family member 1; Short=ABC transporter ABCD.1; Short=AtABCD1; AltName: Full=Peroxisomal ABC transporter 1; Short=AtPXA1; AltName: Full=Protein ACETATE NON-UTILIZING 2; AltName: Full=Protein COMATOSE; AltName: Full=Protein PEROXISOME DEFECTIVE 3; Short=Ped3p gi|15320529|gb|AAK95343.1|AF378120_1 peroxisomal ABC transporter PXA1 [Arabidopsis thaliana] gi|20803766|emb|CAC85290.1| ABC transporter [Arabidopsis thaliana] gi|332661726|gb|AEE87126.1| ABC transporter D family member 1 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|255549548|ref|XP_002515826.1| peroxisomal abc transporter, putative [Ricinus communis] gi|223545055|gb|EEF46568.1| peroxisomal abc transporter, putative [Ricinus communis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1338
UNIPROTKB|Q5F4B9660 ABCD3 "Uncharacterized protein 0.402 0.816 0.354 1.3e-82
RGD|2007659 Abcd3 "ATP-binding cassette, s 0.425 0.863 0.337 1.6e-82
UNIPROTKB|A7Z038656 ABCD3 "Uncharacterized protein 0.429 0.876 0.343 2.7e-82
ZFIN|ZDB-GENE-050517-27766 abcd1 "ATP-binding cassette, s 0.160 0.280 0.484 6.9e-82
MGI|MGI:1349216659 Abcd3 "ATP-binding cassette, s 0.425 0.863 0.335 9.5e-82
WB|WBGene00004058665 pmp-1 [Caenorhabditis elegans 0.408 0.821 0.329 9.5e-82
WB|WBGene00004061734 pmp-4 [Caenorhabditis elegans 0.428 0.780 0.286 7e-62
ZFIN|ZDB-GENE-050517-29659 abcd3b "ATP-binding cassette, 0.456 0.927 0.333 1.5e-80
ZFIN|ZDB-GENE-040426-2868656 abcd3a "ATP-binding cassette, 0.432 0.882 0.336 1.5e-80
DICTYBASE|DDB_G0293194741 abcD2 "ABC transporter D famil 0.156 0.283 0.465 1.9e-80
UNIPROTKB|Q5F4B9 ABCD3 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
 Score = 835 (299.0 bits), Expect = 1.3e-82, P = 1.3e-82
 Identities = 201/567 (35%), Positives = 306/567 (53%)

Query:   107 LLALVGIVVLRTALSNRLAKVQGFLFRAAFLRRVPLFFQLISENILLCF-LLSTMHSTSK 165
             LL +  ++V+RT     + +  G +  +A + R    F+    N +     +S +++  K
Sbjct:    88 LLLIAVMLVVRTYCDIWMIQ-NGTVIESAIIGRSRKDFKKYLFNFIAAMPAISLVNNFLK 146

Query:   166 YITGTLSLQFRKIVTKLIHTRYFENMAYYKISHVDGRITHPEQRLASDVPRFCSELSELV 225
             Y    L L FR  +TK ++  Y +   YYK+ ++D RI +P+Q L  DV +FC+ + +L 
Sbjct:   147 YGLNELKLCFRVRLTKYLYEEYLKAYTYYKMGNLDNRIANPDQLLTQDVEKFCNSVVDLY 206

Query:   226 QDDLTAVTDGLLYTWRLCSYASPKYVFWILAYVLGAGTMMRNFSPAFGKLMSKEQQLEGE 285
              +      D +LY ++L S    +    ++AY++ +G  +       GK+   EQ+ EGE
Sbjct:   207 SNLSKPFLDIVLYIFKLTSAIGAQGPASMMAYLIVSGFFLTRLRRPIGKMTIIEQKYEGE 266

Query:   286 YRQLHSRLRTHAESIAFYGGENKEESHIQQKFKALTRHMRVVLHDHWWFGMIQDFLLKYL 345
             YR ++SRL T++E IAFY G  +E+  I + F+ L  H+   +   +  G I   + KYL
Sbjct:   267 YRYVNSRLITNSEEIAFYNGNLREKQTIHRTFRKLVEHLHNFILFRFSMGFIDTIIAKYL 326

Query:   346 GATVAVILIIEPFFAGNLK-PDTSTLGRAKMLSNLRYHTSVIISLFQSLGTXXXXXXXXX 404
                V  +++  PF   NL  P       A++L +      +++ + Q+LG          
Sbjct:   327 ATVVGYLVVSRPFL--NLADPRHQNSTHAELLEDYYQSGRMLLRMSQALGRIVLAGREMT 384

Query:   405 XXXGYADRIHELMVISRELS----------------IEDKSPQRNGSRNYFSEANYIEFS 448
                G+  RI ELM + ++L+                I+   P   GS    +  N I+F 
Sbjct:   385 RLAGFTARITELMQVLKDLNSGKYQRTMVSQEKDADIKQALPLIPGSGEIINTDNLIKFD 444

Query:   449 GVKVVTPTGNVLVENLTLKVEPGSNLLITGPNGSGKSSLFRVLGGLWPLVSGHIAKPGVG 508
              V +VTP G+VL+++L  +V  G+N+LI GPNG GKSSLFRVLG LWPL  G + KP  G
Sbjct:   445 HVPLVTPNGDVLIQDLNFEVRSGANVLICGPNGCGKSSLFRVLGELWPLFGGRLTKPVRG 504

Query:   509 SDLNKEIFYVPQRPYTAVGTLRDQLIYPLT-SDQEVEPLTHGGMVELLKNVDLEYLLDRY 567
                  ++FYVPQRPY  +GTLRDQ+IYP T  DQ  + ++   + E L NV L  +L+R 
Sbjct:   505 -----KLFYVPQRPYMTLGTLRDQVIYPDTLEDQRKKGISDQVLKEYLDNVQLGQILERE 559

Query:   568 PPEKEI-NWGDELSLGEQQRLGMARLFYHKPKFAILDECTSAVTTDMEERFCAKVRAMGT 626
                  + +W D LS GE+QR+ MARLFYHKP+FAILDECTSAV+ D+E    +  R +G 
Sbjct:   560 GGWDSVQDWMDVLSGGEKQRMAMARLFYHKPQFAILDECTSAVSVDVEGYIYSHCRKVGI 619

Query:   627 SCITISHRPALVAFHDVVLSLDGEGEW 653
             +  T+SHR +L   HD  L +DG G +
Sbjct:   620 TLFTVSHRKSLWKHHDFYLHMDGRGNY 646
GO:0016021 "integral to membrane" evidence=IEA
GO:0042626 "ATPase activity, coupled to transmembrane movement of substances" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA
GO:0005743 "mitochondrial inner membrane" evidence=IEA
GO:0005778 "peroxisomal membrane" evidence=IEA
GO:0005782 "peroxisomal matrix" evidence=IEA
GO:0006635 "fatty acid beta-oxidation" evidence=IEA
GO:0007031 "peroxisome organization" evidence=IEA
GO:0042760 "very long-chain fatty acid catabolic process" evidence=IEA
GO:0042803 "protein homodimerization activity" evidence=IEA
RGD|2007 Abcd3 "ATP-binding cassette, subfamily D (ALD), member 3" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|A7Z038 ABCD3 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-050517-27 abcd1 "ATP-binding cassette, sub-family D (ALD), member 1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
MGI|MGI:1349216 Abcd3 "ATP-binding cassette, sub-family D (ALD), member 3" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
WB|WBGene00004058 pmp-1 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
WB|WBGene00004061 pmp-4 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-050517-29 abcd3b "ATP-binding cassette, sub-family D (ALD), member 3b" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040426-2868 abcd3a "ATP-binding cassette, sub-family D (ALD), member 3a" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0293194 abcD2 "ABC transporter D family protein" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q94FB9AB1D_ARATH3, ., 6, ., 3, ., 4, 70.79460.99320.9940yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.6.3.470.979

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
estExt_fgenesh4_pm.C_LG_V0072
peroxisomal membrane ABC transporter family, PMP family (1310 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1338
TIGR00954659 TIGR00954, 3a01203, Peroxysomal Fatty Acyl CoA Tra 1e-144
TIGR00954659 TIGR00954, 3a01203, Peroxysomal Fatty Acyl CoA Tra 1e-134
pfam06472282 pfam06472, ABC_membrane_2, ABC transporter transme 4e-95
pfam06472282 pfam06472, ABC_membrane_2, ABC transporter transme 2e-90
COG4178604 COG4178, COG4178, ABC-type uncharacterized transpo 1e-88
COG4178604 COG4178, COG4178, ABC-type uncharacterized transpo 1e-79
cd03223166 cd03223, ABCD_peroxisomal_ALDP, ATP-binding casset 1e-75
cd03223166 cd03223, ABCD_peroxisomal_ALDP, ATP-binding casset 2e-61
cd03228171 cd03228, ABCC_MRP_Like, ATP-binding cassette domai 3e-27
COG1132567 COG1132, MdlB, ABC-type multidrug transport system 1e-25
cd03245220 cd03245, ABCC_bacteriocin_exporters, ATP-binding c 4e-24
COG2274709 COG2274, SunT, ABC-type bacteriocin/lantibiotic ex 8e-24
cd03246173 cd03246, ABCC_Protease_Secretion, ATP-binding cass 3e-22
TIGR02857529 TIGR02857, CydD, thiol reductant ABC exporter, Cyd 1e-21
cd03254229 cd03254, ABCC_Glucan_exporter_like, ATP-binding ca 2e-21
COG4988559 COG4988, CydD, ABC-type transport system involved 2e-21
cd03255218 cd03255, ABC_MJ0796_LolCDE_FtsE, ATP-binding casse 3e-20
COG4987573 COG4987, CydC, ABC-type transport system involved 6e-20
TIGR03375694 TIGR03375, type_I_sec_LssB, type I secretion syste 7e-20
cd03235213 cd03235, ABC_Metallic_Cations, ATP-binding cassett 7e-20
COG1123539 COG1123, COG1123, ATPase components of various ABC 1e-19
cd03257228 cd03257, ABC_NikE_OppD_transporters, ATP-binding c 2e-19
COG1121254 COG1121, ZnuC, ABC-type Mn/Zn transport systems, A 2e-19
cd03225211 cd03225, ABC_cobalt_CbiO_domain1, First domain of 2e-19
COG2274709 COG2274, SunT, ABC-type bacteriocin/lantibiotic ex 3e-19
COG4619223 COG4619, COG4619, ABC-type uncharacterized transpo 1e-18
COG1124252 COG1124, DppF, ABC-type dipeptide/oligopeptide/nic 1e-18
COG1120258 COG1120, FepC, ABC-type cobalamin/Fe3+-siderophore 2e-18
TIGR01842544 TIGR01842, type_I_sec_PrtD, type I secretion syste 3e-18
COG1132567 COG1132, MdlB, ABC-type multidrug transport system 4e-18
TIGR02868530 TIGR02868, CydC, thiol reductant ABC exporter, Cyd 5e-18
COG1119257 COG1119, ModF, ABC-type molybdenum transport syste 8e-18
COG1136226 COG1136, SalX, ABC-type antimicrobial peptide tran 8e-18
COG1131293 COG1131, CcmA, ABC-type multidrug transport system 1e-17
COG4988559 COG4988, CydD, ABC-type transport system involved 2e-17
cd03226205 cd03226, ABC_cobalt_CbiO_domain2, Second domain of 2e-17
COG1122235 COG1122, CbiO, ABC-type cobalt transport system, A 5e-17
cd03214180 cd03214, ABC_Iron-Siderophores_B12_Hemin, ATP-bind 2e-16
PRK11160574 PRK11160, PRK11160, cysteine/glutathione ABC trans 2e-16
cd03244221 cd03244, ABCC_MRP_domain2, ATP-binding cassette do 2e-16
COG4618580 COG4618, ArpD, ABC-type protease/lipase transport 8e-16
PRK14250241 PRK14250, PRK14250, phosphate ABC transporter ATP- 8e-16
COG1131293 COG1131, CcmA, ABC-type multidrug transport system 1e-15
COG4987573 COG4987, CydC, ABC-type transport system involved 2e-15
cd03248226 cd03248, ABCC_TAP, ATP-binding cassette domain of 2e-15
COG1123539 COG1123, COG1123, ATPase components of various ABC 4e-15
cd03250204 cd03250, ABCC_MRP_domain1, ATP-binding cassette do 4e-15
cd03253236 cd03253, ABCC_ATM1_transporter, ATP-binding casset 5e-15
cd03249238 cd03249, ABC_MTABC3_MDL1_MDL2, ATP-binding cassett 1e-14
TIGR02857529 TIGR02857, CydD, thiol reductant ABC exporter, Cyd 2e-14
cd03259213 cd03259, ABC_Carb_Solutes_like, ATP-binding casset 2e-14
PRK13539207 PRK13539, PRK13539, cytochrome c biogenesis protei 2e-14
cd03252237 cd03252, ABCC_Hemolysin, ATP-binding cassette doma 2e-14
cd03293220 cd03293, ABC_NrtD_SsuB_transporters, ATP-binding c 4e-14
cd03260227 cd03260, ABC_PstB_phosphate_transporter, ATP-bindi 8e-14
TIGR00958711 TIGR00958, 3a01208, Conjugate Transporter-2 (CT2) 9e-14
cd03264211 cd03264, ABC_drug_resistance_like, ABC-type multid 1e-13
COG2884223 COG2884, FtsE, Predicted ATPase involved in cell d 1e-13
TIGR02673214 TIGR02673, FtsE, cell division ATP-binding protein 1e-13
cd03254229 cd03254, ABCC_Glucan_exporter_like, ATP-binding ca 2e-13
TIGR01842544 TIGR01842, type_I_sec_PrtD, type I secretion syste 2e-13
COG1135339 COG1135, AbcC, ABC-type metal ion transport system 2e-13
cd03231201 cd03231, ABC_CcmA_heme_exporter, Cytochrome c biog 3e-13
TIGR02203571 TIGR02203, MsbA_lipidA, lipid A export permease/AT 3e-13
COG0444316 COG0444, DppD, ABC-type dipeptide/oligopeptide/nic 4e-13
cd03251234 cd03251, ABCC_MsbA, ATP-binding cassette domain of 4e-13
COG4181228 COG4181, COG4181, Predicted ABC-type transport sys 5e-13
cd03260227 cd03260, ABC_PstB_phosphate_transporter, ATP-bindi 7e-13
COG1116248 COG1116, TauB, ABC-type nitrate/sulfonate/bicarbon 7e-13
cd03369207 cd03369, ABCC_NFT1, ATP-binding cassette domain 2 7e-13
cd03230173 cd03230, ABC_DR_subfamily_A, ATP-binding cassette 7e-13
TIGR03796710 TIGR03796, NHLM_micro_ABC1, NHLM bacteriocin syste 8e-13
COG3839338 COG3839, MalK, ABC-type sugar transport systems, A 8e-13
COG4608268 COG4608, AppF, ABC-type oligopeptide transport sys 1e-12
COG4618580 COG4618, ArpD, ABC-type protease/lipase transport 2e-12
COG3842352 COG3842, PotA, ABC-type spermidine/putrescine tran 2e-12
TIGR01186363 TIGR01186, proV, glycine betaine/L-proline transpo 3e-12
TIGR01189198 TIGR01189, ccmA, heme ABC exporter, ATP-binding pr 3e-12
TIGR02204576 TIGR02204, MsbA_rel, ABC transporter, permease/ATP 3e-12
TIGR01193708 TIGR01193, bacteriocin_ABC, ABC-type bacteriocin t 3e-12
cd03235213 cd03235, ABC_Metallic_Cations, ATP-binding cassett 5e-12
COG3638258 COG3638, COG3638, ABC-type phosphate/phosphonate t 5e-12
cd03256241 cd03256, ABC_PhnC_transporter, ATP-binding cassett 7e-12
PRK11174588 PRK11174, PRK11174, cysteine/glutathione ABC trans 7e-12
TIGR03375694 TIGR03375, type_I_sec_LssB, type I secretion syste 8e-12
pfam00005119 pfam00005, ABC_tran, ABC transporter 1e-11
TIGR00968237 TIGR00968, 3a0106s01, sulfate ABC transporter, ATP 1e-11
cd03225211 cd03225, ABC_cobalt_CbiO_domain1, First domain of 2e-11
cd03214180 cd03214, ABC_Iron-Siderophores_B12_Hemin, ATP-bind 2e-11
PRK11160574 PRK11160, PRK11160, cysteine/glutathione ABC trans 2e-11
COG1121254 COG1121, ZnuC, ABC-type Mn/Zn transport systems, A 3e-11
COG1122235 COG1122, CbiO, ABC-type cobalt transport system, A 3e-11
PRK09544251 PRK09544, znuC, high-affinity zinc transporter ATP 3e-11
TIGR02868530 TIGR02868, CydC, thiol reductant ABC exporter, Cyd 4e-11
cd00267157 cd00267, ABC_ATPase, ATP-binding cassette transpor 4e-11
cd03300232 cd03300, ABC_PotA_N, ATP-binding cassette domain o 4e-11
cd03299235 cd03299, ABC_ModC_like, ATP-binding cassette domai 4e-11
COG4152300 COG4152, COG4152, ABC-type uncharacterized transpo 5e-11
cd03255218 cd03255, ABC_MJ0796_LolCDE_FtsE, ATP-binding casse 6e-11
PRK09452375 PRK09452, potA, putrescine/spermidine ABC transpor 6e-11
cd03258233 cd03258, ABC_MetN_methionine_transporter, ATP-bind 6e-11
PRK10247225 PRK10247, PRK10247, putative ABC transporter ATP-b 7e-11
COG1124252 COG1124, DppF, ABC-type dipeptide/oligopeptide/nic 8e-11
cd03245220 cd03245, ABCC_bacteriocin_exporters, ATP-binding c 1e-10
COG1125309 COG1125, OpuBA, ABC-type proline/glycine betaine t 1e-10
cd03294269 cd03294, ABC_Pro_Gly_Betaine, ATP-binding cassette 1e-10
cd03295242 cd03295, ABC_OpuCA_Osmoprotection, ATP-binding cas 1e-10
cd03262213 cd03262, ABC_HisP_GlnQ, ATP-binding cassette domai 1e-10
COG1126240 COG1126, GlnQ, ABC-type polar amino acid transport 1e-10
pfam00005119 pfam00005, ABC_tran, ABC transporter 2e-10
TIGR01192585 TIGR01192, chvA, glucan exporter ATP-binding prote 2e-10
cd03268208 cd03268, ABC_BcrA_bacitracin_resist, ATP-binding c 2e-10
cd03248226 cd03248, ABCC_TAP, ATP-binding cassette domain of 3e-10
TIGR00958711 TIGR00958, 3a01208, Conjugate Transporter-2 (CT2) 3e-10
TIGR01189198 TIGR01189, ccmA, heme ABC exporter, ATP-binding pr 3e-10
TIGR01166190 TIGR01166, cbiO, cobalt transport protein ATP-bind 3e-10
COG4175386 COG4175, ProV, ABC-type proline/glycine betaine tr 3e-10
cd03257228 cd03257, ABC_NikE_OppD_transporters, ATP-binding c 4e-10
COG0488530 COG0488, Uup, ATPase components of ABC transporter 4e-10
PRK15079331 PRK15079, PRK15079, oligopeptide ABC transporter A 5e-10
TIGR03797686 TIGR03797, NHLM_micro_ABC2, NHLM bacteriocin syste 5e-10
TIGR01846694 TIGR01846, type_I_sec_HlyB, type I secretion syste 5e-10
PRK14246257 PRK14246, PRK14246, phosphate ABC transporter ATP- 6e-10
COG1123 539 COG1123, COG1123, ATPase components of various ABC 8e-10
cd03301213 cd03301, ABC_MalK_N, The N-terminal ATPase domain 8e-10
cd03219236 cd03219, ABC_Mj1267_LivG_branched, ATP-binding cas 8e-10
cd03291282 cd03291, ABCC_CFTR1, ATP-binding cassette domain o 8e-10
cd03269210 cd03269, ABC_putative_ATPase, ATP-binding cassette 8e-10
cd03253236 cd03253, ABCC_ATM1_transporter, ATP-binding casset 9e-10
COG4133209 COG4133, CcmA, ABC-type transport system involved 9e-10
COG1120258 COG1120, FepC, ABC-type cobalamin/Fe3+-siderophore 1e-09
cd03256241 cd03256, ABC_PhnC_transporter, ATP-binding cassett 1e-09
COG4133209 COG4133, CcmA, ABC-type transport system involved 1e-09
PRK09493240 PRK09493, glnQ, glutamine ABC transporter ATP-bind 1e-09
COG1129500 COG1129, MglA, ABC-type sugar transport system, AT 1e-09
COG4161242 COG4161, ArtP, ABC-type arginine transport system, 1e-09
COG4555245 COG4555, NatA, ABC-type Na+ transport system, ATPa 2e-09
TIGR02982220 TIGR02982, heterocyst_DevA, ABC exporter ATP-bindi 2e-09
TIGR02211221 TIGR02211, LolD_lipo_ex, lipoprotein releasing sys 2e-09
TIGR02769265 TIGR02769, nickel_nikE, nickel import ATP-binding 2e-09
TIGR02315243 TIGR02315, ABC_phnC, phosphonate ABC transporter, 2e-09
TIGR02204576 TIGR02204, MsbA_rel, ABC transporter, permease/ATP 3e-09
cd03268208 cd03268, ABC_BcrA_bacitracin_resist, ATP-binding c 3e-09
PRK13635279 PRK13635, cbiO, cobalt transporter ATP-binding sub 3e-09
cd03297214 cd03297, ABC_ModC_molybdenum_transporter, ATP-bind 3e-09
COG0396251 COG0396, sufC, Cysteine desulfurase activator ATPa 3e-09
PRK13538204 PRK13538, PRK13538, cytochrome c biogenesis protei 3e-09
cd03292214 cd03292, ABC_FtsE_transporter, ATP-binding cassett 4e-09
COG0488530 COG0488, Uup, ATPase components of ABC transporter 5e-09
COG1123539 COG1123, COG1123, ATPase components of various ABC 6e-09
cd03229178 cd03229, ABC_Class3, ATP-binding cassette domain o 6e-09
PRK10535648 PRK10535, PRK10535, macrolide transporter ATP-bind 6e-09
COG4619223 COG4619, COG4619, ABC-type uncharacterized transpo 7e-09
PRK10261623 PRK10261, PRK10261, glutathione transporter ATP-bi 7e-09
TIGR03410230 TIGR03410, urea_trans_UrtE, urea ABC transporter, 7e-09
COG0410237 COG0410, LivF, ABC-type branched-chain amino acid 8e-09
TIGR01187325 TIGR01187, potA, spermidine/putrescine ABC transpo 8e-09
cd03296239 cd03296, ABC_CysA_sulfate_importer, ATP-binding ca 8e-09
TIGR01271 1490 TIGR01271, CFTR_protein, cystic fibrosis transmemb 9e-09
cd03246173 cd03246, ABCC_Protease_Secretion, ATP-binding cass 1e-08
PRK14250241 PRK14250, PRK14250, phosphate ABC transporter ATP- 1e-08
TIGR03771223 TIGR03771, anch_rpt_ABC, anchored repeat-type ABC 1e-08
cd03224222 cd03224, ABC_TM1139_LivF_branched, ATP-binding cas 1e-08
TIGR009571522 TIGR00957, MRP_assoc_pro, multi drug resistance-as 1e-08
PRK10790592 PRK10790, PRK10790, putative multidrug transporter 1e-08
PRK09544251 PRK09544, znuC, high-affinity zinc transporter ATP 2e-08
COG0488 530 COG0488, Uup, ATPase components of ABC transporter 2e-08
cd03216163 cd03216, ABC_Carb_Monos_I, First domain of the ATP 2e-08
TIGR03873256 TIGR03873, F420-0_ABC_ATP, proposed F420-0 ABC tra 2e-08
cd03247178 cd03247, ABCC_cytochrome_bd, ATP-binding cassette 2e-08
COG1127263 COG1127, Ttg2A, ABC-type transport system involved 2e-08
PRK13657588 PRK13657, PRK13657, cyclic beta-1,2-glucan ABC tra 2e-08
cd03244221 cd03244, ABCC_MRP_domain2, ATP-binding cassette do 3e-08
cd03250204 cd03250, ABCC_MRP_domain1, ATP-binding cassette do 3e-08
PRK13539207 PRK13539, PRK13539, cytochrome c biogenesis protei 3e-08
COG4181228 COG4181, COG4181, Predicted ABC-type transport sys 3e-08
cd00267157 cd00267, ABC_ATPase, ATP-binding cassette transpor 3e-08
TIGR02315243 TIGR02315, ABC_phnC, phosphonate ABC transporter, 3e-08
PRK10895241 PRK10895, PRK10895, lipopolysaccharide ABC transpo 3e-08
COG1116248 COG1116, TauB, ABC-type nitrate/sulfonate/bicarbon 4e-08
PLN032321495 PLN03232, PLN03232, ABC transporter C family membe 4e-08
cd03221144 cd03221, ABCF_EF-3, ATP-binding cassette domain of 4e-08
TIGR02633500 TIGR02633, xylG, D-xylose ABC transporter, ATP-bin 4e-08
cd03228171 cd03228, ABCC_MRP_Like, ATP-binding cassette domai 5e-08
COG4586325 COG4586, COG4586, ABC-type uncharacterized transpo 7e-08
cd03231201 cd03231, ABC_CcmA_heme_exporter, Cytochrome c biog 8e-08
COG4152300 COG4152, COG4152, ABC-type uncharacterized transpo 8e-08
cd03269210 cd03269, ABC_putative_ATPase, ATP-binding cassette 8e-08
PRK13549506 PRK13549, PRK13549, xylose transporter ATP-binding 8e-08
PRK10261623 PRK10261, PRK10261, glutathione transporter ATP-bi 9e-08
TIGR03608206 TIGR03608, L_ocin_972_ABC, putative bacteriocin ex 9e-08
PRK11607377 PRK11607, potG, putrescine transporter ATP-binding 9e-08
cd03259213 cd03259, ABC_Carb_Solutes_like, ATP-binding casset 1e-07
cd03230173 cd03230, ABC_DR_subfamily_A, ATP-binding cassette 1e-07
COG4161242 COG4161, ArtP, ABC-type arginine transport system, 1e-07
TIGR03740223 TIGR03740, galliderm_ABC, gallidermin-class lantib 1e-07
cd03217200 cd03217, ABC_FeS_Assembly, ABC-type transport syst 1e-07
cd03266218 cd03266, ABC_NatA_sodium_exporter, ATP-binding cas 1e-07
COG3845501 COG3845, COG3845, ABC-type uncharacterized transpo 1e-07
COG1118345 COG1118, CysA, ABC-type sulfate/molybdate transpor 1e-07
PRK13548258 PRK13548, hmuV, hemin importer ATP-binding subunit 1e-07
COG4525259 COG4525, TauB, ABC-type taurine transport system, 1e-07
PRK11124242 PRK11124, artP, arginine transporter ATP-binding s 1e-07
cd00267157 cd00267, ABC_ATPase, ATP-binding cassette transpor 2e-07
TIGR03410230 TIGR03410, urea_trans_UrtE, urea ABC transporter, 2e-07
PLN032321495 PLN03232, PLN03232, ABC transporter C family membe 2e-07
TIGR02770230 TIGR02770, nickel_nikD, nickel import ATP-binding 2e-07
cd03261235 cd03261, ABC_Org_Solvent_Resistant, ATP-binding ca 2e-07
cd00267157 cd00267, ABC_ATPase, ATP-binding cassette transpor 3e-07
COG1245591 COG1245, COG1245, Predicted ATPase, RNase L inhibi 3e-07
PRK13650279 PRK13650, cbiO, cobalt transporter ATP-binding sub 3e-07
TIGR03005252 TIGR03005, ectoine_ehuA, ectoine/hydroxyectoine AB 3e-07
PRK10584228 PRK10584, PRK10584, putative ABC transporter ATP-b 3e-07
PRK10419268 PRK10419, nikE, nickel transporter ATP-binding pro 3e-07
COG3842 352 COG3842, PotA, ABC-type spermidine/putrescine tran 4e-07
TIGR03719 552 TIGR03719, ABC_ABC_ChvD, ATP-binding cassette prot 4e-07
COG0411250 COG0411, LivG, ABC-type branched-chain amino acid 4e-07
TIGR03415382 TIGR03415, ABC_choXWV_ATP, choline ABC transporter 4e-07
TIGR02324224 TIGR02324, CP_lyasePhnL, phosphonate C-P lyase sys 5e-07
PTZ002431560 PTZ00243, PTZ00243, ABC transporter; Provisional 5e-07
PRK10982491 PRK10982, PRK10982, galactose/methyl galaxtoside t 5e-07
COG4559259 COG4559, COG4559, ABC-type hemin transport system, 5e-07
PRK13639275 PRK13639, cbiO, cobalt transporter ATP-binding sub 5e-07
cd03293220 cd03293, ABC_NrtD_SsuB_transporters, ATP-binding c 6e-07
PRK11432351 PRK11432, fbpC, ferric transporter ATP-binding sub 7e-07
TIGR03258362 TIGR03258, PhnT, 2-aminoethylphosphonate ABC trans 7e-07
TIGR02142354 TIGR02142, modC_ABC, molybdenum ABC transporter, A 7e-07
COG1136226 COG1136, SalX, ABC-type antimicrobial peptide tran 9e-07
COG0410237 COG0410, LivF, ABC-type branched-chain amino acid 9e-07
PRK13632271 PRK13632, cbiO, cobalt transporter ATP-binding sub 9e-07
cd03228171 cd03228, ABCC_MRP_Like, ATP-binding cassette domai 1e-06
cd03249238 cd03249, ABC_MTABC3_MDL1_MDL2, ATP-binding cassett 1e-06
PRK11174588 PRK11174, PRK11174, cysteine/glutathione ABC trans 1e-06
PRK13538204 PRK13538, PRK13538, cytochrome c biogenesis protei 1e-06
COG4167267 COG4167, SapF, ABC-type antimicrobial peptide tran 1e-06
PRK13540200 PRK13540, PRK13540, cytochrome c biogenesis protei 1e-06
PLN03130 1622 PLN03130, PLN03130, ABC transporter C family membe 1e-06
TIGR03522301 TIGR03522, GldA_ABC_ATP, gliding motility-associat 1e-06
cd03246173 cd03246, ABCC_Protease_Secretion, ATP-binding cass 2e-06
cd03226205 cd03226, ABC_cobalt_CbiO_domain2, Second domain of 2e-06
COG0488530 COG0488, Uup, ATPase components of ABC transporter 2e-06
TIGR012711490 TIGR01271, CFTR_protein, cystic fibrosis transmemb 2e-06
TIGR009571522 TIGR00957, MRP_assoc_pro, multi drug resistance-as 2e-06
TIGR03873256 TIGR03873, F420-0_ABC_ATP, proposed F420-0 ABC tra 2e-06
cd03265220 cd03265, ABC_DrrA, Daunorubicin/doxorubicin resist 2e-06
PRK11264250 PRK11264, PRK11264, putative amino-acid ABC transp 2e-06
cd03289275 cd03289, ABCC_CFTR2, ATP-binding cassette domain 2 2e-06
PRK10762501 PRK10762, PRK10762, D-ribose transporter ATP bindi 2e-06
PLN031301622 PLN03130, PLN03130, ABC transporter C family membe 3e-06
PRK13652277 PRK13652, cbiO, cobalt transporter ATP-binding sub 3e-06
COG4172534 COG4172, COG4172, ABC-type uncharacterized transpo 3e-06
TIGR01978243 TIGR01978, sufC, FeS assembly ATPase SufC 3e-06
COG4559259 COG4559, COG4559, ABC-type hemin transport system, 4e-06
PRK15056272 PRK15056, PRK15056, manganese/iron transporter ATP 4e-06
PRK11629233 PRK11629, lolD, lipoprotein transporter ATP-bindin 4e-06
COG5265497 COG5265, ATM1, ABC-type transport system involved 4e-06
cd03266218 cd03266, ABC_NatA_sodium_exporter, ATP-binding cas 5e-06
cd03252237 cd03252, ABCC_Hemolysin, ATP-binding cassette doma 6e-06
PRK14246257 PRK14246, PRK14246, phosphate ABC transporter ATP- 6e-06
TIGR03265353 TIGR03265, PhnT2, putative 2-aminoethylphosphonate 6e-06
cd03300232 cd03300, ABC_PotA_N, ATP-binding cassette domain o 7e-06
TIGR02982220 TIGR02982, heterocyst_DevA, ABC exporter ATP-bindi 7e-06
COG4136213 COG4136, COG4136, ABC-type uncharacterized transpo 7e-06
COG2884223 COG2884, FtsE, Predicted ATPase involved in cell d 8e-06
TIGR03719552 TIGR03719, ABC_ABC_ChvD, ATP-binding cassette prot 8e-06
PRK11153343 PRK11153, metN, DL-methionine transporter ATP-bind 9e-06
COG4608268 COG4608, AppF, ABC-type oligopeptide transport sys 1e-05
TIGR01166190 TIGR01166, cbiO, cobalt transport protein ATP-bind 1e-05
cd03224222 cd03224, ABC_TM1139_LivF_branched, ATP-binding cas 1e-05
COG2401593 COG2401, COG2401, ABC-type ATPase fused to a predi 1e-05
PRK14239252 PRK14239, PRK14239, phosphate transporter ATP-bind 1e-05
TIGR00968237 TIGR00968, 3a0106s01, sulfate ABC transporter, ATP 2e-05
COG4172534 COG4172, COG4172, ABC-type uncharacterized transpo 2e-05
COG5265497 COG5265, ATM1, ABC-type transport system involved 2e-05
COG1137243 COG1137, YhbG, ABC-type (unclassified) transport s 2e-05
cd03263220 cd03263, ABC_subfamily_A, ATP-binding cassette dom 2e-05
PRK14247250 PRK14247, PRK14247, phosphate ABC transporter ATP- 2e-05
cd03233202 cd03233, ABCG_PDR_domain1, First domain of the ple 2e-05
CHL00131252 CHL00131, ycf16, sulfate ABC transporter protein; 2e-05
PRK14265274 PRK14265, PRK14265, phosphate ABC transporter ATP- 2e-05
PRK10908222 PRK10908, PRK10908, cell division protein FtsE; Pr 2e-05
TIGR01193708 TIGR01193, bacteriocin_ABC, ABC-type bacteriocin t 3e-05
PRK11124242 PRK11124, artP, arginine transporter ATP-binding s 3e-05
COG0411250 COG0411, LivG, ABC-type branched-chain amino acid 3e-05
COG4167267 COG4167, SapF, ABC-type antimicrobial peptide tran 3e-05
PRK14239252 PRK14239, PRK14239, phosphate transporter ATP-bind 3e-05
TIGR01277213 TIGR01277, thiQ, thiamine ABC transporter, ATP-bin 3e-05
PRK10070400 PRK10070, PRK10070, glycine betaine transporter AT 3e-05
cd03220224 cd03220, ABC_KpsT_Wzt, ATP-binding cassette compon 3e-05
PRK15112267 PRK15112, PRK15112, antimicrobial peptide ABC syst 3e-05
PRK13637287 PRK13637, cbiO, cobalt transporter ATP-binding sub 3e-05
PRK14247250 PRK14247, PRK14247, phosphate ABC transporter ATP- 4e-05
PRK13543214 PRK13543, PRK13543, cytochrome c biogenesis protei 4e-05
PRK14260259 PRK14260, PRK14260, phosphate ABC transporter ATP- 4e-05
PRK14245250 PRK14245, PRK14245, phosphate ABC transporter ATP- 4e-05
TIGR03269520 TIGR03269, met_CoM_red_A2, methyl coenzyme M reduc 4e-05
PRK10851353 PRK10851, PRK10851, sulfate/thiosulfate transporte 5e-05
COG4778235 COG4778, PhnL, ABC-type phosphonate transport syst 5e-05
PRK09493240 PRK09493, glnQ, glutamine ABC transporter ATP-bind 6e-05
TIGR01187 325 TIGR01187, potA, spermidine/putrescine ABC transpo 6e-05
cd03247178 cd03247, ABCC_cytochrome_bd, ATP-binding cassette 6e-05
PTZ002431560 PTZ00243, PTZ00243, ABC transporter; Provisional 6e-05
PRK13536340 PRK13536, PRK13536, nodulation factor exporter sub 6e-05
PRK13640282 PRK13640, cbiO, cobalt transporter ATP-binding sub 6e-05
cd03251234 cd03251, ABCC_MsbA, ATP-binding cassette domain of 7e-05
TIGR01188302 TIGR01188, drrA, daunorubicin resistance ABC trans 7e-05
cd03296239 cd03296, ABC_CysA_sulfate_importer, ATP-binding ca 8e-05
COG4525259 COG4525, TauB, ABC-type taurine transport system, 8e-05
cd03265220 cd03265, ABC_DrrA, Daunorubicin/doxorubicin resist 8e-05
cd03213194 cd03213, ABCG_EPDR, Eye pigment and drug resistanc 8e-05
COG4604252 COG4604, CeuD, ABC-type enterochelin transport sys 8e-05
COG4555245 COG4555, NatA, ABC-type Na+ transport system, ATPa 9e-05
PRK14262250 PRK14262, PRK14262, phosphate ABC transporter ATP- 9e-05
PRK14268258 PRK14268, PRK14268, phosphate ABC transporter ATP- 9e-05
COG1117253 COG1117, PstB, ABC-type phosphate transport system 9e-05
COG0444316 COG0444, DppD, ABC-type dipeptide/oligopeptide/nic 1e-04
cd03262213 cd03262, ABC_HisP_GlnQ, ATP-binding cassette domai 1e-04
TIGR03771223 TIGR03771, anch_rpt_ABC, anchored repeat-type ABC 1e-04
PRK10584228 PRK10584, PRK10584, putative ABC transporter ATP-b 1e-04
TIGR03719552 TIGR03719, ABC_ABC_ChvD, ATP-binding cassette prot 1e-04
TIGR03269520 TIGR03269, met_CoM_red_A2, methyl coenzyme M reduc 1e-04
cd03234226 cd03234, ABCG_White, White pigment protein homolog 1e-04
COG4148352 COG4148, ModC, ABC-type molybdate transport system 1e-04
PRK13636283 PRK13636, cbiO, cobalt transporter ATP-binding sub 1e-04
cd03237246 cd03237, ABC_RNaseL_inhibitor_domain2, The ATP-bin 1e-04
cd03264211 cd03264, ABC_drug_resistance_like, ABC-type multid 2e-04
COG1135 339 COG1135, AbcC, ABC-type metal ion transport system 2e-04
COG3839 338 COG3839, MalK, ABC-type sugar transport systems, A 2e-04
COG4172 534 COG4172, COG4172, ABC-type uncharacterized transpo 2e-04
TIGR01978243 TIGR01978, sufC, FeS assembly ATPase SufC 2e-04
COG1137243 COG1137, YhbG, ABC-type (unclassified) transport s 2e-04
TIGR00972247 TIGR00972, 3a0107s01c2, phosphate ABC transporter, 2e-04
TIGR01288303 TIGR01288, nodI, ATP-binding ABC transporter famil 2e-04
PRK11819556 PRK11819, PRK11819, putative ABC transporter ATP-b 2e-04
cd03218232 cd03218, ABC_YhbG, ATP-binding cassette component 2e-04
PRK13409590 PRK13409, PRK13409, putative ATPase RIL; Provision 2e-04
COG0396251 COG0396, sufC, Cysteine desulfurase activator ATPa 3e-04
cd03221144 cd03221, ABCF_EF-3, ATP-binding cassette domain of 3e-04
PRK09473330 PRK09473, oppD, oligopeptide transporter ATP-bindi 3e-04
PRK11248255 PRK11248, tauB, taurine transporter ATP-binding su 3e-04
PRK13641287 PRK13641, cbiO, cobalt transporter ATP-binding sub 3e-04
COG1119257 COG1119, ModF, ABC-type molybdenum transport syste 4e-04
TIGR02673214 TIGR02673, FtsE, cell division ATP-binding protein 4e-04
TIGR03005252 TIGR03005, ectoine_ehuA, ectoine/hydroxyectoine AB 4e-04
TIGR02314343 TIGR02314, ABC_MetN, D-methionine ABC transporter, 4e-04
PRK13647274 PRK13647, cbiO, cobalt transporter ATP-binding sub 4e-04
COG3840231 COG3840, ThiQ, ABC-type thiamine transport system, 4e-04
PRK10575265 PRK10575, PRK10575, iron-hydroxamate transporter A 4e-04
cd03299235 cd03299, ABC_ModC_like, ATP-binding cassette domai 5e-04
PRK14245250 PRK14245, PRK14245, phosphate ABC transporter ATP- 5e-04
PRK14262250 PRK14262, PRK14262, phosphate ABC transporter ATP- 5e-04
COG1101263 COG1101, PhnK, ABC-type uncharacterized transport 5e-04
PRK14241258 PRK14241, PRK14241, phosphate transporter ATP-bind 5e-04
PRK11000 369 PRK11000, PRK11000, maltose/maltodextrin transport 5e-04
PRK09452 375 PRK09452, potA, putrescine/spermidine ABC transpor 6e-04
PRK13543214 PRK13543, PRK13543, cytochrome c biogenesis protei 6e-04
PRK13536340 PRK13536, PRK13536, nodulation factor exporter sub 6e-04
PRK14268258 PRK14268, PRK14268, phosphate ABC transporter ATP- 6e-04
cd03218232 cd03218, ABC_YhbG, ATP-binding cassette component 6e-04
PRK09536402 PRK09536, btuD, corrinoid ABC transporter ATPase; 7e-04
PRK09700510 PRK09700, PRK09700, D-allose transporter ATP-bindi 7e-04
COG1134249 COG1134, TagH, ABC-type polysaccharide/polyol phos 7e-04
TIGR02211221 TIGR02211, LolD_lipo_ex, lipoprotein releasing sys 8e-04
PRK13644274 PRK13644, cbiO, cobalt transporter ATP-binding sub 8e-04
PRK11147635 PRK11147, PRK11147, ABC transporter ATPase compone 8e-04
cd03213194 cd03213, ABCG_EPDR, Eye pigment and drug resistanc 9e-04
PRK10522547 PRK10522, PRK10522, multidrug transporter membrane 9e-04
PRK13547272 PRK13547, hmuV, hemin importer ATP-binding subunit 9e-04
TIGR01186 363 TIGR01186, proV, glycine betaine/L-proline transpo 0.001
COG3638258 COG3638, COG3638, ABC-type phosphate/phosphonate t 0.001
COG4175 386 COG4175, ProV, ABC-type proline/glycine betaine tr 0.001
TIGR01271 1490 TIGR01271, CFTR_protein, cystic fibrosis transmemb 0.001
TIGR03258 362 TIGR03258, PhnT, 2-aminoethylphosphonate ABC trans 0.001
TIGR01288303 TIGR01288, nodI, ATP-binding ABC transporter famil 0.001
PRK11819 556 PRK11819, PRK11819, putative ABC transporter ATP-b 0.001
TIGR03864236 TIGR03864, PQQ_ABC_ATP, ABC transporter, ATP-bindi 0.001
PRK14255252 PRK14255, PRK14255, phosphate ABC transporter ATP- 0.001
PRK14266250 PRK14266, PRK14266, phosphate ABC transporter ATP- 0.001
PRK14237267 PRK14237, PRK14237, phosphate transporter ATP-bind 0.001
cd03267236 cd03267, ABC_NatA_like, ATP-binding cassette domai 0.001
PTZ002651466 PTZ00265, PTZ00265, multidrug resistance protein ( 0.001
COG4674249 COG4674, COG4674, Uncharacterized ABC-type transpo 0.001
TIGR01846694 TIGR01846, type_I_sec_HlyB, type I secretion syste 0.002
PRK10261 623 PRK10261, PRK10261, glutathione transporter ATP-bi 0.002
cd03216163 cd03216, ABC_Carb_Monos_I, First domain of the ATP 0.002
PRK10895241 PRK10895, PRK10895, lipopolysaccharide ABC transpo 0.002
TIGR03740223 TIGR03740, galliderm_ABC, gallidermin-class lantib 0.002
TIGR03719552 TIGR03719, ABC_ABC_ChvD, ATP-binding cassette prot 0.002
TIGR03269520 TIGR03269, met_CoM_red_A2, methyl coenzyme M reduc 0.002
COG1117253 COG1117, PstB, ABC-type phosphate transport system 0.002
PRK13641287 PRK13641, cbiO, cobalt transporter ATP-binding sub 0.002
COG1101263 COG1101, PhnK, ABC-type uncharacterized transport 0.002
PRK14238271 PRK14238, PRK14238, phosphate transporter ATP-bind 0.002
PRK10771232 PRK10771, thiQ, thiamine transporter ATP-binding s 0.002
PRK15134529 PRK15134, PRK15134, microcin C ABC transporter ATP 0.002
PRK13633280 PRK13633, PRK13633, cobalt transporter ATP-binding 0.002
PRK11650356 PRK11650, ugpC, glycerol-3-phosphate transporter A 0.002
PRK15439510 PRK15439, PRK15439, autoinducer 2 ABC transporter 0.002
COG2401593 COG2401, COG2401, ABC-type ATPase fused to a predi 0.003
TIGR03269 520 TIGR03269, met_CoM_red_A2, methyl coenzyme M reduc 0.003
PRK11819556 PRK11819, PRK11819, putative ABC transporter ATP-b 0.003
PRK11000369 PRK11000, PRK11000, maltose/maltodextrin transport 0.003
cd03288257 cd03288, ABCC_SUR2, ATP-binding cassette domain 2 0.003
PRK15064530 PRK15064, PRK15064, ABC transporter ATP-binding pr 0.003
TIGR01184230 TIGR01184, ntrCD, nitrate transport ATP-binding su 0.003
PRK10636638 PRK10636, PRK10636, putative ABC transporter ATP-b 0.003
PRK14270251 PRK14270, PRK14270, phosphate ABC transporter ATP- 0.003
PRK14240250 PRK14240, PRK14240, phosphate transporter ATP-bind 0.003
PRK14267253 PRK14267, PRK14267, phosphate ABC transporter ATP- 0.003
PRK14244251 PRK14244, PRK14244, phosphate ABC transporter ATP- 0.003
TIGR03796710 TIGR03796, NHLM_micro_ABC1, NHLM bacteriocin syste 0.004
COG4586325 COG4586, COG4586, ABC-type uncharacterized transpo 0.004
COG4615546 COG4615, PvdE, ABC-type siderophore export system, 0.004
PRK13648269 PRK13648, cbiO, cobalt transporter ATP-binding sub 0.004
PRK11176582 PRK11176, PRK11176, lipid transporter ATP-binding/ 0.004
>gnl|CDD|233206 TIGR00954, 3a01203, Peroxysomal Fatty Acyl CoA Transporter (FAT) Family protei Back     alignment and domain information 
 Score =  453 bits (1167), Expect = e-144
 Identities = 221/617 (35%), Positives = 336/617 (54%), Gaps = 59/617 (9%)

Query: 741  RVADMFKVLVPTVFDKQGAQLLAVAFLVVSRTWISDRIASLNGTTVKYVLEQDKASFVRL 800
            ++  + K+L+P VF K+   L+ +AFL+VSRT++S  +A+L+G     ++ +   +F  +
Sbjct: 78   KLDFLLKILIPRVFCKETGLLILIAFLLVSRTYLSVYVATLDGQIESSIVRRSPRNFAWI 137

Query: 801  IGVSVLQSAASSFIAPSIRHLTARLALGWRIRMTQHLLKSYLRKNSFYKVFNMSSKSIDA 860
            +    L +  +SFI  +I++L   L L +R+R+T++L   YL   +FYKV N+ S+  + 
Sbjct: 138  LFKWFLIAPPASFINSAIKYLLKELKLRFRVRLTRYLYSKYLSGFTFYKVSNLDSRIQNP 197

Query: 861  DQRITHDLEKLTTDLSGLVTGMVKPSVDILWFTWRMKALTGQRGVAILYAYMLLGLGFLR 920
            DQ +T D+EK    +  L + + KP +D++ +++++    G  G A L+AY+      L 
Sbjct: 198  DQLLTQDVEKFCDSVVELYSNLTKPILDVILYSFKLLTALGSVGPAGLFAYLFATGVVLT 257

Query: 921  SVTPEFGDLTSREQQLEGTFRFMHERLRAHAESVAFFGGGAREKAMIESRFRELLEHSLL 980
             + P  G LT  EQ LEG +R++H RL  ++E +AF+ G   EK  + S F  L+EH  L
Sbjct: 258  KLRPPIGKLTVEEQALEGEYRYVHSRLIMNSEEIAFYQGNKVEKETVMSSFYRLVEHLNL 317

Query: 981  LLKKKWLFGILDDFVTKQLPHNVTWGLSLLYA-----MEHKGDRALVSTQGELAHAL--- 1032
            ++K ++ +G LD+ V K      TW    L A      +      L  ++ EL       
Sbjct: 318  IIKFRFSYGFLDNIVAK-----YTWSAVGLVAVSIPIFDKTHPAFLEMSEEELMQEFYNN 372

Query: 1033 -RFLASVVSQSFLAFGDILELHRKFVELSGGINRIFELEELLDAAQPGD--------DEI 1083
             R L         A G ++   R    L+G   R+  L ++LD  + G+         E 
Sbjct: 373  GRLLLKAAD----ALGRLMLAGRDMTRLAGFTARVDTLLQVLDDVKSGNFKRPRVEEIES 428

Query: 1084 SGSSQHKWNSTD------YQDS-ISFSKLDIITPSQKLLARQLTFEIVPGKSLLVTGPNG 1136
                    N         YQD+ I F  + ++TP+  +L   L+FE+  G +LL+ GPNG
Sbjct: 429  GREGGRNSNLVPGRGIVEYQDNGIKFENIPLVTPNGDVLIESLSFEVPSGNNLLICGPNG 488

Query: 1137 SGKSSVFRVLRGLWPVVSGSLTKPSQHIDEEAGSGCGIFYVPQRPYTCLGTLRDQIIYPL 1196
             GKSS+FR+L  LWPV  G LTKP++           +FYVPQRPY  LGTLRDQIIYP 
Sbjct: 489  CGKSSLFRILGELWPVYGGRLTKPAK---------GKLFYVPQRPYMTLGTLRDQIIYPD 539

Query: 1197 SREEAELRALKLHGKGEKLVDTTNILDSYLKTILEGVRLSYLLEREEVGWDANLNWEDIL 1256
            S E+ + R L                D  L+ IL+ V+L+++LER E GW A  +W D+L
Sbjct: 540  SSEDMKRRGLS---------------DKDLEQILDNVQLTHILER-EGGWSAVQDWMDVL 583

Query: 1257 SLGEQQRLGMARLFFHKPKFGILDECTNATSVDVEEQLYRLAKDMGITFVTSSQRPALIP 1316
            S GE+QR+ MARLF+HKP+F ILDECT+A SVDVE  +YRL ++ GIT  + S R +L  
Sbjct: 584  SGGEKQRIAMARLFYHKPQFAILDECTSAVSVDVEGYMYRLCREFGITLFSVSHRKSLWK 643

Query: 1317 FHSLELRLIDGEGNWEL 1333
            +H   L  +DG G ++ 
Sbjct: 644  YHEYLLY-MDGRGGYQF 659

[Transport and binding proteins, Carbohydrates, organic alcohols, and acids]. Length = 659
>gnl|CDD|233206 TIGR00954, 3a01203, Peroxysomal Fatty Acyl CoA Transporter (FAT) Family protei Back     alignment and domain information
>gnl|CDD|219046 pfam06472, ABC_membrane_2, ABC transporter transmembrane region 2 Back     alignment and domain information
>gnl|CDD|219046 pfam06472, ABC_membrane_2, ABC transporter transmembrane region 2 Back     alignment and domain information
>gnl|CDD|226646 COG4178, COG4178, ABC-type uncharacterized transport system, permease and ATPase components [General function prediction only] Back     alignment and domain information
>gnl|CDD|226646 COG4178, COG4178, ABC-type uncharacterized transport system, permease and ATPase components [General function prediction only] Back     alignment and domain information
>gnl|CDD|213190 cd03223, ABCD_peroxisomal_ALDP, ATP-binding cassette domain of peroxisomal transporter, subfamily D Back     alignment and domain information
>gnl|CDD|213190 cd03223, ABCD_peroxisomal_ALDP, ATP-binding cassette domain of peroxisomal transporter, subfamily D Back     alignment and domain information
>gnl|CDD|213195 cd03228, ABCC_MRP_Like, ATP-binding cassette domain of multidrug resistance protein-like transporters Back     alignment and domain information
>gnl|CDD|224055 COG1132, MdlB, ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|213212 cd03245, ABCC_bacteriocin_exporters, ATP-binding cassette domain of bacteriocin exporters, subfamily C Back     alignment and domain information
>gnl|CDD|225183 COG2274, SunT, ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|213213 cd03246, ABCC_Protease_Secretion, ATP-binding cassette domain of PrtD, subfamily C Back     alignment and domain information
>gnl|CDD|234033 TIGR02857, CydD, thiol reductant ABC exporter, CydD subunit Back     alignment and domain information
>gnl|CDD|213221 cd03254, ABCC_Glucan_exporter_like, ATP-binding cassette domain of glucan transporter and related proteins, subfamily C Back     alignment and domain information
>gnl|CDD|227321 COG4988, CydD, ABC-type transport system involved in cytochrome bd biosynthesis, ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|213222 cd03255, ABC_MJ0796_LolCDE_FtsE, ATP-binding cassette domain of the transporters involved in export of lipoprotein and macrolide, and cell division protein Back     alignment and domain information
>gnl|CDD|227320 COG4987, CydC, ABC-type transport system involved in cytochrome bd biosynthesis, fused ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|234189 TIGR03375, type_I_sec_LssB, type I secretion system ATPase, LssB family Back     alignment and domain information
>gnl|CDD|213202 cd03235, ABC_Metallic_Cations, ATP-binding cassette domain of the metal-type transporters Back     alignment and domain information
>gnl|CDD|224048 COG1123, COG1123, ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] Back     alignment and domain information
>gnl|CDD|213224 cd03257, ABC_NikE_OppD_transporters, ATP-binding cassette domain of nickel/oligopeptides specific transporters Back     alignment and domain information
>gnl|CDD|224046 COG1121, ZnuC, ABC-type Mn/Zn transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|213192 cd03225, ABC_cobalt_CbiO_domain1, First domain of the ATP-binding cassette component of cobalt transport system Back     alignment and domain information
>gnl|CDD|225183 COG2274, SunT, ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|226970 COG4619, COG4619, ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|224049 COG1124, DppF, ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|224045 COG1120, FepC, ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|200134 TIGR01842, type_I_sec_PrtD, type I secretion system ABC transporter, PrtD family Back     alignment and domain information
>gnl|CDD|224055 COG1132, MdlB, ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|234041 TIGR02868, CydC, thiol reductant ABC exporter, CydC subunit Back     alignment and domain information
>gnl|CDD|224044 COG1119, ModF, ABC-type molybdenum transport system, ATPase component/photorepair protein PhrA [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|224059 COG1136, SalX, ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|224054 COG1131, CcmA, ABC-type multidrug transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|227321 COG4988, CydD, ABC-type transport system involved in cytochrome bd biosynthesis, ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|213193 cd03226, ABC_cobalt_CbiO_domain2, Second domain of the ATP-binding cassette component of cobalt transport system Back     alignment and domain information
>gnl|CDD|224047 COG1122, CbiO, ABC-type cobalt transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|213181 cd03214, ABC_Iron-Siderophores_B12_Hemin, ATP-binding component of iron-siderophores, vitamin B12 and hemin transporters and related proteins Back     alignment and domain information
>gnl|CDD|236865 PRK11160, PRK11160, cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed Back     alignment and domain information
>gnl|CDD|213211 cd03244, ABCC_MRP_domain2, ATP-binding cassette domain 2 of multidrug resistance-associated protein Back     alignment and domain information
>gnl|CDD|226969 COG4618, ArpD, ABC-type protease/lipase transport system, ATPase and permease components [General function prediction only] Back     alignment and domain information
>gnl|CDD|237648 PRK14250, PRK14250, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|224054 COG1131, CcmA, ABC-type multidrug transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|227320 COG4987, CydC, ABC-type transport system involved in cytochrome bd biosynthesis, fused ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|213215 cd03248, ABCC_TAP, ATP-binding cassette domain of the Transporter Associated with Antigen Processing, subfamily C Back     alignment and domain information
>gnl|CDD|224048 COG1123, COG1123, ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] Back     alignment and domain information
>gnl|CDD|213217 cd03250, ABCC_MRP_domain1, ATP-binding cassette domain 1 of multidrug resistance-associated protein, subfamily C Back     alignment and domain information
>gnl|CDD|213220 cd03253, ABCC_ATM1_transporter, ATP-binding cassette domain of iron-sulfur clusters transporter, subfamily C Back     alignment and domain information
>gnl|CDD|213216 cd03249, ABC_MTABC3_MDL1_MDL2, ATP-binding cassette domain of a mitochondrial protein MTABC3 and related proteins Back     alignment and domain information
>gnl|CDD|234033 TIGR02857, CydD, thiol reductant ABC exporter, CydD subunit Back     alignment and domain information
>gnl|CDD|213226 cd03259, ABC_Carb_Solutes_like, ATP-binding cassette domain of the carbohydrate and solute transporters-like Back     alignment and domain information
>gnl|CDD|237421 PRK13539, PRK13539, cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>gnl|CDD|213219 cd03252, ABCC_Hemolysin, ATP-binding cassette domain of hemolysin B, subfamily C Back     alignment and domain information
>gnl|CDD|213260 cd03293, ABC_NrtD_SsuB_transporters, ATP-binding cassette domain of the nitrate and sulfonate transporters Back     alignment and domain information
>gnl|CDD|213227 cd03260, ABC_PstB_phosphate_transporter, ATP-binding cassette domain of the phosphate transport system Back     alignment and domain information
>gnl|CDD|233209 TIGR00958, 3a01208, Conjugate Transporter-2 (CT2) Family protein Back     alignment and domain information
>gnl|CDD|213231 cd03264, ABC_drug_resistance_like, ABC-type multidrug transport system, ATPase component Back     alignment and domain information
>gnl|CDD|225438 COG2884, FtsE, Predicted ATPase involved in cell division [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|131721 TIGR02673, FtsE, cell division ATP-binding protein FtsE Back     alignment and domain information
>gnl|CDD|213221 cd03254, ABCC_Glucan_exporter_like, ATP-binding cassette domain of glucan transporter and related proteins, subfamily C Back     alignment and domain information
>gnl|CDD|200134 TIGR01842, type_I_sec_PrtD, type I secretion system ABC transporter, PrtD family Back     alignment and domain information
>gnl|CDD|224058 COG1135, AbcC, ABC-type metal ion transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|213198 cd03231, ABC_CcmA_heme_exporter, Cytochrome c biogenesis ATP-binding export protein Back     alignment and domain information
>gnl|CDD|131258 TIGR02203, MsbA_lipidA, lipid A export permease/ATP-binding protein MsbA Back     alignment and domain information
>gnl|CDD|223521 COG0444, DppD, ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|213218 cd03251, ABCC_MsbA, ATP-binding cassette domain of the bacterial lipid flippase and related proteins, subfamily C Back     alignment and domain information
>gnl|CDD|226647 COG4181, COG4181, Predicted ABC-type transport system involved in lysophospholipase L1 biosynthesis, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>gnl|CDD|213227 cd03260, ABC_PstB_phosphate_transporter, ATP-binding cassette domain of the phosphate transport system Back     alignment and domain information
>gnl|CDD|224041 COG1116, TauB, ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|213269 cd03369, ABCC_NFT1, ATP-binding cassette domain 2 of NFT1, subfamily C Back     alignment and domain information
>gnl|CDD|213197 cd03230, ABC_DR_subfamily_A, ATP-binding cassette domain of the drug resistance transporter and related proteins, subfamily A Back     alignment and domain information
>gnl|CDD|163508 TIGR03796, NHLM_micro_ABC1, NHLM bacteriocin system ABC transporter, peptidase/ATP-binding protein Back     alignment and domain information
>gnl|CDD|226359 COG3839, MalK, ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|226967 COG4608, AppF, ABC-type oligopeptide transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|226969 COG4618, ArpD, ABC-type protease/lipase transport system, ATPase and permease components [General function prediction only] Back     alignment and domain information
>gnl|CDD|226361 COG3842, PotA, ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|130254 TIGR01186, proV, glycine betaine/L-proline transport ATP binding subunit Back     alignment and domain information
>gnl|CDD|233305 TIGR01189, ccmA, heme ABC exporter, ATP-binding protein CcmA Back     alignment and domain information
>gnl|CDD|131259 TIGR02204, MsbA_rel, ABC transporter, permease/ATP-binding protein Back     alignment and domain information
>gnl|CDD|130261 TIGR01193, bacteriocin_ABC, ABC-type bacteriocin transporter Back     alignment and domain information
>gnl|CDD|213202 cd03235, ABC_Metallic_Cations, ATP-binding cassette domain of the metal-type transporters Back     alignment and domain information
>gnl|CDD|226164 COG3638, COG3638, ABC-type phosphate/phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|213223 cd03256, ABC_PhnC_transporter, ATP-binding cassette domain of the binding protein-dependent phosphonate transport system Back     alignment and domain information
>gnl|CDD|236870 PRK11174, PRK11174, cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed Back     alignment and domain information
>gnl|CDD|234189 TIGR03375, type_I_sec_LssB, type I secretion system ATPase, LssB family Back     alignment and domain information
>gnl|CDD|215650 pfam00005, ABC_tran, ABC transporter Back     alignment and domain information
>gnl|CDD|130041 TIGR00968, 3a0106s01, sulfate ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|213192 cd03225, ABC_cobalt_CbiO_domain1, First domain of the ATP-binding cassette component of cobalt transport system Back     alignment and domain information
>gnl|CDD|213181 cd03214, ABC_Iron-Siderophores_B12_Hemin, ATP-binding component of iron-siderophores, vitamin B12 and hemin transporters and related proteins Back     alignment and domain information
>gnl|CDD|236865 PRK11160, PRK11160, cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed Back     alignment and domain information
>gnl|CDD|224046 COG1121, ZnuC, ABC-type Mn/Zn transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|224047 COG1122, CbiO, ABC-type cobalt transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|181939 PRK09544, znuC, high-affinity zinc transporter ATPase; Reviewed Back     alignment and domain information
>gnl|CDD|234041 TIGR02868, CydC, thiol reductant ABC exporter, CydC subunit Back     alignment and domain information
>gnl|CDD|213179 cd00267, ABC_ATPase, ATP-binding cassette transporter nucleotide-binding domain Back     alignment and domain information
>gnl|CDD|213267 cd03300, ABC_PotA_N, ATP-binding cassette domain of the polyamine transporter Back     alignment and domain information
>gnl|CDD|213266 cd03299, ABC_ModC_like, ATP-binding cassette domain similar to the molybdate transporter Back     alignment and domain information
>gnl|CDD|226631 COG4152, COG4152, ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|213222 cd03255, ABC_MJ0796_LolCDE_FtsE, ATP-binding cassette domain of the transporters involved in export of lipoprotein and macrolide, and cell division protein Back     alignment and domain information
>gnl|CDD|236523 PRK09452, potA, putrescine/spermidine ABC transporter ATPase protein; Reviewed Back     alignment and domain information
>gnl|CDD|213225 cd03258, ABC_MetN_methionine_transporter, ATP-binding cassette domain of methionine transporter Back     alignment and domain information
>gnl|CDD|182331 PRK10247, PRK10247, putative ABC transporter ATP-binding protein YbbL; Provisional Back     alignment and domain information
>gnl|CDD|224049 COG1124, DppF, ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|213212 cd03245, ABCC_bacteriocin_exporters, ATP-binding cassette domain of bacteriocin exporters, subfamily C Back     alignment and domain information
>gnl|CDD|224050 COG1125, OpuBA, ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|213261 cd03294, ABC_Pro_Gly_Betaine, ATP-binding cassette domain of the osmoprotectant proline/glycine betaine uptake system Back     alignment and domain information
>gnl|CDD|213262 cd03295, ABC_OpuCA_Osmoprotection, ATP-binding cassette domain of the osmoprotectant transporter Back     alignment and domain information
>gnl|CDD|213229 cd03262, ABC_HisP_GlnQ, ATP-binding cassette domain of the histidine and glutamine transporters Back     alignment and domain information
>gnl|CDD|224051 COG1126, GlnQ, ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|215650 pfam00005, ABC_tran, ABC transporter Back     alignment and domain information
>gnl|CDD|130260 TIGR01192, chvA, glucan exporter ATP-binding protein Back     alignment and domain information
>gnl|CDD|213235 cd03268, ABC_BcrA_bacitracin_resist, ATP-binding cassette domain of the bacitracin-resistance transporter Back     alignment and domain information
>gnl|CDD|213215 cd03248, ABCC_TAP, ATP-binding cassette domain of the Transporter Associated with Antigen Processing, subfamily C Back     alignment and domain information
>gnl|CDD|233209 TIGR00958, 3a01208, Conjugate Transporter-2 (CT2) Family protein Back     alignment and domain information
>gnl|CDD|233305 TIGR01189, ccmA, heme ABC exporter, ATP-binding protein CcmA Back     alignment and domain information
>gnl|CDD|130234 TIGR01166, cbiO, cobalt transport protein ATP-binding subunit Back     alignment and domain information
>gnl|CDD|226643 COG4175, ProV, ABC-type proline/glycine betaine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|213224 cd03257, ABC_NikE_OppD_transporters, ATP-binding cassette domain of nickel/oligopeptides specific transporters Back     alignment and domain information
>gnl|CDD|223562 COG0488, Uup, ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] Back     alignment and domain information
>gnl|CDD|185037 PRK15079, PRK15079, oligopeptide ABC transporter ATP-binding protein OppF; Provisional Back     alignment and domain information
>gnl|CDD|234357 TIGR03797, NHLM_micro_ABC2, NHLM bacteriocin system ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|233596 TIGR01846, type_I_sec_HlyB, type I secretion system ABC transporter, HlyB family Back     alignment and domain information
>gnl|CDD|172734 PRK14246, PRK14246, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|224048 COG1123, COG1123, ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] Back     alignment and domain information
>gnl|CDD|213268 cd03301, ABC_MalK_N, The N-terminal ATPase domain of the maltose transporter, MalK Back     alignment and domain information
>gnl|CDD|213186 cd03219, ABC_Mj1267_LivG_branched, ATP-binding cassette component of branched chain amino acids transport system Back     alignment and domain information
>gnl|CDD|213258 cd03291, ABCC_CFTR1, ATP-binding cassette domain of the cystic fibrosis transmembrane regulator, subfamily C Back     alignment and domain information
>gnl|CDD|213236 cd03269, ABC_putative_ATPase, ATP-binding cassette domain of an uncharacterized transporter Back     alignment and domain information
>gnl|CDD|213220 cd03253, ABCC_ATM1_transporter, ATP-binding cassette domain of iron-sulfur clusters transporter, subfamily C Back     alignment and domain information
>gnl|CDD|226617 COG4133, CcmA, ABC-type transport system involved in cytochrome c biogenesis, ATPase component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|224045 COG1120, FepC, ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|213223 cd03256, ABC_PhnC_transporter, ATP-binding cassette domain of the binding protein-dependent phosphonate transport system Back     alignment and domain information
>gnl|CDD|226617 COG4133, CcmA, ABC-type transport system involved in cytochrome c biogenesis, ATPase component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|181906 PRK09493, glnQ, glutamine ABC transporter ATP-binding protein; Reviewed Back     alignment and domain information
>gnl|CDD|224053 COG1129, MglA, ABC-type sugar transport system, ATPase component [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|226635 COG4161, ArtP, ABC-type arginine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|226927 COG4555, NatA, ABC-type Na+ transport system, ATPase component [Energy production and conversion / Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|132027 TIGR02982, heterocyst_DevA, ABC exporter ATP-binding subunit, DevA family Back     alignment and domain information
>gnl|CDD|131266 TIGR02211, LolD_lipo_ex, lipoprotein releasing system, ATP-binding protein Back     alignment and domain information
>gnl|CDD|131816 TIGR02769, nickel_nikE, nickel import ATP-binding protein NikE Back     alignment and domain information
>gnl|CDD|131368 TIGR02315, ABC_phnC, phosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|131259 TIGR02204, MsbA_rel, ABC transporter, permease/ATP-binding protein Back     alignment and domain information
>gnl|CDD|213235 cd03268, ABC_BcrA_bacitracin_resist, ATP-binding cassette domain of the bacitracin-resistance transporter Back     alignment and domain information
>gnl|CDD|184195 PRK13635, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|213264 cd03297, ABC_ModC_molybdenum_transporter, ATP-binding cassette domain of the molybdenum transport system Back     alignment and domain information
>gnl|CDD|223473 COG0396, sufC, Cysteine desulfurase activator ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|184125 PRK13538, PRK13538, cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>gnl|CDD|213259 cd03292, ABC_FtsE_transporter, ATP-binding cassette domain of the cell division transporter Back     alignment and domain information
>gnl|CDD|223562 COG0488, Uup, ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] Back     alignment and domain information
>gnl|CDD|224048 COG1123, COG1123, ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] Back     alignment and domain information
>gnl|CDD|213196 cd03229, ABC_Class3, ATP-binding cassette domain of the binding protein-dependent transport systems Back     alignment and domain information
>gnl|CDD|182528 PRK10535, PRK10535, macrolide transporter ATP-binding /permease protein; Provisional Back     alignment and domain information
>gnl|CDD|226970 COG4619, COG4619, ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|182342 PRK10261, PRK10261, glutathione transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|234199 TIGR03410, urea_trans_UrtE, urea ABC transporter, ATP-binding protein UrtE Back     alignment and domain information
>gnl|CDD|223487 COG0410, LivF, ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|162242 TIGR01187, potA, spermidine/putrescine ABC transporter ATP-binding subunit Back     alignment and domain information
>gnl|CDD|213263 cd03296, ABC_CysA_sulfate_importer, ATP-binding cassette domain of the sulfate transporter Back     alignment and domain information
>gnl|CDD|233335 TIGR01271, CFTR_protein, cystic fibrosis transmembrane conductor regulator (CFTR) Back     alignment and domain information
>gnl|CDD|213213 cd03246, ABCC_Protease_Secretion, ATP-binding cassette domain of PrtD, subfamily C Back     alignment and domain information
>gnl|CDD|237648 PRK14250, PRK14250, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|163483 TIGR03771, anch_rpt_ABC, anchored repeat-type ABC transporter, ATP-binding subunit Back     alignment and domain information
>gnl|CDD|213191 cd03224, ABC_TM1139_LivF_branched, ATP-binding cassette domain of branched-chain amino acid transporter Back     alignment and domain information
>gnl|CDD|188098 TIGR00957, MRP_assoc_pro, multi drug resistance-associated protein (MRP) Back     alignment and domain information
>gnl|CDD|182733 PRK10790, PRK10790, putative multidrug transporter membrane\ATP-binding components; Provisional Back     alignment and domain information
>gnl|CDD|181939 PRK09544, znuC, high-affinity zinc transporter ATPase; Reviewed Back     alignment and domain information
>gnl|CDD|223562 COG0488, Uup, ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] Back     alignment and domain information
>gnl|CDD|213183 cd03216, ABC_Carb_Monos_I, First domain of the ATP-binding cassette component of monosaccharide transport system Back     alignment and domain information
>gnl|CDD|163585 TIGR03873, F420-0_ABC_ATP, proposed F420-0 ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|213214 cd03247, ABCC_cytochrome_bd, ATP-binding cassette domain of CydCD, subfamily C Back     alignment and domain information
>gnl|CDD|224052 COG1127, Ttg2A, ABC-type transport system involved in resistance to organic solvents, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>gnl|CDD|184214 PRK13657, PRK13657, cyclic beta-1,2-glucan ABC transporter; Provisional Back     alignment and domain information
>gnl|CDD|213211 cd03244, ABCC_MRP_domain2, ATP-binding cassette domain 2 of multidrug resistance-associated protein Back     alignment and domain information
>gnl|CDD|213217 cd03250, ABCC_MRP_domain1, ATP-binding cassette domain 1 of multidrug resistance-associated protein, subfamily C Back     alignment and domain information
>gnl|CDD|237421 PRK13539, PRK13539, cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>gnl|CDD|226647 COG4181, COG4181, Predicted ABC-type transport system involved in lysophospholipase L1 biosynthesis, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>gnl|CDD|213179 cd00267, ABC_ATPase, ATP-binding cassette transporter nucleotide-binding domain Back     alignment and domain information
>gnl|CDD|131368 TIGR02315, ABC_phnC, phosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|182817 PRK10895, PRK10895, lipopolysaccharide ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|224041 COG1116, TauB, ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|215640 PLN03232, PLN03232, ABC transporter C family member; Provisional Back     alignment and domain information
>gnl|CDD|213188 cd03221, ABCF_EF-3, ATP-binding cassette domain of elongation factor 3, subfamily F Back     alignment and domain information
>gnl|CDD|131681 TIGR02633, xylG, D-xylose ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|213195 cd03228, ABCC_MRP_Like, ATP-binding cassette domain of multidrug resistance protein-like transporters Back     alignment and domain information
>gnl|CDD|226952 COG4586, COG4586, ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|213198 cd03231, ABC_CcmA_heme_exporter, Cytochrome c biogenesis ATP-binding export protein Back     alignment and domain information
>gnl|CDD|226631 COG4152, COG4152, ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|213236 cd03269, ABC_putative_ATPase, ATP-binding cassette domain of an uncharacterized transporter Back     alignment and domain information
>gnl|CDD|184134 PRK13549, PRK13549, xylose transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|182342 PRK10261, PRK10261, glutathione transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|188353 TIGR03608, L_ocin_972_ABC, putative bacteriocin export ABC transporter, lactococcin 972 group Back     alignment and domain information
>gnl|CDD|183226 PRK11607, potG, putrescine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|213226 cd03259, ABC_Carb_Solutes_like, ATP-binding cassette domain of the carbohydrate and solute transporters-like Back     alignment and domain information
>gnl|CDD|213197 cd03230, ABC_DR_subfamily_A, ATP-binding cassette domain of the drug resistance transporter and related proteins, subfamily A Back     alignment and domain information
>gnl|CDD|226635 COG4161, ArtP, ABC-type arginine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|163452 TIGR03740, galliderm_ABC, gallidermin-class lantibiotic protection ABC transporter, ATP-binding subunit Back     alignment and domain information
>gnl|CDD|213184 cd03217, ABC_FeS_Assembly, ABC-type transport system involved in Fe-S cluster assembly, ATPase component Back     alignment and domain information
>gnl|CDD|213233 cd03266, ABC_NatA_sodium_exporter, ATP-binding cassette domain of the Na+ transporter Back     alignment and domain information
>gnl|CDD|226364 COG3845, COG3845, ABC-type uncharacterized transport systems, ATPase components [General function prediction only] Back     alignment and domain information
>gnl|CDD|224043 COG1118, CysA, ABC-type sulfate/molybdate transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|237422 PRK13548, hmuV, hemin importer ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|226905 COG4525, TauB, ABC-type taurine transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|182980 PRK11124, artP, arginine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|213179 cd00267, ABC_ATPase, ATP-binding cassette transporter nucleotide-binding domain Back     alignment and domain information
>gnl|CDD|234199 TIGR03410, urea_trans_UrtE, urea ABC transporter, ATP-binding protein UrtE Back     alignment and domain information
>gnl|CDD|215640 PLN03232, PLN03232, ABC transporter C family member; Provisional Back     alignment and domain information
>gnl|CDD|131817 TIGR02770, nickel_nikD, nickel import ATP-binding protein NikD Back     alignment and domain information
>gnl|CDD|213228 cd03261, ABC_Org_Solvent_Resistant, ATP-binding cassette transport system involved in resistant to organic solvents Back     alignment and domain information
>gnl|CDD|213179 cd00267, ABC_ATPase, ATP-binding cassette transporter nucleotide-binding domain Back     alignment and domain information
>gnl|CDD|224166 COG1245, COG1245, Predicted ATPase, RNase L inhibitor (RLI) homolog [General function prediction only] Back     alignment and domain information
>gnl|CDD|184209 PRK13650, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|132050 TIGR03005, ectoine_ehuA, ectoine/hydroxyectoine ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|182569 PRK10584, PRK10584, putative ABC transporter ATP-binding protein YbbA; Provisional Back     alignment and domain information
>gnl|CDD|236689 PRK10419, nikE, nickel transporter ATP-binding protein NikE; Provisional Back     alignment and domain information
>gnl|CDD|226361 COG3842, PotA, ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|163431 TIGR03719, ABC_ABC_ChvD, ATP-binding cassette protein, ChvD family Back     alignment and domain information
>gnl|CDD|223488 COG0411, LivG, ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|188317 TIGR03415, ABC_choXWV_ATP, choline ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|131377 TIGR02324, CP_lyasePhnL, phosphonate C-P lyase system protein PhnL Back     alignment and domain information
>gnl|CDD|240327 PTZ00243, PTZ00243, ABC transporter; Provisional Back     alignment and domain information
>gnl|CDD|182880 PRK10982, PRK10982, galactose/methyl galaxtoside transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|226929 COG4559, COG4559, ABC-type hemin transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|184199 PRK13639, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|213260 cd03293, ABC_NrtD_SsuB_transporters, ATP-binding cassette domain of the nitrate and sulfonate transporters Back     alignment and domain information
>gnl|CDD|183133 PRK11432, fbpC, ferric transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|132302 TIGR03258, PhnT, 2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT Back     alignment and domain information
>gnl|CDD|131197 TIGR02142, modC_ABC, molybdenum ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|224059 COG1136, SalX, ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|223487 COG0410, LivF, ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|237452 PRK13632, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|213195 cd03228, ABCC_MRP_Like, ATP-binding cassette domain of multidrug resistance protein-like transporters Back     alignment and domain information
>gnl|CDD|213216 cd03249, ABC_MTABC3_MDL1_MDL2, ATP-binding cassette domain of a mitochondrial protein MTABC3 and related proteins Back     alignment and domain information
>gnl|CDD|236870 PRK11174, PRK11174, cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed Back     alignment and domain information
>gnl|CDD|184125 PRK13538, PRK13538, cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>gnl|CDD|226637 COG4167, SapF, ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|184127 PRK13540, PRK13540, cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>gnl|CDD|215595 PLN03130, PLN03130, ABC transporter C family member; Provisional Back     alignment and domain information
>gnl|CDD|132561 TIGR03522, GldA_ABC_ATP, gliding motility-associated ABC transporter ATP-binding subunit GldA Back     alignment and domain information
>gnl|CDD|213213 cd03246, ABCC_Protease_Secretion, ATP-binding cassette domain of PrtD, subfamily C Back     alignment and domain information
>gnl|CDD|213193 cd03226, ABC_cobalt_CbiO_domain2, Second domain of the ATP-binding cassette component of cobalt transport system Back     alignment and domain information
>gnl|CDD|223562 COG0488, Uup, ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] Back     alignment and domain information
>gnl|CDD|233335 TIGR01271, CFTR_protein, cystic fibrosis transmembrane conductor regulator (CFTR) Back     alignment and domain information
>gnl|CDD|188098 TIGR00957, MRP_assoc_pro, multi drug resistance-associated protein (MRP) Back     alignment and domain information
>gnl|CDD|163585 TIGR03873, F420-0_ABC_ATP, proposed F420-0 ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|213232 cd03265, ABC_DrrA, Daunorubicin/doxorubicin resistance ATP-binding protein Back     alignment and domain information
>gnl|CDD|183063 PRK11264, PRK11264, putative amino-acid ABC transporter ATP-binding protein YecC; Provisional Back     alignment and domain information
>gnl|CDD|213256 cd03289, ABCC_CFTR2, ATP-binding cassette domain 2 of CFTR,subfamily C Back     alignment and domain information
>gnl|CDD|236755 PRK10762, PRK10762, D-ribose transporter ATP binding protein; Provisional Back     alignment and domain information
>gnl|CDD|215595 PLN03130, PLN03130, ABC transporter C family member; Provisional Back     alignment and domain information
>gnl|CDD|172200 PRK13652, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|226641 COG4172, COG4172, ABC-type uncharacterized transport system, duplicated ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|233665 TIGR01978, sufC, FeS assembly ATPase SufC Back     alignment and domain information
>gnl|CDD|226929 COG4559, COG4559, ABC-type hemin transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|185016 PRK15056, PRK15056, manganese/iron transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|183244 PRK11629, lolD, lipoprotein transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|227590 COG5265, ATM1, ABC-type transport system involved in Fe-S cluster assembly, permease and ATPase components [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|213233 cd03266, ABC_NatA_sodium_exporter, ATP-binding cassette domain of the Na+ transporter Back     alignment and domain information
>gnl|CDD|213219 cd03252, ABCC_Hemolysin, ATP-binding cassette domain of hemolysin B, subfamily C Back     alignment and domain information
>gnl|CDD|172734 PRK14246, PRK14246, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|234152 TIGR03265, PhnT2, putative 2-aminoethylphosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|213267 cd03300, ABC_PotA_N, ATP-binding cassette domain of the polyamine transporter Back     alignment and domain information
>gnl|CDD|132027 TIGR02982, heterocyst_DevA, ABC exporter ATP-binding subunit, DevA family Back     alignment and domain information
>gnl|CDD|226620 COG4136, COG4136, ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|225438 COG2884, FtsE, Predicted ATPase involved in cell division [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|163431 TIGR03719, ABC_ABC_ChvD, ATP-binding cassette protein, ChvD family Back     alignment and domain information
>gnl|CDD|236863 PRK11153, metN, DL-methionine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|226967 COG4608, AppF, ABC-type oligopeptide transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|130234 TIGR01166, cbiO, cobalt transport protein ATP-binding subunit Back     alignment and domain information
>gnl|CDD|213191 cd03224, ABC_TM1139_LivF_branched, ATP-binding cassette domain of branched-chain amino acid transporter Back     alignment and domain information
>gnl|CDD|225265 COG2401, COG2401, ABC-type ATPase fused to a predicted acetyltransferase domain [General function prediction only] Back     alignment and domain information
>gnl|CDD|184585 PRK14239, PRK14239, phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|130041 TIGR00968, 3a0106s01, sulfate ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|226641 COG4172, COG4172, ABC-type uncharacterized transport system, duplicated ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|227590 COG5265, ATM1, ABC-type transport system involved in Fe-S cluster assembly, permease and ATPase components [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|224060 COG1137, YhbG, ABC-type (unclassified) transport system, ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|213230 cd03263, ABC_subfamily_A, ATP-binding cassette domain of the lipid transporters, subfamily A Back     alignment and domain information
>gnl|CDD|172735 PRK14247, PRK14247, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|213200 cd03233, ABCG_PDR_domain1, First domain of the pleiotropic drug resistance-like subfamily G of ATP-binding cassette transporters Back     alignment and domain information
>gnl|CDD|214372 CHL00131, ycf16, sulfate ABC transporter protein; Validated Back     alignment and domain information
>gnl|CDD|237650 PRK14265, PRK14265, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|182829 PRK10908, PRK10908, cell division protein FtsE; Provisional Back     alignment and domain information
>gnl|CDD|130261 TIGR01193, bacteriocin_ABC, ABC-type bacteriocin transporter Back     alignment and domain information
>gnl|CDD|182980 PRK11124, artP, arginine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|223488 COG0411, LivG, ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|226637 COG4167, SapF, ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|184585 PRK14239, PRK14239, phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|130344 TIGR01277, thiQ, thiamine ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|182221 PRK10070, PRK10070, glycine betaine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|213187 cd03220, ABC_KpsT_Wzt, ATP-binding cassette component of polysaccharide transport system Back     alignment and domain information
>gnl|CDD|185067 PRK15112, PRK15112, antimicrobial peptide ABC system ATP-binding protein SapF; Provisional Back     alignment and domain information
>gnl|CDD|237455 PRK13637, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|172735 PRK14247, PRK14247, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|184129 PRK13543, PRK13543, cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>gnl|CDD|172748 PRK14260, PRK14260, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|172733 PRK14245, PRK14245, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|132313 TIGR03269, met_CoM_red_A2, methyl coenzyme M reductase system, component A2 Back     alignment and domain information
>gnl|CDD|182778 PRK10851, PRK10851, sulfate/thiosulfate transporter subunit; Provisional Back     alignment and domain information
>gnl|CDD|227118 COG4778, PhnL, ABC-type phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|181906 PRK09493, glnQ, glutamine ABC transporter ATP-binding protein; Reviewed Back     alignment and domain information
>gnl|CDD|162242 TIGR01187, potA, spermidine/putrescine ABC transporter ATP-binding subunit Back     alignment and domain information
>gnl|CDD|213214 cd03247, ABCC_cytochrome_bd, ATP-binding cassette domain of CydCD, subfamily C Back     alignment and domain information
>gnl|CDD|240327 PTZ00243, PTZ00243, ABC transporter; Provisional Back     alignment and domain information
>gnl|CDD|237419 PRK13536, PRK13536, nodulation factor exporter subunit NodI; Provisional Back     alignment and domain information
>gnl|CDD|184200 PRK13640, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|213218 cd03251, ABCC_MsbA, ATP-binding cassette domain of the bacterial lipid flippase and related proteins, subfamily C Back     alignment and domain information
>gnl|CDD|130256 TIGR01188, drrA, daunorubicin resistance ABC transporter ATP-binding subunit Back     alignment and domain information
>gnl|CDD|213263 cd03296, ABC_CysA_sulfate_importer, ATP-binding cassette domain of the sulfate transporter Back     alignment and domain information
>gnl|CDD|226905 COG4525, TauB, ABC-type taurine transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|213232 cd03265, ABC_DrrA, Daunorubicin/doxorubicin resistance ATP-binding protein Back     alignment and domain information
>gnl|CDD|213180 cd03213, ABCG_EPDR, Eye pigment and drug resistance transporter subfamily G of the ATP-binding cassette superfamily Back     alignment and domain information
>gnl|CDD|226963 COG4604, CeuD, ABC-type enterochelin transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|226927 COG4555, NatA, ABC-type Na+ transport system, ATPase component [Energy production and conversion / Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|172750 PRK14262, PRK14262, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|172756 PRK14268, PRK14268, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|224042 COG1117, PstB, ABC-type phosphate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|223521 COG0444, DppD, ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|213229 cd03262, ABC_HisP_GlnQ, ATP-binding cassette domain of the histidine and glutamine transporters Back     alignment and domain information
>gnl|CDD|163483 TIGR03771, anch_rpt_ABC, anchored repeat-type ABC transporter, ATP-binding subunit Back     alignment and domain information
>gnl|CDD|182569 PRK10584, PRK10584, putative ABC transporter ATP-binding protein YbbA; Provisional Back     alignment and domain information
>gnl|CDD|163431 TIGR03719, ABC_ABC_ChvD, ATP-binding cassette protein, ChvD family Back     alignment and domain information
>gnl|CDD|132313 TIGR03269, met_CoM_red_A2, methyl coenzyme M reductase system, component A2 Back     alignment and domain information
>gnl|CDD|213201 cd03234, ABCG_White, White pigment protein homolog of ABCG transporter subfamily Back     alignment and domain information
>gnl|CDD|226628 COG4148, ModC, ABC-type molybdate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|184196 PRK13636, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|213204 cd03237, ABC_RNaseL_inhibitor_domain2, The ATP-binding cassette domain 2 of RNase L inhibitor Back     alignment and domain information
>gnl|CDD|213231 cd03264, ABC_drug_resistance_like, ABC-type multidrug transport system, ATPase component Back     alignment and domain information
>gnl|CDD|224058 COG1135, AbcC, ABC-type metal ion transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|226359 COG3839, MalK, ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|226641 COG4172, COG4172, ABC-type uncharacterized transport system, duplicated ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|233665 TIGR01978, sufC, FeS assembly ATPase SufC Back     alignment and domain information
>gnl|CDD|224060 COG1137, YhbG, ABC-type (unclassified) transport system, ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|188099 TIGR00972, 3a0107s01c2, phosphate ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|130355 TIGR01288, nodI, ATP-binding ABC transporter family nodulation protein NodI Back     alignment and domain information
>gnl|CDD|236992 PRK11819, PRK11819, putative ABC transporter ATP-binding protein; Reviewed Back     alignment and domain information
>gnl|CDD|213185 cd03218, ABC_YhbG, ATP-binding cassette component of YhbG transport system Back     alignment and domain information
>gnl|CDD|184037 PRK13409, PRK13409, putative ATPase RIL; Provisional Back     alignment and domain information
>gnl|CDD|223473 COG0396, sufC, Cysteine desulfurase activator ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|213188 cd03221, ABCF_EF-3, ATP-binding cassette domain of elongation factor 3, subfamily F Back     alignment and domain information
>gnl|CDD|181888 PRK09473, oppD, oligopeptide transporter ATP-binding component; Provisional Back     alignment and domain information
>gnl|CDD|183056 PRK11248, tauB, taurine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|237456 PRK13641, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|224044 COG1119, ModF, ABC-type molybdenum transport system, ATPase component/photorepair protein PhrA [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|131721 TIGR02673, FtsE, cell division ATP-binding protein FtsE Back     alignment and domain information
>gnl|CDD|132050 TIGR03005, ectoine_ehuA, ectoine/hydroxyectoine ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|131367 TIGR02314, ABC_MetN, D-methionine ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|237457 PRK13647, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|226360 COG3840, ThiQ, ABC-type thiamine transport system, ATPase component [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|182561 PRK10575, PRK10575, iron-hydroxamate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|213266 cd03299, ABC_ModC_like, ATP-binding cassette domain similar to the molybdate transporter Back     alignment and domain information
>gnl|CDD|172733 PRK14245, PRK14245, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|172750 PRK14262, PRK14262, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|224026 COG1101, PhnK, ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|184587 PRK14241, PRK14241, phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|182893 PRK11000, PRK11000, maltose/maltodextrin transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|236523 PRK09452, potA, putrescine/spermidine ABC transporter ATPase protein; Reviewed Back     alignment and domain information
>gnl|CDD|184129 PRK13543, PRK13543, cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>gnl|CDD|237419 PRK13536, PRK13536, nodulation factor exporter subunit NodI; Provisional Back     alignment and domain information
>gnl|CDD|172756 PRK14268, PRK14268, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|213185 cd03218, ABC_YhbG, ATP-binding cassette component of YhbG transport system Back     alignment and domain information
>gnl|CDD|236554 PRK09536, btuD, corrinoid ABC transporter ATPase; Reviewed Back     alignment and domain information
>gnl|CDD|182036 PRK09700, PRK09700, D-allose transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|224057 COG1134, TagH, ABC-type polysaccharide/polyol phosphate transport system, ATPase component [Carbohydrate transport and metabolism / Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|131266 TIGR02211, LolD_lipo_ex, lipoprotein releasing system, ATP-binding protein Back     alignment and domain information
>gnl|CDD|106587 PRK13644, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|236861 PRK11147, PRK11147, ABC transporter ATPase component; Reviewed Back     alignment and domain information
>gnl|CDD|213180 cd03213, ABCG_EPDR, Eye pigment and drug resistance transporter subfamily G of the ATP-binding cassette superfamily Back     alignment and domain information
>gnl|CDD|236707 PRK10522, PRK10522, multidrug transporter membrane component/ATP-binding component; Provisional Back     alignment and domain information
>gnl|CDD|184132 PRK13547, hmuV, hemin importer ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|130254 TIGR01186, proV, glycine betaine/L-proline transport ATP binding subunit Back     alignment and domain information
>gnl|CDD|226164 COG3638, COG3638, ABC-type phosphate/phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|226643 COG4175, ProV, ABC-type proline/glycine betaine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|233335 TIGR01271, CFTR_protein, cystic fibrosis transmembrane conductor regulator (CFTR) Back     alignment and domain information
>gnl|CDD|132302 TIGR03258, PhnT, 2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT Back     alignment and domain information
>gnl|CDD|130355 TIGR01288, nodI, ATP-binding ABC transporter family nodulation protein NodI Back     alignment and domain information
>gnl|CDD|236992 PRK11819, PRK11819, putative ABC transporter ATP-binding protein; Reviewed Back     alignment and domain information
>gnl|CDD|188394 TIGR03864, PQQ_ABC_ATP, ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system Back     alignment and domain information
>gnl|CDD|172743 PRK14255, PRK14255, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|237651 PRK14266, PRK14266, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|237646 PRK14237, PRK14237, phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|213234 cd03267, ABC_NatA_like, ATP-binding cassette domain of an uncharacterized transporter similar in sequence to NatA Back     alignment and domain information
>gnl|CDD|240339 PTZ00265, PTZ00265, multidrug resistance protein (mdr1); Provisional Back     alignment and domain information
>gnl|CDD|227019 COG4674, COG4674, Uncharacterized ABC-type transport system, ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|233596 TIGR01846, type_I_sec_HlyB, type I secretion system ABC transporter, HlyB family Back     alignment and domain information
>gnl|CDD|182342 PRK10261, PRK10261, glutathione transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|213183 cd03216, ABC_Carb_Monos_I, First domain of the ATP-binding cassette component of monosaccharide transport system Back     alignment and domain information
>gnl|CDD|182817 PRK10895, PRK10895, lipopolysaccharide ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|163452 TIGR03740, galliderm_ABC, gallidermin-class lantibiotic protection ABC transporter, ATP-binding subunit Back     alignment and domain information
>gnl|CDD|163431 TIGR03719, ABC_ABC_ChvD, ATP-binding cassette protein, ChvD family Back     alignment and domain information
>gnl|CDD|132313 TIGR03269, met_CoM_red_A2, methyl coenzyme M reductase system, component A2 Back     alignment and domain information
>gnl|CDD|224042 COG1117, PstB, ABC-type phosphate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|237456 PRK13641, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|224026 COG1101, PhnK, ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|184584 PRK14238, PRK14238, phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|182716 PRK10771, thiQ, thiamine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|237917 PRK15134, PRK15134, microcin C ABC transporter ATP-binding protein YejF; Provisional Back     alignment and domain information
>gnl|CDD|237453 PRK13633, PRK13633, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|236947 PRK11650, ugpC, glycerol-3-phosphate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|185336 PRK15439, PRK15439, autoinducer 2 ABC transporter ATP-binding protein LsrA; Provisional Back     alignment and domain information
>gnl|CDD|225265 COG2401, COG2401, ABC-type ATPase fused to a predicted acetyltransferase domain [General function prediction only] Back     alignment and domain information
>gnl|CDD|132313 TIGR03269, met_CoM_red_A2, methyl coenzyme M reductase system, component A2 Back     alignment and domain information
>gnl|CDD|236992 PRK11819, PRK11819, putative ABC transporter ATP-binding protein; Reviewed Back     alignment and domain information
>gnl|CDD|182893 PRK11000, PRK11000, maltose/maltodextrin transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|213255 cd03288, ABCC_SUR2, ATP-binding cassette domain 2 of the sulfonylurea receptor SUR Back     alignment and domain information
>gnl|CDD|237894 PRK15064, PRK15064, ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|130252 TIGR01184, ntrCD, nitrate transport ATP-binding subunits C and D Back     alignment and domain information
>gnl|CDD|236729 PRK10636, PRK10636, putative ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|184597 PRK14270, PRK14270, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|184586 PRK14240, PRK14240, phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|184596 PRK14267, PRK14267, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|172732 PRK14244, PRK14244, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|163508 TIGR03796, NHLM_micro_ABC1, NHLM bacteriocin system ABC transporter, peptidase/ATP-binding protein Back     alignment and domain information
>gnl|CDD|226952 COG4586, COG4586, ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|226968 COG4615, PvdE, ABC-type siderophore export system, fused ATPase and permease components [Secondary metabolites biosynthesis, transport, and catabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|184207 PRK13648, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|183016 PRK11176, PRK11176, lipid transporter ATP-binding/permease protein; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 1338
KOG00551228 consensus Multidrug/pheromone exporter, ABC superf 100.0
KOG00541381 consensus Multidrug resistance-associated protein/ 100.0
PTZ002651466 multidrug resistance protein (mdr1); Provisional 100.0
PLN03130 1622 ABC transporter C family member; Provisional 100.0
PLN032321495 ABC transporter C family member; Provisional 100.0
TIGR009571522 MRP_assoc_pro multi drug resistance-associated pro 100.0
PTZ002431560 ABC transporter; Provisional 100.0
TIGR012711490 CFTR_protein cystic fibrosis transmembrane conduct 100.0
KOG0060659 consensus Long-chain acyl-CoA transporter, ABC sup 100.0
COG4178604 ABC-type uncharacterized transport system, permeas 100.0
KOG0058716 consensus Peptide exporter, ABC superfamily [Intra 100.0
KOG0064728 consensus Peroxisomal long-chain acyl-CoA transpor 100.0
KOG0058716 consensus Peptide exporter, ABC superfamily [Intra 100.0
TIGR00954659 3a01203 Peroxysomal Fatty Acyl CoA Transporter (FA 100.0
KOG0060659 consensus Long-chain acyl-CoA transporter, ABC sup 100.0
COG2274709 SunT ABC-type bacteriocin/lantibiotic exporters, c 100.0
KOG00551228 consensus Multidrug/pheromone exporter, ABC superf 100.0
TIGR00958711 3a01208 Conjugate Transporter-2 (CT2) Family prote 100.0
PRK11174588 cysteine/glutathione ABC transporter membrane/ATP- 100.0
TIGR03796710 NHPM_micro_ABC1 NHPM bacteriocin system ABC transp 100.0
COG2274709 SunT ABC-type bacteriocin/lantibiotic exporters, c 100.0
COG1123539 ATPase components of various ABC-type transport sy 100.0
TIGR01193708 bacteriocin_ABC ABC-type bacteriocin transporter. 100.0
TIGR00954659 3a01203 Peroxysomal Fatty Acyl CoA Transporter (FA 100.0
TIGR02868529 CydC thiol reductant ABC exporter, CydC subunit. T 100.0
TIGR03797686 NHPM_micro_ABC2 NHPM bacteriocin system ABC transp 100.0
KOG0064728 consensus Peroxisomal long-chain acyl-CoA transpor 100.0
TIGR03375694 type_I_sec_LssB type I secretion system ATPase, Ls 100.0
COG4178604 ABC-type uncharacterized transport system, permeas 100.0
PRK11176582 lipid transporter ATP-binding/permease protein; Pr 100.0
PRK13549506 xylose transporter ATP-binding subunit; Provisiona 100.0
PRK11160574 cysteine/glutathione ABC transporter membrane/ATP- 100.0
TIGR00958711 3a01208 Conjugate Transporter-2 (CT2) Family prote 100.0
PRK11174588 cysteine/glutathione ABC transporter membrane/ATP- 100.0
PRK09700510 D-allose transporter ATP-binding protein; Provisio 100.0
COG1132567 MdlB ABC-type multidrug transport system, ATPase a 100.0
TIGR02203571 MsbA_lipidA lipid A export permease/ATP-binding pr 100.0
PRK10790592 putative multidrug transporter membrane\ATP-bindin 100.0
PRK10261623 glutathione transporter ATP-binding protein; Provi 100.0
COG1132567 MdlB ABC-type multidrug transport system, ATPase a 100.0
PRK15134529 microcin C ABC transporter ATP-binding protein Yej 100.0
PRK10762501 D-ribose transporter ATP binding protein; Provisio 100.0
TIGR02857529 CydD thiol reductant ABC exporter, CydD subunit. U 100.0
TIGR03269520 met_CoM_red_A2 methyl coenzyme M reductase system, 100.0
PRK13657588 cyclic beta-1,2-glucan ABC transporter; Provisiona 100.0
TIGR02868529 CydC thiol reductant ABC exporter, CydC subunit. T 100.0
PRK11288501 araG L-arabinose transporter ATP-binding protein; 100.0
TIGR02633500 xylG D-xylose ABC transporter, ATP-binding protein 100.0
TIGR01846694 type_I_sec_HlyB type I secretion system ABC transp 100.0
PRK15064530 ABC transporter ATP-binding protein; Provisional 100.0
TIGR01192585 chvA glucan exporter ATP-binding protein. This mod 100.0
TIGR02204576 MsbA_rel ABC transporter, permease/ATP-binding pro 100.0
PRK11819556 putative ABC transporter ATP-binding protein; Revi 100.0
TIGR03797686 NHPM_micro_ABC2 NHPM bacteriocin system ABC transp 100.0
COG4988559 CydD ABC-type transport system involved in cytochr 100.0
PRK15439510 autoinducer 2 ABC transporter ATP-binding protein 100.0
KOG0057591 consensus Mitochondrial Fe/S cluster exporter, ABC 100.0
KOG0057591 consensus Mitochondrial Fe/S cluster exporter, ABC 100.0
KOG0056790 consensus Heavy metal exporter HMT1, ABC superfami 100.0
PRK10982491 galactose/methyl galaxtoside transporter ATP-bindi 100.0
PTZ002651466 multidrug resistance protein (mdr1); Provisional 100.0
TIGR01193708 bacteriocin_ABC ABC-type bacteriocin transporter. 100.0
TIGR03719552 ABC_ABC_ChvD ATP-binding cassette protein, ChvD fa 100.0
TIGR03796710 NHPM_micro_ABC1 NHPM bacteriocin system ABC transp 100.0
PRK10938490 putative molybdenum transport ATP-binding protein 100.0
COG4987573 CydC ABC-type transport system involved in cytochr 100.0
PRK10789569 putative multidrug transporter membrane\ATP-bindin 100.0
PRK11160574 cysteine/glutathione ABC transporter membrane/ATP- 100.0
PRK10636638 putative ABC transporter ATP-binding protein; Prov 100.0
TIGR03375694 type_I_sec_LssB type I secretion system ATPase, Ls 100.0
PRK11176582 lipid transporter ATP-binding/permease protein; Pr 100.0
TIGR01842544 type_I_sec_PrtD type I secretion system ABC transp 100.0
COG4172534 ABC-type uncharacterized transport system, duplica 100.0
TIGR02857529 CydD thiol reductant ABC exporter, CydD subunit. U 100.0
TIGR00956 1394 3a01205 Pleiotropic Drug Resistance (PDR) Family p 100.0
TIGR02203571 MsbA_lipidA lipid A export permease/ATP-binding pr 100.0
COG4988559 CydD ABC-type transport system involved in cytochr 100.0
PRK11147 635 ABC transporter ATPase component; Reviewed 100.0
PRK10790592 putative multidrug transporter membrane\ATP-bindin 100.0
COG4987573 CydC ABC-type transport system involved in cytochr 100.0
PRK13657588 cyclic beta-1,2-glucan ABC transporter; Provisiona 100.0
KOG0056790 consensus Heavy metal exporter HMT1, ABC superfami 100.0
TIGR01257 2272 rim_protein retinal-specific rim ABC transporter. 100.0
PLN031301622 ABC transporter C family member; Provisional 100.0
TIGR01846694 type_I_sec_HlyB type I secretion system ABC transp 100.0
TIGR009571522 MRP_assoc_pro multi drug resistance-associated pro 100.0
PLN03073718 ABC transporter F family; Provisional 100.0
TIGR02204576 MsbA_rel ABC transporter, permease/ATP-binding pro 100.0
COG5265497 ATM1 ABC-type transport system involved in Fe-S cl 100.0
TIGR01194555 cyc_pep_trnsptr cyclic peptide transporter. This m 100.0
PTZ002431560 ABC transporter; Provisional 100.0
PLN032321495 ABC transporter C family member; Provisional 100.0
TIGR01192585 chvA glucan exporter ATP-binding protein. This mod 100.0
PRK10789569 putative multidrug transporter membrane\ATP-bindin 100.0
PRK13409590 putative ATPase RIL; Provisional 100.0
COG0488530 Uup ATPase components of ABC transporters with dup 100.0
TIGR01842544 type_I_sec_PrtD type I secretion system ABC transp 100.0
PLN03140 1470 ABC transporter G family member; Provisional 100.0
PRK10522547 multidrug transporter membrane component/ATP-bindi 100.0
COG4618580 ArpD ABC-type protease/lipase transport system, AT 100.0
TIGR012711490 CFTR_protein cystic fibrosis transmembrane conduct 100.0
TIGR01194555 cyc_pep_trnsptr cyclic peptide transporter. This m 100.0
KOG00541381 consensus Multidrug resistance-associated protein/ 100.0
COG5265497 ATM1 ABC-type transport system involved in Fe-S cl 100.0
COG4618580 ArpD ABC-type protease/lipase transport system, AT 100.0
PRK10522547 multidrug transporter membrane component/ATP-bindi 100.0
COG1129500 MglA ABC-type sugar transport system, ATPase compo 100.0
COG3845501 ABC-type uncharacterized transport systems, ATPase 100.0
COG1126240 GlnQ ABC-type polar amino acid transport system, A 100.0
COG1116248 TauB ABC-type nitrate/sulfonate/bicarbonate transp 100.0
COG1135339 AbcC ABC-type metal ion transport system, ATPase c 100.0
KOG0927614 consensus Predicted transporter (ABC superfamily) 100.0
COG2884223 FtsE Predicted ATPase involved in cell division [C 100.0
COG1136226 SalX ABC-type antimicrobial peptide transport syst 100.0
cd03289275 ABCC_CFTR2 The CFTR subfamily domain 2. The cystic 100.0
COG1125309 OpuBA ABC-type proline/glycine betaine transport s 100.0
COG1121254 ZnuC ABC-type Mn/Zn transport systems, ATPase comp 100.0
COG1126240 GlnQ ABC-type polar amino acid transport system, A 100.0
COG1120258 FepC ABC-type cobalamin/Fe3+-siderophores transpor 100.0
COG1135 339 AbcC ABC-type metal ion transport system, ATPase c 100.0
COG3638258 ABC-type phosphate/phosphonate transport system, A 100.0
COG1117253 PstB ABC-type phosphate transport system, ATPase c 100.0
COG3839338 MalK ABC-type sugar transport systems, ATPase comp 100.0
PF06472281 ABC_membrane_2: ABC transporter transmembrane regi 100.0
COG1124252 DppF ABC-type dipeptide/oligopeptide/nickel transp 100.0
COG3842352 PotA ABC-type spermidine/putrescine transport syst 100.0
COG1117253 PstB ABC-type phosphate transport system, ATPase c 100.0
COG2884223 FtsE Predicted ATPase involved in cell division [C 100.0
PRK14257329 phosphate ABC transporter ATP-binding protein; Pro 100.0
KOG0062582 consensus ATPase component of ABC transporters wit 100.0
COG1127263 Ttg2A ABC-type transport system involved in resist 100.0
COG1122235 CbiO ABC-type cobalt transport system, ATPase comp 100.0
COG3840231 ThiQ ABC-type thiamine transport system, ATPase co 100.0
COG1136226 SalX ABC-type antimicrobial peptide transport syst 100.0
TIGR02314343 ABC_MetN D-methionine ABC transporter, ATP-binding 100.0
COG1118345 CysA ABC-type sulfate/molybdate transport systems, 100.0
TIGR00960216 3a0501s02 Type II (General) Secretory Pathway (IIS 100.0
cd03289275 ABCC_CFTR2 The CFTR subfamily domain 2. The cystic 100.0
cd03255218 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of 100.0
PRK11650356 ugpC glycerol-3-phosphate transporter ATP-binding 100.0
COG1121254 ZnuC ABC-type Mn/Zn transport systems, ATPase comp 100.0
cd03226205 ABC_cobalt_CbiO_domain2 Domain II of the ABC compo 100.0
cd03293220 ABC_NrtD_SsuB_transporters NrtD and SsuB are the A 100.0
cd03223166 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cass 100.0
COG4181228 Predicted ABC-type transport system involved in ly 100.0
PRK11432351 fbpC ferric transporter ATP-binding subunit; Provi 100.0
COG1116248 TauB ABC-type nitrate/sulfonate/bicarbonate transp 100.0
cd03259213 ABC_Carb_Solutes_like ABC Carbohydrate and Solute 100.0
TIGR02673214 FtsE cell division ATP-binding protein FtsE. This 100.0
cd03292214 ABC_FtsE_transporter FtsE is a hydrophilic nucleot 100.0
PRK13647274 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
cd03261235 ABC_Org_Solvent_Resistant ABC (ATP-binding cassett 100.0
COG1124252 DppF ABC-type dipeptide/oligopeptide/nickel transp 100.0
cd03235213 ABC_Metallic_Cations ABC component of the metal-ty 100.0
TIGR02211221 LolD_lipo_ex lipoprotein releasing system, ATP-bin 100.0
COG1120258 FepC ABC-type cobalamin/Fe3+-siderophores transpor 100.0
PRK11629233 lolD lipoprotein transporter ATP-binding subunit; 100.0
cd03225211 ABC_cobalt_CbiO_domain1 Domain I of the ABC compon 100.0
COG3839 338 MalK ABC-type sugar transport systems, ATPase comp 100.0
TIGR03265353 PhnT2 putative 2-aminoethylphosphonate ABC transpo 100.0
PRK14257329 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK13631320 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK13637287 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK13650279 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK11248255 tauB taurine transporter ATP-binding subunit; Prov 100.0
cd03296239 ABC_CysA_sulfate_importer Part of the ABC transpor 100.0
cd03266218 ABC_NatA_sodium_exporter NatA is the ATPase compon 100.0
PRK10908222 cell division protein FtsE; Provisional 100.0
cd03301213 ABC_MalK_N The N-terminal ATPase domain of the mal 100.0
TIGR03258362 PhnT 2-aminoethylphosphonate ABC transport system, 100.0
PRK11247257 ssuB aliphatic sulfonates transport ATP-binding su 100.0
PRK09452375 potA putrescine/spermidine ABC transporter ATPase 100.0
cd03252237 ABCC_Hemolysin The ABC-transporter hemolysin B is 100.0
PRK11153343 metN DL-methionine transporter ATP-binding subunit 100.0
TIGR02315243 ABC_phnC phosphonate ABC transporter, ATP-binding 100.0
cd03263220 ABC_subfamily_A The ABCA subfamily mediates the tr 100.0
cd03244221 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C. 100.0
cd03250204 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C. 100.0
cd03254229 ABCC_Glucan_exporter_like Glucan exporter ATP-bind 100.0
PRK13651305 cobalt transporter ATP-binding subunit; Provisiona 100.0
cd03256241 ABC_PhnC_transporter ABC-type phosphate/phosphonat 100.0
TIGR00960216 3a0501s02 Type II (General) Secretory Pathway (IIS 100.0
PRK10584228 putative ABC transporter ATP-binding protein YbbA; 100.0
PRK13643288 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
cd03244221 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C. 100.0
cd03269210 ABC_putative_ATPase This subfamily is involved in 100.0
TIGR02314 343 ABC_MetN D-methionine ABC transporter, ATP-binding 100.0
PRK10851353 sulfate/thiosulfate transporter subunit; Provision 100.0
cd03268208 ABC_BcrA_bacitracin_resist The BcrA subfamily repr 100.0
cd03265220 ABC_DrrA DrrA is the ATP-binding protein component 100.0
PRK11000369 maltose/maltodextrin transporter ATP-binding prote 100.0
PRK13636283 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
cd03264211 ABC_drug_resistance_like ABC-type multidrug transp 100.0
COG1125309 OpuBA ABC-type proline/glycine betaine transport s 100.0
cd03245220 ABCC_bacteriocin_exporters ABC-type bacteriocin ex 100.0
cd03288257 ABCC_SUR2 The SUR domain 2. The sulfonylurea recep 100.0
PRK11607377 potG putrescine transporter ATP-binding subunit; P 100.0
PRK13644274 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK13635279 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK13634290 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
cd03223166 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cass 100.0
cd03250204 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C. 100.0
PRK13537306 nodulation ABC transporter NodI; Provisional 100.0
cd03258233 ABC_MetN_methionine_transporter MetN (also known a 100.0
cd03253236 ABCC_ATM1_transporter ATM1 is an ABC transporter t 100.0
PRK13632271 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK13646286 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
cd03298211 ABC_ThiQ_thiamine_transporter ABC-type thiamine tr 100.0
cd03252237 ABCC_Hemolysin The ABC-transporter hemolysin B is 100.0
TIGR01186363 proV glycine betaine/L-proline transport ATP bindi 100.0
TIGR03864236 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, 100.0
cd03262213 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP- 100.0
PRK09536402 btuD corrinoid ABC transporter ATPase; Reviewed 100.0
cd03219236 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC trans 100.0
PRK10247225 putative ABC transporter ATP-binding protein YbbL; 100.0
cd03260227 ABC_PstB_phosphate_transporter Phosphate uptake is 100.0
cd03254229 ABCC_Glucan_exporter_like Glucan exporter ATP-bind 100.0
PRK14250241 phosphate ABC transporter ATP-binding protein; Pro 100.0
COG1131293 CcmA ABC-type multidrug transport system, ATPase c 100.0
PRK13631320 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
cd03255218 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of 100.0
cd03245220 ABCC_bacteriocin_exporters ABC-type bacteriocin ex 100.0
cd03295242 ABC_OpuCA_Osmoprotection OpuCA is a the ATP bindin 100.0
PRK13652277 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
cd03259213 ABC_Carb_Solutes_like ABC Carbohydrate and Solute 100.0
cd03257228 ABC_NikE_OppD_transporters The ABC transporter sub 100.0
COG3638258 ABC-type phosphate/phosphonate transport system, A 100.0
cd03218232 ABC_YhbG The ABC transporters belonging to the Yhb 100.0
cd03226205 ABC_cobalt_CbiO_domain2 Domain II of the ABC compo 100.0
PRK13633280 cobalt transporter ATP-binding subunit; Provisiona 100.0
COG1122235 CbiO ABC-type cobalt transport system, ATPase comp 100.0
cd03292214 ABC_FtsE_transporter FtsE is a hydrophilic nucleot 100.0
TIGR01288303 nodI ATP-binding ABC transporter family nodulation 100.0
cd03251234 ABCC_MsbA MsbA is an essential ABC transporter, cl 100.0
TIGR02673214 FtsE cell division ATP-binding protein FtsE. This 100.0
cd03253236 ABCC_ATM1_transporter ATM1 is an ABC transporter t 100.0
TIGR03608206 L_ocin_972_ABC putative bacteriocin export ABC tra 100.0
COG4619223 ABC-type uncharacterized transport system, ATPase 100.0
cd03290218 ABCC_SUR1_N The SUR domain 1. The sulfonylurea rec 100.0
cd03288257 ABCC_SUR2 The SUR domain 2. The sulfonylurea recep 100.0
cd03248226 ABCC_TAP TAP, the Transporter Associated with Anti 100.0
TIGR01277213 thiQ thiamine ABC transporter, ATP-binding protein 100.0
PRK13639275 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK13641287 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK13640282 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
cd03224222 ABC_TM1139_LivF_branched LivF (TM1139) is part of 100.0
TIGR00972247 3a0107s01c2 phosphate ABC transporter, ATP-binding 100.0
PRK11831269 putative ABC transporter ATP-binding protein YrbF; 100.0
COG4555245 NatA ABC-type Na+ transport system, ATPase compone 100.0
PRK13645289 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK13536340 nodulation factor exporter subunit NodI; Provision 100.0
PRK11650 356 ugpC glycerol-3-phosphate transporter ATP-binding 100.0
PRK13638271 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK13649280 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
cd03249238 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) 100.0
cd03369207 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-ty 100.0
PRK13548258 hmuV hemin importer ATP-binding subunit; Provision 100.0
TIGR02315243 ABC_phnC phosphonate ABC transporter, ATP-binding 100.0
cd03261235 ABC_Org_Solvent_Resistant ABC (ATP-binding cassett 100.0
cd03290218 ABCC_SUR1_N The SUR domain 1. The sulfonylurea rec 100.0
PRK13648269 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
cd03294269 ABC_Pro_Gly_Bertaine This family comprises the gly 100.0
cd03248226 ABCC_TAP TAP, the Transporter Associated with Anti 100.0
COG4615546 PvdE ABC-type siderophore export system, fused ATP 100.0
PRK10575265 iron-hydroxamate transporter ATP-binding subunit; 100.0
PRK11629233 lolD lipoprotein transporter ATP-binding subunit; 100.0
COG3842 352 PotA ABC-type spermidine/putrescine transport syst 100.0
PRK13642277 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK09493240 glnQ glutamine ABC transporter ATP-binding protein 100.0
TIGR02982220 heterocyst_DevA ABC exporter ATP-binding subunit, 100.0
cd03296239 ABC_CysA_sulfate_importer Part of the ABC transpor 100.0
TIGR02211221 LolD_lipo_ex lipoprotein releasing system, ATP-bin 100.0
TIGR03411242 urea_trans_UrtD urea ABC transporter, ATP-binding 100.0
COG3840231 ThiQ ABC-type thiamine transport system, ATPase co 100.0
cd03266218 ABC_NatA_sodium_exporter NatA is the ATPase compon 100.0
cd03256241 ABC_PhnC_transporter ABC-type phosphate/phosphonat 100.0
PRK10744260 pstB phosphate transporter ATP-binding protein; Pr 100.0
PRK10771232 thiQ thiamine transporter ATP-binding subunit; Pro 100.0
PRK11124242 artP arginine transporter ATP-binding subunit; Pro 100.0
PRK13647274 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK11264250 putative amino-acid ABC transporter ATP-binding pr 100.0
PRK11432 351 fbpC ferric transporter ATP-binding subunit; Provi 100.0
COG4525259 TauB ABC-type taurine transport system, ATPase com 100.0
PRK15079331 oligopeptide ABC transporter ATP-binding protein O 100.0
PRK10070400 glycine betaine transporter ATP-binding subunit; P 100.0
cd03268208 ABC_BcrA_bacitracin_resist The BcrA subfamily repr 100.0
PRK14273254 phosphate ABC transporter ATP-binding protein; Pro 100.0
TIGR03522301 GldA_ABC_ATP gliding motility-associated ABC trans 100.0
PRK13650279 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK10619257 histidine/lysine/arginine/ornithine transporter su 100.0
cd03235213 ABC_Metallic_Cations ABC component of the metal-ty 100.0
TIGR03005252 ectoine_ehuA ectoine/hydroxyectoine ABC transporte 100.0
PRK14242253 phosphate transporter ATP-binding protein; Provisi 100.0
cd03263220 ABC_subfamily_A The ABCA subfamily mediates the tr 100.0
PRK13637287 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
cd03301213 ABC_MalK_N The N-terminal ATPase domain of the mal 100.0
cd03293220 ABC_NrtD_SsuB_transporters NrtD and SsuB are the A 100.0
PRK11231255 fecE iron-dicitrate transporter ATP-binding subuni 100.0
TIGR02769265 nickel_nikE nickel import ATP-binding protein NikE 100.0
PRK14269246 phosphate ABC transporter ATP-binding protein; Pro 100.0
cd03369207 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-ty 100.0
cd03251234 ABCC_MsbA MsbA is an essential ABC transporter, cl 100.0
PRK14268258 phosphate ABC transporter ATP-binding protein; Pro 100.0
KOG0065 1391 consensus Pleiotropic drug resistance proteins (PD 100.0
cd03225211 ABC_cobalt_CbiO_domain1 Domain I of the ABC compon 100.0
PRK10908222 cell division protein FtsE; Provisional 100.0
cd03231201 ABC_CcmA_heme_exporter CcmA, the ATP-binding compo 100.0
PRK14235267 phosphate transporter ATP-binding protein; Provisi 100.0
cd03249238 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) 100.0
TIGR03410230 urea_trans_UrtE urea ABC transporter, ATP-binding 100.0
COG1127263 Ttg2A ABC-type transport system involved in resist 100.0
cd03246173 ABCC_Protease_Secretion This family represents the 100.0
PRK13538204 cytochrome c biogenesis protein CcmA; Provisional 100.0
PRK11300255 livG leucine/isoleucine/valine transporter ATP-bin 100.0
TIGR00968237 3a0106s01 sulfate ABC transporter, ATP-binding pro 100.0
cd03260227 ABC_PstB_phosphate_transporter Phosphate uptake is 100.0
PRK10895241 lipopolysaccharide ABC transporter ATP-binding pro 100.0
cd03264211 ABC_drug_resistance_like ABC-type multidrug transp 100.0
PRK10253265 iron-enterobactin transporter ATP-binding protein; 100.0
cd03219236 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC trans 100.0
PRK14250241 phosphate ABC transporter ATP-binding protein; Pro 100.0
cd03247178 ABCC_cytochrome_bd The CYD subfamily implicated in 100.0
TIGR03873256 F420-0_ABC_ATP proposed F420-0 ABC transporter, AT 100.0
PRK14259269 phosphate ABC transporter ATP-binding protein; Pro 100.0
cd03234226 ABCG_White The White subfamily represents ABC tran 100.0
PRK13540200 cytochrome c biogenesis protein CcmA; Provisional 100.0
cd03262213 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP- 100.0
cd03300232 ABC_PotA_N PotA is an ABC-type transporter and the 100.0
PRK13646286 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK14247250 phosphate ABC transporter ATP-binding protein; Pro 100.0
cd03298211 ABC_ThiQ_thiamine_transporter ABC-type thiamine tr 100.0
PRK11308327 dppF dipeptide transporter ATP-binding subunit; Pr 100.0
PRK13636283 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
TIGR03740223 galliderm_ABC gallidermin-class lantibiotic protec 100.0
TIGR03265 353 PhnT2 putative 2-aminoethylphosphonate ABC transpo 100.0
PRK11247257 ssuB aliphatic sulfonates transport ATP-binding su 100.0
TIGR01188302 drrA daunorubicin resistance ABC transporter ATP-b 100.0
PRK11614237 livF leucine/isoleucine/valine transporter ATP-bin 100.0
PRK11153 343 metN DL-methionine transporter ATP-binding subunit 100.0
PRK13632271 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK10851 353 sulfate/thiosulfate transporter subunit; Provision 100.0
TIGR03864236 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, 100.0
COG4559259 ABC-type hemin transport system, ATPase component 100.0
cd03269210 ABC_putative_ATPase This subfamily is involved in 100.0
PRK14237267 phosphate transporter ATP-binding protein; Provisi 100.0
PRK09544251 znuC high-affinity zinc transporter ATPase; Review 100.0
PRK15112267 antimicrobial peptide ABC system ATP-binding prote 100.0
PRK14251251 phosphate ABC transporter ATP-binding protein; Pro 100.0
cd03258233 ABC_MetN_methionine_transporter MetN (also known a 100.0
PRK13543214 cytochrome c biogenesis protein CcmA; Provisional 100.0
PRK13643288 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK11248255 tauB taurine transporter ATP-binding subunit; Prov 100.0
cd03291282 ABCC_CFTR1 The CFTR subfamily domain 1. The cystic 100.0
PRK13539207 cytochrome c biogenesis protein CcmA; Provisional 100.0
TIGR01978243 sufC FeS assembly ATPase SufC. SufC is part of the 100.0
cd03218232 ABC_YhbG The ABC transporters belonging to the Yhb 100.0
TIGR01166190 cbiO cobalt transport protein ATP-binding subunit. 100.0
PRK15056272 manganese/iron transporter ATP-binding protein; Pr 100.0
PRK14248268 phosphate ABC transporter ATP-binding protein; Pro 100.0
cd03295242 ABC_OpuCA_Osmoprotection OpuCA is a the ATP bindin 100.0
PRK14269246 phosphate ABC transporter ATP-binding protein; Pro 100.0
cd03224222 ABC_TM1139_LivF_branched LivF (TM1139) is part of 100.0
cd03299235 ABC_ModC_like Archeal protein closely related to M 100.0
PRK14267253 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK11000 369 maltose/maltodextrin transporter ATP-binding prote 100.0
PRK10584228 putative ABC transporter ATP-binding protein YbbA; 100.0
cd03257228 ABC_NikE_OppD_transporters The ABC transporter sub 100.0
cd03247178 ABCC_cytochrome_bd The CYD subfamily implicated in 100.0
cd03246173 ABCC_Protease_Secretion This family represents the 100.0
PRK09452 375 potA putrescine/spermidine ABC transporter ATPase 100.0
PRK14240250 phosphate transporter ATP-binding protein; Provisi 100.0
PRK13547272 hmuV hemin importer ATP-binding subunit; Provision 100.0
TIGR03258 362 PhnT 2-aminoethylphosphonate ABC transport system, 100.0
TIGR03005252 ectoine_ehuA ectoine/hydroxyectoine ABC transporte 100.0
PRK13634290 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK14256252 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK09984262 phosphonate/organophosphate ester transporter subu 100.0
PRK13644274 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK14239252 phosphate transporter ATP-binding protein; Provisi 100.0
PRK14245250 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK14274259 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK14254285 phosphate ABC transporter ATP-binding protein; Pro 100.0
cd03265220 ABC_DrrA DrrA is the ATP-binding protein component 100.0
PRK14270251 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK13635279 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK13651305 cobalt transporter ATP-binding subunit; Provisiona 100.0
PRK09536 402 btuD corrinoid ABC transporter ATPase; Reviewed 100.0
TIGR00972247 3a0107s01c2 phosphate ABC transporter, ATP-binding 100.0
PRK10744260 pstB phosphate transporter ATP-binding protein; Pr 100.0
PRK11022326 dppD dipeptide transporter ATP-binding subunit; Pr 100.0
cd03230173 ABC_DR_subfamily_A This family of ATP-binding prot 100.0
PRK11607 377 potG putrescine transporter ATP-binding subunit; P 100.0
PRK11144352 modC molybdate transporter ATP-binding protein; Pr 100.0
TIGR03415382 ABC_choXWV_ATP choline ABC transporter, ATP-bindin 100.0
PRK14241258 phosphate transporter ATP-binding protein; Provisi 100.0
PRK14244251 phosphate ABC transporter ATP-binding protein; Pro 100.0
TIGR02324224 CP_lyasePhnL phosphonate C-P lyase system protein 100.0
TIGR03411242 urea_trans_UrtD urea ABC transporter, ATP-binding 100.0
KOG0066807 consensus eIF2-interacting protein ABC50 (ABC supe 100.0
TIGR02982220 heterocyst_DevA ABC exporter ATP-binding subunit, 100.0
TIGR01189198 ccmA heme ABC exporter, ATP-binding protein CcmA. 100.0
PRK14249251 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK13652277 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK14273254 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK14238271 phosphate transporter ATP-binding protein; Provisi 100.0
PRK10619257 histidine/lysine/arginine/ornithine transporter su 100.0
PRK11701258 phnK phosphonate C-P lyase system protein PhnK; Pr 100.0
PRK10247225 putative ABC transporter ATP-binding protein YbbL; 100.0
PRK11264250 putative amino-acid ABC transporter ATP-binding pr 100.0
cd03297214 ABC_ModC_molybdenum_transporter ModC is an ABC-typ 100.0
TIGR01277213 thiQ thiamine ABC transporter, ATP-binding protein 100.0
PRK13649280 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK13645289 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK11124242 artP arginine transporter ATP-binding subunit; Pro 100.0
PRK13537306 nodulation ABC transporter NodI; Provisional 100.0
TIGR00968237 3a0106s01 sulfate ABC transporter, ATP-binding pro 100.0
cd03231201 ABC_CcmA_heme_exporter CcmA, the ATP-binding compo 100.0
PRK14253249 phosphate ABC transporter ATP-binding protein; Pro 100.0
TIGR03608206 L_ocin_972_ABC putative bacteriocin export ABC tra 100.0
PRK14275286 phosphate ABC transporter ATP-binding protein; Pro 100.0
cd03228171 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein 100.0
TIGR02142354 modC_ABC molybdenum ABC transporter, ATP-binding p 100.0
PRK14242253 phosphate transporter ATP-binding protein; Provisi 100.0
cd03229178 ABC_Class3 This class is comprised of all BPD (Bin 100.0
PRK09493240 glnQ glutamine ABC transporter ATP-binding protein 100.0
PRK14236272 phosphate transporter ATP-binding protein; Provisi 100.0
PRK13633280 cobalt transporter ATP-binding subunit; Provisiona 100.0
PRK14262250 phosphate ABC transporter ATP-binding protein; Pro 100.0
COG1123539 ATPase components of various ABC-type transport sy 100.0
PRK14255252 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK10575265 iron-hydroxamate transporter ATP-binding subunit; 100.0
TIGR01288303 nodI ATP-binding ABC transporter family nodulation 100.0
cd03294269 ABC_Pro_Gly_Bertaine This family comprises the gly 100.0
TIGR03410230 urea_trans_UrtE urea ABC transporter, ATP-binding 100.0
PRK14235267 phosphate transporter ATP-binding protein; Provisi 100.0
cd03230173 ABC_DR_subfamily_A This family of ATP-binding prot 100.0
cd03300232 ABC_PotA_N PotA is an ABC-type transporter and the 100.0
PRK10419268 nikE nickel transporter ATP-binding protein NikE; 100.0
PRK14260259 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK13642277 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK14243264 phosphate transporter ATP-binding protein; Provisi 100.0
COG0410237 LivF ABC-type branched-chain amino acid transport 100.0
TIGR01186 363 proV glycine betaine/L-proline transport ATP bindi 100.0
PRK14265274 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK13641287 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK10771232 thiQ thiamine transporter ATP-binding subunit; Pro 100.0
COG1137243 YhbG ABC-type (unclassified) transport system, ATP 100.0
PRK14261253 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK14271276 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK15093330 antimicrobial peptide ABC transporter ATP-binding 100.0
PRK11300255 livG leucine/isoleucine/valine transporter ATP-bin 100.0
COG4175386 ProV ABC-type proline/glycine betaine transport sy 100.0
PRK11831269 putative ABC transporter ATP-binding protein YrbF; 100.0
PRK10895241 lipopolysaccharide ABC transporter ATP-binding pro 100.0
PRK13541195 cytochrome c biogenesis protein CcmA; Provisional 100.0
cd03291282 ABCC_CFTR1 The CFTR subfamily domain 1. The cystic 100.0
cd03229178 ABC_Class3 This class is comprised of all BPD (Bin 100.0
PRK11231255 fecE iron-dicitrate transporter ATP-binding subuni 100.0
cd03267236 ABC_NatA_like Similar in sequence to NatA, this is 100.0
PRK11614237 livF leucine/isoleucine/valine transporter ATP-bin 100.0
PRK14247250 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK14259269 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK14252265 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK13638271 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK13639275 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
cd03234226 ABCG_White The White subfamily represents ABC tran 100.0
PRK15079331 oligopeptide ABC transporter ATP-binding protein O 100.0
TIGR01184230 ntrCD nitrate transport ATP-binding subunits C and 100.0
PRK10418254 nikD nickel transporter ATP-binding protein NikD; 100.0
PRK13640282 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK13538204 cytochrome c biogenesis protein CcmA; Provisional 100.0
PRK14268258 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK14258261 phosphate ABC transporter ATP-binding protein; Pro 100.0
TIGR02769265 nickel_nikE nickel import ATP-binding protein NikE 100.0
PRK14263261 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK13648269 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
cd03232192 ABC_PDR_domain2 The pleiotropic drug resistance-li 100.0
PRK09473330 oppD oligopeptide transporter ATP-binding componen 100.0
TIGR03873256 F420-0_ABC_ATP proposed F420-0 ABC transporter, AT 100.0
TIGR02323253 CP_lyasePhnK phosphonate C-P lyase system protein 100.0
PRK14246257 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK13548258 hmuV hemin importer ATP-binding subunit; Provision 100.0
PRK14256252 phosphate ABC transporter ATP-binding protein; Pro 100.0
cd03213194 ABCG_EPDR ABCG transporters are involved in eye pi 100.0
COG4619223 ABC-type uncharacterized transport system, ATPase 100.0
TIGR01978243 sufC FeS assembly ATPase SufC. SufC is part of the 100.0
PRK14267253 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK14237267 phosphate transporter ATP-binding protein; Provisi 100.0
PRK14251251 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK14272252 phosphate ABC transporter ATP-binding protein; Pro 100.0
cd03215182 ABC_Carb_Monos_II This family represents domain II 100.0
PRK14244251 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK13540200 cytochrome c biogenesis protein CcmA; Provisional 100.0
PRK10253265 iron-enterobactin transporter ATP-binding protein; 100.0
PRK14240250 phosphate transporter ATP-binding protein; Provisi 100.0
COG4181228 Predicted ABC-type transport system involved in ly 100.0
cd03233202 ABC_PDR_domain1 The pleiotropic drug resistance (P 100.0
PRK14245250 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK14266250 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK10070 400 glycine betaine transporter ATP-binding subunit; P 100.0
>KOG0055 consensus Multidrug/pheromone exporter, ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information 
Probab=100.00  E-value=1.1e-136  Score=1275.07  Aligned_cols=1125  Identities=18%  Similarity=0.211  Sum_probs=749.5

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHhhhHHHHHHHhcChhHHHHHHHHH----HHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q 000711          105 RDLLALVGIVVLRTALSNRLAKVQGFLFRAAFLRRVPLFFQLISEN----ILLCFLLSTMHSTSKYITGTLSLQFRKIVT  180 (1338)
Q Consensus       105 ~~l~~~~~l~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~----~~~~~~~~~~~~~~~~l~~~l~~~~R~~lt  180 (1338)
                      .++.+.++.+++.-...-.+..+.+.+.+.+...........+..+    +.+.++..+...+........+.|    .+
T Consensus        28 ~Lm~~G~i~a~~~G~~~P~~~ii~g~~~~~~~~~~~~~~~~~~~~~~l~~~~lg~~~~~~~~~q~~c~~~~geR----q~  103 (1228)
T KOG0055|consen   28 LLMILGSIGAIAHGLGLPLMSIIFGKLTDVLGDNTNKIASSEVSKVALYFVYLGVGVFISGFIQVSCWMRTGER----QT  103 (1228)
T ss_pred             HHHHHHHHHHHhcCccchHHHHHHHHHHHHHHhccchhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH----HH
Confidence            4344455555555555556667777888877765522211222222    222222222233444444555555    89


Q ss_pred             HHHHHHHhcccccccccccCCC-CCCchhHHHccHHHHHHHHHHHHHHhHHHHHHHHHHHHHHHHhchhhHHHHHHHHHH
Q 000711          181 KLIHTRYFENMAYYKISHVDGR-ITHPEQRLASDVPRFCSELSELVQDDLTAVTDGLLYTWRLCSYASPKYVFWILAYVL  259 (1338)
Q Consensus       181 ~~l~~~~~~~~~~~~~~~~d~~-~~n~~qRit~Di~~~~~~~~~l~~~~l~~~~~~~~~~~~l~~~~~~~l~~~~l~~~~  259 (1338)
                      .++|++|++..+.++++|||.+ .++..+|+++|++++.+.+.+.+..++..+.+ |+-.+.+.++..|.++++++.+.|
T Consensus       104 ~riR~~yl~~iLrQdi~~fD~~~~g~~~~~l~~d~~~I~d~~geKvg~~i~~~~~-fi~g~ii~F~~~W~Ltlv~l~~~P  182 (1228)
T KOG0055|consen  104 ARIRSKYLKAILRQDIGWFDTNSTGELVTRLSDDIELIQDAIGEKVGNFIQLLAT-FIAGFVIGFYYGWKLTLVMLSFIP  182 (1228)
T ss_pred             HHHHHHHHHHHHhCccceeecccccceEEEecCcHHHHHHHHHHHHHHHHHHHHH-HHHHHHHHHHHHHHHHHHHHHHHH
Confidence            9999999999999999999975 57999999999999999999988866554433 333445566678889999998888


Q ss_pred             HHHHHHHHHhhhHHHHHHHHHHHHHHHHHHHHHHHHhHHHHHHhCChHHHHHHHHHHHHHHHHHHHH-HHHHHHHHHHHH
Q 000711          260 GAGTMMRNFSPAFGKLMSKEQQLEGEYRQLHSRLRTHAESIAFYGGENKEESHIQQKFKALTRHMRV-VLHDHWWFGMIQ  338 (1338)
Q Consensus       260 ~~~~~~~~~~~~~~~l~~~~~~~e~~~r~~~~~i~~~~e~I~~~~~e~~e~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~  338 (1338)
                      +..+....+.+.+.+...++++..++.-...++...++++|.+|+||+.|.    ++|.+..+..++ .++...+.++..
T Consensus       183 li~~~g~~~a~~~~~~t~ke~~~ya~Ag~iaEe~i~~iRTV~af~gq~~e~----~ry~~~L~~~~k~gi~~g~~~G~~~  258 (1228)
T KOG0055|consen  183 LIAIAGGLLARFLSKLTEKEQEAYAKAGSIAEEVISSIRTVYAFNGEKKEI----ERYSKALENALKFGIKKGLFKGLGL  258 (1228)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhhhhhhhcCcHHHH----HHHHHHHHHHHHHHHHHHHHHHHHh
Confidence            888777778888889999999998988888899999999999999999998    566665554443 355555555543


Q ss_pred             HHHHHHHHHHHHHHHHHHhHhcccccCC-cchhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q 000711          339 DFLLKYLGATVAVILIIEPFFAGNLKPD-TSTLGRAKMLSNLRYHTSVIISLFQSLGTLSISSRRLNRLSGYADRIHELM  417 (1338)
Q Consensus       339 ~~~~~~~~~~~~~~~~~~~~~~g~~~~~-~~~~g~~~~~~~~~~~~~~~~~~~~~l~~l~~~~~~l~~~~~~~~ri~~~~  417 (1338)
                      .+...++....+..    .|+++.+... ..+.|..  +.   .+.+++.. -.++++..+.+..+..+.+++.+|++++
T Consensus       259 G~~~~~~~~~~a~~----~WyG~~li~~~~~~~g~v--~~---v~~~vl~g-~~sLgqa~p~l~~f~~a~~aa~~I~~~i  328 (1228)
T KOG0055|consen  259 GFTFFLLFASYALA----FWYGSTLILNGGYNGGDV--IT---VFFSVLIG-GMSLGQASPHLSAFAKARAAAYRIFETI  328 (1228)
T ss_pred             HHHHHHHHHHHHHH----HHHHHHHHhcCCCCCceE--EE---EEeehhhh-hhhhhccccchHHHhccccchHHHHHHh
Confidence            33221122222222    2444343222 1222221  10   01112222 2377888888899999999999999999


Q ss_pred             HhhhhccccCCCCCCCCCCCCcCCCCcEEEEeEEEEcCCC--CeeeeeeeEEEeCCCEEEEEcCCCCcHHHHHHHHcCCC
Q 000711          418 VISRELSIEDKSPQRNGSRNYFSEANYIEFSGVKVVTPTG--NVLVENLTLKVEPGSNLLITGPNGSGKSSLFRVLGGLW  495 (1338)
Q Consensus       418 ~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~~v~~~~~~~--~~~l~~~sl~i~~G~~~~i~G~sGsGKSTLl~~l~g~~  495 (1338)
                      +..+.++..+.     .........+.|+|+||+|+||..  .++|+|+||+|++|+.++|||||||||||++++|.|+|
T Consensus       329 ~~~~~i~~~~~-----~~~~~~~~~g~ief~nV~FsYPsRpdv~Il~g~sl~i~~G~~valVG~SGsGKST~i~LL~Rfy  403 (1228)
T KOG0055|consen  329 DRKPSIDPYSK-----GGRVLSSIKGEIEFRNVCFSYPSRPDVKILKGVSLKIPSGQTVALVGPSGSGKSTLIQLLARFY  403 (1228)
T ss_pred             cCCCCCCcccc-----cCCcccccccceEEEEEEecCCCCCcchhhCCeEEEeCCCCEEEEECCCCCCHHHHHHHHHHhc
Confidence            88776543210     011111236789999999999975  48999999999999999999999999999999999999


Q ss_pred             CCCccEEEeCCCC------ccccccEEEEecCCCCCCCCHHHHhcCCCCCCcccCCCCHHHHHHHHHHcCCchHHhcCCC
Q 000711          496 PLVSGHIAKPGVG------SDLNKEIFYVPQRPYTAVGTLRDQLIYPLTSDQEVEPLTHGGMVELLKNVDLEYLLDRYPP  569 (1338)
Q Consensus       496 ~~~~G~i~~~~~~------~~~~~~i~~v~Q~~~l~~~tl~eni~~~~~~~~~~~~~~~~~~~~~l~~~~l~~~~~~~~~  569 (1338)
                      +|++|+|.+||.+      +++|++||.|.|+|.+|++||+|||.||.++      .+.+++.++++.++.++++..+|.
T Consensus       404 dP~~G~V~idG~di~~~~~~~lr~~iglV~QePvlF~~tI~eNI~~G~~d------at~~~i~~a~k~ana~~fi~~lp~  477 (1228)
T KOG0055|consen  404 DPTSGEVLIDGEDIRNLNLKWLRSQIGLVSQEPVLFATTIRENIRYGKPD------ATREEIEEAAKAANAHDFILKLPD  477 (1228)
T ss_pred             CCCCceEEEcCccchhcchHHHHhhcCeeeechhhhcccHHHHHhcCCCc------ccHHHHHHHHHHccHHHHHHhhHH
Confidence            9999999999987      4578899999999999999999999999754      688999999999999999999998


Q ss_pred             Cccc---cCCCCCChhHHHHHHHHHHHccCCCEEEEecCCCCCCHHHHHHHHHHHHc--cCCeEEEEecChhhHhhcceE
Q 000711          570 EKEI---NWGDELSLGEQQRLGMARLFYHKPKFAILDECTSAVTTDMEERFCAKVRA--MGTSCITISHRPALVAFHDVV  644 (1338)
Q Consensus       570 ~~~~---~~g~~LSgGqkQRlalARal~~~p~illLDEpts~LD~~~~~~i~~~l~~--~~~t~i~itH~~~~~~~~d~i  644 (1338)
                      +.++   +.|.+|||||||||||||||+++|+||||||||||||+++|+.++++|.+  .|+|.|+|+||+++++++|+|
T Consensus       478 g~~T~vge~g~qLSGGQKQRIAIARalv~~P~ILLLDEaTSaLD~~se~~Vq~ALd~~~~grTTivVaHRLStIrnaD~I  557 (1228)
T KOG0055|consen  478 GYDTLVGERGVQLSGGQKQRIAIARALVRNPKILLLDEATSALDAESERVVQEALDKASKGRTTIVVAHRLSTIRNADKI  557 (1228)
T ss_pred             hhcccccCCCCCCChHHHHHHHHHHHHHhCCCEEEecCcccccCHHHHHHHHHHHHHhhcCCeEEEEeeehhhhhccCEE
Confidence            7665   46789999999999999999999999999999999999999999999976  599999999999999999999


Q ss_pred             EEccCCCceEEeecCCCcccccccchh-hcccccccc----chhhHHHHHHHHHhhcccccC-CcccchhhhHHHhhCCC
Q 000711          645 LSLDGEGEWRVHDKRDGSSVVTKSGIN-MIKSSETDR----QSDAMAVEQAFVTAKKDSAFS-NPKAQSYVSEVIAASPI  718 (1338)
Q Consensus       645 ~~l~~~g~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~----~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~  718 (1338)
                      ++++++  ..++...+.+.......+. .....+.+.    ..+..........+...+... ............. ...
T Consensus       558 ~v~~~G--~IvE~G~h~ELi~~~G~Y~~lv~~Q~~~~~~~~~~~~~~~~~~~~~s~~~s~~~~~~~~~~~~~~~~~-~~~  634 (1228)
T KOG0055|consen  558 AVMEEG--KIVEQGTHDELIALGGIYSSLVRLQELEKAAEDEEEEESLKEERSRSLKSSSSSPSLSRGSNRSNLLS-VKP  634 (1228)
T ss_pred             EEEECC--EEEEecCHHHHHhccchHHHHHHHHhhhhhhhccccccchhhhhhhccccccccccccCCcccccccc-ccc
Confidence            999973  3444443322211111111 000000000    000000000000000000000 0000000000000 000


Q ss_pred             CCCCCCCCCccccccCcccchhhHHhHHHHhhccccchhhHHHH----HHHHHHHHHHHHHHHHHhhcchHHHHHHhcCH
Q 000711          719 ADHNVPLPVFPQLKSAPRILPLRVADMFKVLVPTVFDKQGAQLL----AVAFLVVSRTWISDRIASLNGTTVKYVLEQDK  794 (1338)
Q Consensus       719 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~----~~~~~~~~~~wl~~~~~~~~~~~~~~~~~~~~  794 (1338)
                       ++...  ..+..........+++..   ...|.|.....|.+.    +...++++..+ +..+..+........  +..
T Consensus       635 -~~e~~--~~~~~~~~~~~s~~~i~k---~~~pe~~~l~lG~i~a~i~G~~~P~fa~~~-s~~~~~f~~~~~~~~--~~~  705 (1228)
T KOG0055|consen  635 -EGEDP--EEPVSEEDEKVSFWRIFK---LNKPEWPYLLLGSLGAAIRGATYPLFAYVF-SQVLEAFYPPDDDEL--KRE  705 (1228)
T ss_pred             -ccccc--ccccccccccccHHHHHH---hccchhHHHHHHHHHHHHhhhhHHHHHHHH-HHHHHHHhCCChHHH--HHH
Confidence             00000  000000001112233332   222332222222222    12222222211 111111110000000  001


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccc-ccchhhcccCCCCCCccchhHHHHHHHHH
Q 000711          795 ASFVRLIGVSVLQSAASSFIAPSIRHLTARLALGWRIRMTQHLLKSYLRK-NSFYKVFNMSSKSIDADQRITHDLEKLTT  873 (1338)
Q Consensus       795 ~~~~~~~~i~~~~~~~~~~~~~~~~~~~~~~~~~~r~~l~~~l~~~~l~~-~~ff~~~~~~~~~~~~~~Rls~D~~~l~~  873 (1338)
                      ..+  +..++++.++...+..++..++...++..|..+++.+++++.|++ ..|||..+++   +.+.+|+++|...+..
T Consensus       706 ~~~--~al~f~~l~~~~~i~~~~q~~~f~~~ge~Lt~R~R~~~F~~ll~qd~~wFD~~~ns---g~l~~RLa~Da~~vr~  780 (1228)
T KOG0055|consen  706 VRA--WALIFLGLGIVSGITNFLQHYFFGIAGEKLTKRLRSMMFRALLRQEVGWFDDPENS---GALSSRLATDASNVRA  780 (1228)
T ss_pred             HHH--HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcCCCcccCCCccc---hHHHHHHhcchHHHHH
Confidence            112  223344445555556666667777778888888888888888886 5999987765   6688999999987655


Q ss_pred             HHHH----HHHH---hhHhHHHHHHHHHHHHHhhchhhHHHHHHHHHHHHHHHHHhcCccccccHHHHH-hccchHHHHH
Q 000711          874 DLSG----LVTG---MVKPSVDILWFTWRMKALTGQRGVAILYAYMLLGLGFLRSVTPEFGDLTSREQQ-LEGTFRFMHE  945 (1338)
Q Consensus       874 ~l~~----~~~~---~i~~~~~i~~~~~~l~~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-le~~~r~~~~  945 (1338)
                      .+..    ++..   ++.+++..++++|+|++++..    ..+++++......+..    .....+.++ .+...+.+ .
T Consensus       781 ~v~~rl~~vv~~~~~~~~~iiiaf~~~W~lalv~la----~~Pll~~~~~~~~~~~----~~~~~~~~~~~~ea~~iA-~  851 (1228)
T KOG0055|consen  781 AVGDRLSLVVQNIAAVIIGIIIAFIYGWRLALVVLA----TFPLLILSGYLQKKFL----KGFSKDDKKAYEEASKIA-I  851 (1228)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH----HHHHHHHHHHHHHHHH----hhhhHHHHHHHHHHHHHH-H
Confidence            4333    3322   333445557899999987522    1111111111111211    111222222 23333333 3


Q ss_pred             HHHhhHHHhhhcCChHHHHHHHHHHHHHHH-HHHHHHHHHHHHhhhhhHHHHhhhhhHHHHHHHHHHHHhhcccchhhhc
Q 000711          946 RLRAHAESVAFFGGGAREKAMIESRFRELL-EHSLLLLKKKWLFGILDDFVTKQLPHNVTWGLSLLYAMEHKGDRALVST 1024 (1338)
Q Consensus       946 ~~~~~~e~i~~~~~~~~e~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 1024 (1338)
                      +..+++++|++|+.+   .+. .+.|.+.+ ...+...++.++.++...  ..+......++++++|+..+......  +
T Consensus       852 eai~NIrTV~al~~e---~~~-~~~y~~~l~~p~~~~~~~~~i~gl~f~--~sqs~~~~~~A~~f~~G~~Li~~g~~--~  923 (1228)
T KOG0055|consen  852 EAVSNIRTVAALCAE---EKF-MELYKEELEKPRKSSFKRGLISGLGFG--FSQSLLFFVYALSFWYGARLISNGEM--T  923 (1228)
T ss_pred             HHHHhHHHHHHHhhH---HHH-HHHHHHHHHHHHHHHHHHHHHHHHHHH--HHHHHHHHHHHHHHHHhHHHHhcCCc--C
Confidence            445688999998743   333 33444444 455566677777666533  33444456677888887654332211  2


Q ss_pred             hHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhHHhHHHHHHHHHhhcCCCCCCccCCccCCCCCCCCCCceEEee
Q 000711         1025 QGELAHALRFLASVVSQSFLAFGDILELHRKFVELSGGINRIFELEELLDAAQPGDDEISGSSQHKWNSTDYQDSISFSK 1104 (1338)
Q Consensus      1025 ~g~l~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~a~~Ri~~~~~~~~~~~~~~~~~~~~~~~~wp~~~~~g~I~f~n 1104 (1338)
                      +..+...  |  .++......+++.....+.+.....|+.+|+++++.++..+...     +....+|  ..+|+|+|+|
T Consensus       924 ~~~~~~v--f--~~l~~ta~~~~~~~s~~Pd~~ka~~Aa~~iF~i~dr~~~i~~~~-----~~~~~~~--~~~G~I~~~~  992 (1228)
T KOG0055|consen  924 FEDVFRV--F--MALSFTAMALGQASSYAPDISKAKIAAGSIFEILDRKPTIDPDS-----TSGGKLP--NVKGDIEFRN  992 (1228)
T ss_pred             HHHHHHH--H--HHHHHHHHHHHHHHhhCcHHHHHHHHHHHHHHHhcCCCCCCCCC-----CCCCccc--cceeEEEEee
Confidence            2222111  1  11222334455566677778888899999999998765332211     1111122  2589999999


Q ss_pred             eEEeCCCc--cccccccceEEeCCCEEEEEcCCCCcHHHHHHHHhCCCCCCCceEEcCCCCCccc--cCCcccEEEEcCC
Q 000711         1105 LDIITPSQ--KLLARQLTFEIVPGKSLLVTGPNGSGKSSVFRVLRGLWPVVSGSLTKPSQHIDEE--AGSGCGIFYVPQR 1180 (1338)
Q Consensus      1105 V~f~yp~~--~~vL~~lsf~I~~GekvaIVG~SGsGKSTL~~lL~Rl~~~~sG~I~idg~dI~~~--~~lr~~i~~VpQd 1180 (1338)
                      |+|.||++  .+||+|+||+|++||+|||||||||||||++.+|+|||||++|+|.|||.||+++  +++|++|++|+||
T Consensus       993 V~F~YPsRP~~~Il~~l~l~i~~GqTvALVG~SGsGKSTvI~LLeRfYdp~~G~V~IDg~dik~lnl~~LR~~i~lVsQE 1072 (1228)
T KOG0055|consen  993 VSFAYPTRPDVPVLNNLSLSIRAGQTVALVGPSGSGKSTVISLLERFYDPDAGKVKIDGVDIKDLNLKWLRKQIGLVSQE 1072 (1228)
T ss_pred             eEeeCCCCCCchhhcCCcEEecCCCEEEEECCCCCCHHHHHHHHHHhcCCCCCeEEECCcccccCCHHHHHHhcceeccC
Confidence            99999985  4799999999999999999999999999999999999999999999999999998  6899999999999


Q ss_pred             CCCCCCCHHHHhcCCC-c-hHHHHHHHHhhhcCCccccccccCchHHHHHHHhhCCchhhhhhhcccCcccC-cccCCCC
Q 000711         1181 PYTCLGTLRDQIIYPL-S-REEAELRALKLHGKGEKLVDTTNILDSYLKTILEGVRLSYLLEREEVGWDANL-NWEDILS 1257 (1338)
Q Consensus      1181 P~LF~GTIReNL~~p~-~-~~~~~~~a~~~a~~~~~~~~~~~~~d~~i~~~l~~~~L~~~i~~~~~Gldt~~-~~g~~LS 1257 (1338)
                      |.||++||||||.|+. . +++|+++|||.|++|+|                        +..+|+||||.+ ++|.+||
T Consensus      1073 P~LF~~TIrENI~YG~~~vs~~eIi~Aak~ANaH~F------------------------I~sLP~GyDT~vGerG~QLS 1128 (1228)
T KOG0055|consen 1073 PVLFNGTIRENIAYGSEEVSEEEIIEAAKLANAHNF------------------------ISSLPQGYDTRVGERGVQLS 1128 (1228)
T ss_pred             chhhcccHHHHHhccCCCCCHHHHHHHHHHhhhHHH------------------------HhcCcCcccCccCcccCcCC
Confidence            9999999999999983 2 56777888888876554                        445678999998 5899999


Q ss_pred             hhHHHHHHHHHHhhcCCCEEEeecCCCCCCHHHHHHHHHHHHh--cCCeEEEeccCCCCcccccceEEEecCC
Q 000711         1258 LGEQQRLGMARLFFHKPKFGILDECTNATSVDVEEQLYRLAKD--MGITFVTSSQRPALIPFHSLELRLIDGE 1328 (1338)
Q Consensus      1258 gGQrQrlaiARAlLr~p~ILiLDEATSaLD~~te~~i~~~~~~--~~~TvI~IAHRl~~i~~~d~~l~l~~g~ 1328 (1338)
                      ||||||||||||++||||||+|||||||||.++|+.+|+++..  .|+|+|+|||||+||+-+|.+.++.+|.
T Consensus      1129 GGQKQRIAIARAilRnPkILLLDEATSALDseSErvVQeALd~a~~gRT~IvIAHRLSTIqnaD~I~Vi~~G~ 1201 (1228)
T KOG0055|consen 1129 GGQKQRIAIARAILRNPKILLLDEATSALDSESERVVQEALDRAMEGRTTIVIAHRLSTIQNADVIAVLKNGK 1201 (1228)
T ss_pred             chHHHHHHHHHHHHcCCCeeeeeccchhhhhhhHHHHHHHHHHhhcCCcEEEEecchhhhhcCCEEEEEECCE
Confidence            9999999999999999999999999999999999999998854  5999999999999999999999997763

>KOG0054 consensus Multidrug resistance-associated protein/mitoxantrone resistance protein, ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PTZ00265 multidrug resistance protein (mdr1); Provisional Back     alignment and domain information
>PLN03130 ABC transporter C family member; Provisional Back     alignment and domain information
>PLN03232 ABC transporter C family member; Provisional Back     alignment and domain information
>TIGR00957 MRP_assoc_pro multi drug resistance-associated protein (MRP) Back     alignment and domain information
>PTZ00243 ABC transporter; Provisional Back     alignment and domain information
>TIGR01271 CFTR_protein cystic fibrosis transmembrane conductor regulator (CFTR) Back     alignment and domain information
>KOG0060 consensus Long-chain acyl-CoA transporter, ABC superfamily (involved in peroxisome organization and biogenesis) [Lipid transport and metabolism; General function prediction only] Back     alignment and domain information
>COG4178 ABC-type uncharacterized transport system, permease and ATPase components [General function prediction only] Back     alignment and domain information
>KOG0058 consensus Peptide exporter, ABC superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0064 consensus Peroxisomal long-chain acyl-CoA transporter, ABC superfamily [Lipid transport and metabolism] Back     alignment and domain information
>KOG0058 consensus Peptide exporter, ABC superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>TIGR00954 3a01203 Peroxysomal Fatty Acyl CoA Transporter (FAT) Family protei Back     alignment and domain information
>KOG0060 consensus Long-chain acyl-CoA transporter, ABC superfamily (involved in peroxisome organization and biogenesis) [Lipid transport and metabolism; General function prediction only] Back     alignment and domain information
>COG2274 SunT ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain [Defense mechanisms] Back     alignment and domain information
>KOG0055 consensus Multidrug/pheromone exporter, ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>TIGR00958 3a01208 Conjugate Transporter-2 (CT2) Family protein Back     alignment and domain information
>PRK11174 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed Back     alignment and domain information
>TIGR03796 NHPM_micro_ABC1 NHPM bacteriocin system ABC transporter, peptidase/ATP-binding protein Back     alignment and domain information
>COG2274 SunT ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain [Defense mechanisms] Back     alignment and domain information
>COG1123 ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] Back     alignment and domain information
>TIGR01193 bacteriocin_ABC ABC-type bacteriocin transporter Back     alignment and domain information
>TIGR00954 3a01203 Peroxysomal Fatty Acyl CoA Transporter (FAT) Family protei Back     alignment and domain information
>TIGR02868 CydC thiol reductant ABC exporter, CydC subunit Back     alignment and domain information
>TIGR03797 NHPM_micro_ABC2 NHPM bacteriocin system ABC transporter, ATP-binding protein Back     alignment and domain information
>KOG0064 consensus Peroxisomal long-chain acyl-CoA transporter, ABC superfamily [Lipid transport and metabolism] Back     alignment and domain information
>TIGR03375 type_I_sec_LssB type I secretion system ATPase, LssB family Back     alignment and domain information
>COG4178 ABC-type uncharacterized transport system, permease and ATPase components [General function prediction only] Back     alignment and domain information
>PRK11176 lipid transporter ATP-binding/permease protein; Provisional Back     alignment and domain information
>PRK13549 xylose transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11160 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed Back     alignment and domain information
>TIGR00958 3a01208 Conjugate Transporter-2 (CT2) Family protein Back     alignment and domain information
>PRK11174 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed Back     alignment and domain information
>PRK09700 D-allose transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG1132 MdlB ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms] Back     alignment and domain information
>TIGR02203 MsbA_lipidA lipid A export permease/ATP-binding protein MsbA Back     alignment and domain information
>PRK10790 putative multidrug transporter membrane\ATP-binding components; Provisional Back     alignment and domain information
>PRK10261 glutathione transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG1132 MdlB ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms] Back     alignment and domain information
>PRK15134 microcin C ABC transporter ATP-binding protein YejF; Provisional Back     alignment and domain information
>PRK10762 D-ribose transporter ATP binding protein; Provisional Back     alignment and domain information
>TIGR02857 CydD thiol reductant ABC exporter, CydD subunit Back     alignment and domain information
>TIGR03269 met_CoM_red_A2 methyl coenzyme M reductase system, component A2 Back     alignment and domain information
>PRK13657 cyclic beta-1,2-glucan ABC transporter; Provisional Back     alignment and domain information
>TIGR02868 CydC thiol reductant ABC exporter, CydC subunit Back     alignment and domain information
>PRK11288 araG L-arabinose transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR02633 xylG D-xylose ABC transporter, ATP-binding protein Back     alignment and domain information
>TIGR01846 type_I_sec_HlyB type I secretion system ABC transporter, HlyB family Back     alignment and domain information
>PRK15064 ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR01192 chvA glucan exporter ATP-binding protein Back     alignment and domain information
>TIGR02204 MsbA_rel ABC transporter, permease/ATP-binding protein Back     alignment and domain information
>PRK11819 putative ABC transporter ATP-binding protein; Reviewed Back     alignment and domain information
>TIGR03797 NHPM_micro_ABC2 NHPM bacteriocin system ABC transporter, ATP-binding protein Back     alignment and domain information
>COG4988 CydD ABC-type transport system involved in cytochrome bd biosynthesis, ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK15439 autoinducer 2 ABC transporter ATP-binding protein LsrA; Provisional Back     alignment and domain information
>KOG0057 consensus Mitochondrial Fe/S cluster exporter, ABC superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0057 consensus Mitochondrial Fe/S cluster exporter, ABC superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0056 consensus Heavy metal exporter HMT1, ABC superfamily [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK10982 galactose/methyl galaxtoside transporter ATP-binding protein; Provisional Back     alignment and domain information
>PTZ00265 multidrug resistance protein (mdr1); Provisional Back     alignment and domain information
>TIGR01193 bacteriocin_ABC ABC-type bacteriocin transporter Back     alignment and domain information
>TIGR03719 ABC_ABC_ChvD ATP-binding cassette protein, ChvD family Back     alignment and domain information
>TIGR03796 NHPM_micro_ABC1 NHPM bacteriocin system ABC transporter, peptidase/ATP-binding protein Back     alignment and domain information
>PRK10938 putative molybdenum transport ATP-binding protein ModF; Provisional Back     alignment and domain information
>COG4987 CydC ABC-type transport system involved in cytochrome bd biosynthesis, fused ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10789 putative multidrug transporter membrane\ATP-binding components; Provisional Back     alignment and domain information
>PRK11160 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed Back     alignment and domain information
>PRK10636 putative ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR03375 type_I_sec_LssB type I secretion system ATPase, LssB family Back     alignment and domain information
>PRK11176 lipid transporter ATP-binding/permease protein; Provisional Back     alignment and domain information
>TIGR01842 type_I_sec_PrtD type I secretion system ABC transporter, PrtD family Back     alignment and domain information
>COG4172 ABC-type uncharacterized transport system, duplicated ATPase component [General function prediction only] Back     alignment and domain information
>TIGR02857 CydD thiol reductant ABC exporter, CydD subunit Back     alignment and domain information
>TIGR00956 3a01205 Pleiotropic Drug Resistance (PDR) Family protein Back     alignment and domain information
>TIGR02203 MsbA_lipidA lipid A export permease/ATP-binding protein MsbA Back     alignment and domain information
>COG4988 CydD ABC-type transport system involved in cytochrome bd biosynthesis, ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK11147 ABC transporter ATPase component; Reviewed Back     alignment and domain information
>PRK10790 putative multidrug transporter membrane\ATP-binding components; Provisional Back     alignment and domain information
>COG4987 CydC ABC-type transport system involved in cytochrome bd biosynthesis, fused ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK13657 cyclic beta-1,2-glucan ABC transporter; Provisional Back     alignment and domain information
>KOG0056 consensus Heavy metal exporter HMT1, ABC superfamily [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR01257 rim_protein retinal-specific rim ABC transporter Back     alignment and domain information
>PLN03130 ABC transporter C family member; Provisional Back     alignment and domain information
>TIGR01846 type_I_sec_HlyB type I secretion system ABC transporter, HlyB family Back     alignment and domain information
>TIGR00957 MRP_assoc_pro multi drug resistance-associated protein (MRP) Back     alignment and domain information
>PLN03073 ABC transporter F family; Provisional Back     alignment and domain information
>TIGR02204 MsbA_rel ABC transporter, permease/ATP-binding protein Back     alignment and domain information
>COG5265 ATM1 ABC-type transport system involved in Fe-S cluster assembly, permease and ATPase components [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR01194 cyc_pep_trnsptr cyclic peptide transporter Back     alignment and domain information
>PTZ00243 ABC transporter; Provisional Back     alignment and domain information
>PLN03232 ABC transporter C family member; Provisional Back     alignment and domain information
>TIGR01192 chvA glucan exporter ATP-binding protein Back     alignment and domain information
>PRK10789 putative multidrug transporter membrane\ATP-binding components; Provisional Back     alignment and domain information
>PRK13409 putative ATPase RIL; Provisional Back     alignment and domain information
>COG0488 Uup ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] Back     alignment and domain information
>TIGR01842 type_I_sec_PrtD type I secretion system ABC transporter, PrtD family Back     alignment and domain information
>PLN03140 ABC transporter G family member; Provisional Back     alignment and domain information
>PRK10522 multidrug transporter membrane component/ATP-binding component; Provisional Back     alignment and domain information
>COG4618 ArpD ABC-type protease/lipase transport system, ATPase and permease components [General function prediction only] Back     alignment and domain information
>TIGR01271 CFTR_protein cystic fibrosis transmembrane conductor regulator (CFTR) Back     alignment and domain information
>TIGR01194 cyc_pep_trnsptr cyclic peptide transporter Back     alignment and domain information
>KOG0054 consensus Multidrug resistance-associated protein/mitoxantrone resistance protein, ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>COG5265 ATM1 ABC-type transport system involved in Fe-S cluster assembly, permease and ATPase components [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG4618 ArpD ABC-type protease/lipase transport system, ATPase and permease components [General function prediction only] Back     alignment and domain information
>PRK10522 multidrug transporter membrane component/ATP-binding component; Provisional Back     alignment and domain information
>COG1129 MglA ABC-type sugar transport system, ATPase component [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG3845 ABC-type uncharacterized transport systems, ATPase components [General function prediction only] Back     alignment and domain information
>COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>COG1116 TauB ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG1135 AbcC ABC-type metal ion transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG0927 consensus Predicted transporter (ABC superfamily) [General function prediction only] Back     alignment and domain information
>COG2884 FtsE Predicted ATPase involved in cell division [Cell division and chromosome partitioning] Back     alignment and domain information
>COG1136 SalX ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>cd03289 ABCC_CFTR2 The CFTR subfamily domain 2 Back     alignment and domain information
>COG1125 OpuBA ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>COG1121 ZnuC ABC-type Mn/Zn transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>COG1120 FepC ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>COG1135 AbcC ABC-type metal ion transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG3638 ABC-type phosphate/phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG1117 PstB ABC-type phosphate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG3839 MalK ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF06472 ABC_membrane_2: ABC transporter transmembrane region 2; InterPro: IPR010509 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energise diverse biological systems Back     alignment and domain information
>COG1124 DppF ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>COG3842 PotA ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>COG1117 PstB ABC-type phosphate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG2884 FtsE Predicted ATPase involved in cell division [Cell division and chromosome partitioning] Back     alignment and domain information
>PRK14257 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>KOG0062 consensus ATPase component of ABC transporters with duplicated ATPase domains/Translation elongation factor EF-3b [Amino acid transport and metabolism; Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG1127 Ttg2A ABC-type transport system involved in resistance to organic solvents, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>COG1122 CbiO ABC-type cobalt transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG3840 ThiQ ABC-type thiamine transport system, ATPase component [Coenzyme metabolism] Back     alignment and domain information
>COG1136 SalX ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>TIGR02314 ABC_MetN D-methionine ABC transporter, ATP-binding protein Back     alignment and domain information
>COG1118 CysA ABC-type sulfate/molybdate transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR00960 3a0501s02 Type II (General) Secretory Pathway (IISP) Family protein Back     alignment and domain information
>cd03289 ABCC_CFTR2 The CFTR subfamily domain 2 Back     alignment and domain information
>cd03255 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of liporoteins from the cytoplasmic membrane (LolCDE) Back     alignment and domain information
>PRK11650 ugpC glycerol-3-phosphate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG1121 ZnuC ABC-type Mn/Zn transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd03226 ABC_cobalt_CbiO_domain2 Domain II of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota Back     alignment and domain information
>cd03293 ABC_NrtD_SsuB_transporters NrtD and SsuB are the ATP-binding subunits of the bacterial ABC-type nitrate and sulfonate transport systems, respectively Back     alignment and domain information
>cd03223 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette transporter (Pat) is involved in the import of very long-chain fatty acids (VLCFA) into the peroxisome Back     alignment and domain information
>COG4181 Predicted ABC-type transport system involved in lysophospholipase L1 biosynthesis, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PRK11432 fbpC ferric transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG1116 TauB ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd03259 ABC_Carb_Solutes_like ABC Carbohydrate and Solute Transporters-like subgroup Back     alignment and domain information
>TIGR02673 FtsE cell division ATP-binding protein FtsE Back     alignment and domain information
>cd03292 ABC_FtsE_transporter FtsE is a hydrophilic nucleotide-binding protein that binds FtsX to form a heterodimeric ATP-binding cassette (ABC)-type transporter that associates with the bacterial inner membrane Back     alignment and domain information
>PRK13647 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03261 ABC_Org_Solvent_Resistant ABC (ATP-binding cassette) transport system involved in resistant to organic solvents; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>COG1124 DppF ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>cd03235 ABC_Metallic_Cations ABC component of the metal-type transporters Back     alignment and domain information
>TIGR02211 LolD_lipo_ex lipoprotein releasing system, ATP-binding protein Back     alignment and domain information
>COG1120 FepC ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>PRK11629 lolD lipoprotein transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03225 ABC_cobalt_CbiO_domain1 Domain I of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota Back     alignment and domain information
>COG3839 MalK ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR03265 PhnT2 putative 2-aminoethylphosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK14257 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13631 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13637 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13650 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11248 tauB taurine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03296 ABC_CysA_sulfate_importer Part of the ABC transporter complex cysAWTP involved in sulfate import Back     alignment and domain information
>cd03266 ABC_NatA_sodium_exporter NatA is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled proton or K+ uptake Back     alignment and domain information
>PRK10908 cell division protein FtsE; Provisional Back     alignment and domain information
>cd03301 ABC_MalK_N The N-terminal ATPase domain of the maltose transporter, MalK Back     alignment and domain information
>TIGR03258 PhnT 2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT Back     alignment and domain information
>PRK11247 ssuB aliphatic sulfonates transport ATP-binding subunit; Provisional Back     alignment and domain information
>PRK09452 potA putrescine/spermidine ABC transporter ATPase protein; Reviewed Back     alignment and domain information
>cd03252 ABCC_Hemolysin The ABC-transporter hemolysin B is a central component of the secretion machinery that translocates the toxin, hemolysin A, in a Sec-independent fashion across both membranes of E Back     alignment and domain information
>PRK11153 metN DL-methionine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR02315 ABC_phnC phosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>cd03263 ABC_subfamily_A The ABCA subfamily mediates the transport of a variety of lipid compounds Back     alignment and domain information
>cd03244 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C Back     alignment and domain information
>cd03250 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C Back     alignment and domain information
>cd03254 ABCC_Glucan_exporter_like Glucan exporter ATP-binding protein Back     alignment and domain information
>PRK13651 cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03256 ABC_PhnC_transporter ABC-type phosphate/phosphonate transport system Back     alignment and domain information
>TIGR00960 3a0501s02 Type II (General) Secretory Pathway (IISP) Family protein Back     alignment and domain information
>PRK10584 putative ABC transporter ATP-binding protein YbbA; Provisional Back     alignment and domain information
>PRK13643 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03244 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C Back     alignment and domain information
>cd03269 ABC_putative_ATPase This subfamily is involved in drug resistance, nodulation, lipid transport, and bacteriocin and lantibiotic immunity Back     alignment and domain information
>TIGR02314 ABC_MetN D-methionine ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK10851 sulfate/thiosulfate transporter subunit; Provisional Back     alignment and domain information
>cd03268 ABC_BcrA_bacitracin_resist The BcrA subfamily represents ABC transporters involved in peptide antibiotic resistance Back     alignment and domain information
>cd03265 ABC_DrrA DrrA is the ATP-binding protein component of a bacterial exporter complex that confers resistance to the antibiotics daunorubicin and doxorubicin Back     alignment and domain information
>PRK11000 maltose/maltodextrin transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13636 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03264 ABC_drug_resistance_like ABC-type multidrug transport system, ATPase component Back     alignment and domain information
>COG1125 OpuBA ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>cd03245 ABCC_bacteriocin_exporters ABC-type bacteriocin exporters Back     alignment and domain information
>cd03288 ABCC_SUR2 The SUR domain 2 Back     alignment and domain information
>PRK11607 potG putrescine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13644 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13635 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13634 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03223 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette transporter (Pat) is involved in the import of very long-chain fatty acids (VLCFA) into the peroxisome Back     alignment and domain information
>cd03250 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C Back     alignment and domain information
>PRK13537 nodulation ABC transporter NodI; Provisional Back     alignment and domain information
>cd03258 ABC_MetN_methionine_transporter MetN (also known as YusC) is an ABC-type transporter encoded by metN of the metNPQ operon in Bacillus subtilis that is involved in methionine transport Back     alignment and domain information
>cd03253 ABCC_ATM1_transporter ATM1 is an ABC transporter that is expressed in the mitochondria Back     alignment and domain information
>PRK13632 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13646 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03298 ABC_ThiQ_thiamine_transporter ABC-type thiamine tranport system; part of the binding-protein-dependent transport system tbpA-thiPQ for thiamine and TPP Back     alignment and domain information
>cd03252 ABCC_Hemolysin The ABC-transporter hemolysin B is a central component of the secretion machinery that translocates the toxin, hemolysin A, in a Sec-independent fashion across both membranes of E Back     alignment and domain information
>TIGR01186 proV glycine betaine/L-proline transport ATP binding subunit Back     alignment and domain information
>TIGR03864 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system Back     alignment and domain information
>cd03262 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP-binding components of the bacterial periplasmic histidine and glutamine permeases, repectively Back     alignment and domain information
>PRK09536 btuD corrinoid ABC transporter ATPase; Reviewed Back     alignment and domain information
>cd03219 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC transporter subfamily is involved in the transport of the hydrophobic amino acids leucine, isoleucine and valine Back     alignment and domain information
>PRK10247 putative ABC transporter ATP-binding protein YbbL; Provisional Back     alignment and domain information
>cd03260 ABC_PstB_phosphate_transporter Phosphate uptake is of fundamental importance in the cell physiology of bacteria because phosphate is required as a nutrient Back     alignment and domain information
>cd03254 ABCC_Glucan_exporter_like Glucan exporter ATP-binding protein Back     alignment and domain information
>PRK14250 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG1131 CcmA ABC-type multidrug transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>PRK13631 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03255 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of liporoteins from the cytoplasmic membrane (LolCDE) Back     alignment and domain information
>cd03245 ABCC_bacteriocin_exporters ABC-type bacteriocin exporters Back     alignment and domain information
>cd03295 ABC_OpuCA_Osmoprotection OpuCA is a the ATP binding component of a bacterial solute transporter that serves a protective role to cells growing in a hyperosmolar environment Back     alignment and domain information
>PRK13652 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03259 ABC_Carb_Solutes_like ABC Carbohydrate and Solute Transporters-like subgroup Back     alignment and domain information
>cd03257 ABC_NikE_OppD_transporters The ABC transporter subfamily specific for the transport of dipeptides, oligopeptides (OppD), and nickel (NikDE) Back     alignment and domain information
>COG3638 ABC-type phosphate/phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd03218 ABC_YhbG The ABC transporters belonging to the YhbG family are similar to members of the Mj1267_LivG family, which is involved in the transport of branched-chain amino acids Back     alignment and domain information
>cd03226 ABC_cobalt_CbiO_domain2 Domain II of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota Back     alignment and domain information
>PRK13633 cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG1122 CbiO ABC-type cobalt transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd03292 ABC_FtsE_transporter FtsE is a hydrophilic nucleotide-binding protein that binds FtsX to form a heterodimeric ATP-binding cassette (ABC)-type transporter that associates with the bacterial inner membrane Back     alignment and domain information
>TIGR01288 nodI ATP-binding ABC transporter family nodulation protein NodI Back     alignment and domain information
>cd03251 ABCC_MsbA MsbA is an essential ABC transporter, closely related to eukaryotic MDR proteins Back     alignment and domain information
>TIGR02673 FtsE cell division ATP-binding protein FtsE Back     alignment and domain information
>cd03253 ABCC_ATM1_transporter ATM1 is an ABC transporter that is expressed in the mitochondria Back     alignment and domain information
>TIGR03608 L_ocin_972_ABC putative bacteriocin export ABC transporter, lactococcin 972 group Back     alignment and domain information
>COG4619 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>cd03290 ABCC_SUR1_N The SUR domain 1 Back     alignment and domain information
>cd03288 ABCC_SUR2 The SUR domain 2 Back     alignment and domain information
>cd03248 ABCC_TAP TAP, the Transporter Associated with Antigen Processing; TAP is essential for peptide delivery from the cytosol into the lumen of the endoplasmic reticulum (ER), where these peptides are loaded on major histocompatibility complex (MHC) I molecules Back     alignment and domain information
>TIGR01277 thiQ thiamine ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK13639 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13641 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13640 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03224 ABC_TM1139_LivF_branched LivF (TM1139) is part of the LIV-I bacterial ABC-type two-component transport system that imports neutral, branched-chain amino acids Back     alignment and domain information
>TIGR00972 3a0107s01c2 phosphate ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK11831 putative ABC transporter ATP-binding protein YrbF; Provisional Back     alignment and domain information
>COG4555 NatA ABC-type Na+ transport system, ATPase component [Energy production and conversion / Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK13645 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13536 nodulation factor exporter subunit NodI; Provisional Back     alignment and domain information
>PRK11650 ugpC glycerol-3-phosphate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13638 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13649 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03249 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) is a mitochondrial ATP-binding cassette protein involved in iron homeostasis and one of four ABC transporters expressed in the mitochondrial inner membrane, the other three being MDL1(ABC7), MDL2, and ATM1 Back     alignment and domain information
>cd03369 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-type transporter 1) Back     alignment and domain information
>PRK13548 hmuV hemin importer ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR02315 ABC_phnC phosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>cd03261 ABC_Org_Solvent_Resistant ABC (ATP-binding cassette) transport system involved in resistant to organic solvents; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>cd03290 ABCC_SUR1_N The SUR domain 1 Back     alignment and domain information
>PRK13648 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03294 ABC_Pro_Gly_Bertaine This family comprises the glycine betaine/L-proline ATP binding subunit in bacteria and its equivalents in archaea Back     alignment and domain information
>cd03248 ABCC_TAP TAP, the Transporter Associated with Antigen Processing; TAP is essential for peptide delivery from the cytosol into the lumen of the endoplasmic reticulum (ER), where these peptides are loaded on major histocompatibility complex (MHC) I molecules Back     alignment and domain information
>COG4615 PvdE ABC-type siderophore export system, fused ATPase and permease components [Secondary metabolites biosynthesis, transport, and catabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK10575 iron-hydroxamate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11629 lolD lipoprotein transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG3842 PotA ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>PRK13642 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK09493 glnQ glutamine ABC transporter ATP-binding protein; Reviewed Back     alignment and domain information
>TIGR02982 heterocyst_DevA ABC exporter ATP-binding subunit, DevA family Back     alignment and domain information
>cd03296 ABC_CysA_sulfate_importer Part of the ABC transporter complex cysAWTP involved in sulfate import Back     alignment and domain information
>TIGR02211 LolD_lipo_ex lipoprotein releasing system, ATP-binding protein Back     alignment and domain information
>TIGR03411 urea_trans_UrtD urea ABC transporter, ATP-binding protein UrtD Back     alignment and domain information
>COG3840 ThiQ ABC-type thiamine transport system, ATPase component [Coenzyme metabolism] Back     alignment and domain information
>cd03266 ABC_NatA_sodium_exporter NatA is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled proton or K+ uptake Back     alignment and domain information
>cd03256 ABC_PhnC_transporter ABC-type phosphate/phosphonate transport system Back     alignment and domain information
>PRK10744 pstB phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10771 thiQ thiamine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11124 artP arginine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13647 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11264 putative amino-acid ABC transporter ATP-binding protein YecC; Provisional Back     alignment and domain information
>PRK11432 fbpC ferric transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG4525 TauB ABC-type taurine transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK15079 oligopeptide ABC transporter ATP-binding protein OppF; Provisional Back     alignment and domain information
>PRK10070 glycine betaine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03268 ABC_BcrA_bacitracin_resist The BcrA subfamily represents ABC transporters involved in peptide antibiotic resistance Back     alignment and domain information
>PRK14273 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR03522 GldA_ABC_ATP gliding motility-associated ABC transporter ATP-binding subunit GldA Back     alignment and domain information
>PRK13650 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK10619 histidine/lysine/arginine/ornithine transporter subunit; Provisional Back     alignment and domain information
>cd03235 ABC_Metallic_Cations ABC component of the metal-type transporters Back     alignment and domain information
>TIGR03005 ectoine_ehuA ectoine/hydroxyectoine ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK14242 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03263 ABC_subfamily_A The ABCA subfamily mediates the transport of a variety of lipid compounds Back     alignment and domain information
>PRK13637 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03301 ABC_MalK_N The N-terminal ATPase domain of the maltose transporter, MalK Back     alignment and domain information
>cd03293 ABC_NrtD_SsuB_transporters NrtD and SsuB are the ATP-binding subunits of the bacterial ABC-type nitrate and sulfonate transport systems, respectively Back     alignment and domain information
>PRK11231 fecE iron-dicitrate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR02769 nickel_nikE nickel import ATP-binding protein NikE Back     alignment and domain information
>PRK14269 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03369 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-type transporter 1) Back     alignment and domain information
>cd03251 ABCC_MsbA MsbA is an essential ABC transporter, closely related to eukaryotic MDR proteins Back     alignment and domain information
>PRK14268 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>KOG0065 consensus Pleiotropic drug resistance proteins (PDR1-15), ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>cd03225 ABC_cobalt_CbiO_domain1 Domain I of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota Back     alignment and domain information
>PRK10908 cell division protein FtsE; Provisional Back     alignment and domain information
>cd03231 ABC_CcmA_heme_exporter CcmA, the ATP-binding component of the bacterial CcmAB transporter Back     alignment and domain information
>PRK14235 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03249 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) is a mitochondrial ATP-binding cassette protein involved in iron homeostasis and one of four ABC transporters expressed in the mitochondrial inner membrane, the other three being MDL1(ABC7), MDL2, and ATM1 Back     alignment and domain information
>TIGR03410 urea_trans_UrtE urea ABC transporter, ATP-binding protein UrtE Back     alignment and domain information
>COG1127 Ttg2A ABC-type transport system involved in resistance to organic solvents, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>cd03246 ABCC_Protease_Secretion This family represents the ABC component of the protease secretion system PrtD, a 60-kDa integral membrane protein sharing 37% identity with HlyB, the ABC component of the alpha-hemolysin secretion pathway, in the C-terminal domain Back     alignment and domain information
>PRK13538 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>PRK11300 livG leucine/isoleucine/valine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR00968 3a0106s01 sulfate ABC transporter, ATP-binding protein Back     alignment and domain information
>cd03260 ABC_PstB_phosphate_transporter Phosphate uptake is of fundamental importance in the cell physiology of bacteria because phosphate is required as a nutrient Back     alignment and domain information
>PRK10895 lipopolysaccharide ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03264 ABC_drug_resistance_like ABC-type multidrug transport system, ATPase component Back     alignment and domain information
>PRK10253 iron-enterobactin transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03219 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC transporter subfamily is involved in the transport of the hydrophobic amino acids leucine, isoleucine and valine Back     alignment and domain information
>PRK14250 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03247 ABCC_cytochrome_bd The CYD subfamily implicated in cytochrome bd biogenesis Back     alignment and domain information
>TIGR03873 F420-0_ABC_ATP proposed F420-0 ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK14259 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03234 ABCG_White The White subfamily represents ABC transporters homologous to the Drosophila white gene, which acts as a dimeric importer for eye pigment precursors Back     alignment and domain information
>PRK13540 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>cd03262 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP-binding components of the bacterial periplasmic histidine and glutamine permeases, repectively Back     alignment and domain information
>cd03300 ABC_PotA_N PotA is an ABC-type transporter and the ATPase component of the spermidine/putrescine-preferential uptake system consisting of PotA, -B, -C, and -D Back     alignment and domain information
>PRK13646 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14247 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03298 ABC_ThiQ_thiamine_transporter ABC-type thiamine tranport system; part of the binding-protein-dependent transport system tbpA-thiPQ for thiamine and TPP Back     alignment and domain information
>PRK11308 dppF dipeptide transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13636 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR03740 galliderm_ABC gallidermin-class lantibiotic protection ABC transporter, ATP-binding subunit Back     alignment and domain information
>TIGR03265 PhnT2 putative 2-aminoethylphosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK11247 ssuB aliphatic sulfonates transport ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR01188 drrA daunorubicin resistance ABC transporter ATP-binding subunit Back     alignment and domain information
>PRK11614 livF leucine/isoleucine/valine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11153 metN DL-methionine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13632 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK10851 sulfate/thiosulfate transporter subunit; Provisional Back     alignment and domain information
>TIGR03864 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system Back     alignment and domain information
>COG4559 ABC-type hemin transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd03269 ABC_putative_ATPase This subfamily is involved in drug resistance, nodulation, lipid transport, and bacteriocin and lantibiotic immunity Back     alignment and domain information
>PRK14237 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK09544 znuC high-affinity zinc transporter ATPase; Reviewed Back     alignment and domain information
>PRK15112 antimicrobial peptide ABC system ATP-binding protein SapF; Provisional Back     alignment and domain information
>PRK14251 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03258 ABC_MetN_methionine_transporter MetN (also known as YusC) is an ABC-type transporter encoded by metN of the metNPQ operon in Bacillus subtilis that is involved in methionine transport Back     alignment and domain information
>PRK13543 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>PRK13643 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11248 tauB taurine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03291 ABCC_CFTR1 The CFTR subfamily domain 1 Back     alignment and domain information
>PRK13539 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>TIGR01978 sufC FeS assembly ATPase SufC Back     alignment and domain information
>cd03218 ABC_YhbG The ABC transporters belonging to the YhbG family are similar to members of the Mj1267_LivG family, which is involved in the transport of branched-chain amino acids Back     alignment and domain information
>TIGR01166 cbiO cobalt transport protein ATP-binding subunit Back     alignment and domain information
>PRK15056 manganese/iron transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14248 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03295 ABC_OpuCA_Osmoprotection OpuCA is a the ATP binding component of a bacterial solute transporter that serves a protective role to cells growing in a hyperosmolar environment Back     alignment and domain information
>PRK14269 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03224 ABC_TM1139_LivF_branched LivF (TM1139) is part of the LIV-I bacterial ABC-type two-component transport system that imports neutral, branched-chain amino acids Back     alignment and domain information
>cd03299 ABC_ModC_like Archeal protein closely related to ModC Back     alignment and domain information
>PRK14267 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11000 maltose/maltodextrin transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10584 putative ABC transporter ATP-binding protein YbbA; Provisional Back     alignment and domain information
>cd03257 ABC_NikE_OppD_transporters The ABC transporter subfamily specific for the transport of dipeptides, oligopeptides (OppD), and nickel (NikDE) Back     alignment and domain information
>cd03247 ABCC_cytochrome_bd The CYD subfamily implicated in cytochrome bd biogenesis Back     alignment and domain information
>cd03246 ABCC_Protease_Secretion This family represents the ABC component of the protease secretion system PrtD, a 60-kDa integral membrane protein sharing 37% identity with HlyB, the ABC component of the alpha-hemolysin secretion pathway, in the C-terminal domain Back     alignment and domain information
>PRK09452 potA putrescine/spermidine ABC transporter ATPase protein; Reviewed Back     alignment and domain information
>PRK14240 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13547 hmuV hemin importer ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR03258 PhnT 2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT Back     alignment and domain information
>TIGR03005 ectoine_ehuA ectoine/hydroxyectoine ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK13634 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14256 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK09984 phosphonate/organophosphate ester transporter subunit; Provisional Back     alignment and domain information
>PRK13644 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14239 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14245 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14274 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14254 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03265 ABC_DrrA DrrA is the ATP-binding protein component of a bacterial exporter complex that confers resistance to the antibiotics daunorubicin and doxorubicin Back     alignment and domain information
>PRK14270 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13635 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13651 cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK09536 btuD corrinoid ABC transporter ATPase; Reviewed Back     alignment and domain information
>TIGR00972 3a0107s01c2 phosphate ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK10744 pstB phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11022 dppD dipeptide transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03230 ABC_DR_subfamily_A This family of ATP-binding proteins belongs to a multisubunit transporter involved in drug resistance (BcrA and DrrA), nodulation, lipid transport, and lantibiotic immunity Back     alignment and domain information
>PRK11607 potG putrescine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11144 modC molybdate transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR03415 ABC_choXWV_ATP choline ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK14241 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14244 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR02324 CP_lyasePhnL phosphonate C-P lyase system protein PhnL Back     alignment and domain information
>TIGR03411 urea_trans_UrtD urea ABC transporter, ATP-binding protein UrtD Back     alignment and domain information
>KOG0066 consensus eIF2-interacting protein ABC50 (ABC superfamily) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR02982 heterocyst_DevA ABC exporter ATP-binding subunit, DevA family Back     alignment and domain information
>TIGR01189 ccmA heme ABC exporter, ATP-binding protein CcmA Back     alignment and domain information
>PRK14249 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13652 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14273 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14238 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10619 histidine/lysine/arginine/ornithine transporter subunit; Provisional Back     alignment and domain information
>PRK11701 phnK phosphonate C-P lyase system protein PhnK; Provisional Back     alignment and domain information
>PRK10247 putative ABC transporter ATP-binding protein YbbL; Provisional Back     alignment and domain information
>PRK11264 putative amino-acid ABC transporter ATP-binding protein YecC; Provisional Back     alignment and domain information
>cd03297 ABC_ModC_molybdenum_transporter ModC is an ABC-type transporter and the ATPase component of a molybdate transport system that also includes the periplasmic binding protein ModA and the membrane protein ModB Back     alignment and domain information
>TIGR01277 thiQ thiamine ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK13649 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13645 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11124 artP arginine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13537 nodulation ABC transporter NodI; Provisional Back     alignment and domain information
>TIGR00968 3a0106s01 sulfate ABC transporter, ATP-binding protein Back     alignment and domain information
>cd03231 ABC_CcmA_heme_exporter CcmA, the ATP-binding component of the bacterial CcmAB transporter Back     alignment and domain information
>PRK14253 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR03608 L_ocin_972_ABC putative bacteriocin export ABC transporter, lactococcin 972 group Back     alignment and domain information
>PRK14275 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03228 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-like transporters are involved in drug, peptide, and lipid export Back     alignment and domain information
>TIGR02142 modC_ABC molybdenum ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK14242 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03229 ABC_Class3 This class is comprised of all BPD (Binding Protein Dependent) systems that are largely represented in archaea and eubacteria and are primarily involved in scavenging solutes from the environment Back     alignment and domain information
>PRK09493 glnQ glutamine ABC transporter ATP-binding protein; Reviewed Back     alignment and domain information
>PRK14236 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13633 cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14262 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG1123 ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] Back     alignment and domain information
>PRK14255 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10575 iron-hydroxamate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR01288 nodI ATP-binding ABC transporter family nodulation protein NodI Back     alignment and domain information
>cd03294 ABC_Pro_Gly_Bertaine This family comprises the glycine betaine/L-proline ATP binding subunit in bacteria and its equivalents in archaea Back     alignment and domain information
>TIGR03410 urea_trans_UrtE urea ABC transporter, ATP-binding protein UrtE Back     alignment and domain information
>PRK14235 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03230 ABC_DR_subfamily_A This family of ATP-binding proteins belongs to a multisubunit transporter involved in drug resistance (BcrA and DrrA), nodulation, lipid transport, and lantibiotic immunity Back     alignment and domain information
>cd03300 ABC_PotA_N PotA is an ABC-type transporter and the ATPase component of the spermidine/putrescine-preferential uptake system consisting of PotA, -B, -C, and -D Back     alignment and domain information
>PRK10419 nikE nickel transporter ATP-binding protein NikE; Provisional Back     alignment and domain information
>PRK14260 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13642 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14243 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG0410 LivF ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR01186 proV glycine betaine/L-proline transport ATP binding subunit Back     alignment and domain information
>PRK14265 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13641 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK10771 thiQ thiamine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG1137 YhbG ABC-type (unclassified) transport system, ATPase component [General function prediction only] Back     alignment and domain information
>PRK14261 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14271 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK15093 antimicrobial peptide ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11300 livG leucine/isoleucine/valine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG4175 ProV ABC-type proline/glycine betaine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>PRK11831 putative ABC transporter ATP-binding protein YrbF; Provisional Back     alignment and domain information
>PRK10895 lipopolysaccharide ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13541 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>cd03291 ABCC_CFTR1 The CFTR subfamily domain 1 Back     alignment and domain information
>cd03229 ABC_Class3 This class is comprised of all BPD (Binding Protein Dependent) systems that are largely represented in archaea and eubacteria and are primarily involved in scavenging solutes from the environment Back     alignment and domain information
>PRK11231 fecE iron-dicitrate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03267 ABC_NatA_like Similar in sequence to NatA, this is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled to proton or K+ uptake Back     alignment and domain information
>PRK11614 livF leucine/isoleucine/valine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14247 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14259 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14252 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13638 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13639 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03234 ABCG_White The White subfamily represents ABC transporters homologous to the Drosophila white gene, which acts as a dimeric importer for eye pigment precursors Back     alignment and domain information
>PRK15079 oligopeptide ABC transporter ATP-binding protein OppF; Provisional Back     alignment and domain information
>TIGR01184 ntrCD nitrate transport ATP-binding subunits C and D Back     alignment and domain information
>PRK10418 nikD nickel transporter ATP-binding protein NikD; Provisional Back     alignment and domain information
>PRK13640 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13538 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>PRK14268 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14258 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR02769 nickel_nikE nickel import ATP-binding protein NikE Back     alignment and domain information
>PRK14263 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13648 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03232 ABC_PDR_domain2 The pleiotropic drug resistance-like (PDR) family of ATP-binding cassette (ABC) transporters Back     alignment and domain information
>PRK09473 oppD oligopeptide transporter ATP-binding component; Provisional Back     alignment and domain information
>TIGR03873 F420-0_ABC_ATP proposed F420-0 ABC transporter, ATP-binding protein Back     alignment and domain information
>TIGR02323 CP_lyasePhnK phosphonate C-P lyase system protein PhnK Back     alignment and domain information
>PRK14246 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13548 hmuV hemin importer ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14256 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03213 ABCG_EPDR ABCG transporters are involved in eye pigment (EP) precursor transport, regulation of lipid-trafficking mechanisms, and pleiotropic drug resistance (DR) Back     alignment and domain information
>COG4619 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>TIGR01978 sufC FeS assembly ATPase SufC Back     alignment and domain information
>PRK14267 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14237 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14251 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14272 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03215 ABC_Carb_Monos_II This family represents domain II of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information
>PRK14244 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13540 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>PRK10253 iron-enterobactin transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14240 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG4181 Predicted ABC-type transport system involved in lysophospholipase L1 biosynthesis, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>cd03233 ABC_PDR_domain1 The pleiotropic drug resistance (PDR) family of ATP-binding cassette (ABC) transporters Back     alignment and domain information
>PRK14245 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14266 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10070 glycine betaine transporter ATP-binding subunit; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1338
3qf4_B598 Crystal Structure Of A Heterodimeric Abc Transporte 4e-14
3qf4_B598 Crystal Structure Of A Heterodimeric Abc Transporte 4e-07
4f4c_A1321 The Crystal Structure Of The Multi-Drug Transporter 2e-13
4f4c_A1321 The Crystal Structure Of The Multi-Drug Transporter 7e-06
3g5u_A1284 Structure Of P-Glycoprotein Reveals A Molecular Bas 3e-13
3g5u_A 1284 Structure Of P-Glycoprotein Reveals A Molecular Bas 3e-05
3g60_A1284 Structure Of P-Glycoprotein Reveals A Molecular Bas 3e-13
3g60_A 1284 Structure Of P-Glycoprotein Reveals A Molecular Bas 3e-05
1mv5_A243 Crystal Structure Of Lmra Atp-Binding Domain Length 3e-12
1mv5_A243 Crystal Structure Of Lmra Atp-Binding Domain Length 9e-09
3nh6_A306 Nucleotide Binding Domain Of Human Abcb6 (Apo Struc 1e-11
3nh6_A306 Nucleotide Binding Domain Of Human Abcb6 (Apo Struc 3e-07
1r0z_A286 Phosphorylated Cystic Fibrosis Transmembrane Conduc 2e-10
1z47_A355 Structure Of The Atpase Subunit Cysa Of The Putativ 3e-10
1z47_A 355 Structure Of The Atpase Subunit Cysa Of The Putativ 1e-05
1q3h_A286 Mouse Cftr Nbd1 With Amp.Pnp Length = 286 3e-10
1xf9_A283 Structure Of Nbd1 From Murine Cftr- F508s Mutant Le 1e-09
1xfa_A283 Structure Of Nbd1 From Murine Cftr- F508r Mutant Le 1e-09
1oxs_C353 Crystal Structure Of Glcv, The Abc-Atpase Of The Gl 1e-09
2yz2_A266 Crystal Structure Of The Abc Transporter In The Cob 1e-09
2hyd_A578 Multidrug Abc Transporter Sav1866 Length = 578 1e-09
2hyd_A578 Multidrug Abc Transporter Sav1866 Length = 578 2e-05
4hlu_A268 Structure Of The Ecfa-a' Heterodimer Bound To Adp L 2e-09
1jj7_A260 Crystal Structure Of The C-Terminal Atpase Domain O 2e-09
1jj7_A260 Crystal Structure Of The C-Terminal Atpase Domain O 2e-06
3d31_A348 Modbc From Methanosarcina Acetivorans Length = 348 5e-09
3c41_J242 Abc Protein Artp In Complex With Amp-PnpMG2+ Length 5e-09
2olj_A263 Abc Protein Artp In Complex With AdpMG2+ Length = 2 6e-09
1oxx_K353 Crystal Structure Of Glcv, The Abc-Atpase Of The Gl 6e-09
2ixf_A271 Crystal Structure Of The Atpase Domain Of Tap1 With 7e-09
2ixf_A271 Crystal Structure Of The Atpase Domain Of Tap1 With 9e-07
2ixg_A271 Crystal Structure Of The Atpase Domain Of Tap1 With 7e-09
2ixg_A271 Crystal Structure Of The Atpase Domain Of Tap1 With 1e-06
3qf4_A587 Crystal Structure Of A Heterodimeric Abc Transporte 1e-08
2ixe_A271 Crystal Structure Of The Atpase Domain Of Tap1 With 1e-08
2ixe_A271 Crystal Structure Of The Atpase Domain Of Tap1 With 2e-06
3si7_A285 The Crystal Structure Of The Nbd1 Domain Of The Mou 1e-08
2d62_A375 Crystal Structure Of Multiple Sugar Binding Transpo 2e-08
2d62_A 375 Crystal Structure Of Multiple Sugar Binding Transpo 1e-04
2ghi_A260 Crystal Structure Of Plasmodium Yoelii Multidrug Re 3e-08
2ghi_A260 Crystal Structure Of Plasmodium Yoelii Multidrug Re 9e-04
3b5y_A582 Crystal Structure Of Msba From Salmonella Typhimuri 3e-08
3b5y_A582 Crystal Structure Of Msba From Salmonella Typhimuri 4e-04
1g29_1372 Malk Length = 372 4e-08
1g29_1 372 Malk Length = 372 3e-04
1l2t_A235 Dimeric Structure Of Mj0796, A Bacterial Abc Transp 4e-08
3tif_A235 Dimeric Structure Of A Post-Hydrolysis State Of The 4e-08
2it1_A362 Structure Of Ph0203 Protein From Pyrococcus Horikos 6e-08
2it1_A 362 Structure Of Ph0203 Protein From Pyrococcus Horikos 5e-06
4ayt_A595 Structure Of The Human Mitochondrial Abc Transporte 6e-08
4ayt_A595 Structure Of The Human Mitochondrial Abc Transporte 2e-04
3b5w_A582 Crystal Structure Of Eschericia Coli Msba Length = 2e-07
3b5w_A582 Crystal Structure Of Eschericia Coli Msba Length = 9e-05
1f3o_A235 Crystal Structure Of Mj0796 Atp-Binding Cassette Le 2e-07
4ayw_A619 Structure Of The Human Mitochondrial Abc Transporte 3e-07
4ayw_A619 Structure Of The Human Mitochondrial Abc Transporte 1e-04
2yyz_A359 Crystal Structure Of Sugar Abc Transporter, Atp-Bin 6e-07
3b5x_A582 Crystal Structure Of Msba From Vibrio Cholerae Leng 6e-07
1q12_A 381 Crystal Structure Of The Atp-bound E. Coli Malk Len 6e-07
1q1b_A 381 Crystal Structure Of E. Coli Malk In The Nucleotide 7e-07
4hlu_D268 Structure Of The Ecfa-a' Heterodimer Bound To Adp L 7e-07
2r6g_A 381 The Crystal Structure Of The E. Coli Maltose Transp 2e-06
2pcj_A224 Crystal Structure Of Abc Transporter (Aq_297) From 4e-06
3gd7_A390 Crystal Structure Of Human Nbd2 Complexed With N6- 5e-06
1xmi_A291 Crystal Structure Of Human F508a Nbd1 Domain With A 8e-06
2cbz_A237 Structure Of The Human Multidrug Resistance Protein 1e-05
2pmk_A243 Crystal Structures Of An Isolated Abc-Atpase In Com 2e-05
1mt0_A241 Atp-Binding Domain Of Haemolysin B From Escherichia 2e-05
2ff7_A247 The Abc-Atpase Of The Abc-Transporter Hlyb In The A 2e-05
3b5j_A243 Crystal Structures Of The S504a Mutant Of An Isolat 3e-05
2bbo_A291 Human Nbd1 With Phe508 Length = 291 3e-05
2ffb_A247 The Crystal Structure Of The Hlyb-Nbd E631q Mutant 4e-05
2bbs_A290 Human Deltaf508 Nbd1 With Three Solubilizing Mutati 5e-05
2pze_A229 Minimal Human Cftr First Nucleotide Binding Domain 1e-04
1v43_A372 Crystal Structure Of Atpase Subunit Of Abc Sugar Tr 1e-04
1vci_A373 Crystal Structure Of The Atp-binding Cassette Of Mu 1e-04
2bbt_A290 Human Deltaf508 Nbd1 With Two Solublizing Mutations 1e-04
2pzg_A241 Minimal Human Cftr First Nucleotide Binding Domain 1e-04
1xef_A241 Crystal Structure Of The AtpMG2+ BOUND COMPOSITE DI 2e-04
2ffa_A247 Crystal Structure Of Abc-Atpase H662a Of The Abc-Tr 2e-04
1yqt_A538 Rnase-L Inhibitor Length = 538 3e-04
4g1u_C266 X-Ray Structure Of The Bacterial Heme Transporter H 3e-04
1g6h_A257 Crystal Structure Of The Adp Conformation Of Mj1267 7e-04
>pdb|3QF4|B Chain B, Crystal Structure Of A Heterodimeric Abc Transporter In Its Inward- Facing Conformation Length = 598 Back     alignment and structure 
Iteration: 1

 Score = 77.8 bits (190), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 72/258 (27%), Positives = 117/258 (45%), Gaps = 35/258 (13%)
Query: 410 ADRIHELMVISRELSIEDKSPQRNGSRNYFSEANYIEFSGVKVVTPTGNVLVENLTLKVE 469
           A+RI E++    +L  E   P     R    E   IEF  V         +++++T  ++
Sbjct: 327 AERIFEIL----DLEEEKDDPDAVELREVRGE---IEFKNVWFSYDKKKPVLKDITFHIK 379
Query: 470 PGSNLLITGPNGSGKSSLFRVLGGLWPLVSGHIAKPGVG------SDLNKEIFYVPQRPY 523
           PG  + + GP GSGK+++  +L   + +  G I   G+       S L   I  V Q   
Sbjct: 380 PGQKVALVGPTGSGKTTIVNLLMRFYDVDRGQILVDGIDIRKIKRSSLRSSIGIVLQDTI 439
Query: 524 TAVGTLRDQLIY--PLTSDQEVE---PLTHGGMVELLKNVDLEYLLDRYPPEKEI---NW 575
               T+++ L Y  P  +D+E++    LTH            ++ +   P   E    + 
Sbjct: 440 LFSTTVKENLKYGNPGATDEEIKEAAKLTHS-----------DHFIKHLPEGYETVLTDN 488
Query: 576 GDELSLGEQQRLGMARLFYHKPKFAILDECTSAVTTDMEERFCAKVRAM--GTSCITISH 633
           G++LS G++Q L + R F   PK  ILDE TS V T  E+   A +  +  G + I I+H
Sbjct: 489 GEDLSQGQRQLLAITRAFLANPKILILDEATSNVDTKTEKSIQAAMWKLMEGKTSIIIAH 548
Query: 634 RPALVAFHDVVLSL-DGE 650
           R   +   D+++ L DGE
Sbjct: 549 RLNTIKNADLIIVLRDGE 566
>pdb|3QF4|B Chain B, Crystal Structure Of A Heterodimeric Abc Transporter In Its Inward- Facing Conformation Length = 598 Back     alignment and structure
>pdb|4F4C|A Chain A, The Crystal Structure Of The Multi-Drug Transporter Length = 1321 Back     alignment and structure
>pdb|4F4C|A Chain A, The Crystal Structure Of The Multi-Drug Transporter Length = 1321 Back     alignment and structure
>pdb|3G5U|A Chain A, Structure Of P-Glycoprotein Reveals A Molecular Basis For Poly-Specific Drug Binding Length = 1284 Back     alignment and structure
>pdb|3G5U|A Chain A, Structure Of P-Glycoprotein Reveals A Molecular Basis For Poly-Specific Drug Binding Length = 1284 Back     alignment and structure
>pdb|3G60|A Chain A, Structure Of P-Glycoprotein Reveals A Molecular Basis For Poly-Specific Drug Binding Length = 1284 Back     alignment and structure
>pdb|3G60|A Chain A, Structure Of P-Glycoprotein Reveals A Molecular Basis For Poly-Specific Drug Binding Length = 1284 Back     alignment and structure
>pdb|1MV5|A Chain A, Crystal Structure Of Lmra Atp-Binding Domain Length = 243 Back     alignment and structure
>pdb|1MV5|A Chain A, Crystal Structure Of Lmra Atp-Binding Domain Length = 243 Back     alignment and structure
>pdb|3NH6|A Chain A, Nucleotide Binding Domain Of Human Abcb6 (Apo Structure) Length = 306 Back     alignment and structure
>pdb|3NH6|A Chain A, Nucleotide Binding Domain Of Human Abcb6 (Apo Structure) Length = 306 Back     alignment and structure
>pdb|1R0Z|A Chain A, Phosphorylated Cystic Fibrosis Transmembrane Conductance Regulator (Cftr) Nucleotide-Binding Domain One (Nbd1) With Atp Length = 286 Back     alignment and structure
>pdb|1Z47|A Chain A, Structure Of The Atpase Subunit Cysa Of The Putative Sulfate Atp-Binding Cassette (Abc) Transporter From Alicyclobacillus Acidocaldarius Length = 355 Back     alignment and structure
>pdb|1Z47|A Chain A, Structure Of The Atpase Subunit Cysa Of The Putative Sulfate Atp-Binding Cassette (Abc) Transporter From Alicyclobacillus Acidocaldarius Length = 355 Back     alignment and structure
>pdb|1Q3H|A Chain A, Mouse Cftr Nbd1 With Amp.Pnp Length = 286 Back     alignment and structure
>pdb|1XF9|A Chain A, Structure Of Nbd1 From Murine Cftr- F508s Mutant Length = 283 Back     alignment and structure
>pdb|1XFA|A Chain A, Structure Of Nbd1 From Murine Cftr- F508r Mutant Length = 283 Back     alignment and structure
>pdb|1OXS|C Chain C, Crystal Structure Of Glcv, The Abc-Atpase Of The Glucose Abc Transporter From Sulfolobus Solfataricus Length = 353 Back     alignment and structure
>pdb|2YZ2|A Chain A, Crystal Structure Of The Abc Transporter In The Cobalt Transport System Length = 266 Back     alignment and structure
>pdb|2HYD|A Chain A, Multidrug Abc Transporter Sav1866 Length = 578 Back     alignment and structure
>pdb|2HYD|A Chain A, Multidrug Abc Transporter Sav1866 Length = 578 Back     alignment and structure
>pdb|4HLU|A Chain A, Structure Of The Ecfa-a' Heterodimer Bound To Adp Length = 268 Back     alignment and structure
>pdb|1JJ7|A Chain A, Crystal Structure Of The C-Terminal Atpase Domain Of Human Tap1 Length = 260 Back     alignment and structure
>pdb|1JJ7|A Chain A, Crystal Structure Of The C-Terminal Atpase Domain Of Human Tap1 Length = 260 Back     alignment and structure
>pdb|3D31|A Chain A, Modbc From Methanosarcina Acetivorans Length = 348 Back     alignment and structure
>pdb|3C41|J Chain J, Abc Protein Artp In Complex With Amp-PnpMG2+ Length = 242 Back     alignment and structure
>pdb|2OLJ|A Chain A, Abc Protein Artp In Complex With AdpMG2+ Length = 263 Back     alignment and structure
>pdb|1OXX|K Chain K, Crystal Structure Of Glcv, The Abc-Atpase Of The Glucose Abc Transporter From Sulfolobus Solfataricus Length = 353 Back     alignment and structure
>pdb|2IXF|A Chain A, Crystal Structure Of The Atpase Domain Of Tap1 With Atp (D645q, Q678h Mutant) Length = 271 Back     alignment and structure
>pdb|2IXF|A Chain A, Crystal Structure Of The Atpase Domain Of Tap1 With Atp (D645q, Q678h Mutant) Length = 271 Back     alignment and structure
>pdb|2IXG|A Chain A, Crystal Structure Of The Atpase Domain Of Tap1 With Atp (S621a, G622v, D645n Mutant) Length = 271 Back     alignment and structure
>pdb|2IXG|A Chain A, Crystal Structure Of The Atpase Domain Of Tap1 With Atp (S621a, G622v, D645n Mutant) Length = 271 Back     alignment and structure
>pdb|3QF4|A Chain A, Crystal Structure Of A Heterodimeric Abc Transporter In Its Inward- Facing Conformation Length = 587 Back     alignment and structure
>pdb|2IXE|A Chain A, Crystal Structure Of The Atpase Domain Of Tap1 With Atp (d645n Mutant) Length = 271 Back     alignment and structure
>pdb|2IXE|A Chain A, Crystal Structure Of The Atpase Domain Of Tap1 With Atp (d645n Mutant) Length = 271 Back     alignment and structure
>pdb|3SI7|A Chain A, The Crystal Structure Of The Nbd1 Domain Of The Mouse Cftr Protein, Deltaf508 Mutant Length = 285 Back     alignment and structure
>pdb|2D62|A Chain A, Crystal Structure Of Multiple Sugar Binding Transport Atp- Binding Protein Length = 375 Back     alignment and structure
>pdb|2D62|A Chain A, Crystal Structure Of Multiple Sugar Binding Transport Atp- Binding Protein Length = 375 Back     alignment and structure
>pdb|2GHI|A Chain A, Crystal Structure Of Plasmodium Yoelii Multidrug Resistance Protein 2 Length = 260 Back     alignment and structure
>pdb|2GHI|A Chain A, Crystal Structure Of Plasmodium Yoelii Multidrug Resistance Protein 2 Length = 260 Back     alignment and structure
>pdb|3B5Y|A Chain A, Crystal Structure Of Msba From Salmonella Typhimurium With Amppnp Length = 582 Back     alignment and structure
>pdb|3B5Y|A Chain A, Crystal Structure Of Msba From Salmonella Typhimurium With Amppnp Length = 582 Back     alignment and structure
>pdb|1G29|1 Chain 1, Malk Length = 372 Back     alignment and structure
>pdb|1G29|1 Chain 1, Malk Length = 372 Back     alignment and structure
>pdb|1L2T|A Chain A, Dimeric Structure Of Mj0796, A Bacterial Abc Transporter Cassette Length = 235 Back     alignment and structure
>pdb|3TIF|A Chain A, Dimeric Structure Of A Post-Hydrolysis State Of The Atp-Binding Cassette Mj0796 Bound To Adp And Pi Length = 235 Back     alignment and structure
>pdb|2IT1|A Chain A, Structure Of Ph0203 Protein From Pyrococcus Horikoshii Length = 362 Back     alignment and structure
>pdb|2IT1|A Chain A, Structure Of Ph0203 Protein From Pyrococcus Horikoshii Length = 362 Back     alignment and structure
>pdb|4AYT|A Chain A, Structure Of The Human Mitochondrial Abc Transporter, Abcb10 Length = 595 Back     alignment and structure
>pdb|4AYT|A Chain A, Structure Of The Human Mitochondrial Abc Transporter, Abcb10 Length = 595 Back     alignment and structure
>pdb|3B5W|A Chain A, Crystal Structure Of Eschericia Coli Msba Length = 582 Back     alignment and structure
>pdb|3B5W|A Chain A, Crystal Structure Of Eschericia Coli Msba Length = 582 Back     alignment and structure
>pdb|1F3O|A Chain A, Crystal Structure Of Mj0796 Atp-Binding Cassette Length = 235 Back     alignment and structure
>pdb|4AYW|A Chain A, Structure Of The Human Mitochondrial Abc Transporter, Abcb10 (plate Form) Length = 619 Back     alignment and structure
>pdb|4AYW|A Chain A, Structure Of The Human Mitochondrial Abc Transporter, Abcb10 (plate Form) Length = 619 Back     alignment and structure
>pdb|2YYZ|A Chain A, Crystal Structure Of Sugar Abc Transporter, Atp-Binding Protein Length = 359 Back     alignment and structure
>pdb|3B5X|A Chain A, Crystal Structure Of Msba From Vibrio Cholerae Length = 582 Back     alignment and structure
>pdb|1Q12|A Chain A, Crystal Structure Of The Atp-bound E. Coli Malk Length = 381 Back     alignment and structure
>pdb|1Q1B|A Chain A, Crystal Structure Of E. Coli Malk In The Nucleotide-Free Form Length = 381 Back     alignment and structure
>pdb|4HLU|D Chain D, Structure Of The Ecfa-a' Heterodimer Bound To Adp Length = 268 Back     alignment and structure
>pdb|2R6G|A Chain A, The Crystal Structure Of The E. Coli Maltose Transporter Length = 381 Back     alignment and structure
>pdb|2PCJ|A Chain A, Crystal Structure Of Abc Transporter (Aq_297) From Aquifex Aeolicus Vf5 Length = 224 Back     alignment and structure
>pdb|3GD7|A Chain A, Crystal Structure Of Human Nbd2 Complexed With N6- Phenylethyl-Atp (P-Atp) Length = 390 Back     alignment and structure
>pdb|1XMI|A Chain A, Crystal Structure Of Human F508a Nbd1 Domain With Atp Length = 291 Back     alignment and structure
>pdb|2CBZ|A Chain A, Structure Of The Human Multidrug Resistance Protein 1 Nucleotide Binding Domain 1 Length = 237 Back     alignment and structure
>pdb|2PMK|A Chain A, Crystal Structures Of An Isolated Abc-Atpase In Complex With Tnp-Adp Length = 243 Back     alignment and structure
>pdb|1MT0|A Chain A, Atp-Binding Domain Of Haemolysin B From Escherichia Coli Length = 241 Back     alignment and structure
>pdb|2FF7|A Chain A, The Abc-Atpase Of The Abc-Transporter Hlyb In The Adp Bound State Length = 247 Back     alignment and structure
>pdb|3B5J|A Chain A, Crystal Structures Of The S504a Mutant Of An Isolated Abc-atpase In Complex With Tnp-adp Length = 243 Back     alignment and structure
>pdb|2BBO|A Chain A, Human Nbd1 With Phe508 Length = 291 Back     alignment and structure
>pdb|2FFB|A Chain A, The Crystal Structure Of The Hlyb-Nbd E631q Mutant In Complex With Adp Length = 247 Back     alignment and structure
>pdb|2BBS|A Chain A, Human Deltaf508 Nbd1 With Three Solubilizing Mutations Length = 290 Back     alignment and structure
>pdb|2PZE|A Chain A, Minimal Human Cftr First Nucleotide Binding Domain As A Head-To-Tail Dimer Length = 229 Back     alignment and structure
>pdb|1V43|A Chain A, Crystal Structure Of Atpase Subunit Of Abc Sugar Transporter Length = 372 Back     alignment and structure
>pdb|1VCI|A Chain A, Crystal Structure Of The Atp-binding Cassette Of Multisugar Transporter From Pyrococcus Horikoshii Ot3 Complexed With Atp Length = 373 Back     alignment and structure
>pdb|2BBT|A Chain A, Human Deltaf508 Nbd1 With Two Solublizing Mutations. Length = 290 Back     alignment and structure
>pdb|2PZG|A Chain A, Minimal Human Cftr First Nucleotide Binding Domain As A Monomer Length = 241 Back     alignment and structure
>pdb|1XEF|A Chain A, Crystal Structure Of The AtpMG2+ BOUND COMPOSITE DIMER OF HLYB-Nbd Length = 241 Back     alignment and structure
>pdb|2FFA|A Chain A, Crystal Structure Of Abc-Atpase H662a Of The Abc-Transporter Hlyb In Complex With Adp Length = 247 Back     alignment and structure
>pdb|1YQT|A Chain A, Rnase-L Inhibitor Length = 538 Back     alignment and structure
>pdb|4G1U|C Chain C, X-Ray Structure Of The Bacterial Heme Transporter Hmuuv From Yersinia Pestis Length = 266 Back     alignment and structure
>pdb|1G6H|A Chain A, Crystal Structure Of The Adp Conformation Of Mj1267, An Atp- Binding Cassette Of An Abc Transporter Length = 257 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1338
3g5u_A1284 MCG1178, multidrug resistance protein 1A; P-glycop 6e-24
3g5u_A1284 MCG1178, multidrug resistance protein 1A; P-glycop 5e-13
3g5u_A 1284 MCG1178, multidrug resistance protein 1A; P-glycop 1e-04
3ozx_A538 RNAse L inhibitor; ATP binding cassette protein, h 4e-19
3ozx_A538 RNAse L inhibitor; ATP binding cassette protein, h 3e-13
3ozx_A538 RNAse L inhibitor; ATP binding cassette protein, h 2e-10
3ozx_A 538 RNAse L inhibitor; ATP binding cassette protein, h 6e-08
3j16_B608 RLI1P; ribosome recycling, translation, eukarya, r 1e-18
3j16_B608 RLI1P; ribosome recycling, translation, eukarya, r 7e-15
3j16_B608 RLI1P; ribosome recycling, translation, eukarya, r 7e-09
3j16_B 608 RLI1P; ribosome recycling, translation, eukarya, r 2e-05
2pjz_A263 Hypothetical protein ST1066; ATP binding protein, 4e-18
2pjz_A263 Hypothetical protein ST1066; ATP binding protein, 2e-09
2ihy_A279 ABC transporter, ATP-binding protein; ATPase, ABC 1e-17
2ihy_A279 ABC transporter, ATP-binding protein; ATPase, ABC 7e-08
1yqt_A538 RNAse L inhibitor; ATP-binding cassette, ribosome 2e-17
1yqt_A538 RNAse L inhibitor; ATP-binding cassette, ribosome 3e-15
1yqt_A 538 RNAse L inhibitor; ATP-binding cassette, ribosome 6e-08
1yqt_A538 RNAse L inhibitor; ATP-binding cassette, ribosome 2e-07
3bk7_A607 ABC transporter ATP-binding protein; ABC ATPase, i 2e-17
3bk7_A607 ABC transporter ATP-binding protein; ABC ATPase, i 1e-15
3bk7_A 607 ABC transporter ATP-binding protein; ABC ATPase, i 2e-08
3bk7_A607 ABC transporter ATP-binding protein; ABC ATPase, i 3e-08
2nq2_C253 Hypothetical ABC transporter ATP-binding protein H 2e-17
2nq2_C253 Hypothetical ABC transporter ATP-binding protein H 3e-09
1sgw_A214 Putative ABC transporter; structural genomics, P p 8e-15
1sgw_A214 Putative ABC transporter; structural genomics, P p 7e-10
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-14
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-13
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-07
1vt4_I1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-05
3gd7_A390 Fusion complex of cystic fibrosis transmembrane co 3e-14
3gd7_A 390 Fusion complex of cystic fibrosis transmembrane co 4e-06
3nh6_A306 ATP-binding cassette SUB-family B member 6, mitoc; 3e-14
3nh6_A306 ATP-binding cassette SUB-family B member 6, mitoc; 7e-09
2qi9_C249 Vitamin B12 import ATP-binding protein BTUD; inner 4e-14
2qi9_C249 Vitamin B12 import ATP-binding protein BTUD; inner 2e-06
3b5x_A582 Lipid A export ATP-binding/permease protein MSBA; 4e-13
3b5x_A582 Lipid A export ATP-binding/permease protein MSBA; 3e-06
3b60_A582 Lipid A export ATP-binding/permease protein MSBA; 6e-13
3b60_A582 Lipid A export ATP-binding/permease protein MSBA; 4e-07
1mv5_A243 LMRA, multidrug resistance ABC transporter ATP-bin 7e-13
1mv5_A243 LMRA, multidrug resistance ABC transporter ATP-bin 6e-06
3qf4_A587 ABC transporter, ATP-binding protein; multidrug tr 1e-12
2ghi_A260 Transport protein; multidrug resistance protein, M 2e-12
2ghi_A260 Transport protein; multidrug resistance protein, M 2e-06
1vpl_A256 ABC transporter, ATP-binding protein; TM0544, stru 3e-11
1vpl_A256 ABC transporter, ATP-binding protein; TM0544, stru 8e-08
2bbs_A290 Cystic fibrosis transmembrane conductance regulato 4e-11
2bbs_A290 Cystic fibrosis transmembrane conductance regulato 8e-06
3gfo_A275 Cobalt import ATP-binding protein CBIO 1; structur 8e-11
3gfo_A275 Cobalt import ATP-binding protein CBIO 1; structur 4e-06
2pze_A229 Cystic fibrosis transmembrane conductance regulat; 1e-10
2pze_A229 Cystic fibrosis transmembrane conductance regulat; 4e-05
2ff7_A247 Alpha-hemolysin translocation ATP-binding protein 2e-10
2ff7_A247 Alpha-hemolysin translocation ATP-binding protein 6e-05
2cbz_A237 Multidrug resistance-associated protein 1; ABC pro 4e-10
2cbz_A237 Multidrug resistance-associated protein 1; ABC pro 2e-04
3tui_C366 Methionine import ATP-binding protein METN; ABC-tr 6e-10
1z47_A355 CYSA, putative ABC-transporter ATP-binding protein 8e-10
3d31_A348 Sulfate/molybdate ABC transporter, ATP-binding pro 1e-09
3fvq_A359 Fe(3+) IONS import ATP-binding protein FBPC; nucle 4e-09
2yz2_A266 Putative ABC transporter ATP-binding protein TM_0; 5e-09
2pcj_A224 ABC transporter, lipoprotein-releasing system ATP- 6e-09
2yl4_A595 ATP-binding cassette SUB-family B member 10, mitoc 1e-08
2yl4_A595 ATP-binding cassette SUB-family B member 10, mitoc 7e-04
1oxx_K353 GLCV, glucose, ABC transporter, ATP binding protei 3e-08
2olj_A263 Amino acid ABC transporter; ABC domain, ATPase, hy 3e-08
4a82_A578 Cystic fibrosis transmembrane conductance regulat; 4e-08
4a82_A578 Cystic fibrosis transmembrane conductance regulat; 6e-04
2onk_A240 Molybdate/tungstate ABC transporter, ATP-binding p 4e-08
2onk_A240 Molybdate/tungstate ABC transporter, ATP-binding p 6e-04
2ixe_A271 Antigen peptide transporter 1; ABC ATPase, hydrola 7e-08
3qf4_B598 Uncharacterized ABC transporter ATP-binding prote 8e-08
1g6h_A257 High-affinity branched-chain amino acid transport 1e-07
1g6h_A257 High-affinity branched-chain amino acid transport 3e-04
3tif_A235 Uncharacterized ABC transporter ATP-binding prote; 7e-07
1ji0_A240 ABC transporter; ATP binding protein, structural g 3e-06
2iw3_A986 Elongation factor 3A; acetylation, ATP-binding, pr 2e-05
2iw3_A986 Elongation factor 3A; acetylation, ATP-binding, pr 3e-04
2iw3_A 986 Elongation factor 3A; acetylation, ATP-binding, pr 4e-04
1b0u_A262 Histidine permease; ABC transporter, transport pro 9e-05
2it1_A362 362AA long hypothetical maltose/maltodextrin trans 4e-04
>3g5u_A MCG1178, multidrug resistance protein 1A; P-glycoprotein, PGP, cyclic peptide, membrane protein; 3.80A {Mus musculus} PDB: 3g61_A* 3g60_A* Length = 1284 Back     alignment and structure
 Score =  108 bits (273), Expect = 6e-24
 Identities = 183/967 (18%), Positives = 358/967 (37%), Gaps = 166/967 (17%)

Query: 386  IISLFQSLGTLSISSRRLNRLSGYADRIHELMVISRELSIEDKSPQRNGSRNYFSEANYI 445
            ++    S+G  S +        G A  + +  +I  + SI+  S   +G +    + N +
Sbjct: 334  VLIGAFSVGQASPNIEAFANARGAAYEVFK--IIDNKPSIDSFSK--SGHKPDNIQGN-L 388

Query: 446  EFSGVKVVTPT-GNVLV-ENLTLKVEPGSNLLITGPNGSGKSSLFRVLGGLWPLVSGHIA 503
            EF  +    P+   V + + L LKV+ G  + + G +G GKS+  +++  L+  + G ++
Sbjct: 389  EFKNIHFSYPSRKEVQILKGLNLKVKSGQTVALVGNSGCGKSTTVQLMQRLYDPLDGMVS 448

Query: 504  KPGVG-SDLN-----KEIFYVPQRPYTAVGTLRDQLIY--PLTSDQEVEPLTHGGMVELL 555
              G     +N     + I  V Q P     T+ + + Y     +  E+E        + +
Sbjct: 449  IDGQDIRTINVRYLREIIGVVSQEPVLFATTIAENIRYGREDVTMDEIE--------KAV 500

Query: 556  KNVDLEYLLDRYPP-------EKEINWGDELSLGEQQRLGMARLFYHKPKFAILDECTSA 608
            K  +    + + P        E+    G +LS G++QR+ +AR     PK  +LDE TSA
Sbjct: 501  KEANAYDFIMKLPHQFDTLVGER----GAQLSGGQKQRIAIARALVRNPKILLLDEATSA 556

Query: 609  VTTDMEER-FCAKVRAM-GTSCITISHRPALVAFHDVVLSLDGEGEWRV-----HD---K 658
            + T+ E     A  +A  G + I I+HR + V   DV+   D  G   +     HD   +
Sbjct: 557  LDTESEAVVQAALDKAREGRTTIVIAHRLSTVRNADVIAGFD-GG--VIVEQGNHDELMR 613

Query: 659  RDG--SSVVTKSGINMIKSSETDRQSDAMAVEQAFVTAKKDSAFSNPKAQSYVSEVIAAS 716
              G    +V             +       ++   +++K   +    +  +  S      
Sbjct: 614  EKGIYFKLVMTQTAGNEIELGNEACKSKDEIDNLDMSSKDSGSSLIRRRSTRKSICGPHD 673

Query: 717  PIADHNVPLPVFPQLKSAP--RILPLRVADMFKVLVPTVFDK-QGAQLLAVAFLVVSRTW 773
                 +    +   +  A   RIL L   +    +V        G    A + +      
Sbjct: 674  QDRKLSTKEALDEDVPPASFWRILKLNSTEWPYFVVGIFCAIINGGLQPAFSVI------ 727

Query: 774  ISDRIASLNGTTVKYVLEQDKASFVRLIGVSVLQSAASSFIAPSIRH-LTARLALGWRIR 832
             S  +             Q+ ++   L+ + +      SFI   ++     +       R
Sbjct: 728  FSKVVGVFTNGGPPETQRQN-SNLFSLLFLIL---GIISFITFFLQGFTFGKAGEILTKR 783

Query: 833  MTQHLLKSYLRKN-SFYKVFNMSSKSIDADQRITHDLEKL-----------TTDLSGLVT 880
            +   + KS LR++ S++     ++ ++    R+ +D  ++             +++ L T
Sbjct: 784  LRYMVFKSMLRQDVSWFDDPKNTTGALTT--RLANDAAQVKGATGSRLAVIFQNIANLGT 841

Query: 881  GMVKPSVDI-LWFTWRMKALTGQRGVAILYAYMLLGLGFLRSVTPEFGDLTSREQQLEGT 939
            G++     I L + W++  L     + +    ++   G +       G     +++LEG+
Sbjct: 842  GII-----ISLIYGWQL-TL-----LLLAIVPIIAIAGVVEMKM-LSGQALKDKKELEGS 889

Query: 940  FRFMHERLRAHAESVAFFGGGAREKAMIESRFRELLEHSLLLLKKKWLFGILDDFVTKQL 999
             +   E +     +V       RE+       + L       +KK  +FGI   F   Q 
Sbjct: 890  GKIATEAIENF-RTVVSLT---REQKFETMYAQSLQIPYRNAMKKAHVFGIT--FSFTQA 943

Query: 1000 PHNVTWGLSLLYAMEHKGDRALVSTQGELAHALRFLA-SVVSQSFLAFGDILELHRKFVE 1058
                ++  +  +         LV+ Q  +      L  S +    +A G +      + +
Sbjct: 944  MMYFSYAAAFRFGAY------LVT-QQLMTFENVLLVFSAIVFGAMAVGQVSSFAPDYAK 996

Query: 1059 LSGGINRIFELEELLDAAQPGDDEISGSSQHKWNSTDYQDSISFSKLDIITPS---QKLL 1115
             +   + I  + E          EI   S         + ++ FS +    P+     +L
Sbjct: 997  ATVSASHIIRIIEK-------TPEIDSYSTQGLKPNMLEGNVQFSGVVFNYPTRPSIPVL 1049

Query: 1116 ARQLTFEIVPGKSLLVTGPNGSGKSSVFRVLRGLWPVVSGSLT---KPSQHIDEEAG-SG 1171
             + L+ E+  G++L + G +G GKS+V ++L   +  ++GS+    K  + ++ +   + 
Sbjct: 1050 -QGLSLEVKKGQTLALVGSSGCGKSTVVQLLERFYDPMAGSVFLDGKEIKQLNVQWLRAQ 1108

Query: 1172 CGIFYVPQRPYTCLGTLRDQIIY-----PLSREEAELRALKLHGKGEKLVDTTNILD--- 1223
             GI  V Q P     ++ + I Y      +S EE   RA K            NI     
Sbjct: 1109 LGI--VSQEPILFDCSIAENIAYGDNSRVVSYEEIV-RAAKE----------ANIHQFID 1155

Query: 1224 ---SYLKTIL--EGVRLSYLLEREEVGWDANLNWEDILSLGEQQRLGMARLFFHKPKFGI 1278
                   T +  +G +LS        G             G++QR+ +AR    +P   +
Sbjct: 1156 SLPDKYNTRVGDKGTQLS--------G-------------GQKQRIAIARALVRQPHILL 1194

Query: 1279 LDECTNA 1285
            LDE T+A
Sbjct: 1195 LDEATSA 1201
>3g5u_A MCG1178, multidrug resistance protein 1A; P-glycoprotein, PGP, cyclic peptide, membrane protein; 3.80A {Mus musculus} PDB: 3g61_A* 3g60_A* Length = 1284 Back     alignment and structure
>3g5u_A MCG1178, multidrug resistance protein 1A; P-glycoprotein, PGP, cyclic peptide, membrane protein; 3.80A {Mus musculus} PDB: 3g61_A* 3g60_A* Length = 1284 Back     alignment and structure
>3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} Length = 538 Back     alignment and structure
>3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} Length = 538 Back     alignment and structure
>3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} Length = 538 Back     alignment and structure
>3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} Length = 538 Back     alignment and structure
>3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; NMR {Saccharomyces cerevisiae} Length = 608 Back     alignment and structure
>3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; NMR {Saccharomyces cerevisiae} Length = 608 Back     alignment and structure
>3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; NMR {Saccharomyces cerevisiae} Length = 608 Back     alignment and structure
>3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; NMR {Saccharomyces cerevisiae} Length = 608 Back     alignment and structure
>2pjz_A Hypothetical protein ST1066; ATP binding protein, structural genomics, NPPSFA; 1.90A {Sulfolobus tokodaii} Length = 263 Back     alignment and structure
>2pjz_A Hypothetical protein ST1066; ATP binding protein, structural genomics, NPPSFA; 1.90A {Sulfolobus tokodaii} Length = 263 Back     alignment and structure
>2ihy_A ABC transporter, ATP-binding protein; ATPase, ABC cassette, hydrolase; HET: MSE; 1.90A {Staphylococcus aureus} Length = 279 Back     alignment and structure
>2ihy_A ABC transporter, ATP-binding protein; ATPase, ABC cassette, hydrolase; HET: MSE; 1.90A {Staphylococcus aureus} Length = 279 Back     alignment and structure
>1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} Length = 538 Back     alignment and structure
>1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} Length = 538 Back     alignment and structure
>1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} Length = 538 Back     alignment and structure
>1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} Length = 538 Back     alignment and structure
>3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* Length = 607 Back     alignment and structure
>3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* Length = 607 Back     alignment and structure
>3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* Length = 607 Back     alignment and structure
>3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* Length = 607 Back     alignment and structure
>2nq2_C Hypothetical ABC transporter ATP-binding protein HI1470; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae} Length = 253 Back     alignment and structure
>2nq2_C Hypothetical ABC transporter ATP-binding protein HI1470; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae} Length = 253 Back     alignment and structure
>1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12 Length = 214 Back     alignment and structure
>1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12 Length = 214 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3gd7_A Fusion complex of cystic fibrosis transmembrane conductance regulator, residues 1193-1427...; CFTR, ABC transporter, nucleotide binding domain, NBD; HET: B44; 2.70A {Homo sapiens} Length = 390 Back     alignment and structure
>3gd7_A Fusion complex of cystic fibrosis transmembrane conductance regulator, residues 1193-1427...; CFTR, ABC transporter, nucleotide binding domain, NBD; HET: B44; 2.70A {Homo sapiens} Length = 390 Back     alignment and structure
>3nh6_A ATP-binding cassette SUB-family B member 6, mitoc; ABC-transporter, ABCB6, nucleotide binding domain, heme BIOS transport protein; 2.00A {Homo sapiens} PDB: 3nh9_A* 3nha_A* 3nhb_A* Length = 306 Back     alignment and structure
>3nh6_A ATP-binding cassette SUB-family B member 6, mitoc; ABC-transporter, ABCB6, nucleotide binding domain, heme BIOS transport protein; 2.00A {Homo sapiens} PDB: 3nh9_A* 3nha_A* 3nhb_A* Length = 306 Back     alignment and structure
>2qi9_C Vitamin B12 import ATP-binding protein BTUD; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_C* 4dbl_C Length = 249 Back     alignment and structure
>2qi9_C Vitamin B12 import ATP-binding protein BTUD; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_C* 4dbl_C Length = 249 Back     alignment and structure
>3b5x_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; 5.50A {Vibrio cholerae} Length = 582 Back     alignment and structure
>3b5x_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; 5.50A {Vibrio cholerae} Length = 582 Back     alignment and structure
>3b60_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; HET: ANP; 3.70A {Salmonella typhimurium} SCOP: c.37.1.12 f.37.1.1 PDB: 3b5y_A* 3b5z_A* 3b5w_A Length = 582 Back     alignment and structure
>3b60_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; HET: ANP; 3.70A {Salmonella typhimurium} SCOP: c.37.1.12 f.37.1.1 PDB: 3b5y_A* 3b5z_A* 3b5w_A Length = 582 Back     alignment and structure
>1mv5_A LMRA, multidrug resistance ABC transporter ATP-binding and permease protein; asymmetric dimer, tetramer, P-glycoprotein; HET: ATP ADP; 3.10A {Lactococcus lactis} SCOP: c.37.1.12 Length = 243 Back     alignment and structure
>1mv5_A LMRA, multidrug resistance ABC transporter ATP-binding and permease protein; asymmetric dimer, tetramer, P-glycoprotein; HET: ATP ADP; 3.10A {Lactococcus lactis} SCOP: c.37.1.12 Length = 243 Back     alignment and structure
>3qf4_A ABC transporter, ATP-binding protein; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} Length = 587 Back     alignment and structure
>2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str} Length = 260 Back     alignment and structure
>2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str} Length = 260 Back     alignment and structure
>1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12 Length = 256 Back     alignment and structure
>1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12 Length = 256 Back     alignment and structure
>2bbs_A Cystic fibrosis transmembrane conductance regulator; ATP binding cassette, transport protein; HET: ATP; 2.05A {Homo sapiens} PDB: 2bbt_A* 1xmi_A* 1xmj_A* 2bbo_A* 3si7_A* 1r0w_A 1q3h_A 1r0x_A* 1r0y_A* 1r0z_A* 1r10_A* 1xf9_A* 1xfa_A* Length = 290 Back     alignment and structure
>2bbs_A Cystic fibrosis transmembrane conductance regulator; ATP binding cassette, transport protein; HET: ATP; 2.05A {Homo sapiens} PDB: 2bbt_A* 1xmi_A* 1xmj_A* 2bbo_A* 3si7_A* 1r0w_A 1q3h_A 1r0x_A* 1r0y_A* 1r0z_A* 1r10_A* 1xf9_A* 1xfa_A* Length = 290 Back     alignment and structure
>3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124} Length = 275 Back     alignment and structure
>3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124} Length = 275 Back     alignment and structure
>2pze_A Cystic fibrosis transmembrane conductance regulat; NBD, ABC transporter, CFTR, hydrolase; HET: ATP; 1.70A {Homo sapiens} PDB: 2pzg_A* 2pzf_A* 1ckx_A 1cky_A 1ckw_A 1ckz_A Length = 229 Back     alignment and structure
>2pze_A Cystic fibrosis transmembrane conductance regulat; NBD, ABC transporter, CFTR, hydrolase; HET: ATP; 1.70A {Homo sapiens} PDB: 2pzg_A* 2pzf_A* 1ckx_A 1cky_A 1ckw_A 1ckz_A Length = 229 Back     alignment and structure
>2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A* Length = 247 Back     alignment and structure
>2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A* Length = 247 Back     alignment and structure
>2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens} Length = 237 Back     alignment and structure
>2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens} Length = 237 Back     alignment and structure
>3tui_C Methionine import ATP-binding protein METN; ABC-transporter, type I ABC type importer, methionine uptake transporter, membrane protein; HET: ADP; 2.90A {Escherichia coli} PDB: 3tuj_C 3tuz_C* 3dhw_C Length = 366 Back     alignment and structure
>1z47_A CYSA, putative ABC-transporter ATP-binding protein; alpha/beta motif, beta sandwich, ligand binding protein; 1.90A {Alicyclobacillus acidocaldarius} Length = 355 Back     alignment and structure
>3d31_A Sulfate/molybdate ABC transporter, ATP-binding protein; ATP-binding, nucleotide-binding, membrane, transmembrane, transport protein; 3.00A {Methanosarcina acetivorans} SCOP: b.40.6.3 c.37.1.12 Length = 348 Back     alignment and structure
>3fvq_A Fe(3+) IONS import ATP-binding protein FBPC; nucleotide binding domain, ABC motor domain, ferric iron transport, cell inner membrane; HET: ATP; 1.90A {Neisseria gonorrhoeae} Length = 359 Back     alignment and structure
>2yz2_A Putative ABC transporter ATP-binding protein TM_0; cobalt transport, TM02 hydrolase, inner membrane, membrane, nucleotide-binding; 2.30A {Thermotoga maritima} Length = 266 Back     alignment and structure
>2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein; structural genomics; 1.70A {Aquifex aeolicus} PDB: 2pcl_A Length = 224 Back     alignment and structure
>1oxx_K GLCV, glucose, ABC transporter, ATP binding protein; ABC-ATPase, ATP-binding cassette, ATPase, transport protein; 1.45A {Sulfolobus solfataricus} SCOP: b.40.6.3 c.37.1.12 PDB: 1oxs_C 1oxt_A 1oxu_A* 1oxv_A* Length = 353 Back     alignment and structure
>2olj_A Amino acid ABC transporter; ABC domain, ATPase, hydrolase; HET: ADP; 2.05A {Geobacillus stearothermophilus} PDB: 2olk_A* 2ouk_A 2q0h_A* 3c4j_A* 3c41_J* Length = 263 Back     alignment and structure
>4a82_A Cystic fibrosis transmembrane conductance regulat; CFTR, ION channel, transport protein, casse protein; 2.00A {Homo sapiens} PDB: 2onj_A* 2hyd_A Length = 578 Back     alignment and structure
>4a82_A Cystic fibrosis transmembrane conductance regulat; CFTR, ION channel, transport protein, casse protein; 2.00A {Homo sapiens} PDB: 2onj_A* 2hyd_A Length = 578 Back     alignment and structure
>2onk_A Molybdate/tungstate ABC transporter, ATP-binding protein; membrane protein; 3.10A {Archaeoglobus fulgidus} SCOP: c.37.1.12 Length = 240 Back     alignment and structure
>2onk_A Molybdate/tungstate ABC transporter, ATP-binding protein; membrane protein; 3.10A {Archaeoglobus fulgidus} SCOP: c.37.1.12 Length = 240 Back     alignment and structure
>2ixe_A Antigen peptide transporter 1; ABC ATPase, hydrolase; HET: ATP; 2.0A {Rattus norvegicus} PDB: 2ixg_A* 2ixf_A* 1jj7_A* Length = 271 Back     alignment and structure
>3qf4_B Uncharacterized ABC transporter ATP-binding prote TM_0288; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} Length = 598 Back     alignment and structure
>1g6h_A High-affinity branched-chain amino acid transport ATP-binding protein; beta-core domain; HET: ADP; 1.60A {Methanocaldococcus jannaschii} SCOP: c.37.1.12 PDB: 1gaj_A 1g9x_A* Length = 257 Back     alignment and structure
>1g6h_A High-affinity branched-chain amino acid transport ATP-binding protein; beta-core domain; HET: ADP; 1.60A {Methanocaldococcus jannaschii} SCOP: c.37.1.12 PDB: 1gaj_A 1g9x_A* Length = 257 Back     alignment and structure
>3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A* Length = 235 Back     alignment and structure
>1ji0_A ABC transporter; ATP binding protein, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: ATP; 2.00A {Thermotoga maritima} SCOP: c.37.1.12 Length = 240 Back     alignment and structure
>2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A Length = 986 Back     alignment and structure
>2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A Length = 986 Back     alignment and structure
>2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A Length = 986 Back     alignment and structure
>1b0u_A Histidine permease; ABC transporter, transport protein; HET: ATP; 1.50A {Salmonella typhimurium} SCOP: c.37.1.12 Length = 262 Back     alignment and structure
>2it1_A 362AA long hypothetical maltose/maltodextrin transport ATP-binding protein; structural genomics, NPPSFA; 1.94A {Pyrococcus horikoshii} Length = 362 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

No hit with probability above 80.00

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 1338
d2hyda1255 c.37.1.12 (A:324-578) Putative multidrug export AT 9e-31
d2hyda1255 c.37.1.12 (A:324-578) Putative multidrug export AT 4e-19
d1r0wa_281 c.37.1.12 (A:) Cystic fibrosis transmembrane condu 6e-30
d1r0wa_281 c.37.1.12 (A:) Cystic fibrosis transmembrane condu 2e-18
d3b60a1253 c.37.1.12 (A:329-581) Multidrug resistance ABC tra 7e-29
d3b60a1253 c.37.1.12 (A:329-581) Multidrug resistance ABC tra 5e-19
d1mv5a_242 c.37.1.12 (A:) Multidrug resistance ABC transporte 7e-28
d1mv5a_242 c.37.1.12 (A:) Multidrug resistance ABC transporte 2e-17
d2pmka1241 c.37.1.12 (A:467-707) Haemolysin B ATP-binding pro 1e-27
d2pmka1241 c.37.1.12 (A:467-707) Haemolysin B ATP-binding pro 4e-15
d1jj7a_251 c.37.1.12 (A:) Peptide transporter Tap1, C-termina 9e-27
d1jj7a_251 c.37.1.12 (A:) Peptide transporter Tap1, C-termina 9e-19
d1v43a3239 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N 8e-24
d1v43a3239 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N 5e-18
d3dhwc1240 c.37.1.12 (C:1-240) Methionine import ATP-binding 2e-23
d3dhwc1240 c.37.1.12 (C:1-240) Methionine import ATP-binding 8e-13
d1b0ua_258 c.37.1.12 (A:) ATP-binding subunit of the histidin 3e-22
d1b0ua_258 c.37.1.12 (A:) ATP-binding subunit of the histidin 2e-12
d1oxxk2242 c.37.1.12 (K:1-242) Glucose transport protein GlcV 4e-21
d1oxxk2242 c.37.1.12 (K:1-242) Glucose transport protein GlcV 6e-10
d1l2ta_230 c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jann 5e-21
d1l2ta_230 c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jann 9e-14
d1vpla_238 c.37.1.12 (A:) Putative ABC transporter TM0544 {Th 7e-20
d1vpla_238 c.37.1.12 (A:) Putative ABC transporter TM0544 {Th 1e-12
d1g6ha_254 c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jann 1e-19
d1g6ha_254 c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jann 1e-13
d1g2912240 c.37.1.12 (1:1-240) Maltose transport protein MalK 2e-19
d1g2912240 c.37.1.12 (1:1-240) Maltose transport protein MalK 1e-11
d1sgwa_200 c.37.1.12 (A:) Putative ABC transporter PF0895 {Py 3e-19
d1sgwa_200 c.37.1.12 (A:) Putative ABC transporter PF0895 {Py 7e-14
d1l7vc_231 c.37.1.12 (C:) ABC transporter involved in vitamin 4e-19
d1l7vc_231 c.37.1.12 (C:) ABC transporter involved in vitamin 2e-09
d2awna2232 c.37.1.12 (A:4-235) Maltose transport protein MalK 2e-18
d2awna2232 c.37.1.12 (A:4-235) Maltose transport protein MalK 1e-11
d1ji0a_240 c.37.1.12 (A:) Branched chain aminoacid ABC transp 6e-18
d1ji0a_240 c.37.1.12 (A:) Branched chain aminoacid ABC transp 2e-09
d3d31a2229 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transpor 5e-17
d3d31a2229 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transpor 1e-08
d2onka1240 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP 7e-13
d2onka1240 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP 6e-09
d1ye8a1178 c.37.1.11 (A:1-178) Hypothetical kinase-like prote 1e-09
g1f2t.1292 c.37.1.12 (A:,B:) Rad50 {Archaeon Pyrococcus furio 2e-04
g1f2t.1292 c.37.1.12 (A:,B:) Rad50 {Archaeon Pyrococcus furio 2e-04
g1ii8.1369 c.37.1.12 (A:,B:) Rad50 {Archaeon Pyrococcus furio 0.003
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Length = 255 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: ABC transporter ATPase domain-like
domain: Putative multidrug export ATP-binding/permease protein SAV1866
species: Staphylococcus aureus [TaxId: 1280]

 Score =  120 bits (302), Expect = 9e-31
 Identities = 49/219 (22%), Positives = 94/219 (42%), Gaps = 22/219 (10%)

Query: 445 IEFSGVKVVTPTGNVLV-ENLTLKVEPGSNLLITGPNGSGKSSLFRVLGGLWPLVSGHIA 503
           I+   V          + +++ L +E G  +   G +G GKS+L  ++   + + SG I 
Sbjct: 17  IDIDHVSFQYNDNEAPILKDINLSIEKGETVAFVGMSGGGKSTLINLIPRFYDVTSGQIL 76

Query: 504 KPGV------GSDLNKEIFYVPQRPYTAVGTLRDQLIYPLT--SDQEVEPLTHGGMVELL 555
             G          L  +I  V Q       T+++ ++      +D+EV         E  
Sbjct: 77  IDGHNIKDFLTGSLRNQIGLVQQDNILFSDTVKENILLGRPTATDEEVV--------EAA 128

Query: 556 KNVDLEYLLDRYPP--EKEIN-WGDELSLGEQQRLGMARLFYHKPKFAILDECTSAVTTD 612
           K  +    +   P   + E+   G +LS G++QRL +AR+F + P   ILDE TSA+  +
Sbjct: 129 KMANAHDFIMNLPQGYDTEVGERGVKLSGGQKQRLSIARIFLNNPPILILDEATSALDLE 188

Query: 613 MEERFCAKVRAM--GTSCITISHRPALVAFHDVVLSLDG 649
            E      +  +    + + ++HR + +   D ++ ++ 
Sbjct: 189 SESIIQEALDVLSKDRTTLIVAHRLSTITHADKIVVIEN 227
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Length = 255 Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 281 Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 281 Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Length = 253 Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Length = 253 Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Length = 242 Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Length = 242 Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Length = 241 Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Length = 241 Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Length = 251 Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Length = 251 Back     information, alignment and structure
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Length = 239 Back     information, alignment and structure
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Length = 239 Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Length = 240 Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Length = 240 Back     information, alignment and structure
>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Length = 258 Back     information, alignment and structure
>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Length = 258 Back     information, alignment and structure
>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Length = 242 Back     information, alignment and structure
>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Length = 242 Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 230 Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 230 Back     information, alignment and structure
>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Length = 238 Back     information, alignment and structure
>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Length = 238 Back     information, alignment and structure
>d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 254 Back     information, alignment and structure
>d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 254 Back     information, alignment and structure
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Length = 240 Back     information, alignment and structure
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Length = 240 Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Length = 200 Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Length = 200 Back     information, alignment and structure
>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} Length = 231 Back     information, alignment and structure
>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} Length = 231 Back     information, alignment and structure
>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 232 Back     information, alignment and structure
>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 232 Back     information, alignment and structure
>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Length = 240 Back     information, alignment and structure
>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Length = 240 Back     information, alignment and structure
>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Length = 229 Back     information, alignment and structure
>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Length = 229 Back     information, alignment and structure
>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Length = 240 Back     information, alignment and structure
>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Length = 240 Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Length = 178 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query1338
d2bhua3420 Glycosyltrehalose trehalohydrolase, central domain 100.0
d1ejda_419 UDP-N-acetylglucosamine enolpyruvyl transferase (E 100.0
d2df7a1419 Birnavirus VP2 {Infectious bursal disease virus [T 100.0
d1om4a_418 Nitric oxide (NO) synthase oxygenase domain {Rat ( 100.0
d2gp4a2418 6-phosphogluconate dehydratase EDD {Shewanella one 100.0
d1f61a_418 Isocitrate lyase {Mycobacterium tuberculosis [TaxI 100.0
d2r5ea1418 Kynurenine--oxoglutarate transaminase I {Yellowfev 100.0
d1w7la_418 Kynurenine--oxoglutarate transaminase I {Human (Ho 100.0
d1pv7a_417 Lactose permease {Escherichia coli [TaxId: 562]} 100.0
d1w6ga1417 Copper amine oxidase, domain 3 {Arthrobacter globi 100.0
d3bona1417 Botulinum neurotoxin {Clostridium botulinum, serot 100.0
d1q7ea_417 Hypothetical protein YfdW {Escherichia coli [TaxId 100.0
d1gff1_417 Microvirus capsid proteins {Bacteriophage G4 [TaxI 100.0
d2csga1417 Hypothetical protein YbiU {Salmonella typhimurium 100.0
d1ltka_417 Phosphoglycerate kinase {Malaria parasite (Plasmod 100.0
d1vema2417 Bacterial beta-amylase {Bacillus cereus [TaxId: 13 100.0
d1q2oa_416 Nitric oxide (NO) synthase oxygenase domain {Cow ( 100.0
d1dfoa_416 Serine hydroxymethyltransferase {Escherichia coli 100.0
d1d8wa_416 L-rhamnose isomerase {Escherichia coli [TaxId: 562 100.0
d2vnud4416 Exosome complex exonuclease RRP44 {Saccharomyces c 100.0
d1igwa_416 Isocitrate lyase {Escherichia coli [TaxId: 562]} 100.0
d1pb1a_416 Isocitrate dehydrogenase, ICDH {Escherichia coli [ 100.0
d1dnva_415 Densovirus capsid protein {Galleria mellonella den 100.0
d2ieaa2415 Pyruvate dehydrogenase E1 component, PP module {Es 100.0
d1so2a_415 cGMP-inhibited 3',5'-cyclic phosphodiesterase B, p 100.0
d16pka_415 Phosphoglycerate kinase {Trypanosoma brucei [TaxId 100.0
d1qpga_415 Phosphoglycerate kinase {Baker's yeast (Saccharomy 100.0
d2qeec1415 Uncharacterized protein BH0493 {Bacillus haloduran 100.0
d1s5ja2415 Family B DNA polymerase {Sulfolobus solfataricus [ 100.0
d1kbia1414 Flavocytochrome b2, C-terminal domain {Baker's yea 100.0
d2b8na1414 Putative glycerate kinase (hypothetical protein TM 100.0
d1o20a_414 Gamma-glutamyl phosphate reductase {Thermotoga mar 100.0
d1t0la_414 NADP-dependent isocitrate dehydrogenase {Human (Ho 100.0
d1vh4a_413 Stabilizer of iron transporter SufD {Escherichia c 100.0
d1t5la1413 Nucleotide excision repair enzyme UvrB {Bacillus c 100.0
d1hdia_413 Phosphoglycerate kinase {Pig (Sus scrofa) [TaxId: 100.0
d1lwda_413 NADP-dependent isocitrate dehydrogenase {Pig (Sus 100.0
d2qgma1413 Succinoglycan biosynthesis protein BC3205 {Bacillu 100.0
d1zjca1413 Aminopeptidase S, AMPS {Staphylococcus aureus [Tax 100.0
d1ulva1413 Glucodextranase, domain A {Arthrobacter globiformi 100.0
d1a0tp_413 Sucrose-specific porin {Enterobacterium (Salmonell 100.0
d1ocka_412 Malonamidase E2 {Bradyrhizobium japonicum [TaxId: 100.0
d1yzya1412 Hypothetical protein HI1011 {Haemophilus influenza 100.0
d1yaaa_412 Aspartate aminotransferase, AAT {Baker's yeast (Sa 100.0
d1bw0a_412 Tyrosine aminotransferase (TAT) {Trypanosoma cruzi 100.0
d1rxxa_412 Arginine deiminase {Pseudomonas aeruginosa [TaxId: 100.0
d1ajsa_412 Aspartate aminotransferase, AAT {Pig (Sus scrofa), 100.0
d1ufaa2412 Hypothetical protein TT1467, N-terminal domain {Th 100.0
d1t3ca_411 Botulinum neurotoxin {Clostridium botulinum, serot 100.0
d2afaa1411 Putative NAG isomerase YihS {Salmonella typhimuriu 100.0
d1ux5a_411 Bni1 {Baker's yeast (Saccharomyces cerevisiae) [Ta 100.0
d1izoa_411 Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis 100.0
d2ccaa1410 Catalase-peroxidase KatG {Mycobacterium tuberculos 100.0
d1p1ja1410 Myo-inositol 1-phosphate synthase {Baker's yeast ( 100.0
d1kfsa2410 DNA polymerase I (Klenow fragment) {Escherichia co 100.0
d1s5ja1410 Exonuclease domain of family B DNA polymerases {Su 100.0
d1uuqa_410 Exomannosidase {Cellvibrio mixtus [TaxId: 39650]} 100.0
d2cmza1409 Spike glycoprotein {Vesicular stomatitis indiana v 100.0
d1tv5a1409 Dihydroorotate dehydrogenase {Plasmodium falciparu 100.0
d1qtma2409 DNA polymerase I (Klenow fragment) {Thermus aquati 100.0
d2g0da1409 Nisin biosynthesis protein NisC {Lactococcus lacti 100.0
d1b25a1409 Formaldehyde ferredoxin oxidoreductase {Archaeon P 100.0
d1s9ra_409 Arginine deiminase {Mycoplasma arginini [TaxId: 20 100.0
g1wht.1409 Serine carboxypeptidase II {Wheat (Triticum vulgar 100.0
d1dkla_409 Phytase (myo-inositol-hexakisphosphate-3-phosphohy 100.0
d1wzaa2409 Bacterial alpha-amylase {Halothermothrix orenii [T 100.0
d1r76a_408 Polygalacturonic acid lyase (pectate lyase) {Azosp 100.0
d1c4oa1408 Nucleotide excision repair enzyme UvrB {Thermus th 100.0
d1f1oa_408 Adenylosuccinate lyase {Bacillus subtilis [TaxId: 100.0
d1h4pa_408 Exo-beta-(1,3)-glucanase {Baker's yeast (Saccharom 100.0
d2hhva2408 DNA polymerase I (Klenow fragment) {Bacillus stear 100.0
d1n11a_408 Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1t3ia_408 Probable cysteine desulfurase SufS {Synechocystis 100.0
d1qs0a_407 2-oxoisovalerate dehydrogenase (E1B), PP module {P 100.0
d1eu8a_407 D-maltodextrin-binding protein, MBP {Archaeon Ther 100.0
d1qhoa4407 Cyclodextrin glycosyltransferase {Bacillus stearot 100.0
d1u2za_406 Catalytic, N-terminal domain of histone methyltran 100.0
d1itka1406 Catalase-peroxidase KatG {Archaeon Haloarcula mari 100.0
d1mwva1406 Catalase-peroxidase KatG {Burkholderia pseudomalle 100.0
d1ei6a_406 Phosphonoacetate hydrolase {Pseudomonas fluorescen 100.0
d1ub2a1406 Catalase-peroxidase KatG {Synechococcus sp. pcc 79 100.0
d2ayia1406 Aminopeptidase T {Thermus thermophilus [TaxId: 274 100.0
d3bmva4406 Cyclodextrin glycosyltransferase {Thermoanaerobact 100.0
d1kl1a_405 Serine hydroxymethyltransferase {Bacillus stearoth 100.0
d2nwwa1405 Proton glutamate symport protein {Pyrococcus horik 100.0
d1h6za3405 Pyruvate phosphate dikinase, N-terminal domain {Tr 100.0
d1jf9a_405 NifS-like protein/selenocysteine lyase {Escherichi 100.0
d1lnsa3405 X-Prolyl dipeptidyl aminopeptidase PepX, middle do 100.0
d1qz9a_404 Kynureninase {Pseudomonas fluorescens [TaxId: 294] 100.0
d2b5dx2404 Alpha-amylase AmyC {Thermotoga maritima [TaxId: 23 100.0
d1re9a_404 Cytochrome P450-CAM {Pseudomonas putida [TaxId: 30 100.0
d1uyra2404 Acetyl-coenzyme A carboxylase {Baker's yeast (Sacc 100.0
d1z7da1404 Ornithine aminotransferase {Plasmodium yoelii yoel 100.0
d2byla1404 Ornithine aminotransferase {Human (Homo sapiens) [ 100.0
d1h12a_404 Endo-1,4-beta-xylanase {Pseudoalteromonas haloplan 100.0
d1wsta1403 Multiple substrate aminotransferase, MSAT {Thermoc 100.0
d1xksa_403 Nuclear pore complex protein Nup133 {Human (Homo s 100.0
d1ueda_403 p450 monoxygenase OxyC {Amycolatopsis orientalis [ 100.0
d1hx0a2403 Animal alpha-amylase {Pig (Sus scrofa) [TaxId: 982 100.0
d1gwia_403 Cyp154c1 monooxygenase {Streptomyces coelicolor [T 100.0
d3b55a1403 Succinoglycan biosynthesis protein BC3120 {Bacillu 100.0
d1dofa_402 Adenylosuccinate lyase {Archaeon Pyrobaculum aerop 100.0
d2g5da1402 Membrane-bound lytic murein transglycosylase A, ML 100.0
d1xk7a1402 Crotonobetainyl-CoA:carnitine CoA-transferase, Cai 100.0
d1fp3a_402 N-acyl-D-glucosamine 2-epimerase {Pig (Sus scrofa) 100.0
d1z8oa1402 Cytochrome P450-ERYF {Saccharopolyspora erythraea 100.0
g1w2w.1402 Putative methylthioribose-1-phosphate isomerase Yp 100.0
d1p9ra_401 Extracellular secretion NTPase EpsE {Vibrio choler 100.0
d1fc4a_401 2-amino-3-ketobutyrate CoA ligase {Escherichia col 100.0
d1q5da_401 Cytochrome P450epok {Sorangium cellulosum [TaxId: 100.0
d1a12a_401 Regulator of chromosome condensation RCC1 {Human ( 100.0
d1iira_401 UDP-glucosyltransferase GtfB {Amycolatopsis orient 100.0
d1rrva_401 TDP-vancosaminyltransferase GftD {Amycolatopsis or 100.0
d2h6fb1401 Protein farnesyltransferase, beta-subunit {Human ( 100.0
d1jdpa_401 Hormone binding domain of the atrial natriuretic p 100.0
d7aata_401 Aspartate aminotransferase, AAT {Chicken (Gallus g 100.0
d2r7da2401 Ribonuclease II family protein DR0020 {Deinococcus 100.0
d1odoa_401 Cyp154a1 monooxygenase {Streptomyces coelicolor [T 100.0
d1ru4a_400 Pectate transeliminase {Erwinia chrysanthemi [TaxI 100.0
d1tq4a_400 Interferon-inducible GTPase {Mouse (Mus musculus) 100.0
d3ovwa_400 Cellobiohydrolase I (cellulase, Endoglucanase I, C 100.0
d1inpa_400 Inositol polyphosphate 1-phosphatase {Cow (Bos tau 100.0
d1eh9a3400 Glycosyltrehalose trehalohydrolase, central domain 100.0
d2olua2400 Penicillin-binding protein 2, PBP2 {Staphylococcus 100.0
d1oyaa_399 Old yellow enzyme (OYE) {Lager yeast (Saccharomyce 100.0
d1s1fa_399 Cyp158a2 {Streptomyces coelicolor [TaxId: 1902]} 100.0
d2ah2a2399 Trypanosoma sialidase {Parasitic flagellate protoz 100.0
d1jfba_399 Cytochrome P450-NOR, nitric reductase {Fungus (Fus 100.0
d1bn8a_399 Pectate lyase {Bacillus subtilis [TaxId: 1423]} 100.0
d1ojja_399 Cellobiohydrolase I (cellulase, Endoglucanase I, C 100.0
d1vpea_398 Phosphoglycerate kinase {Thermotoga maritima [TaxI 100.0
d1qgna_398 Cystathionine gamma-synthase, CGS {Common tobacco 100.0
d1vlja_398 NADH-dependent butanol dehydrogenase A (TM0820) {T 100.0
d1y4ia1397 Methionine gamma-lyase, MGL {Citrobacter freundii 100.0
d1q1la_397 Chorismate synthase, AroC {Aquifex aeolicus [TaxId 100.0
d1vkoa1397 Myo-inositol 1-phosphate synthase {Caenorhabditis 100.0
d3tata_397 Aromatic aminoacid aminotransferase, AroAT {Escher 100.0
d1lf6a1397 Bacterial glucoamylase, C-terminal domain {Thermoa 100.0
d1vjva_397 Ubiquitin carboxyl-terminal hydrolase 6 {Baker's y 100.0
d2bwna1396 5-aminolevulinate synthase {Rhodobacter capsulatus 100.0
d1m7xa3396 1,4-alpha-glucan branching enzyme, central domain 100.0
d2q7wa1396 Aspartate aminotransferase, AAT {Escherichia coli 100.0
d1io1a_395 Phase 1 flagellin {Salmonella typhimurium [TaxId: 100.0
g1f8v.1395 Alphanodavirus capsid protein {Pariacoto virus [Ta 100.0
d2bfda1395 Branched-chain alpha-keto acid dehydrogenase, PP m 100.0
d1nw1a_395 Choline kinase {Caenorhabditis elegans [TaxId: 623 100.0
d2py6a1395 Methyltransferase FkbM {Methylobacillus flagellatu 100.0
d1aora1395 Aldehyde ferredoxin oxidoreductase {Archaeon Pyroc 100.0
d1w36b2395 Exodeoxyribonuclease V beta chain (RecB), N-termin 100.0
d1xi9a_395 Putative alanine aminotransferase {Pyrococcus furi 100.0
d1n40a_395 Cyp121 monooxygenase (P450 Mt2) {Mycobacterium tub 100.0
d1e5ea_394 Methionine gamma-lyase, MGL {Trichomonas vaginalis 100.0
d1phpa_394 Phosphoglycerate kinase {Bacillus stearothermophil 100.0
d1u1ha1394 5-methyltetrahydropteroyltriglutamate--homocystein 100.0
d2ay1a_394 Aromatic aminoacid aminotransferase, AroAT {Paraco 100.0
d1qo7a_394 Bacterial epoxide hydrolase {Aspergillus niger [Ta 100.0
d1c7na_394 Cystalysin {Treponema denticola [TaxId: 158]} 100.0
d2pb1a1394 Exo-beta-(1,3)-glucanase {Yeast (Candida albicans) 100.0
d1lfka_394 p450 monoxygenase OxyB {Amycolatopsis orientalis [ 100.0
d1atia2394 Glycyl-tRNA synthetase (GlyRS) {Thermus thermophil 100.0
d2d3na2394 Bacterial alpha-amylase {Bacillus sp. 707 [TaxId: 100.0
d1q8ia2394 Family B DNA polymerase {Escherichia coli [TaxId: 100.0
d1ldja2394 Cullin homolog 1, Cul-1 {Human (Homo sapiens) [Tax 100.0
d1n8pa_393 Cystathionine gamma-lyase (CYS3) {Baker's yeast (S 100.0
d1xlma_393 D-xylose isomerase {Arthrobacter, strain b3728 [Ta 100.0
d1kwga2393 A4 beta-galactosidase {Thermus thermophilus [TaxId 100.0
d1g8ma2393 AICAR transformylase domain of bifunctional purine 100.0
d1sq9a_393 Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac 100.0
d1i24a_393 Sulfolipid biosynthesis protein SQD1 {Thale cress 100.0
d1hvxa2393 Bacterial alpha-amylase {Bacillus stearothermophil 100.0
d1e43a2393 Bacterial alpha-amylase {Chimera (Bacillus amyloli 100.0
d1gc0a_392 Methionine gamma-lyase, MGL {Pseudomonas putida [T 100.0
d2d0ta1392 Indoleamine 2,3-dioxygenase {Human (Homo sapiens) 100.0
d2pula1392 Methylthioribose kinase MtnK {Bacillus subtilis [T 100.0
d1xima_392 D-xylose isomerase {Actinoplanes missouriensis [Ta 100.0
d1yvua2392 Argonaute homologue Aq_1447 {Aquifex aeolicus [Tax 100.0
d1cl1a_391 Cystathionine beta-lyase, CBL {Escherichia coli [T 100.0
d1pn3a_391 TDP-epi-vancosaminyltransferase GtfA {Amycolatopsi 100.0
d1gpea1391 Glucose oxidase {Penicillium amagasakiense [TaxId: 100.0
d1nt4a_391 Glucose-1-phosphatase {Escherichia coli [TaxId: 56 100.0
d1p3wa_391 Cysteine desulfurase IscS {Escherichia coli [TaxId 100.0
d1lwha2391 4-alpha-glucanotransferase {Thermotoga maritima [T 100.0
d4ubpc2390 alpha-subunit of urease, catalytic domain {Bacillu 100.0
d1v6sa_390 Phosphoglycerate kinase {Thermus thermophilus [Tax 100.0
d1nsca_390 Influenza neuraminidase {Influenza B virus, differ 100.0
d1qopb_390 Tryptophan synthase, beta-subunit {Salmonella typh 100.0
d1oj7a_390 Hypothetical oxidoreductase yqhD {Escherichia coli 100.0
d1ud2a2390 Bacterial alpha-amylase {Bacillus sp., ksm-k38 [Ta 100.0
d1sg6a_389 Dehydroquinate synthase, DHQS {Aspergillus nidulan 100.0
d2gb3a1389 AAT homologue TM1698 {Thermotoga maritima [TaxId: 100.0
d1jiha2389 DNA polymerase eta {Baker's yeast (Saccharomyces c 100.0
d1e9yb2389 alpha-subunit of urease, catalytic domain {Helicob 100.0
d2o3ia1389 Hypothetical protein CV3147 {Chromobacterium viola 100.0
d1f8ea_388 Influenza neuraminidase {Influenza A virus, differ 100.0
d1u7la_388 Vacuolar ATP synthase subunit C {Baker's yeast (Sa 100.0
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 100.0
d1eepa_388 Inosine monophosphate dehydrogenase (IMPDH) {Lyme 100.0
d1qxoa_388 Chorismate synthase, AroC {Streptococcus pneumonia 100.0
d2ch1a1388 3-hydroxykynurenine transaminase {Malaria mosquito 100.0
d2dcfa1388 6-aminohexanoate-dimer hydrolase NylC {Flavobacter 100.0
d1gdea_388 Aromatic aminoacid aminotransferase, AroAT {Archae 100.0
d2py5a2388 phi29 DNA polymerase {Bacteriophage phi-29 [TaxId: 100.0
d1q8ia1388 Exonuclease domain of family B DNA polymerases {Es 100.0
d1h0ca_388 Alanine-glyoxylate aminotransferase {Human (Homo s 100.0
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 100.0
d1j32a_388 Aspartate aminotransferase, AAT {Phormidium lapide 100.0
d1ku0a_388 Lipase L1 {Bacillus stearothermophilus [TaxId: 142 100.0
d1x38a1388 Beta-D-glucan exohydrolase, N-terminal domain {Bar 100.0
d1zeea1387 Hypothetical protein SO4414 {Shewanella oneidensis 100.0
d2aepa1387 Influenza neuraminidase {Influenza A virus, differ 100.0
d1qvra2387 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 100.0
d1vefa1387 Acetylornithine/acetyl-lysine aminotransferase Arg 100.0
d1zsqa2387 Myotubularin-related protein 2, C-terminal domain 100.0
d1bxba_387 D-xylose isomerase {Thermus aquaticus, subsp. Ther 100.0
d2qp8a1387 beta-secretase (memapsin) {Human (Homo sapiens) [T 100.0
d1k3ia3387 Galactose oxidase, central domain {Fungi (Fusarium 100.0
d1ur4a_387 Beta-1,4-galactanase {Bacillus licheniformis [TaxI 100.0
d2ex0a1387 Alpha-2,3/2,6-sialyltransferase/sialidase {Pasteur 100.0
d1r6ta2386 Tryptophanyl-tRNA synthetase (TrpRS) {Human (Homo 100.0
d1v8za1386 Tryptophan synthase, beta-subunit {Archaeon Pyroco 100.0
d1muwa_386 D-xylose isomerase {Streptomyces olivochromogenes 100.0
d3c10a1386 Histone deacetylase 7, HDAC7 {Human (Homo sapiens) 100.0
d1v5da_386 Chitosanase {Bacillus sp., strain k17 [TaxId: 1409 100.0
d1xmxa_385 Hypothetical protein VC1899 {Vibrio cholerae [TaxI 100.0
d1rrma_385 Lactaldehyde reductase FucO {Escherichia coli [Tax 100.0
d1ir6a_385 Exonuclease RecJ {Thermus thermophilus [TaxId: 274 100.0
d1uhga_385 Ovalbumin {Hen (Gallus gallus) [TaxId: 9031]} 100.0
d1ejxc2385 alpha-subunit of urease, catalytic domain {Klebsie 100.0
d1cf3a1385 Glucose oxidase {Aspergillus niger [TaxId: 5061]} 100.0
d1n97a_385 Cyp175a1 {Thermus thermophilus [TaxId: 274]} 100.0
d2c5wb1385 Penicillin-binding protein 1a, transpeptidase doma 100.0
d2b9va2385 Alpha-amino acid ester hydrolase {Acetobacter past 100.0
d2ix0a4385 Exoribonuclease 2, RNB {Escherichia coli [TaxId: 5 100.0
d3c0na2384 (Pro)aerolysin, pore-forming lobe {Aeromonas hydro 100.0
d1cs1a_384 Cystathionine gamma-synthase, CGS {Escherichia col 100.0
d1mtyb_384 Methane monooxygenase hydrolase beta subunit {Meth 100.0
d1b9ha_384 3-amino-5-hydroxybenzoic acid synthase (AHBA synth 100.0
d1hn0a1384 Chondroitin ABC lyase I {Proteus vulgaris [TaxId: 100.0
d2fvka2384 Dihydropyrimidine amidohydrolase Pyd2 {Yeast (Sacc 100.0
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 100.0
d1vz6a_383 Glutamate N-acetyltransferase 2 (ornithine acetylt 100.0
d1u7ga_383 Ammonium transporter AmtB {Escherichia coli [TaxId 100.0
d1bs0a_383 PLP-dependent acyl-CoA synthase (8-amino-7-oxonano 100.0
d1mhyb_383 Methane monooxygenase hydrolase beta subunit {Meth 100.0
d1bo1a_383 Phosphatidylinositol phosphate kinase IIbeta, PIPK 100.0
d2v5za1383 Monoamine oxidase B {Human (Homo sapiens) [TaxId: 100.0
d1imva_383 Pigment epithelium-derived factor, PEDF {Human (Ho 100.0
d1gy8a_383 Uridine diphosphogalactose-4-epimerase (UDP-galact 100.0
d2ayna1383 Ubiquitin carboxyl-terminal hydrolase 14 {Human (H 100.0
d1u08a_382 Putative methionine aminotransferase YdbL {Escheri 100.0
d1b5pa_382 Aspartate aminotransferase, AAT {Thermus thermophi 100.0
d1wkva1382 O-acetylserine sulfhydrylase (Cysteine synthase) { 100.0
d1ea9c3382 Maltogenic amylase, central domain {Bacillus sp., 100.0
d2bkwa1382 Alanine-glyoxylate aminotransferase {Baker's yeast 100.0
d1t1ua1382 Choline O-acetyltransferase {Rat (Rattus norvegicu 100.0
d1xl7a1382 Peroxisomal carnitine O-octanoyltransferase, COT { 100.0
d1wzla3382 Maltogenic amylase, central domain {Thermoactinomy 100.0
d1j0ha3382 Neopullulanase, central domain {Bacillus stearothe 100.0
d3bvua3381 Golgi alpha-mannosidase II {Fruit fly (Drosophila 100.0
d1by7a_381 Plasminogen activator inhibitor-2 {Human (Homo sap 100.0
d1odza_381 Mannanase A, ManA {Pseudomonas cellulosa (Cellvibr 100.0
d2bo4a1381 Mannosylglycerate synthase, MGS {Rhodothermus mari 100.0
d1elua_381 Cystine C-S lyase C-des {Synechocystis sp. [TaxId: 100.0
d2guya2381 Fungal alpha-amylases {Aspergillus oryzae, Taka-am 100.0
d1xipa_381 Nucleoporin NUP159 {Baker's yeast (Saccharomyces c 100.0
d2aaaa2381 Fungal alpha-amylases {Aspergillus niger, acid amy 100.0
d1mpxa2381 Alpha-amino acid ester hydrolase {Xanthomonas citr 100.0
d1t6ex_381 Xylanase inhibitor TAXI-I {Wheat (Triticum aestivu 100.0
d1ibja_380 Cystathionine beta-lyase, CBL {Thale cress (Arabid 100.0
d1vbga3380 Pyruvate phosphate dikinase, N-terminal domain {Ma 100.0
d2gmha1380 Electron transfer flavoprotein-ubiquinone oxidored 100.0
d1q45a_380 12-oxophytodienoate reductase (OPR, OYE homolog) { 100.0
d1qyia_380 Hypothetical protein MW1667 (SA1546) {Staphylococc 100.0
d1edga_380 Endoglucanase CelA {Clostridium cellulolyticum [Ta 100.0
d1elja_380 D-maltodextrin-binding protein, MBP {Archaeon Pyro 100.0
d2f5va1379 Pyranose 2-oxidase {White-rot fungus (Peniophora s 100.0
d1lj5a_379 Plasminogen activator inhibitor-1 {Human (Homo sap 100.0
d3sila_379 Salmonella sialidase {Salmonella typhimurium, stra 100.0
d1jr1a1378 Inosine monophosphate dehydrogenase (IMPDH) {Chine 100.0
d2icya2378 UDP-glucose pyrophosphorylase 2 (UDPGP 2) {Thale c 100.0
d1xqga_378 Maspin {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1jaea2378 Animal alpha-amylase {Yellow mealworm (Tenebrio mo 100.0
d1o6ca_377 UDP-N-acetylglucosamine 2-epimerase {Bacillus subt 100.0
d1a59a_377 Citrate synthase {Antarctic bacterium DS2-3R [TaxI 100.0
d1vjoa_377 Alanine-glyoxylate aminotransferase {Cyanobacteria 100.0
d2d5ja1377 Unsaturated glucuronyl hydrolase {Bacillus sp. GL1 100.0
d1ci9a_377 Esterase EstB {Burkholderia gladioli [TaxId: 28095 100.0
d1k8qa_377 Gastric lipase {Dog (Canis familiaris) [TaxId: 961 100.0
d2i71a1377 Hypothetical protein SSO1389 {Sulfolobus solfatari 100.0
d1jmma_377 V-region of surface antigen I/II (SA I/II, PAC) {S 100.0
d1nm8a1377 Carnitine acetyltransferase {Human (Homo sapiens) 100.0
d1f6da_376 UDP-N-acetylglucosamine 2-epimerase {Escherichia c 100.0
d1mdoa_376 Aminotransferase ArnB {Salmonella typhimurium [Tax 100.0
d2vata1376 Acetyl-CoA:deacetylcephalosporin C acetyltransfera 100.0
d1k9oi_376 Alaserpin (serpin 1) {Tobacco hornworm (Manduca se 100.0
d1eg5a_376 NifS-like protein/selenocysteine lyase {Thermotoga 100.0
d2v3qa1376 PstS-like phosphate-binding protein {Human (Homo s 100.0
d1wu4a1376 Xylanase Y {Bacillus halodurans [TaxId: 86665]} 100.0
d1bhea_376 Polygalacturonase {Erwinia carotovora, subsp. caro 100.0
d2fug41375 NADH-quinone oxidoreductase chain 4, Nqo4 {Thermus 100.0
d1o4sa_375 Aspartate aminotransferase, AAT {Thermotoga mariti 100.0
d2dula1375 N(2),N(2)-dimethylguanosine tRNA methyltransferase 100.0
d1ih7a1375 Exonuclease domain of family B DNA polymerases {Ba 100.0
g1hle.1375 Elastase inhibitor {Horse (Equus caballus) [TaxId: 100.0
d1kbla3375 Pyruvate phosphate dikinase, N-terminal domain {Cl 100.0
d1txka2374 Glucans biosynthesis protein G (MdoG, OpgG), N-ter 100.0
d1ioma_374 Citrate synthase {Thermus thermophilus [TaxId: 274 100.0
d2a0ua1374 Initiation factor 2b {Leishmania major [TaxId: 566 100.0
d1o69a_374 Aminotransferase homolog WlaK (PglE, Cj1121c) {Cam 100.0
d1nd7a_374 WW domain-containing protein 1, WWP1 {Human (Homo 100.0
d1gwja_374 Morphinone reductase {Pseudomonas putida [TaxId: 3 100.0
d1rp4a_374 Endoplasmic oxidoreductin 1, Ero1p {Baker's yeast 100.0
d2bvca2374 Glutamine synthetase, C-terminal domain {Mycobacte 100.0
d1so7a_374 Sialidase 2 (Neu2) {Human (Homo sapiens) [TaxId: 9 100.0
d1kfwa1374 Psychrophilic chitinase B {Arthrobacter sp., tad20 100.0
d1seza1373 Protoporphyrinogen oxidase {Tobacco (Nicotiana tab 100.0
d1v4va_373 UDP-N-acetylglucosamine 2-epimerase {Thermus therm 100.0
d1ogmx2373 Dextranase, catalytic domain {Penicillium miniolut 100.0
d2madh_373 Methylamine dehydrogenase, H-chain {Gram negative 100.0
d1miqa_373 Plasmepsin (a hemoglobin-degrading enzyme) {Plasmo 100.0
d1qo0a_373 Amide receptor/negative regulator of the amidase o 100.0
d1m0wa2373 Eukaryotic glutathione synthetase ATP-binding doma 100.0
d1r5ya_372 Queosine tRNA-guanine transglycosylase {Zymomonas 100.0
d1c3pa_372 HDAC homologue {Aquifex aeolicus [TaxId: 63363]} 100.0
d1j58a_372 Oxalate decarboxylase OxdC (YvrK) {Bacillus subtil 100.0
d1noya_372 Exonuclease domain of family B DNA polymerases {Ba 100.0
d1vkpa_372 Agmatine iminohydrolase {Thale-cress (Arabidopsis 100.0
d1qlpa_372 Antitrypsin, alpha-1 {Human (Homo sapiens) [TaxId: 100.0
g1htr.1372 Pepsin(ogen) {Human (Homo sapiens), progastricsin 100.0
d1teda_372 Polyketide synthase PKS18 {Mycobacterium tuberculo 100.0
d1mkfa_371 Viral chemokine binding protein m3 {Murid herpesvi 100.0
d1r53a_371 Chorismate synthase, AroC {Baker's yeast (Saccharo 100.0
d1to6a_371 Glycerate kinase GlxK {Neisseria meningitidis, (se 100.0
d1aj8a_371 Citrate synthase {Archaeon Pyrococcus furiosus [Ta 100.0
d1c8ba_371 Germination protease {Bacillus megaterium [TaxId: 100.0
d1n7oa1371 Hyaluronate lyase {Streptococcus pneumoniae [TaxId 100.0
d1f1sa1371 Hyaluronate lyase {Streptococcus agalactiae [TaxId 100.0
d1eg1a_371 Cellobiohydrolase I (cellulase, Endoglucanase I, C 100.0
d1r85a_371 Xylanase {Bacillus stearothermophilus, Xt6 [TaxId: 100.0
d1k8kc_371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 100.0
d2fnua1371 Spore coat polysaccharide biosynthesis protein C { 100.0
d2dexx3370 Peptidylarginine deiminase Pad4, catalytic C-termi 100.0
d2gx8a1370 Nif3-related protein BC4286 {Bacillus cereus [TaxI 100.0
d2hgsa4370 Eukaryotic glutathione synthetase ATP-binding doma 100.0
d3psga_370 Pepsin(ogen) {Pig (Sus scrofa) [TaxId: 9823]} 100.0
d2iida1370 L-aminoacid oxidase {Malayan pit viper (Calloselas 100.0
d1rh9a1370 Beta-mannanase {Tomato (Lycopersicon esculentum) [ 100.0
d3coxa1370 Cholesterol oxidase of GMC family {Brevibacterium 100.0
d2iw1a1370 Lipopolysaccharide core biosynthesis protein RfaG 100.0
d1iq0a2370 Arginyl-tRNA synthetase (ArgRS) {Thermus thermophi 100.0
d1itua_369 Renal dipeptidase {Human (Homo sapiens) [TaxId: 96 100.0
d1rwha1369 Chondroitinase AC {Arthrobacter aurescens [TaxId: 100.0
g1ii8.1369 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 100.0
d2ewoa1369 Agmatine iminohydrolase {Streptococcus mutans [Tax 100.0
d2heka1369 Hypothetical protein aq_1910 {Aquifex aeolicus [Ta 100.0
g1as4.1369 Antichymotrypsin, alpha-1 {Human (Homo sapiens) [T 100.0
d1ga6a_369 Serine-carboxyl proteinase, SCP {Pseudomonas sp., 100.0
d1laxa_369 D-maltodextrin-binding protein, MBP {Escherichia c 100.0
d1e7ua4369 Phoshoinositide 3-kinase (PI3K), catalytic domain 100.0
d2ncda_368 Kinesin motor Ncd (non-claret disjunctional) {Frui 100.0
d1r8ga_368 Carboxylate-amine ligase YbdK {Escherichia coli [T 100.0
d2cu0a1368 Inosine monophosphate dehydrogenase (IMPDH) {Pyroc 100.0
d1mdah_368 Methylamine dehydrogenase, H-chain {Paracoccus den 100.0
d1f52a2368 Glutamine synthetase, C-terminal domain {Salmonell 100.0
d1pyya4368 Penicillin-binding protein 2x (pbp-2x), transpepti 100.0
d1v2da_368 Glutamine aminotransferase {Thermus thermophilus [ 100.0
d1o7xa_367 Citrate synthase {Archaeon Sulfolobus solfataricus 100.0
d1d3ga_367 Dihydroorotate dehydrogenase {Human (Homo sapiens) 100.0
d1b65a_367 L-aminopeptidase D-Ala-esterase/amidase DmpA {Ochr 100.0
d1iuqa_367 Glycerol-3-phosphate (1)-acyltransferase {Cushaw s 100.0
d1ue8a_367 Cyp119 {Archaeon Sulfolobus tokodaii [TaxId: 11195 100.0
d1n4wa1367 Cholesterol oxidase of GMC family {Streptomyces sp 100.0
d1ursa_367 D-maltodextrin-binding protein, MBP {Alicyclobacil 100.0
d1qw9a2367 Alpha-L-arabinofuranosidase, catalytic domain {Bac 100.0
d1hz4a_366 Transcription factor MalT domain III {Escherichia 100.0
d1moqa_366 "Isomerase domain" of glucosamine 6-phosphate synt 100.0
d1io7a_366 Cyp119 {Archaeon Sulfolobus solfataricus [TaxId: 2 100.0
d1h6za1366 Pyruvate phosphate dikinase, C-terminal domain {Tr 100.0
d2bvya2366 Mannanase A, ManA {Cellulomonas fimi [TaxId: 1708] 100.0
d1jq5a_366 Glycerol dehydrogenase {Bacillus stearothermophilu 100.0
d1u5ua_366 Allene oxide synthase-lipoxygenase protein, N-term 100.0
d2aeua1366 Hypothetical protein MJ0158 {Archaeon Methanococcu 100.0
d1fn9a_365 Outer capsid protein sigma 3 {Reovirus [TaxId: 108 100.0
d1um0a_365 Chorismate synthase, AroC {Helicobacter pylori [Ta 100.0
d2pnwa1365 Membrane-bound lytic murein transglycosylase A, ML 100.0
d1zkda1365 Hypothetical protein RPA4359 {Rhodopseudomonas pal 100.0
d1u1ha2365 5-methyltetrahydropteroyltriglutamate--homocystein 100.0
d1w85a_365 Pyruvate dehydrogenase E1-alpha, PdhA {Bacillus st 100.0
d1zfja1365 Inosine monophosphate dehydrogenase (IMPDH) {Strep 100.0
d3c8ya1365 Fe-only hydrogenase, catalytic domain {Clostridium 100.0
d1jofa_365 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu 100.0
d1t64a_364 Histone deacetylase 8, HDAC8 {Human (Homo sapiens) 100.0
d1um8a_364 ClpX {Helicobacter pylori [TaxId: 210]} 100.0
d2jera1364 Agmatine iminohydrolase {Enterococcus faecalis [Ta 100.0
d1icpa_364 12-oxophytodienoate reductase (OPR, OYE homolog) { 100.0
d1sdma_364 Kinesin heavy chain-like protein {Potato (Solanum 100.0
d1kbla1364 Pyruvate phosphate dikinase, C-terminal domain {Cl 100.0
d1omwa3364 G-protein coupled receptor kinase 2 {Cow (Bos taur 100.0
d1kq3a_364 Glycerol dehydrogenase {Thermotoga maritima [TaxId 100.0
d2e7ja1364 Selenocysteinyl-tRNA synthase (SepSecS) {Archaeogl 100.0
d1us3a2364 Xylanase 10c {Cellvibrio japonicus [TaxId: 155077] 100.0
d1oc7a_364 Cellobiohydrolase II (Cel6) {Humicola insolens, Ce 100.0
d1w0pa3364 Vibrio cholerae sialidase {Vibrio cholerae [TaxId: 100.0
d1m7va_363 Nitric oxide (NO) synthase oxygenase domain {Bacil 100.0
d1zaia1363 Fructose-1,6-bisphosphate aldolase {Rabbit (Orycto 100.0
d1khba1363 Cytosolic phosphoenolpyruvate carboxykinase (GTP-h 100.0
d1zq1a2363 Glutamyl-tRNA(Gln) amidotransferase subunit D, Gat 100.0
d2c5aa1363 GDP-mannose-3', 5'-epimerase {Thale cress (Arabido 100.0
d1vyra_363 Pentaerythritol tetranirate reductase {Enterobacte 100.0
d1cnza_363 3-isopropylmalate dehydrogenase, IPMDH {Salmonella 100.0
d1onha_363 AMPC beta-Lactamase, class C {Enterobacter cloacae 100.0
d1nc5a_363 Hypothetical protein YteR {Bacillus subtilis [TaxI 100.0
d1kwfa_363 CelA cellulase {Clostridium thermocellum [TaxId: 1 100.0
d2a1ha1363 Branched-chain aminoacid aminotransferase {Human ( 100.0
d1umga_362 ST0318 {Archaeon Sulfolobus tokodaii [TaxId: 11195 100.0
d1gqea_362 Polypeptide chain release factor 2 (RF2) {Escheric 100.0
d1umda_362 Branched-chain alpha-keto acid dehydrogenase, PP m 100.0
d2pl5a1362 Homoserine O-acetyltransferase {Leptospira interro 100.0
d2drwa1362 D-Amino acid amidase DaaA {Ochrobactrum anthropi [ 100.0
d1v8ka_362 Kinesin {Mouse (Mus musculus), kif2c [TaxId: 10090 100.0
d1pvna1362 Inosine monophosphate dehydrogenase (IMPDH) {Tritr 100.0
d3thia_362 Thiaminase I {Paenibacillus thiaminolyticus [TaxId 100.0
d1nqka_362 Alkanesulfonate monooxygenase SsuD {Escherichia co 100.0
d1vlca_362 3-isopropylmalate dehydrogenase, IPMDH {Thermotoga 100.0
d1svma_362 Papillomavirus large T antigen helicase domain {Si 100.0
d2gjxa1362 beta-hexosaminidase A {Human (Homo sapiens) [TaxId 100.0
d1q8ya_362 Sky1p {Baker's yeast (Saccharomyces cerevisiae) [T 100.0
d1qjwa_362 Cellobiohydrolase II (Cel6) {Trichoderma reesei, C 100.0
d2ozla1361 E1-beta subunit of pyruvate dehydrogenase (PP modu 100.0
d1x1ia1361 Xanthan lyase {Bacillus sp. gl1 [TaxId: 84635]} 100.0
d1dhsa_361 Deoxyhypusine synthase, DHS {Human (Homo sapiens) 100.0
d1m32a_361 2-aminoethylphosphonate transaminase {Salmonella t 100.0
d2c0ra1361 Phosphoserine aminotransferase, PSAT {Bacillus cir 100.0
d1lt7a_361 Betaine-homocysteine S-methyltransferase {Human (H 100.0
d1rqga2361 Methionyl-tRNA synthetase (MetRS) {Pyrococcus abys 100.0
d1kewa_361 dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus 100.0
d1d2fa_361 Modulator in mal gene expression, MalY {Escherichi 100.0
d1pe9a_361 Pectate lyase {Erwinia chrysanthemi, type A [TaxId 100.0
d1mxga2361 Bacterial alpha-amylase {Archaeon Pyrococcus woese 100.0
d1qo5a_360 Fructose-1,6-bisphosphate aldolase {Human (Homo sa 100.0
d1sq1a_360 Chorismate synthase, AroC {Campylobacter jejuni [T 100.0
d1w23a_360 Phosphoserine aminotransferase, PSAT {Bacillus alc 100.0
d1jdwa_360 L-arginine: glycine amidinotransferase {Human (Hom 100.0
d1bjna_360 Phosphoserine aminotransferase, PSAT {Escherichia 100.0
d1xfia_360 Hypothetical protein At2g17340 {Thale cress (Arabi 100.0
d1oxwa_360 Patatin {Heartleaf nightshade (Solanum cardiophyll 100.0
d1pn0a1360 Phenol hydroxylase {Soil-living yeast (Trichosporo 100.0
d1kdga1360 Flavoprotein domain of flavocytochrome cellobiose 100.0
d2jbwa1360 2,6-dihydropseudooxynicotine hydrolase {Arthrobact 100.0
d1k32a3360 Tricorn protease domain 2 {Archaeon Thermoplasma a 100.0
d4bcla_359 Bacteriochlorophyll A protein {Prosthecochloris ae 100.0
d1goxa_359 Glycolate oxidase {Spinach (Spinacia oleracea) [Ta 100.0
d1m6ex_359 Salicylic acid carboxyl methyltransferase (SAMT) { 100.0
d1yvra1359 60-kda SS-aARo ribonucleoprotein {African clawed f 100.0
d1x74a1359 2-methylacyl-CoA racemase Mcr {Mycobacterium tuber 100.0
d1w36d1359 Exodeoxyribonuclease V alpha chain (RecD) {Escheri 100.0
d2hrca1359 Ferrochelatase {Human (Homo sapiens) [TaxId: 9606] 100.0
d1idka_359 Pectin lyase {Aspergillus niger, type A [TaxId: 50 100.0
d1qcxa_359 Pectin lyase {Aspergillus niger, type B [TaxId: 50 100.0
d1o2da_359 Alcohol dehydrogenase TM0920 {Thermotoga maritima 100.0
d2hdsa1358 AMPC beta-Lactamase, class C {Escherichia coli, ce 100.0
g1lq8.1358 Protein C inhibitor {Human (Homo sapiens) [TaxId: 100.0
d1ecea_358 Endocellulase E1 {Acidothermus cellulolyticus [Tax 100.0
d1m7ja3358 N-acyl-D-aminoacid amidohydrolase, catalytic domai 100.0
d1dosa_358 Fructose-bisphosphate aldolase (FBP aldolase) {Esc 100.0
d1jkma_358 Carboxylesterase {Bacillus subtilis, brefeldin A e 100.0
d1uwva2358 rRNA (Uracil-5-)-methyltransferase RumA, catalytic 100.0
d1edqa2358 Chitinase A, catalytic domain {Serratia marcescens 100.0
d1taza_357 Catalytic domain of cyclic nucleotide phosphodiest 100.0
d2qapa1357 Fructose-1,6-bisphosphate aldolase {Trypanosome (L 100.0
d2b61a1357 Homoserine O-acetyltransferase {Haemophilus influe 100.0
d1a05a_357 3-isopropylmalate dehydrogenase, IPMDH {Thiobacill 100.0
d1yyda1357 Fungal peroxidase (ligninase) {Basidomycetos fungu 100.0
d1t1ga_357 Serine-carboxyl proteinase, SCP {Bacillus novosp. 100.0
d1gcya2357 G4-amylase (1,4-alpha-D-glucan maltotetrahydrolase 100.0
d2amxa1357 Adenosine deaminase (ADA) {Plasmodium yoelii [TaxI 100.0
d1db3a_357 GDP-mannose 4,6-dehydratase {Escherichia coli [Tax 100.0
d1g01a_357 Alkaline cellulase K catalytic domain {Bacillus sp 100.0
d1mppa_357 Pepsin {Mucor pusillus [TaxId: 4840]} 100.0
d16vpa_356 Conserved core of transcriptional regulatory prote 100.0
d1r3sa_356 Uroporphyrinogen decarboxylase, UROD {Human (Homo 100.0
d1jnra2356 Adenylylsulfate reductase A subunit {Archaeon Arch 100.0
d1v53a1356 3-isopropylmalate dehydrogenase, IPMDH {Bacillus c 100.0
d1w8oa3356 Micromonospora sialidase, N-terminal domain {Micro 100.0
d1lbqa_356 Ferrochelatase {Baker's yeast (Saccharomyces cerev 100.0
d1jaka1356 beta-N-acetylhexosaminidase {Streptomyces plicatus 100.0
d1l0wa3356 Aspartyl-tRNA synthetase (AspRS) {Thermus thermoph 100.0
d1rkxa_356 CDP-glucose-4,6-dehydratase {Yersinia pseudotuberc 100.0
d2ebsa2356 Oligoxyloglucan reducing end-specific cellobiohydr 100.0
d1vbga1356 Pyruvate phosphate dikinase, C-terminal domain {Ma 100.0
d1goia2356 Chitinase B, catalytic domain {Serratia marcescens 100.0
d3bu7a1355 Gentisate 1,2-dioxygenase {Silicibacter pomeroyi [ 100.0
d1fuia2355 L-fucose isomerase, N-terminal and second domains 100.0
d2b1pa1355 c-jun N-terminal kinase (jnk3s) {Human (Homo sapie 100.0
d1luca_355 Bacterial luciferase alpha chain, LuxA {Vibrio har 100.0
d1jbqa_355 Cystathionine beta-synthase {Human (Homo sapiens) 100.0
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 100.0
g1mtp.1355 Thermopin {Thermobifida fusca [TaxId: 2021]} 100.0
d2bbkh_355 Methylamine dehydrogenase, H-chain {Paracoccus den 100.0
d1iq8a1355 Archaeosine tRNA-guanine transglycosylase, N-termi 100.0
>d2bhua3 c.1.8.1 (A:111-530) Glycosyltrehalose trehalohydrolase, central domain {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: (Trans)glycosidases
family: Amylase, catalytic domain
domain: Glycosyltrehalose trehalohydrolase, central domain
species: Deinococcus radiodurans [TaxId: 1299]

Probab=100.00  E-value=0  Score=31702.72  Aligned_cols=1  Identities=0%  Similarity=-0.427  Sum_probs=0.0

Q ss_pred             C-------------------------------------------------------------------------------
Q ss_conf             9-------------------------------------------------------------------------------
Q 000711          481 G-------------------------------------------------------------------------------  481 (1338)
Q Consensus       481 G-------------------------------------------------------------------------------  481 (1338)
                      -                                                                               
T Consensus         1 ~~~w~~~~~~~~~~~~~viYe~~~~~f~~~Gd~~g~~~~ldyl~~LGv~~i~L~Pv~~~~~~~~~GY~~~d~~~vdp~~G   80 (420)
T d2bhua3           1 TFDWTDADWHGIKLADCVFYEVHVGTFTPEGTYRAAAEKLPYLKELGVTAIQVMPLAAFDGQRGWGYDGAAFYAPYAPYG   80 (420)
T ss_dssp             SSCCCCTTCCCCCGGGCCEEEECHHHHSSSCSHHHHHHTHHHHHHHTCCEEEECCCEECSSSCCCSTTCCEEEEECGGGC
T ss_pred             CCCCCCCCCCCCCCCCCEEEEEEHHHCCCCCCHHHHHHHHHHHHHCCCCEEEECCCCCCCCCCCCCCCCCCCCCCCCCCC
T ss_conf             96899989798884224899996002188999999998679999769998995998768888998888566888685659


Q ss_pred             --------------------------------------------------------------------------------
Q ss_conf             --------------------------------------------------------------------------------
Q 000711          482 --------------------------------------------------------------------------------  481 (1338)
Q Consensus       482 --------------------------------------------------------------------------------  481 (1338)
                                                                                                      
T Consensus        81 ~~~d~~~lv~~aH~~gi~VilD~V~NH~~~~~~~~~~~~~~~~~~~~~~~~~~dlN~~np~v~~~~~~~~~~Wl~~~GVD  160 (420)
T d2bhua3          81 RPEDLMALVDAAHRLGLGVFLDVVYNHFGPSGNYLSSYAPSYFTDRFSSAWGMGLDYAEPHMRRYVTGNARMWLRDYHFD  160 (420)
T ss_dssp             CHHHHHHHHHHHHHTTCEEEEEECCSCCCSSSCCHHHHCGGGEEEEEECSSSEEECTTSHHHHHHHHHHHHHHHHHHCCS
T ss_pred             CHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHEEEECCCCC
T ss_conf             99999999999974054534465535667777633334443334554322345545368699999988764032014653


Q ss_pred             --------------------------------------------------------------------------------
Q ss_conf             --------------------------------------------------------------------------------
Q 000711          482 --------------------------------------------------------------------------------  481 (1338)
Q Consensus       482 --------------------------------------------------------------------------------  481 (1338)
                                                                                                      
T Consensus       161 GfR~D~~~~l~~~~~~~~~~~~~~~~~~~~p~~~~i~E~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  240 (420)
T d2bhua3         161 GLRLDATPYMTDDSETHILTELAQEIHELGGTHLLLAEDHRNLPDLVTVNHLDGIWTDDFHHETRVTLTGEQEGYYAGYR  240 (420)
T ss_dssp             EEEETTGGGCCCCSSSCHHHHHHHHHHTTCSCCEEEEECSSCCTHHHHTTCCSEEECTHHHHHHHHHHHCCCSGGGGGCC
T ss_pred             EEEEEEEEEECCCCCCCCHHHHHHHHHHHCCCCEEEECCCCCCHHHHCCCCCCCCCCCCCCHHHHHCCCCCCCCCCCCCC
T ss_conf             78873333202122310079998888764687425620357753121001125422323210444301334445312330


Q ss_pred             --------------------------------------------------------------------------------
Q ss_conf             --------------------------------------------------------------------------------
Q 000711          482 --------------------------------------------------------------------------------  481 (1338)
Q Consensus       482 --------------------------------------------------------------------------------  481 (1338)
                                                                                                      
T Consensus       241 ~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~~~~nHD~~~~~~~~~r~~~~~~~~~~~~k~a~~~ll  320 (420)
T d2bhua3         241 GGAEALAYTIRRGWRYEGQFWAVKGEEHERGHPSDALEAPNFVYCIQNHDQIGNRPLGERLHQSDGVTLHEYRGAAALLL  320 (420)
T ss_dssp             CSHHHHHHHHHHSSSCEEEEECCTTCCEEEECCCTTCCGGGEEEESCCHHHHHTSTTCCCGGGSTTCCHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHCCCCCCCHHHHHCHHHHHCCCCCCCCHHHEEEEECCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHH
T ss_conf             26678999985144446520443153554126433455213034321566323553112356643565999999999998


Q ss_pred             --------------------------------------------------------------------------------
Q ss_conf             --------------------------------------------------------------------------------
Q 000711          482 --------------------------------------------------------------------------------  481 (1338)
Q Consensus       482 --------------------------------------------------------------------------------  481 (1338)
                                                                                                      
T Consensus       321 t~pG~P~iy~GdEig~~~~~~~~~d~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~w~~~~~~~~~~~  400 (420)
T d2bhua3         321 TLPMTPLLFQGQEWAASTPFQFFSDHAGELGQAVSEGRKKEFGGFSGFSGEDVPDPQAEQTFLNSKLNWAEREGGEHART  400 (420)
T ss_dssp             HSSSEEEEETTGGGTCSSCCCCCCCCCHHHHHHHHHHHHHHC---------CCCCTTSHHHHHTTSCCSGGGGSHHHHHH
T ss_pred             HCCCCCEEECCHHHCCCCCCCCCCCCCCHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHCCCCCHHH
T ss_conf             48998798577511789986323456402203544466311367776665557886555544456678788623476899


Q ss_pred             -------------------C
Q ss_conf             -------------------9
Q 000711          482 -------------------S  482 (1338)
Q Consensus       482 -------------------s  482 (1338)
                                         -
T Consensus       401 ~~~yr~Li~lRk~~p~l~~~  420 (420)
T d2bhua3         401 LRLYRDLLRLRREDPVLHNR  420 (420)
T ss_dssp             HHHHHHHHHHHHHCTTTTCC
T ss_pred             HHHHHHHHHHHHCCHHHHCC
T ss_conf             99999999999568987575
>d1ejda_ d.68.2.2 (A:) UDP-N-acetylglucosamine enolpyruvyl transferase (EPT, MurA, MurZ) {Enterobacter cloacae [TaxId: 550]} Back     information, alignment and structure
>d2df7a1 b.121.4.9 (A:11-429) Birnavirus VP2 {Infectious bursal disease virus [TaxId: 10995]} Back     information, alignment and structure
>d1om4a_ d.174.1.1 (A:) Nitric oxide (NO) synthase oxygenase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2gp4a2 d.334.1.1 (A:1-418) 6-phosphogluconate dehydratase EDD {Shewanella oneidensis [TaxId: 70863]} Back     information, alignment and structure
>d1f61a_ c.1.12.7 (A:) Isocitrate lyase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2r5ea1 c.67.1.1 (A:12-429) Kynurenine--oxoglutarate transaminase I {Yellowfever mosquito (Aedes aegypti) [TaxId: 7159]} Back     information, alignment and structure
>d1w7la_ c.67.1.1 (A:) Kynurenine--oxoglutarate transaminase I {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pv7a_ f.38.1.2 (A:) Lactose permease {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1w6ga1 b.30.2.1 (A:212-628) Copper amine oxidase, domain 3 {Arthrobacter globiformis [TaxId: 1665]} Back     information, alignment and structure
>d3bona1 d.92.1.7 (A:3-419) Botulinum neurotoxin {Clostridium botulinum, serotype A [TaxId: 1491]} Back     information, alignment and structure
>d1q7ea_ c.123.1.1 (A:) Hypothetical protein YfdW {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gff1_ b.121.5.1 (1:) Microvirus capsid proteins {Bacteriophage G4 [TaxId: 10843]} Back     information, alignment and structure
>d2csga1 b.82.2.12 (A:3-419) Hypothetical protein YbiU {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1ltka_ c.86.1.1 (A:) Phosphoglycerate kinase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1vema2 c.1.8.1 (A:1-417) Bacterial beta-amylase {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1q2oa_ d.174.1.1 (A:) Nitric oxide (NO) synthase oxygenase domain {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1dfoa_ c.67.1.4 (A:) Serine hydroxymethyltransferase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1d8wa_ c.1.15.2 (A:) L-rhamnose isomerase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2vnud4 b.40.4.16 (D:495-910) Exosome complex exonuclease RRP44 {Saccharomyces cerevisiae [TaxId: 4932]} Back     information, alignment and structure
>d1igwa_ c.1.12.7 (A:) Isocitrate lyase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pb1a_ c.77.1.1 (A:) Isocitrate dehydrogenase, ICDH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dnva_ b.121.5.3 (A:) Densovirus capsid protein {Galleria mellonella densovirus [TaxId: 37138]} Back     information, alignment and structure
>d2ieaa2 c.36.1.10 (A:56-470) Pyruvate dehydrogenase E1 component, PP module {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1so2a_ a.211.1.2 (A:) cGMP-inhibited 3',5'-cyclic phosphodiesterase B, pde3b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d16pka_ c.86.1.1 (A:) Phosphoglycerate kinase {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1qpga_ c.86.1.1 (A:) Phosphoglycerate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2qeec1 c.1.9.8 (C:2-416) Uncharacterized protein BH0493 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1s5ja2 e.8.1.1 (A:450-864) Family B DNA polymerase {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1kbia1 c.1.4.1 (A:98-511) Flavocytochrome b2, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2b8na1 c.118.1.1 (A:4-417) Putative glycerate kinase (hypothetical protein TM1585) {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1o20a_ c.82.1.1 (A:) Gamma-glutamyl phosphate reductase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1t0la_ c.77.1.1 (A:) NADP-dependent isocitrate dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vh4a_ b.80.6.1 (A:) Stabilizer of iron transporter SufD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1t5la1 c.37.1.19 (A:2-414) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} Back     information, alignment and structure
>d1hdia_ c.86.1.1 (A:) Phosphoglycerate kinase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1lwda_ c.77.1.1 (A:) NADP-dependent isocitrate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2qgma1 c.150.1.3 (A:33-445) Succinoglycan biosynthesis protein BC3205 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1zjca1 e.60.1.1 (A:3-415) Aminopeptidase S, AMPS {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1ulva1 a.102.1.5 (A:274-686) Glucodextranase, domain A {Arthrobacter globiformis [TaxId: 1665]} Back     information, alignment and structure
>d1a0tp_ f.4.3.2 (P:) Sucrose-specific porin {Enterobacterium (Salmonella typhimurium) [TaxId: 90371]} Back     information, alignment and structure
>d1ocka_ c.117.1.1 (A:) Malonamidase E2 {Bradyrhizobium japonicum [TaxId: 375]} Back     information, alignment and structure
>d1yzya1 c.146.1.1 (A:1-412) Hypothetical protein HI1011 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1yaaa_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Baker's yeast (Saccharomyces cerevisiae), cytosolic form [TaxId: 4932]} Back     information, alignment and structure
>d1bw0a_ c.67.1.1 (A:) Tyrosine aminotransferase (TAT) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1rxxa_ d.126.1.4 (A:) Arginine deiminase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1ajsa_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Pig (Sus scrofa), cytosolic form [TaxId: 9823]} Back     information, alignment and structure
>d1ufaa2 c.6.2.4 (A:1-412) Hypothetical protein TT1467, N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1t3ca_ d.92.1.7 (A:) Botulinum neurotoxin {Clostridium botulinum, serotype E [TaxId: 1491]} Back     information, alignment and structure
>d2afaa1 a.102.1.3 (A:4-415) Putative NAG isomerase YihS {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1ux5a_ a.207.1.1 (A:) Bni1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1izoa_ a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2ccaa1 a.93.1.3 (A:26-435) Catalase-peroxidase KatG {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1p1ja1 c.2.1.3 (A:9-322,A:438-533) Myo-inositol 1-phosphate synthase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1kfsa2 e.8.1.1 (A:519-928) DNA polymerase I (Klenow fragment) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1s5ja1 c.55.3.5 (A:40-449) Exonuclease domain of family B DNA polymerases {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1uuqa_ c.1.8.3 (A:) Exomannosidase {Cellvibrio mixtus [TaxId: 39650]} Back     information, alignment and structure
>d2cmza1 e.76.1.2 (A:1-409) Spike glycoprotein {Vesicular stomatitis indiana virus [TaxId: 11277]} Back     information, alignment and structure
>d1tv5a1 c.1.4.1 (A:158-566) Dihydroorotate dehydrogenase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1qtma2 e.8.1.1 (A:423-831) DNA polymerase I (Klenow fragment) {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d2g0da1 a.102.6.1 (A:7-415) Nisin biosynthesis protein NisC {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d1b25a1 a.110.1.1 (A:211-619) Formaldehyde ferredoxin oxidoreductase {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1s9ra_ d.126.1.4 (A:) Arginine deiminase {Mycoplasma arginini [TaxId: 2094]} Back     information, alignment and structure
>d1dkla_ c.60.1.2 (A:) Phytase (myo-inositol-hexakisphosphate-3-phosphohydrolase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wzaa2 c.1.8.1 (A:28-436) Bacterial alpha-amylase {Halothermothrix orenii [TaxId: 31909]} Back     information, alignment and structure
>d1r76a_ a.102.5.1 (A:) Polygalacturonic acid lyase (pectate lyase) {Azospirillum irakense [TaxId: 34011]} Back     information, alignment and structure
>d1c4oa1 c.37.1.19 (A:2-409) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1f1oa_ a.127.1.1 (A:) Adenylosuccinate lyase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1h4pa_ c.1.8.3 (A:) Exo-beta-(1,3)-glucanase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2hhva2 e.8.1.1 (A:469-876) DNA polymerase I (Klenow fragment) {Bacillus stearothermophilus, newly identified strain as yet unnamed [TaxId: 1422]} Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t3ia_ c.67.1.3 (A:) Probable cysteine desulfurase SufS {Synechocystis sp. PCC 6803 [TaxId: 1148]} Back     information, alignment and structure
>d1qs0a_ c.36.1.11 (A:) 2-oxoisovalerate dehydrogenase (E1B), PP module {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1eu8a_ c.94.1.1 (A:) D-maltodextrin-binding protein, MBP {Archaeon Thermococcus litoralis [TaxId: 2265]} Back     information, alignment and structure
>d1qhoa4 c.1.8.1 (A:1-407) Cyclodextrin glycosyltransferase {Bacillus stearothermophilus, maltogenic alpha-amylase [TaxId: 1422]} Back     information, alignment and structure
>d1u2za_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1itka1 a.93.1.3 (A:18-423) Catalase-peroxidase KatG {Archaeon Haloarcula marismortui [TaxId: 2238]} Back     information, alignment and structure
>d1mwva1 a.93.1.3 (A:35-440) Catalase-peroxidase KatG {Burkholderia pseudomallei [TaxId: 28450]} Back     information, alignment and structure
>d1ei6a_ c.76.1.4 (A:) Phosphonoacetate hydrolase {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1ub2a1 a.93.1.3 (A:21-426) Catalase-peroxidase KatG {Synechococcus sp. pcc 7942 [TaxId: 1140]} Back     information, alignment and structure
>d2ayia1 e.60.1.1 (A:3-408) Aminopeptidase T {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d3bmva4 c.1.8.1 (A:1-406) Cyclodextrin glycosyltransferase {Thermoanaerobacterium [TaxId: 28895]} Back     information, alignment and structure
>d1kl1a_ c.67.1.4 (A:) Serine hydroxymethyltransferase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2nwwa1 f.49.1.1 (A:12-416) Proton glutamate symport protein {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1h6za3 d.142.1.5 (A:1-405) Pyruvate phosphate dikinase, N-terminal domain {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1jf9a_ c.67.1.3 (A:) NifS-like protein/selenocysteine lyase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lnsa3 c.69.1.21 (A:146-550) X-Prolyl dipeptidyl aminopeptidase PepX, middle domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d1qz9a_ c.67.1.3 (A:) Kynureninase {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d2b5dx2 c.6.2.4 (X:1-404) Alpha-amylase AmyC {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1re9a_ a.104.1.1 (A:) Cytochrome P450-CAM {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1uyra2 c.14.1.4 (A:1815-2218) Acetyl-coenzyme A carboxylase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1z7da1 c.67.1.4 (A:7-410) Ornithine aminotransferase {Plasmodium yoelii yoelii [TaxId: 73239]} Back     information, alignment and structure
>d2byla1 c.67.1.4 (A:36-439) Ornithine aminotransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h12a_ a.102.1.2 (A:) Endo-1,4-beta-xylanase {Pseudoalteromonas haloplanktis [TaxId: 228]} Back     information, alignment and structure
>d1wsta1 c.67.1.1 (A:13-415) Multiple substrate aminotransferase, MSAT {Thermococcus profundus [TaxId: 49899]} Back     information, alignment and structure
>d1xksa_ b.69.14.1 (A:) Nuclear pore complex protein Nup133 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ueda_ a.104.1.1 (A:) p450 monoxygenase OxyC {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d1hx0a2 c.1.8.1 (A:1-403) Animal alpha-amylase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1gwia_ a.104.1.1 (A:) Cyp154c1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d3b55a1 c.150.1.3 (A:40-442) Succinoglycan biosynthesis protein BC3120 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1dofa_ a.127.1.1 (A:) Adenylosuccinate lyase {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d2g5da1 b.52.1.4 (A:40-441) Membrane-bound lytic murein transglycosylase A, MLTA {Neisseria gonorrhoeae [TaxId: 485]} Back     information, alignment and structure
>d1xk7a1 c.123.1.1 (A:4-405) Crotonobetainyl-CoA:carnitine CoA-transferase, CaiB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fp3a_ a.102.1.3 (A:) N-acyl-D-glucosamine 2-epimerase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1z8oa1 a.104.1.1 (A:3-404) Cytochrome P450-ERYF {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1fc4a_ c.67.1.4 (A:) 2-amino-3-ketobutyrate CoA ligase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1q5da_ a.104.1.1 (A:) Cytochrome P450epok {Sorangium cellulosum [TaxId: 56]} Back     information, alignment and structure
>d1a12a_ b.69.5.1 (A:) Regulator of chromosome condensation RCC1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iira_ c.87.1.5 (A:) UDP-glucosyltransferase GtfB {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d1rrva_ c.87.1.5 (A:) TDP-vancosaminyltransferase GftD {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d2h6fb1 a.102.4.3 (B:521-921) Protein farnesyltransferase, beta-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jdpa_ c.93.1.1 (A:) Hormone binding domain of the atrial natriuretic peptide receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d7aata_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Chicken (Gallus gallus), mitochondria [TaxId: 9031]} Back     information, alignment and structure
>d2r7da2 b.40.4.16 (A:3-403) Ribonuclease II family protein DR0020 {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1odoa_ a.104.1.1 (A:) Cyp154a1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1ru4a_ b.80.1.9 (A:) Pectate transeliminase {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d1tq4a_ c.37.1.8 (A:) Interferon-inducible GTPase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d3ovwa_ b.29.1.10 (A:) Cellobiohydrolase I (cellulase, Endoglucanase I, CBH1) {Fusarium oxysporum [TaxId: 5507]} Back     information, alignment and structure
>d1inpa_ e.7.1.1 (A:) Inositol polyphosphate 1-phosphatase {Cow (Bos taurus), brain [TaxId: 9913]} Back     information, alignment and structure
>d1eh9a3 c.1.8.1 (A:91-490) Glycosyltrehalose trehalohydrolase, central domain {Archaeon Sulfolobus solfataricus, km1 [TaxId: 2287]} Back     information, alignment and structure
>d2olua2 e.3.1.1 (A:293-692) Penicillin-binding protein 2, PBP2 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1oyaa_ c.1.4.1 (A:) Old yellow enzyme (OYE) {Lager yeast (Saccharomyces pastorianus) [TaxId: 27292]} Back     information, alignment and structure
>d1s1fa_ a.104.1.1 (A:) Cyp158a2 {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d2ah2a2 b.68.1.1 (A:1-399) Trypanosoma sialidase {Parasitic flagellate protozoan (Trypanosoma cruzi) [TaxId: 5693]} Back     information, alignment and structure
>d1jfba_ a.104.1.1 (A:) Cytochrome P450-NOR, nitric reductase {Fungus (Fusarium oxysporum) [TaxId: 5507]} Back     information, alignment and structure
>d1bn8a_ b.80.1.1 (A:) Pectate lyase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1vpea_ c.86.1.1 (A:) Phosphoglycerate kinase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1qgna_ c.67.1.3 (A:) Cystathionine gamma-synthase, CGS {Common tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1vlja_ e.22.1.2 (A:) NADH-dependent butanol dehydrogenase A (TM0820) {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1y4ia1 c.67.1.3 (A:2-398) Methionine gamma-lyase, MGL {Citrobacter freundii [TaxId: 546]} Back     information, alignment and structure
>d1q1la_ d.258.1.1 (A:) Chorismate synthase, AroC {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1vkoa1 c.2.1.3 (A:11-314,A:429-521) Myo-inositol 1-phosphate synthase {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d3tata_ c.67.1.1 (A:) Aromatic aminoacid aminotransferase, AroAT {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lf6a1 a.102.1.5 (A:288-684) Bacterial glucoamylase, C-terminal domain {Thermoanaerobacterium thermosaccharolyticum [TaxId: 1517]} Back     information, alignment and structure
>d1vjva_ d.3.1.9 (A:) Ubiquitin carboxyl-terminal hydrolase 6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2bwna1 c.67.1.4 (A:2-397) 5-aminolevulinate synthase {Rhodobacter capsulatus [TaxId: 1061]} Back     information, alignment and structure
>d1m7xa3 c.1.8.1 (A:227-622) 1,4-alpha-glucan branching enzyme, central domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2q7wa1 c.67.1.1 (A:1-396) Aspartate aminotransferase, AAT {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1io1a_ e.32.1.1 (A:) Phase 1 flagellin {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2bfda1 c.36.1.11 (A:6-400) Branched-chain alpha-keto acid dehydrogenase, PP module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nw1a_ d.144.1.8 (A:) Choline kinase {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d2py6a1 c.66.1.56 (A:14-408) Methyltransferase FkbM {Methylobacillus flagellatus [TaxId: 405]} Back     information, alignment and structure
>d1aora1 a.110.1.1 (A:211-605) Aldehyde ferredoxin oxidoreductase {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1w36b2 c.37.1.19 (B:486-880) Exodeoxyribonuclease V beta chain (RecB), N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xi9a_ c.67.1.1 (A:) Putative alanine aminotransferase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1n40a_ a.104.1.1 (A:) Cyp121 monooxygenase (P450 Mt2) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1e5ea_ c.67.1.3 (A:) Methionine gamma-lyase, MGL {Trichomonas vaginalis, MGL1 [TaxId: 5722]} Back     information, alignment and structure
>d1phpa_ c.86.1.1 (A:) Phosphoglycerate kinase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1u1ha1 c.1.22.2 (A:2-395) 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase MetE {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2ay1a_ c.67.1.1 (A:) Aromatic aminoacid aminotransferase, AroAT {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1qo7a_ c.69.1.11 (A:) Bacterial epoxide hydrolase {Aspergillus niger [TaxId: 5061]} Back     information, alignment and structure
>d1c7na_ c.67.1.3 (A:) Cystalysin {Treponema denticola [TaxId: 158]} Back     information, alignment and structure
>d2pb1a1 c.1.8.3 (A:7-400) Exo-beta-(1,3)-glucanase {Yeast (Candida albicans) [TaxId: 5476]} Back     information, alignment and structure
>d1lfka_ a.104.1.1 (A:) p450 monoxygenase OxyB {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d1atia2 d.104.1.1 (A:1-394) Glycyl-tRNA synthetase (GlyRS) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2d3na2 c.1.8.1 (A:5-398) Bacterial alpha-amylase {Bacillus sp. 707 [TaxId: 1416]} Back     information, alignment and structure
>d1q8ia2 e.8.1.1 (A:390-783) Family B DNA polymerase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ldja2 a.118.17.1 (A:17-410) Cullin homolog 1, Cul-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n8pa_ c.67.1.3 (A:) Cystathionine gamma-lyase (CYS3) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1xlma_ c.1.15.3 (A:) D-xylose isomerase {Arthrobacter, strain b3728 [TaxId: 1663]} Back     information, alignment and structure
>d1kwga2 c.1.8.1 (A:1-393) A4 beta-galactosidase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1g8ma2 c.97.1.4 (A:201-593) AICAR transformylase domain of bifunctional purine biosynthesis enzyme ATIC {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1i24a_ c.2.1.2 (A:) Sulfolipid biosynthesis protein SQD1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1hvxa2 c.1.8.1 (A:1-393) Bacterial alpha-amylase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1e43a2 c.1.8.1 (A:1-393) Bacterial alpha-amylase {Chimera (Bacillus amyloliquefaciens) and (Bacillus licheniformis) [TaxId: 1390]} Back     information, alignment and structure
>d1gc0a_ c.67.1.3 (A:) Methionine gamma-lyase, MGL {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2d0ta1 a.266.1.2 (A:12-403) Indoleamine 2,3-dioxygenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2pula1 d.144.1.6 (A:5-396) Methylthioribose kinase MtnK {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1xima_ c.1.15.3 (A:) D-xylose isomerase {Actinoplanes missouriensis [TaxId: 1866]} Back     information, alignment and structure
>d1yvua2 c.55.3.10 (A:315-706) Argonaute homologue Aq_1447 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1cl1a_ c.67.1.3 (A:) Cystathionine beta-lyase, CBL {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pn3a_ c.87.1.5 (A:) TDP-epi-vancosaminyltransferase GtfA {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d1gpea1 c.3.1.2 (A:1-328,A:525-587) Glucose oxidase {Penicillium amagasakiense [TaxId: 63559]} Back     information, alignment and structure
>d1nt4a_ c.60.1.2 (A:) Glucose-1-phosphatase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1p3wa_ c.67.1.3 (A:) Cysteine desulfurase IscS {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lwha2 c.1.8.1 (A:1-391) 4-alpha-glucanotransferase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d4ubpc2 c.1.9.2 (C:132-434,C:484-570) alpha-subunit of urease, catalytic domain {Bacillus pasteurii [TaxId: 1474]} Back     information, alignment and structure
>d1v6sa_ c.86.1.1 (A:) Phosphoglycerate kinase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1nsca_ b.68.1.1 (A:) Influenza neuraminidase {Influenza B virus, different strains [TaxId: 11520]} Back     information, alignment and structure
>d1qopb_ c.79.1.1 (B:) Tryptophan synthase, beta-subunit {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1oj7a_ e.22.1.2 (A:) Hypothetical oxidoreductase yqhD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ud2a2 c.1.8.1 (A:1-390) Bacterial alpha-amylase {Bacillus sp., ksm-k38 [TaxId: 1409]} Back     information, alignment and structure
>d1sg6a_ e.22.1.1 (A:) Dehydroquinate synthase, DHQS {Aspergillus nidulans [TaxId: 162425]} Back     information, alignment and structure
>d2gb3a1 c.67.1.1 (A:4-392) AAT homologue TM1698 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1jiha2 e.8.1.7 (A:1-389) DNA polymerase eta {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1e9yb2 c.1.9.2 (B:132-431,B:481-569) alpha-subunit of urease, catalytic domain {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2o3ia1 e.73.1.1 (A:2-390) Hypothetical protein CV3147 {Chromobacterium violaceum [TaxId: 536]} Back     information, alignment and structure
>d1f8ea_ b.68.1.1 (A:) Influenza neuraminidase {Influenza A virus, different strains [TaxId: 11320]} Back     information, alignment and structure
>d1u7la_ e.57.1.1 (A:) Vacuolar ATP synthase subunit C {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1eepa_ c.1.5.1 (A:) Inosine monophosphate dehydrogenase (IMPDH) {Lyme disease spirochete (Borrelia burgdorferi) [TaxId: 139]} Back     information, alignment and structure
>d1qxoa_ d.258.1.1 (A:) Chorismate synthase, AroC {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d2ch1a1 c.67.1.3 (A:2-389) 3-hydroxykynurenine transaminase {Malaria mosquito (Anopheles gambiae) [TaxId: 7165]} Back     information, alignment and structure
>d2dcfa1 e.3.1.1 (A:5-392) 6-aminohexanoate-dimer hydrolase NylC {Flavobacterium sp. [TaxId: 239]} Back     information, alignment and structure
>d1gdea_ c.67.1.1 (A:) Aromatic aminoacid aminotransferase, AroAT {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2py5a2 e.8.1.1 (A:188-575) phi29 DNA polymerase {Bacteriophage phi-29 [TaxId: 10756]} Back     information, alignment and structure
>d1q8ia1 c.55.3.5 (A:2-389) Exonuclease domain of family B DNA polymerases {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1h0ca_ c.67.1.3 (A:) Alanine-glyoxylate aminotransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1j32a_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Phormidium lapideum [TaxId: 32060]} Back     information, alignment and structure
>d1ku0a_ c.69.1.18 (A:) Lipase L1 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1x38a1 c.1.8.7 (A:1-388) Beta-D-glucan exohydrolase, N-terminal domain {Barley (Hordeum vulgare) [TaxId: 4513]} Back     information, alignment and structure
>d1zeea1 a.266.1.2 (A:6-392) Hypothetical protein SO4414 {Shewanella oneidensis [TaxId: 70863]} Back     information, alignment and structure
>d2aepa1 b.68.1.1 (A:83-469) Influenza neuraminidase {Influenza A virus, different strains [TaxId: 11320]} Back     information, alignment and structure
>d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1vefa1 c.67.1.4 (A:9-395) Acetylornithine/acetyl-lysine aminotransferase ArgD {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1zsqa2 c.45.1.3 (A:199-585) Myotubularin-related protein 2, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bxba_ c.1.15.3 (A:) D-xylose isomerase {Thermus aquaticus, subsp. Thermophilus [TaxId: 271]} Back     information, alignment and structure
>d2qp8a1 b.50.1.2 (A:60-446) beta-secretase (memapsin) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Back     information, alignment and structure
>d1ur4a_ c.1.8.3 (A:) Beta-1,4-galactanase {Bacillus licheniformis [TaxId: 1402]} Back     information, alignment and structure
>d2ex0a1 c.87.1.9 (A:26-412) Alpha-2,3/2,6-sialyltransferase/sialidase {Pasteurella multocida [TaxId: 747]} Back     information, alignment and structure
>d1r6ta2 c.26.1.1 (A:82-467) Tryptophanyl-tRNA synthetase (TrpRS) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v8za1 c.79.1.1 (A:1-386) Tryptophan synthase, beta-subunit {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1muwa_ c.1.15.3 (A:) D-xylose isomerase {Streptomyces olivochromogenes [TaxId: 1963]} Back     information, alignment and structure
>d3c10a1 c.42.1.2 (A:515-900) Histone deacetylase 7, HDAC7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v5da_ a.102.1.2 (A:) Chitosanase {Bacillus sp., strain k17 [TaxId: 1409]} Back     information, alignment and structure
>d1xmxa_ c.52.1.26 (A:) Hypothetical protein VC1899 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1rrma_ e.22.1.2 (A:) Lactaldehyde reductase FucO {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ir6a_ c.107.1.2 (A:) Exonuclease RecJ {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1uhga_ e.1.1.1 (A:) Ovalbumin {Hen (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1ejxc2 c.1.9.2 (C:1130-1422,C:1476-1567) alpha-subunit of urease, catalytic domain {Klebsiella aerogenes [TaxId: 28451]} Back     information, alignment and structure
>d1cf3a1 c.3.1.2 (A:3-324,A:521-583) Glucose oxidase {Aspergillus niger [TaxId: 5061]} Back     information, alignment and structure
>d1n97a_ a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2c5wb1 e.3.1.1 (B:266-650) Penicillin-binding protein 1a, transpeptidase domain {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d2b9va2 c.69.1.21 (A:50-434) Alpha-amino acid ester hydrolase {Acetobacter pasteurianus [TaxId: 438]} Back     information, alignment and structure
>d2ix0a4 b.40.4.16 (A:173-557) Exoribonuclease 2, RNB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3c0na2 f.8.1.1 (A:85-468) (Pro)aerolysin, pore-forming lobe {Aeromonas hydrophila [TaxId: 644]} Back     information, alignment and structure
>d1cs1a_ c.67.1.3 (A:) Cystathionine gamma-synthase, CGS {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mtyb_ a.25.1.2 (B:) Methane monooxygenase hydrolase beta subunit {Methylococcus capsulatus [TaxId: 414]} Back     information, alignment and structure
>d1b9ha_ c.67.1.4 (A:) 3-amino-5-hydroxybenzoic acid synthase (AHBA synthase) {Amycolatopsis mediterranei [TaxId: 33910]} Back     information, alignment and structure
>d1hn0a1 a.102.3.2 (A:235-618) Chondroitin ABC lyase I {Proteus vulgaris [TaxId: 585]} Back     information, alignment and structure
>d2fvka2 c.1.9.6 (A:57-440) Dihydropyrimidine amidohydrolase Pyd2 {Yeast (Saccharomyces kluyveri) [TaxId: 4934]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1vz6a_ d.154.1.2 (A:) Glutamate N-acetyltransferase 2 (ornithine acetyltransferase) {Streptomyces clavuligerus [TaxId: 1901]} Back     information, alignment and structure
>d1u7ga_ f.44.1.1 (A:) Ammonium transporter AmtB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1bs0a_ c.67.1.4 (A:) PLP-dependent acyl-CoA synthase (8-amino-7-oxonanoate synthase, AONS) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mhyb_ a.25.1.2 (B:) Methane monooxygenase hydrolase beta subunit {Methylosinus trichosporium [TaxId: 426]} Back     information, alignment and structure
>d1bo1a_ d.143.1.2 (A:) Phosphatidylinositol phosphate kinase IIbeta, PIPK IIbeta {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2v5za1 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1imva_ e.1.1.1 (A:) Pigment epithelium-derived factor, PEDF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gy8a_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d2ayna1 d.3.1.9 (A:100-482) Ubiquitin carboxyl-terminal hydrolase 14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u08a_ c.67.1.1 (A:) Putative methionine aminotransferase YdbL {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1b5pa_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1wkva1 c.79.1.1 (A:2-383) O-acetylserine sulfhydrylase (Cysteine synthase) {Archaeon Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1ea9c3 c.1.8.1 (C:122-503) Maltogenic amylase, central domain {Bacillus sp., cyclomaltodextrinase [TaxId: 1409]} Back     information, alignment and structure
>d2bkwa1 c.67.1.3 (A:3-384) Alanine-glyoxylate aminotransferase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1t1ua1 c.43.1.3 (A:20-401) Choline O-acetyltransferase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1xl7a1 c.43.1.3 (A:11-392) Peroxisomal carnitine O-octanoyltransferase, COT {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wzla3 c.1.8.1 (A:121-502) Maltogenic amylase, central domain {Thermoactinomyces vulgaris, TVAII [TaxId: 2026]} Back     information, alignment and structure
>d1j0ha3 c.1.8.1 (A:124-505) Neopullulanase, central domain {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d3bvua3 c.6.2.1 (A:31-411) Golgi alpha-mannosidase II {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1by7a_ e.1.1.1 (A:) Plasminogen activator inhibitor-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1odza_ c.1.8.3 (A:) Mannanase A, ManA {Pseudomonas cellulosa (Cellvibrio japonicus) [TaxId: 155077]} Back     information, alignment and structure
>d2bo4a1 c.68.1.18 (A:2-382) Mannosylglycerate synthase, MGS {Rhodothermus marinus [TaxId: 29549]} Back     information, alignment and structure
>d1elua_ c.67.1.3 (A:) Cystine C-S lyase C-des {Synechocystis sp. [TaxId: 1143]} Back     information, alignment and structure
>d2guya2 c.1.8.1 (A:1-381) Fungal alpha-amylases {Aspergillus oryzae, Taka-amylase [TaxId: 5062]} Back     information, alignment and structure
>d1xipa_ b.69.14.1 (A:) Nucleoporin NUP159 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2aaaa2 c.1.8.1 (A:1-381) Fungal alpha-amylases {Aspergillus niger, acid amylase [TaxId: 5061]} Back     information, alignment and structure
>d1mpxa2 c.69.1.21 (A:24-404) Alpha-amino acid ester hydrolase {Xanthomonas citri [TaxId: 346]} Back     information, alignment and structure
>d1t6ex_ b.50.1.2 (X:) Xylanase inhibitor TAXI-I {Wheat (Triticum aestivum) [TaxId: 4565]} Back     information, alignment and structure
>d1ibja_ c.67.1.3 (A:) Cystathionine beta-lyase, CBL {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1vbga3 d.142.1.5 (A:3-382) Pyruvate phosphate dikinase, N-terminal domain {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d2gmha1 c.3.1.2 (A:4-236,A:336-482) Electron transfer flavoprotein-ubiquinone oxidoreductase, EFT-QO {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1q45a_ c.1.4.1 (A:) 12-oxophytodienoate reductase (OPR, OYE homolog) {Thale cress (Arabidopsis thaliana), OPR3 [TaxId: 3702]} Back     information, alignment and structure
>d1qyia_ c.108.1.13 (A:) Hypothetical protein MW1667 (SA1546) {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1edga_ c.1.8.3 (A:) Endoglucanase CelA {Clostridium cellulolyticum [TaxId: 1521]} Back     information, alignment and structure
>d1elja_ c.94.1.1 (A:) D-maltodextrin-binding protein, MBP {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2f5va1 c.3.1.2 (A:43-354,A:553-619) Pyranose 2-oxidase {White-rot fungus (Peniophora sp. SG) [TaxId: 204723]} Back     information, alignment and structure
>d1lj5a_ e.1.1.1 (A:) Plasminogen activator inhibitor-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3sila_ b.68.1.1 (A:) Salmonella sialidase {Salmonella typhimurium, strain lt2 [TaxId: 90371]} Back     information, alignment and structure
>d1jr1a1 c.1.5.1 (A:17-112,A:233-514) Inosine monophosphate dehydrogenase (IMPDH) {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1xqga_ e.1.1.1 (A:) Maspin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jaea2 c.1.8.1 (A:1-378) Animal alpha-amylase {Yellow mealworm (Tenebrio molitor), larva [TaxId: 7067]} Back     information, alignment and structure
>d1o6ca_ c.87.1.3 (A:) UDP-N-acetylglucosamine 2-epimerase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1a59a_ a.103.1.1 (A:) Citrate synthase {Antarctic bacterium DS2-3R [TaxId: 56673]} Back     information, alignment and structure
>d1vjoa_ c.67.1.3 (A:) Alanine-glyoxylate aminotransferase {Cyanobacteria (Nostoc sp. pcc 7120) [TaxId: 103690]} Back     information, alignment and structure
>d2d5ja1 a.102.1.7 (A:1-377) Unsaturated glucuronyl hydrolase {Bacillus sp. GL1 [TaxId: 84635]} Back     information, alignment and structure
>d1ci9a_ e.3.1.1 (A:) Esterase EstB {Burkholderia gladioli [TaxId: 28095]} Back     information, alignment and structure
>d1k8qa_ c.69.1.6 (A:) Gastric lipase {Dog (Canis familiaris) [TaxId: 9615]} Back     information, alignment and structure
>d2i71a1 e.72.1.1 (A:1-377) Hypothetical protein SSO1389 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1jmma_ b.30.6.1 (A:) V-region of surface antigen I/II (SA I/II, PAC) {Streptococcus mutans [TaxId: 1309]} Back     information, alignment and structure
>d1nm8a1 c.43.1.3 (A:9-385) Carnitine acetyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f6da_ c.87.1.3 (A:) UDP-N-acetylglucosamine 2-epimerase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mdoa_ c.67.1.4 (A:) Aminotransferase ArnB {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2vata1 c.69.1.40 (A:7-382) Acetyl-CoA:deacetylcephalosporin C acetyltransferase CefG {Acremonium chrysogenum [TaxId: 5044]} Back     information, alignment and structure
>d1k9oi_ e.1.1.1 (I:) Alaserpin (serpin 1) {Tobacco hornworm (Manduca sexta) [TaxId: 7130]} Back     information, alignment and structure
>d1eg5a_ c.67.1.3 (A:) NifS-like protein/selenocysteine lyase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2v3qa1 c.94.1.1 (A:1-376) PstS-like phosphate-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wu4a1 a.102.1.2 (A:6-381) Xylanase Y {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1bhea_ b.80.1.3 (A:) Polygalacturonase {Erwinia carotovora, subsp. carotovora [TaxId: 554]} Back     information, alignment and structure
>d2fug41 e.18.1.2 (4:35-409) NADH-quinone oxidoreductase chain 4, Nqo4 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1o4sa_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2dula1 c.66.1.58 (A:3-377) N(2),N(2)-dimethylguanosine tRNA methyltransferase Trm1 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1ih7a1 c.55.3.5 (A:1-375) Exonuclease domain of family B DNA polymerases {Bacteriophage RB69 [TaxId: 12353]} Back     information, alignment and structure
>d1kbla3 d.142.1.5 (A:2-376) Pyruvate phosphate dikinase, N-terminal domain {Clostridium symbiosum [TaxId: 1512]} Back     information, alignment and structure
>d1txka2 b.30.5.9 (A:23-396) Glucans biosynthesis protein G (MdoG, OpgG), N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ioma_ a.103.1.1 (A:) Citrate synthase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2a0ua1 c.124.1.5 (A:10-383) Initiation factor 2b {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1o69a_ c.67.1.4 (A:) Aminotransferase homolog WlaK (PglE, Cj1121c) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1nd7a_ d.148.1.1 (A:) WW domain-containing protein 1, WWP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gwja_ c.1.4.1 (A:) Morphinone reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1rp4a_ a.227.1.1 (A:) Endoplasmic oxidoreductin 1, Ero1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2bvca2 d.128.1.1 (A:105-478) Glutamine synthetase, C-terminal domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1so7a_ b.68.1.1 (A:) Sialidase 2 (Neu2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kfwa1 c.1.8.5 (A:10-327,A:389-444) Psychrophilic chitinase B {Arthrobacter sp., tad20 [TaxId: 1667]} Back     information, alignment and structure
>d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1v4va_ c.87.1.3 (A:) UDP-N-acetylglucosamine 2-epimerase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ogmx2 b.80.1.10 (X:202-574) Dextranase, catalytic domain {Penicillium minioluteum [TaxId: 28574]} Back     information, alignment and structure
>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d1miqa_ b.50.1.2 (A:) Plasmepsin (a hemoglobin-degrading enzyme) {Plasmodium vivax [TaxId: 5855]} Back     information, alignment and structure
>d1qo0a_ c.93.1.1 (A:) Amide receptor/negative regulator of the amidase operon (AmiC) {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1m0wa2 d.142.1.6 (A:6-210,A:324-491) Eukaryotic glutathione synthetase ATP-binding domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1r5ya_ c.1.20.1 (A:) Queosine tRNA-guanine transglycosylase {Zymomonas mobilis [TaxId: 542]} Back     information, alignment and structure
>d1c3pa_ c.42.1.2 (A:) HDAC homologue {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1j58a_ b.82.1.2 (A:) Oxalate decarboxylase OxdC (YvrK) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1noya_ c.55.3.5 (A:) Exonuclease domain of family B DNA polymerases {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1vkpa_ d.126.1.6 (A:) Agmatine iminohydrolase {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1qlpa_ e.1.1.1 (A:) Antitrypsin, alpha-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1teda_ c.95.1.2 (A:) Polyketide synthase PKS18 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1mkfa_ b.116.1.1 (A:) Viral chemokine binding protein m3 {Murid herpesvirus 4, MuHV-4 [TaxId: 33708]} Back     information, alignment and structure
>d1r53a_ d.258.1.1 (A:) Chorismate synthase, AroC {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1to6a_ c.141.1.1 (A:) Glycerate kinase GlxK {Neisseria meningitidis, (serogroup A) [TaxId: 487]} Back     information, alignment and structure
>d1aj8a_ a.103.1.1 (A:) Citrate synthase {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1c8ba_ c.56.1.2 (A:) Germination protease {Bacillus megaterium [TaxId: 1404]} Back     information, alignment and structure
>d1n7oa1 a.102.3.2 (A:170-540) Hyaluronate lyase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1f1sa1 a.102.3.2 (A:249-619) Hyaluronate lyase {Streptococcus agalactiae [TaxId: 1311]} Back     information, alignment and structure
>d1eg1a_ b.29.1.10 (A:) Cellobiohydrolase I (cellulase, Endoglucanase I, CBH1) {Trichoderma reesei, Endoglucanase I [TaxId: 51453]} Back     information, alignment and structure
>d1r85a_ c.1.8.3 (A:) Xylanase {Bacillus stearothermophilus, Xt6 [TaxId: 1422]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2fnua1 c.67.1.4 (A:2-372) Spore coat polysaccharide biosynthesis protein C {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2dexx3 d.126.1.5 (X:294-663) Peptidylarginine deiminase Pad4, catalytic C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gx8a1 c.135.1.1 (A:4-373) Nif3-related protein BC4286 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d2hgsa4 d.142.1.6 (A:3-201,A:304-474) Eukaryotic glutathione synthetase ATP-binding domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3psga_ b.50.1.2 (A:) Pepsin(ogen) {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} Back     information, alignment and structure
>d1rh9a1 c.1.8.3 (A:30-399) Beta-mannanase {Tomato (Lycopersicon esculentum) [TaxId: 4081]} Back     information, alignment and structure
>d3coxa1 c.3.1.2 (A:5-318,A:451-506) Cholesterol oxidase of GMC family {Brevibacterium sterolicum [TaxId: 1702]} Back     information, alignment and structure
>d2iw1a1 c.87.1.8 (A:2-371) Lipopolysaccharide core biosynthesis protein RfaG {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1iq0a2 c.26.1.1 (A:97-466) Arginyl-tRNA synthetase (ArgRS) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1itua_ c.1.9.7 (A:) Renal dipeptidase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rwha1 a.102.3.2 (A:4-372) Chondroitinase AC {Arthrobacter aurescens [TaxId: 43663]} Back     information, alignment and structure
>d2ewoa1 d.126.1.6 (A:2-370) Agmatine iminohydrolase {Streptococcus mutans [TaxId: 1309]} Back     information, alignment and structure
>d2heka1 a.211.1.1 (A:1-369) Hypothetical protein aq_1910 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1ga6a_ c.41.1.2 (A:) Serine-carboxyl proteinase, SCP {Pseudomonas sp., sedolisin [TaxId: 306]} Back     information, alignment and structure
>d1laxa_ c.94.1.1 (A:) D-maltodextrin-binding protein, MBP {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ncda_ c.37.1.9 (A:) Kinesin motor Ncd (non-claret disjunctional) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1r8ga_ d.128.1.3 (A:) Carboxylate-amine ligase YbdK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2cu0a1 c.1.5.1 (A:3-96,A:207-480) Inosine monophosphate dehydrogenase (IMPDH) {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1f52a2 d.128.1.1 (A:101-468) Glutamine synthetase, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1pyya4 e.3.1.1 (A:264-631) Penicillin-binding protein 2x (pbp-2x), transpeptidase domain {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1v2da_ c.67.1.1 (A:) Glutamine aminotransferase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1o7xa_ a.103.1.1 (A:) Citrate synthase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1d3ga_ c.1.4.1 (A:) Dihydroorotate dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b65a_ d.154.1.1 (A:) L-aminopeptidase D-Ala-esterase/amidase DmpA {Ochrobactrum anthropi [TaxId: 529]} Back     information, alignment and structure
>d1iuqa_ c.112.1.1 (A:) Glycerol-3-phosphate (1)-acyltransferase {Cushaw squash (Cucurbita moschata) [TaxId: 3662]} Back     information, alignment and structure
>d1ue8a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1n4wa1 c.3.1.2 (A:9-318,A:451-507) Cholesterol oxidase of GMC family {Streptomyces sp. [TaxId: 1931]} Back     information, alignment and structure
>d1ursa_ c.94.1.1 (A:) D-maltodextrin-binding protein, MBP {Alicyclobacillus acidocaldarius [TaxId: 405212]} Back     information, alignment and structure
>d1qw9a2 c.1.8.3 (A:18-384) Alpha-L-arabinofuranosidase, catalytic domain {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1moqa_ c.80.1.1 (A:) "Isomerase domain" of glucosamine 6-phosphate synthase (GLMS) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1io7a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1h6za1 c.1.12.2 (A:538-903) Pyruvate phosphate dikinase, C-terminal domain {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d2bvya2 c.1.8.3 (A:5-370) Mannanase A, ManA {Cellulomonas fimi [TaxId: 1708]} Back     information, alignment and structure
>d1jq5a_ e.22.1.2 (A:) Glycerol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1u5ua_ e.5.1.2 (A:) Allene oxide synthase-lipoxygenase protein, N-terminal domain {Black sea rod (Plexaura homomalla) [TaxId: 47982]} Back     information, alignment and structure
>d2aeua1 c.67.1.8 (A:9-374) Hypothetical protein MJ0158 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1fn9a_ d.196.1.1 (A:) Outer capsid protein sigma 3 {Reovirus [TaxId: 10891]} Back     information, alignment and structure
>d1um0a_ d.258.1.1 (A:) Chorismate synthase, AroC {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2pnwa1 b.52.1.4 (A:5-369) Membrane-bound lytic murein transglycosylase A, MLTA {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1zkda1 c.66.1.52 (A:2-366) Hypothetical protein RPA4359 {Rhodopseudomonas palustris [TaxId: 1076]} Back     information, alignment and structure
>d1u1ha2 c.1.22.2 (A:396-760) 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase MetE {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1w85a_ c.36.1.11 (A:) Pyruvate dehydrogenase E1-alpha, PdhA {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1zfja1 c.1.5.1 (A:2-94,A:221-492) Inosine monophosphate dehydrogenase (IMPDH) {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d3c8ya1 c.96.1.1 (A:210-574) Fe-only hydrogenase, catalytic domain {Clostridium pasteurianum [TaxId: 1501]} Back     information, alignment and structure
>d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d1t64a_ c.42.1.2 (A:) Histone deacetylase 8, HDAC8 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2jera1 d.126.1.6 (A:2-365) Agmatine iminohydrolase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1icpa_ c.1.4.1 (A:) 12-oxophytodienoate reductase (OPR, OYE homolog) {Tomato (Lycopersicon esculentum), OPR1 [TaxId: 4081]} Back     information, alignment and structure
>d1sdma_ c.37.1.9 (A:) Kinesin heavy chain-like protein {Potato (Solanum tuberosum) [TaxId: 4113]} Back     information, alignment and structure
>d1kbla1 c.1.12.2 (A:510-873) Pyruvate phosphate dikinase, C-terminal domain {Clostridium symbiosum [TaxId: 1512]} Back     information, alignment and structure
>d1omwa3 d.144.1.7 (A:186-549) G-protein coupled receptor kinase 2 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1kq3a_ e.22.1.2 (A:) Glycerol dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2e7ja1 c.67.1.9 (A:8-371) Selenocysteinyl-tRNA synthase (SepSecS) {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1us3a2 c.1.8.3 (A:243-606) Xylanase 10c {Cellvibrio japonicus [TaxId: 155077]} Back     information, alignment and structure
>d1oc7a_ c.6.1.1 (A:) Cellobiohydrolase II (Cel6) {Humicola insolens, Cel6a [TaxId: 34413]} Back     information, alignment and structure
>d1w0pa3 b.68.1.1 (A:217-346,A:544-777) Vibrio cholerae sialidase {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1m7va_ d.174.1.1 (A:) Nitric oxide (NO) synthase oxygenase domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1zaia1 c.1.10.1 (A:1-363) Fructose-1,6-bisphosphate aldolase {Rabbit (Oryctolagus cuniculus), muscle isozyme [TaxId: 9986]} Back     information, alignment and structure
>d1khba1 c.91.1.1 (A:260-622) Cytosolic phosphoenolpyruvate carboxykinase (GTP-hydrolyzing) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zq1a2 c.88.1.1 (A:76-438) Glutamyl-tRNA(Gln) amidotransferase subunit D, GatD {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d2c5aa1 c.2.1.2 (A:13-375) GDP-mannose-3', 5'-epimerase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1vyra_ c.1.4.1 (A:) Pentaerythritol tetranirate reductase {Enterobacter cloacae [TaxId: 550]} Back     information, alignment and structure
>d1cnza_ c.77.1.1 (A:) 3-isopropylmalate dehydrogenase, IPMDH {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1onha_ e.3.1.1 (A:) AMPC beta-Lactamase, class C {Enterobacter cloacae, P99, cephalosporinase [TaxId: 550]} Back     information, alignment and structure
>d1nc5a_ a.102.1.6 (A:) Hypothetical protein YteR {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1kwfa_ a.102.1.2 (A:) CelA cellulase {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d2a1ha1 e.17.1.1 (A:3-365) Branched-chain aminoacid aminotransferase {Human (Homo sapiens), mitochondrial [TaxId: 9606]} Back     information, alignment and structure
>d1umga_ d.280.1.1 (A:) ST0318 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1gqea_ e.38.1.1 (A:) Polypeptide chain release factor 2 (RF2) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1umda_ c.36.1.11 (A:) Branched-chain alpha-keto acid dehydrogenase, PP module {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2pl5a1 c.69.1.40 (A:5-366) Homoserine O-acetyltransferase {Leptospira interrogans [TaxId: 173]} Back     information, alignment and structure
>d2drwa1 e.3.1.1 (A:2-363) D-Amino acid amidase DaaA {Ochrobactrum anthropi [TaxId: 529]} Back     information, alignment and structure
>d1v8ka_ c.37.1.9 (A:) Kinesin {Mouse (Mus musculus), kif2c [TaxId: 10090]} Back     information, alignment and structure
>d1pvna1 c.1.5.1 (A:2-99,A:231-494) Inosine monophosphate dehydrogenase (IMPDH) {Tritrichomonas foetus [TaxId: 5724]} Back     information, alignment and structure
>d3thia_ c.94.1.1 (A:) Thiaminase I {Paenibacillus thiaminolyticus [TaxId: 49283]} Back     information, alignment and structure
>d1nqka_ c.1.16.4 (A:) Alkanesulfonate monooxygenase SsuD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vlca_ c.77.1.1 (A:) 3-isopropylmalate dehydrogenase, IPMDH {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Back     information, alignment and structure
>d2gjxa1 c.1.8.6 (A:167-528) beta-hexosaminidase A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q8ya_ d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qjwa_ c.6.1.1 (A:) Cellobiohydrolase II (Cel6) {Trichoderma reesei, Cel6a [TaxId: 51453]} Back     information, alignment and structure
>d2ozla1 c.36.1.11 (A:1-361) E1-beta subunit of pyruvate dehydrogenase (PP module) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x1ia1 a.102.3.2 (A:26-386) Xanthan lyase {Bacillus sp. gl1 [TaxId: 84635]} Back     information, alignment and structure
>d1dhsa_ c.31.1.1 (A:) Deoxyhypusine synthase, DHS {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m32a_ c.67.1.3 (A:) 2-aminoethylphosphonate transaminase {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2c0ra1 c.67.1.4 (A:2-362) Phosphoserine aminotransferase, PSAT {Bacillus circulans, subsp. alkalophilus [TaxId: 1397]} Back     information, alignment and structure
>d1lt7a_ c.1.26.1 (A:) Betaine-homocysteine S-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rqga2 c.26.1.1 (A:1-138,A:174-396) Methionyl-tRNA synthetase (MetRS) {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1kewa_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]} Back     information, alignment and structure
>d1d2fa_ c.67.1.3 (A:) Modulator in mal gene expression, MalY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pe9a_ b.80.1.1 (A:) Pectate lyase {Erwinia chrysanthemi, type A [TaxId: 556]} Back     information, alignment and structure
>d1mxga2 c.1.8.1 (A:1-361) Bacterial alpha-amylase {Archaeon Pyrococcus woesei [TaxId: 2262]} Back     information, alignment and structure
>d1qo5a_ c.1.10.1 (A:) Fructose-1,6-bisphosphate aldolase {Human (Homo sapiens), liver isozyme [TaxId: 9606]} Back     information, alignment and structure
>d1sq1a_ d.258.1.1 (A:) Chorismate synthase, AroC {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1w23a_ c.67.1.4 (A:) Phosphoserine aminotransferase, PSAT {Bacillus alcalophilus [TaxId: 1445]} Back     information, alignment and structure
>d1jdwa_ d.126.1.2 (A:) L-arginine: glycine amidinotransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bjna_ c.67.1.4 (A:) Phosphoserine aminotransferase, PSAT {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xfia_ e.50.1.1 (A:) Hypothetical protein At2g17340 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1oxwa_ c.19.1.3 (A:) Patatin {Heartleaf nightshade (Solanum cardiophyllum) [TaxId: 160510]} Back     information, alignment and structure
>d1pn0a1 c.3.1.2 (A:1-240,A:342-461) Phenol hydroxylase {Soil-living yeast (Trichosporon cutaneum) [TaxId: 5554]} Back     information, alignment and structure
>d1kdga1 c.3.1.2 (A:215-512,A:694-755) Flavoprotein domain of flavocytochrome cellobiose dehydrogenase (CDH), FAD-binding domain {Fungus (Phanerochaete chrysosporium) [TaxId: 5306]} Back     information, alignment and structure
>d2jbwa1 c.69.1.41 (A:8-367) 2,6-dihydropseudooxynicotine hydrolase {Arthrobacter nicotinovorans [TaxId: 29320]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d4bcla_ b.75.1.1 (A:) Bacteriochlorophyll A protein {Prosthecochloris aestuarii, strain 2k [TaxId: 1102]} Back     information, alignment and structure
>d1goxa_ c.1.4.1 (A:) Glycolate oxidase {Spinach (Spinacia oleracea) [TaxId: 3562]} Back     information, alignment and structure
>d1m6ex_ c.66.1.35 (X:) Salicylic acid carboxyl methyltransferase (SAMT) {Clarkia breweri [TaxId: 36903]} Back     information, alignment and structure
>d1yvra1 a.118.25.1 (A:5-363) 60-kda SS-aARo ribonucleoprotein {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
>d1x74a1 c.123.1.1 (A:2-360) 2-methylacyl-CoA racemase Mcr {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2hrca1 c.92.1.1 (A:65-423) Ferrochelatase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1idka_ b.80.1.2 (A:) Pectin lyase {Aspergillus niger, type A [TaxId: 5061]} Back     information, alignment and structure
>d1qcxa_ b.80.1.2 (A:) Pectin lyase {Aspergillus niger, type B [TaxId: 5061]} Back     information, alignment and structure
>d1o2da_ e.22.1.2 (A:) Alcohol dehydrogenase TM0920 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2hdsa1 e.3.1.1 (A:4-361) AMPC beta-Lactamase, class C {Escherichia coli, cephalosporinase [TaxId: 562]} Back     information, alignment and structure
>d1ecea_ c.1.8.3 (A:) Endocellulase E1 {Acidothermus cellulolyticus [TaxId: 28049]} Back     information, alignment and structure
>d1m7ja3 c.1.9.11 (A:62-419) N-acyl-D-aminoacid amidohydrolase, catalytic domain {Alcaligenes faecalis [TaxId: 511]} Back     information, alignment and structure
>d1dosa_ c.1.10.2 (A:) Fructose-bisphosphate aldolase (FBP aldolase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jkma_ c.69.1.2 (A:) Carboxylesterase {Bacillus subtilis, brefeldin A esterase [TaxId: 1423]} Back     information, alignment and structure
>d1uwva2 c.66.1.40 (A:75-432) rRNA (Uracil-5-)-methyltransferase RumA, catalytic domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1edqa2 c.1.8.5 (A:133-443,A:517-563) Chitinase A, catalytic domain {Serratia marcescens [TaxId: 615]} Back     information, alignment and structure
>d1taza_ a.211.1.2 (A:) Catalytic domain of cyclic nucleotide phosphodiesterase 1b, PDE1B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2qapa1 c.1.10.1 (A:1-357) Fructose-1,6-bisphosphate aldolase {Trypanosome (Leishmania mexicana) [TaxId: 5665]} Back     information, alignment and structure
>d2b61a1 c.69.1.40 (A:2-358) Homoserine O-acetyltransferase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1a05a_ c.77.1.1 (A:) 3-isopropylmalate dehydrogenase, IPMDH {Thiobacillus ferrooxidans [TaxId: 920]} Back     information, alignment and structure
>d1yyda1 a.93.1.1 (A:1-357) Fungal peroxidase (ligninase) {Basidomycetos fungus (Phanerochaete chrysosporium) [TaxId: 5306]} Back     information, alignment and structure
>d1t1ga_ c.41.1.2 (A:) Serine-carboxyl proteinase, SCP {Bacillus novosp. MN-32, kumamolisin [TaxId: 198803]} Back     information, alignment and structure
>d1gcya2 c.1.8.1 (A:1-357) G4-amylase (1,4-alpha-D-glucan maltotetrahydrolase) {Pseudomonas stutzeri [TaxId: 316]} Back     information, alignment and structure
>d2amxa1 c.1.9.1 (A:20-376) Adenosine deaminase (ADA) {Plasmodium yoelii [TaxId: 5861]} Back     information, alignment and structure
>d1db3a_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g01a_ c.1.8.3 (A:) Alkaline cellulase K catalytic domain {Bacillus sp. [TaxId: 1409]} Back     information, alignment and structure
>d1mppa_ b.50.1.2 (A:) Pepsin {Mucor pusillus [TaxId: 4840]} Back     information, alignment and structure
>d16vpa_ d.180.1.1 (A:) Conserved core of transcriptional regulatory protein vp16 {Herpes simplex virus type 1 [TaxId: 10298]} Back     information, alignment and structure
>d1r3sa_ c.1.22.1 (A:) Uroporphyrinogen decarboxylase, UROD {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jnra2 c.3.1.4 (A:2-256,A:402-502) Adenylylsulfate reductase A subunit {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1v53a1 c.77.1.1 (A:1-356) 3-isopropylmalate dehydrogenase, IPMDH {Bacillus coagulans [TaxId: 1398]} Back     information, alignment and structure
>d1w8oa3 b.68.1.1 (A:47-402) Micromonospora sialidase, N-terminal domain {Micromonospora viridifaciens [TaxId: 1881]} Back     information, alignment and structure
>d1lbqa_ c.92.1.1 (A:) Ferrochelatase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1jaka1 c.1.8.6 (A:151-506) beta-N-acetylhexosaminidase {Streptomyces plicatus [TaxId: 1922]} Back     information, alignment and structure
>d1l0wa3 d.104.1.1 (A:105-294,A:415-580) Aspartyl-tRNA synthetase (AspRS) {Thermus thermophilus, AspRS-1 [TaxId: 274]} Back     information, alignment and structure
>d1rkxa_ c.2.1.2 (A:) CDP-glucose-4,6-dehydratase {Yersinia pseudotuberculosis [TaxId: 633]} Back     information, alignment and structure
>d2ebsa2 b.69.13.1 (A:431-786) Oligoxyloglucan reducing end-specific cellobiohydrolase {Yeast (Geotrichum sp. M128) [TaxId: 203496]} Back     information, alignment and structure
>d1vbga1 c.1.12.2 (A:521-876) Pyruvate phosphate dikinase, C-terminal domain {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1goia2 c.1.8.5 (A:3-291,A:380-446) Chitinase B, catalytic domain {Serratia marcescens [TaxId: 615]} Back     information, alignment and structure
>d3bu7a1 b.82.1.23 (A:19-373) Gentisate 1,2-dioxygenase {Silicibacter pomeroyi [TaxId: 89184]} Back     information, alignment and structure
>d1fuia2 c.85.1.1 (A:1-355) L-fucose isomerase, N-terminal and second domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2b1pa1 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3s) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1luca_ c.1.16.1 (A:) Bacterial luciferase alpha chain, LuxA {Vibrio harveyi [TaxId: 669]} Back     information, alignment and structure
>d1jbqa_ c.79.1.1 (A:) Cystathionine beta-synthase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1iq8a1 c.1.20.1 (A:6-360) Archaeosine tRNA-guanine transglycosylase, N-terminal domain {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure