Citrus Sinensis ID: 000712

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------1000------1010------1020------1030------1040------1050------1060------1070------1080------1090------1100------1110------1120------1130------1140------1150------1160------1170------1180------1190------1200------1210------1220------1230------1240------1250------1260------1270------1280------1290------1300------1310------1320------1330------
MSSWGLGWKRPLEIFKLTLSYGTEEAGYDPFNRLSTSSSSSTSTSSLSSPTVMTRDPELGFRIDLEWTSGEEEDQVALKLQSQLMVALPVPEDTVVVELAPQEEGDVATDAANVGVEMRVVKRREPLRAVVLTKGVGSGHLSDGIGVLTRLMRSDLSTSGPGNNMGSGFCDHWKTVTAVSLCGLGLSALPVDLTRLPVLEKLYLDNNKLSTLPPELGAMKNLKVLIVDNNMLVCVPVELRECVGLVELSLEHNRLVRPLLDFRAMAELKILRLFGNPLEFLPEILPLLKLRHLSLANIRIVADENLRSVNVQIEMENNSYFGASRHKLSAFFSLIFRFSSCHHPLLASALAKIMQDQENRVVVGKDENAVRQLISMISSDNRHVVEQACSALSSLAGDVSVAMLLMKCDIMQPIIAVLKSFAPEEVKSVLQVVGQLAFASDTVAQKMLTKDVLKSLKLLCAHKNPEVQRFALLAVGNLAFCLENRRILVTSESLRDLLMRLTVGPEPRVNKAAARALAILGENESLRRAIRGRQVPKQGLRILSMDGGGMKGLATVQILKEIEKGTGKRIHELFDLVCGTSTGGMLAIALAVKLMTLDQCEEIYKNLGKLVFAEPFPKDNEAATWREKLDQIYKSSSQSFRVVVHGSKHSADQFERLLKEMCADEDGDLLIESSVKNIPKVFTVSTLVNVMPAQPFIFRNYQYPAGTPEVPFSISENSGITVLGSPTTGAQVGYKRSAFIGSCKHQVWQAIRASSAAPYYLDDFSDDVFRWQDGAIVANNPTIFAIREAQLLWPDTRIDCLVSIGCGSVPTKTRRGGWRYLDTGQVLIESACSVDRAEEALSTLLPMLPEIQYYRFNPVDERCEMELDETDPAEWLKLEAAVDEYINNNSESFKNVCERLLLPFQQDEKWSENLKSQHFPRGKVSNTDEISPSLGWRRNTLLVEAMHSPDSGRVGHHARALESFCASNGIRLSLLHGISGIGKSMPGATFPTPFSSPLITGSFPSSPLLYSPDVGPQRIGRIDMVPPLSLDGLQAGKTFSSPPVSPKAHRQLSLHVRSLHEKLQSLPQVGIVHLCLQNDTVGSILSWQNDVFVVAEPGEHADKFLQSVKSSLLSVMRSNRRKGASVLSNISTIADLIHFRPYFQVGNVVHRYIGRQTQVMEDDHEIAAYMFRRTVPSMHLTPDDVRWMIGAWRERIIICTGTYGPTPPVVKAFLDSGAKAVVCPSAEPQEMSLTSFHGSGEFNVVENGRFEIGEEEAEDEDVEPSSPVSDWEDSEPEKSGEHLMGVWDDEEEELSQFICHLYDFLFREGARVDAALQKALASHRKLRYICHLPGIR
cccccccccccccEEEEEccccccccccccccccccccccccccccccccccccccccccEEEEccccccccHHHHHHHHHHHHHHHccccccEEEEEcccccccccccccccccccHHHHHccccccEEEcccccccccccHHHHHHccccEEcccccccccccccccccccccccEEEccccccccccccccccccccEEEccccccccccHHHHccccccEEcccccccccccHHHHccccccEEEcccccccccHHHHHccccccEEccccccccccccccccccccEEEcccccccccccccccccccccccccEEccccccccccHHHHHHHcccccccccHHHHHHHcccccccEEccccccccccHHHHHcccccEEEccccccHHccccHHHHHHHccccccHHHHHHHccccHHHHHHHHHHHHcccccccHHHHccccHHHHHHcHHHccccccHHHHHHHHHHcccccccccHHHHccHHHHHHHHHHHcccccHHHHHHHHHHHHHHcccHHHHHHHHcccccccccEEEEEcccccccHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHcccccHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHcccccEEEcccccccHHHHHHHHHHHHcccccccccccccccccEEEEEEEEcccccccEEEEccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHcccccccccccccccccEEEEccccccccHHHHHHHHHHHcccccccEEEEEccccccccccccccccccHHHHHHHHHHcHHHHHHHHHHHccccccccEEEEcccccccccccccccHHHHHHHHHHHHHHHHHcHHHHHHHHHHHccccccHHHHHHHHHccccccccccccccccccccccccEEEEEccccccccccccccHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHccccccEEEEEEEEccccccEEEEcccEEEEEcccHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHccccEEEEccEEEEEEcccEEEEccccHHHHHHHHcccccccccHHHHHHHHHHHcccEEEEEccccccHHHHHHHHHccccEEEccccccccccccEEcccccccccccccEEccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHcccccEEccccccc
ccccccccccccHEEEEEEcccccccccccccccccccccccccccccccccccccccccEEEEEEccccccHHHHHHHHHHHHHHHccccccEEEEEEccccccccccccccEEEEEEEEEcccccEEEEEEEEccccccccccEHHHHHHHcccccccccccHHHHccHccHHHHEEEcccccccEccHHHHHcHHHHHEEccccccccccHHHHHHHccEEEEEcccEEEEccHHHHHHHHHHEEEcccccccccHHcHHHHHHHHHHHHccccHHHcHHHcHHHHccEEEEEEEEEEEcccccccEEEEEEcccHHHHHcHHHHHHHHHHHEcccccccHHHHHHHHHHHHcccccHHHcccHHHHHHHHHHHccccHHHHHHHHHHHHHHcccHHHHHHHHHccHHHHHHHHHHccccHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHccHcccEEEEcHHHHHHHHHHHHcccHHHHHHHHHHHHHHcccHHHHHHHcccccccccEEEEEEcccHHHHHHHHHHHHHHHHHHcccHHHHHHEEccccHHHHHHHHHHHccccHHHHHHHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHcHcccccccccccccccEEEEEEEEEcccccccEEEEccccccccccccccccccccccccccccccccccHHccccccccccHHHHHHHHccccccccccccccccEEccccEEcccHHHHHHHHHHHHcccccEEEEEEEccccccccccccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccEEEEcccccccccccccccHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHccccHHHHHHHHHHHccccccccccccccccccccccEEEEEEcccccccccccccHHHHHHHHHccccEEEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEcccccccccccccccHHHHHHHHHHccccEEEEEEEEccccccEEEEEcccEEEEEccHHHHHHHHHHHHHHHHHHHHHHccccccccccHccHHHHHHccccEEEccEEEEEEccccEEcccccEHHHHHHHccccHHcccHHHHHHHHHHHHccEEEEcccccccHHHHHHHHHcccEEEEEcccccccccEEEEEcccccccccccEEEEccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHccccEEEEcccccc
msswglgwkrpLEIFKLTLsygteeagydpfnrlstssssststsslssptvmtrdpelgfridlewtsgeeEDQVALKLQSQLMvalpvpedtvvvelapqeegdvatdaANVGVEMRVVKRREPLRAVVLTkgvgsghlsdgIGVLTRLMrsdlstsgpgnnmgsgfcdhwKTVTAVSLcglglsalpvdltrlpvleklyldnnklstlppelgamkNLKVLIVDNNMLVCVPVELRECVGLVELSLehnrlvrpllDFRAMAELKILRLfgnpleflpeILPLLKLRHLSLANIRIVADENLRSVNVQIEmennsyfgasrHKLSAFFSLIFRFSSCHHPLLASALAKIMQdqenrvvvgkdENAVRQLISMISSDNRHVVEQACSALSSLAGDVSVAMLLMKCDIMQPIIAVLKSFAPEEVKSVLQVVGQLAFASDTVAQKMLTKDVLKSLKLLCAHKNPEVQRFALLAVGNLAFCLENRRILVTSESLRDLLMRLTVGPEPRVNKAAARALAILGENESLRRAirgrqvpkqGLRILsmdgggmkgLATVQILKEIEKGTGKRIHELFDLVCGTSTGGMLAIALAVKLMTLDQCEEIYKNLGklvfaepfpkdneaATWREKLDQIYKSSSQSFRVVVHGSKHSADQFERLLKEMCADEDGDLLIESSVKNIPKVFTVSTLvnvmpaqpfifrnyqypagtpevpfsisensgitvlgspttgaqvgykrsafigSCKHQVWQAIRassaapyylddfsddvfrwqdgaivannpTIFAIREAqllwpdtridclvsigcgsvptktrrggwryldtGQVLIESACSVDRAEEALSTLlpmlpeiqyyrfnpvdercemeldetdpaEWLKLEAAVDEYINNNSESFKNVCERLllpfqqdekwsenlksqhfprgkvsntdeispslgwrRNTLLVEamhspdsgrvghhARALESFCASNGIRLSLLHGisgigksmpgatfptpfssplitgsfpsspllyspdvgpqrigridmvpplsldglqagktfssppvspkahrqLSLHVRSLHEKLQSLPQVGIVHLCLQNDTVGSILSWQNDvfvvaepgehADKFLQSVKSSLLSVMRSNRRKGASVLSNISTIAdlihfrpyfqvgNVVHRYIGRQTQVMEDDHEIAAYMFrrtvpsmhltpdDVRWMIGAWRERIIICtgtygptppvVKAFLDsgakavvcpsaepqemsltsfhgsgefnvvengrfeigeeeaededvepsspvsdwedsepeksgehlmgvwDDEEEELSQFICHLYDFLFREGARVDAALQKALASHRKLRYichlpgir
msswglgwkrpLEIFKLTLSYGTEEAGYDPFNrlstssssststsslssptvmtrdpeLGFRIDLEWTSGEEEDQVALKLQSQLMVALPVPEDTVVVELAPqeegdvatdaanvgvemrvvkrreplravvltkgvgsghlsdgiGVLTRLMRSDLSTSGPGNNMGSGFCDHWKTVTAVSLCGLGLSALPVDLTRLPVLEKLYLDNNKLSTLPPELGAMKNLKVLIVDNNMLVCVPVELRECVGLVELSLEHNRLVRPLLDFRAMAELKILRLFGNPLEFLPEILPLLKLRHLSLANIRIVADENLRSVNVQIEMENNSYFGASRHKLSAFFSLIFRFSSCHHPLLASALAKIMQDQENRVVVGKDENAVRQLISmissdnrhVVEQACSALSSLAGDVSVAMLLMKCDIMQPIIAVLKSFAPEEVKSVLQVVGQLAFASDTVAQKMLTKDVLKSLKLLCAHKNPEVQRFALLAVGNLAFCLENRRILVTSESLRDLLMRltvgpeprvnKAAARALAIlgeneslrrairgrqvpkqglrilsmdgggmkGLATVQILKEIEKGTGKRIHELFDLVCGTSTGGMLAIALAVKLMTLDQCEEIYKNLGKLVFAEPFPKDNEAATWREKLDQIYKSSSQSFRVVVHGSKHSADQFERLLKEMCADEDGDLLIESSVKNIPKVFTVSTLVNVMPAQPFIFRNYQYPAGTPEVPFSISENSGITVLGSPTTGAQVGYKRSAFIGSCKHQVWQAIRASSAAPYYLDDFSDDVFRWQDGAIVANNPTIFAIREAQLLWPDTRIDCLVSIgcgsvptktrrggwryLDTGQVLIESACSVDRAEEALStllpmlpeiQYYRFNPVDERCEMELDETDPAEWLKLEAAVDEYINNNSESFKNVCERLLLPFQQDEKWSENLksqhfprgkvsntdeispslgWRRNTLLVEAMHSPDSGRVGHHARALESFCASNGIRLSLLHGISGIGKSMPGATFPTPFSSPLITGSFPSSPLLYSPDVGPQRIGRIDMVPPLSLDGLQAGKTFSSPPVSPKAHRQLSLHVRSLHEKLQSLPQVGIVHLCLQNDTVGSILSWQNDVFVVAEPGEHADKFLQSVKSSLLSVMRSNRRKGASVLSNISTIADLIHFRPYFQVGNVVHRYIGRQTQVMEDDHEIAAYMFrrtvpsmhltPDDVRWMIGAWRERIIICTGTYGPTPPVVKAFLDSGAKAVVCPSAEPQEMSLTSFHGSGEFNVVENGRFEIGeeeaededvepsspvsdwedsepekSGEHLMGVWDDEEEELSQFICHLYDFLFREGARVDAALQKALashrklryichlpgir
MSSWGLGWKRPLEIFKLTLSYGTEEAGYDPFNRlstssssststsslssPTVMTRDPELGFRIDLEWTSGEEEDQVALKLQSQLMVALPVPEDTVVVELAPQEEGDVATDAANVGVEMRVVKRREPLRAVVLTKGVGSGHLSDGIGVLTRLMRSDLSTSGPGNNMGSGFCDHWKTVTAVSLCGLGLSALPVDLTRLPVLEKLYLDNNKLSTLPPELGAMKNLKVLIVDNNMLVCVPVELRECVGLVELSLEHNRLVRPLLDFRAMAELKILRLFGNpleflpeilpllklrhlSLANIRIVADENLRSVNVQIEMENNSYFGASRHKLSAFFSLIFRFSSCHHPLLASALAKIMQDQENRVVVGKDENAVRQLISMISSDNRHVVEQACSALSSLAGDVSVAMLLMKCDIMQPIIAVLKSFAPEEVKSVLQVVGQLAFASDTVAQKMLTKDVLKSLKLLCAHKNPEVQRFALLAVGNLAFCLENRRILVTSESLRDLLMRLTVGPEPRVNKAAARALAILGENESLRRAIRGRQVPKQGLRILSMDGGGMKGLATVQILKEIEKGTGKRIHELFDLVCGTSTGGMLAIALAVKLMTLDQCEEIYKNLGKLVFAEPFPKDNEAATWREKLDQIYKSSSQSFRVVVHGSKHSADQFERLLKEMCADEDGDLLIESSVKNIPKVFTVSTLVNVMPAQPFIFRNYQYPAGTPEVPFSISENSGITVLGSPTTGAQVGYKRSAFIGSCKHQVWQAIRASSAAPYYLDDFSDDVFRWQDGAIVANNPTIFAIREAQLLWPDTRIDCLVSIGCGSVPTKTRRGGWRYLDTGQVLIESACSVDRAEEALSTLLPMLPEIQYYRFNPVDERCEMELDETDPAEWLKLEAAVDEYINNNSESFKNVCERLLLPFQQDEKWSENLKSQHFPRGKVSNTDEISPSLGWRRNTLLVEAMHSPDSGRVGHHARALESFCASNGIRLSLLHGISGIGKSMPGATFPTPFSSPLITGSFPSSPLLYSPDVGPQRIGRIDMVPPLSLDGLQAGKTFSSPPVSPKAHRQLSLHVRSLHEKLQSLPQVGIVHLCLQNDTVGSILSWQNDVFVVAEPGEHADKFLQSVKSSLLSVMRSNRRKGASVLSNISTIADLIHFRPYFQVGNVVHRYIGRQTQVMEDDHEIAAYMFRRTVPSMHLTPDDVRWMIGAWRERIIICTGTYGPTPPVVKAFLDSGAKAVVCPSAEPQEMSLTSFHGSGEFNVvengrfeigeeeaededvePSSPVSDWEDSEPEKSGEHLMGVWDDEEEELSQFICHLYDFLFREGARVDAALQKALASHRKLRYICHLPGIR
***WGLGWKRPLEIFKLTLSYGTEEAG********************************GFRIDLEWTS*****QVALKLQSQLMVALPVPEDTVVVELAPQEEGDVATDAANVGVEMRVVKRREPLRAVVLTKGVGSGHLSDGIGVLTRLMR***********MGSGFCDHWKTVTAVSLCGLGLSALPVDLTRLPVLEKLYLDNNKLSTLPPELGAMKNLKVLIVDNNMLVCVPVELRECVGLVELSLEHNRLVRPLLDFRAMAELKILRLFGNPLEFLPEILPLLKLRHLSLANIRIVADENLRSVNVQIEMENNSYFGASRHKLSAFFSLIFRFSSCHHPLLASALAKIMQDQENRVVVGKDENAVRQLISMISSDNRHVVEQACSALSSLAGDVSVAMLLMKCDIMQPIIAVLKSFAPEEVKSVLQVVGQLAFASDTVAQKMLTKDVLKSLKLLCAHKNPEVQRFALLAVGNLAFCLENRRILVTSESLRDLLMRLTVGPEPRVNKAAARALAILGENESLRRAIRGRQVPKQGLRILSMDGGGMKGLATVQILKEIEKGTGKRIHELFDLVCGTSTGGMLAIALAVKLMTLDQCEEIYKNLGKLVFAEPFPKDNEAATWREKLDQIYK****SFRVVVHGS***ADQFERLLKEMCADEDGDLLIESSVKNIPKVFTVSTLVNVMPAQPFIFRNYQYPAGTPEVPFSISENSGITVLGSPTTGAQVGYKRSAFIGSCKHQVWQAIRASSAAPYYLDDFSDDVFRWQDGAIVANNPTIFAIREAQLLWPDTRIDCLVSIGCGSVPTKTRRGGWRYLDTGQVLIESACSVDRAEEALSTLLPMLPEIQYYRFNPVDERCEMELDETDPAEWLKLEAAVDEYINNNSESFKNVCERLLLPFQQ****************************GWRRNTLLVEA********VGHHARALESFCASNGIRLSLLHGISGIGKSM**********************************************************************VRSLHEKLQSLPQVGIVHLCLQNDTVGSILSWQNDVFVVAEPGEHADKFLQSV***LL**********ASVLSNISTIADLIHFRPYFQVGNVVHRYIGRQTQVMEDDHEIAAYMFRRTVPSMHLTPDDVRWMIGAWRERIIICTGTYGPTPPVVKAFLDSGAKAVVC*************************************************************GVWDDEEEELSQFICHLYDFLFREGARVDAALQKALASHRKLRYICHLP***
*******WKRPLEIFKLTLSYGT**************************************RIDLEWTSGEEEDQVALKLQSQLMVALPVPEDTVVVELAPQEEGDVATDAANVGVEMRVVKRREPLRAVVLTKGVGSGHLSDGIGVLTRLMRSDLSTSGPGNNMGSGFCDHWKTVTAVSLCGLGLSALPVDLTRLPVLEKLYLDNNKLSTLPPELGAMKNLKVLIVDNNMLVCVPVELRECVGLVELSLEHNRLVRPLLDFRAMAELKILRLFGNPLEFLPEILPLLKLRHLSLANIRIVADENLRSVNVQIEMENNSYFGASRHKLSAFFSLIFRFSSCHHPLLASALAKIMQDQENRVVVGKDENAVRQLISMISSDNRHVVEQACSALSSLAGDVSVAMLLMKCDIMQPIIAVLKSFAPEEVKSVLQVVGQLAFASDTVAQKMLTKDVLKSLKLLCAHKNPEVQRFALLAVGNLAFCLENRRILVTSESLRDLLMRLTVGPEPRVNKAAARALAILGENESLRRAIRGRQVPKQGLRILSMDGGGMKGLATVQILKEIEKGTGKRIHELFDLVCGTSTGGMLAIALAVKLMTLDQCEEIYKNLGKLVFAEPFPKDNEAATWREKLDQIYKSSSQSFRVVVHGSKHSADQFERLLKEMCADE**********KNIPKVFTVSTLVNVMPAQPFIFRNYQYPAGTPEVPFSISENSGITVLG*****************SCKHQVWQAIRASSAAPYYLDDFSDDVFRWQDGAIVANNPTIFAIREAQLLWPDTRIDCLVSIGCGSVPTK*****WRYLDTGQVLIESACSVDRAEEALSTLLPMLPEIQYYRFNPVDERCEMELDETDPAEWLKLEAAVDEYINNNSESFKNVCERLLL**************************************LLV****************ALESFCASNG**********************************************************************************************QSLPQVGIVHLCLQNDTVGSILSWQNDVFVVAEPGEHADKFLQSVKSS****************SNISTIADLIHFRPYFQVGNVVHRYIGRQTQVMEDDHEIAAYMFRRTVPSMHLTPDDVRWMIGAWRERIIICTGTYGPTPPVVKAFLDSGAKAVVCPSAEPQ******************************************************MGVWDDEEEELSQFICHLYDFLFREGARVDAALQKALASHRKLRYICHLPGI*
MSSWGLGWKRPLEIFKLTLSYGTEEAGYDPFNR*******************MTRDPELGFRIDLEWTSGEEEDQVALKLQSQLMVALPVPEDTVVVELAPQEEGDVATDAANVGVEMRVVKRREPLRAVVLTKGVGSGHLSDGIGVLTRLMRSDLSTSGPGNNMGSGFCDHWKTVTAVSLCGLGLSALPVDLTRLPVLEKLYLDNNKLSTLPPELGAMKNLKVLIVDNNMLVCVPVELRECVGLVELSLEHNRLVRPLLDFRAMAELKILRLFGNPLEFLPEILPLLKLRHLSLANIRIVADENLRSVNVQIEMENNSYFGASRHKLSAFFSLIFRFSSCHHPLLASALAKIMQDQENRVVVGKDENAVRQLISMISSDNRHVVEQACSALSSLAGDVSVAMLLMKCDIMQPIIAVLKSFAPEEVKSVLQVVGQLAFASDTVAQKMLTKDVLKSLKLLCAHKNPEVQRFALLAVGNLAFCLENRRILVTSESLRDLLMRLTVGPEPRVNKAAARALAILGENESLRRAIRGRQVPKQGLRILSMDGGGMKGLATVQILKEIEKGTGKRIHELFDLVCGTSTGGMLAIALAVKLMTLDQCEEIYKNLGKLVFAEPFPKDNEAATWREKLDQIYKSSSQSFRVVVHGSKHSADQFERLLKEMCADEDGDLLIESSVKNIPKVFTVSTLVNVMPAQPFIFRNYQYPAGTPEVPFSISENSGITVLGSPTTGAQVGYKRSAFIGSCKHQVWQAIRASSAAPYYLDDFSDDVFRWQDGAIVANNPTIFAIREAQLLWPDTRIDCLVSIGCGSVPTKTRRGGWRYLDTGQVLIESACSVDRAEEALSTLLPMLPEIQYYRFNPVDERCEMELDETDPAEWLKLEAAVDEYINNNSESFKNVCERLLLPFQQDEKWSENLKSQHFPRGKVSNTDEISPSLGWRRNTLLVEAMHSPDSGRVGHHARALESFCASNGIRLSLLHGISGIGKSMPGATFPTPFSSPLITGSFPSSPLLYSPDVGPQRIGRIDMVPPLSLDGLQAGKT*************LSLHVRSLHEKLQSLPQVGIVHLCLQNDTVGSILSWQNDVFVVAEPGEHADKFLQSVKSSLLSVMRSNRRKGASVLSNISTIADLIHFRPYFQVGNVVHRYIGRQTQVMEDDHEIAAYMFRRTVPSMHLTPDDVRWMIGAWRERIIICTGTYGPTPPVVKAFLDSGAKAVVCPSAEPQEMSLTSFHGSGEFNVVENGRFEIG****************************HLMGVWDDEEEELSQFICHLYDFLFREGARVDAALQKALASHRKLRYICHLPGIR
****GLGWKRPLEIFKLTLSYGTE*********************************ELGFRIDLEWTSGEEEDQVALKLQSQLMVALPVPEDTVVVELAPQ*******DAANVGVEMRVVKRREPLRAVVLTKGVGSGHLSDGIGVLTRLMRSDLSTSGPGNNMGSGFCDHWKTVTAVSLCGLGLSALPVDLTRLPVLEKLYLDNNKLSTLPPELGAMKNLKVLIVDNNMLVCVPVELRECVGLVELSLEHNRLVRPLLDFRAMAELKILRLFGNPLEFLPEILPLLKLRHLSLANIRIVADENLRSVNVQIEMENNSYFGASRHKLSAFFSLIFRFSSCHHPLLASALAKIMQDQENRVVVGKDENAVRQLISMISSDNRHVVEQACSALSSLAGDVSVAMLLMKCDIMQPIIAVLKSFAPEEVKSVLQVVGQLAFASDTVAQKMLTKDVLKSLKLLCAHKNPEVQRFALLAVGNLAFCLENRRILVTSESLRDLLMRLTVGPEPRVNKAAARALAILGENESLRRAIRGRQVPKQGLRILSMDGGGMKGLATVQILKEIEKGTGKRIHELFDLVCGTSTGGMLAIALAVKLMTLDQCEEIYKNLGKLVFAEPFPKDNEAATWREKLDQIYKSSSQSFRVVVHGSKHSADQFERLLKEMCADEDGDLLIESSVKNIPKVFTVSTLVNVMPAQPFIFRNYQYPAGT**********SGITVLGS***GAQVGYKRSAFIGSCKHQVWQAIRASSAAPYYLDDFSDDVFRWQDGAIVANNPTIFAIREAQLLWPDTRIDCLVSIGCGSVPTKTRRGGWRYLDTGQVLIESACSVDRAEEALSTLLPMLPEIQYYRFNPVDERCEMELDETDPAEWLKLEAAVDEYINNNSESFKNVCERLLLPFQQDEKWSENLKSQHFPRGKVSNTDEISPSLGWRRNTLLVEAMHSPDSGRVGHHARALESFCASNGIRLSLLHGISGIGKSMPGATFPTPFSSPLITGSFPSSPLLYSPDVGPQRIGRIDMVPPLSLDGLQAGKTF****VSPKAHRQLSLHVRSLHEKLQSLPQVGIVHLCLQNDTVGSILSWQNDVFVVAEPGEHADKFLQSVKSSLLSVMRSNRRKGASVLSNISTIADLIHFRPYFQVGNVVHRYIGRQTQVMEDDHEIAAYMFRRTVPSMHLTPDDVRWMIGAWRERIIICTGTYGPTPPVVKAFLDSGAKAVVCPSAEPQEMSLTSFHGSGEFNVVENGRFEIGEE*****************************GVWDDEEEELSQFICHLYDFLFREGARVDAALQKALASHRKLRYICHLPG**
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSSWGLGWKRPLEIFKLTLSYGTEEAGYDPFNRLSTSSSSSTSTSSLSSPTVMTRDPELGFRIDLEWTSGEEEDQVALKLQSQLMVALPVPEDTVVVELAPQEEGDVATDAANVGVEMRVVKRREPLRAVVLTKGVGSGHLSDGIGVLTRLMRSDLSTSGPGNNMGSGFCDHWKTVTAVSLCGLGLSALPVDLTRLPVLEKLYLDNNKLSTLPPELGAMKNLKVLIVDNNMLVCVPVELRECVGLVELSLEHNRLVRPLLDFRAMAELKILRLFGNPLEFLPEILPLLKLRHLSLANIRIVADENLRSVNVQIEMENNSYFGASRHKLSAFFSLIFRFSSCHHPLLASALAKIMQDQENRVVVGKDENAVRQLISMISSDNRHVVEQACSALSSLAGDVSVAMLLMKCDIMQPIIAVLKSFAPEEVKSVLQVVGQLAFASDTVAQKMLTKDVLKSLKLLCAHKNPEVQRFALLAVGNLAFCLENRRILVTSESLRDLLMRLTVGPEPRVNKAAARALAILGENESLRRAIRGRQVPKQGLRILSMDGGGMKGLATVQILKEIEKGTGKRIHELFDLVCGTSTGGMLAIALAVKLMTLDQCEEIYKNLGKLVFAEPFPKDNEAATWREKLDQIYKSSSQSFRVVVHGSKHSADQFERLLKEMCADEDGDLLIESSVKNIPKVFTVSTLVNVMPAQPFIFRNYQYPAGTPEVPFSISENSGITVLGSPTTGAQVGYKRSAFIGSCKHQVWQAIRASSAAPYYLDDFSDDVFRWQDGAIVANNPTIFAIREAQLLWPDTRIDCLVSIGCGSVPTKTRRGGWRYLDTGQVLIESACSVDRAEEALSTLLPMLPEIQYYRFNPVDERCEMELDETDPAEWLKLEAAVDEYINNNSESFKNVCERLLLPFQQDEKWSENLKSQHFPRGKVSNTDEISPSLGWRRNTLLVEAMHSPDSGRVGHHARALESFCASNGIRLSLLHGISGIGKSMPGATFPTPFSSPLITGSFPSSPLLYSPDVGPQRIGRIDMVPPLSLDGLQAGKTFSSPPVSPKAHRQLSLHVRSLHEKLQSLPQVGIVHLCLQNDTVGSILSWQNDVFVVAEPGEHADKFLQSVKSSLLSVMRSNRRKGASVLSNISTIADLIHFRPYFQVGNVVHRYIGRQTQVMEDDHEIAAYMFRRTVPSMHLTPDDVRWMIGAWRERIIICTGTYGPTPPVVKAFLDSGAKAVVCPSAEPQEMSLTSFHGSGEFNVVENGRFEIGEEEAEDEDVEPSSPVSDWEDSEPEKSGEHLMGVWDDEEEELSQFICHLYDFLFREGARVDAALQKALASHRKLRYICHLPGIR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query1336 2.2.26 [Sep-21-2011]
Q8K1N1776 Calcium-independent phosp yes no 0.258 0.445 0.314 7e-47
Q5XTS1786 Calcium-independent phosp yes no 0.262 0.446 0.307 1e-45
Q9NP80782 Calcium-independent phosp yes no 0.261 0.446 0.313 3e-45
P97570807 85/88 kDa calcium-indepen yes no 0.223 0.369 0.273 5e-19
P97819807 85/88 kDa calcium-indepen no no 0.225 0.372 0.273 5e-19
O60733806 85/88 kDa calcium-indepen no no 0.225 0.373 0.260 5e-15
O74874690 Glucose-repressible alcoh yes no 0.077 0.149 0.359 8e-10
Q5B778675 Glucose-repressible alcoh no no 0.092 0.183 0.346 2e-09
Q7KRY7 1851 Protein lap4 OS=Drosophil no no 0.115 0.083 0.356 1e-08
Q5A761787 Glucose-repressible alcoh N/A no 0.080 0.137 0.354 3e-08
>sp|Q8K1N1|PLPL8_MOUSE Calcium-independent phospholipase A2-gamma OS=Mus musculus GN=Pnpla8 PE=2 SV=1 Back     alignment and function desciption
 Score =  190 bits (483), Expect = 7e-47,   Method: Compositional matrix adjust.
 Identities = 130/413 (31%), Positives = 203/413 (49%), Gaps = 67/413 (16%)

Query: 492 ESLRDLLMRLTVGPEPRVNKAAARALAILGENESLRRAIRGRQVPKQGLRILSMDGGGMK 551
           E +   L+RL    +  +  A    LA++G  +     ++GR     G+RIL++DGGG +
Sbjct: 397 EKIIPYLLRLRQVKDETLQAAVREILALIGYVD----PVKGR-----GIRILTIDGGGTR 447

Query: 552 GLATVQILKEIEKGTGKRIHELFDLVCGTSTGGMLAIALAVKLMTLDQCEEIYKNLGKLV 611
           G+  +Q L+++ + T K IH+LFD +CG STG +LA  L +  M LD+CEE+Y+ LG  V
Sbjct: 448 GVVALQTLRKLVELTQKPIHQLFDYICGVSTGAILAFMLGLFHMPLDECEELYRKLGSDV 507

Query: 612 FAEPFPKDNEAATWREKLDQIYKSSSQSFRVVVHGSKHSADQFERLLKEMCADEDGDLLI 671
           F +         +W           S +F        + ++ +E++LK    D  G  L+
Sbjct: 508 FTQNVIVGTVKMSW-----------SHAF--------YDSNTWEKILK----DRIGSALM 544

Query: 672 ESSVKN--IPKVFTVSTLVNV-MPAQPFIFRNYQYPAGTPEVPFSISENSGITVLGSPTT 728
             + +N   PKV  +ST+VN     + F+FRNY +  GT                     
Sbjct: 545 IETARNPACPKVAAISTIVNRGQTPKAFVFRNYGHFPGT--------------------- 583

Query: 729 GAQVGYKRSAFIGSCKHQVWQAIRASSAAPYYLDDFSDDVFRWQDGAIVANNPTIFAIRE 788
                   S ++G C++++WQAIRASSAAP Y  +++      QDG ++ NNP+  A+ E
Sbjct: 584 -------NSHYLGGCQYKMWQAIRASSAAPGYFAEYALGSDLHQDGGLLLNNPSALALHE 636

Query: 789 AQLLWPDTRIDCLVSIGCGSVPTKTRRGGWRYLDTGQVLIESACSVDRAEEALSTLLPML 848
            + +WPDT ++C+VS+G G   +  R     Y      L     S    EE    L  +L
Sbjct: 637 CKCIWPDTPLECIVSLGTGRYESDVRNTS-TYTSLKTKLSNVISSATDTEEVHIMLDGLL 695

Query: 849 PEIQYYRFNPVDERCE-MELDETDPAEWLKLEAAVDEYINNNSESFKNVCERL 900
           P   Y+RFNPV   CE + LDE+   +  +L+    +YI  N +  K V + L
Sbjct: 696 PSDTYFRFNPVI--CENIPLDESRDEKLDQLQLEGMKYIERNDQKMKKVAKIL 746
Calcium-independent phospholipase A2, which catalyzes the hydrolysis of the sn-2 position of glycerophospholipids, PtdSer and to a lower extent PtdCho. Cleaves membrane phospholipids.
Mus musculus (taxid: 10090)
EC: 3EC: .EC: 1EC: .EC: 1EC: .EC: 5
>sp|Q5XTS1|PLPL8_RABIT Calcium-independent phospholipase A2-gamma OS=Oryctolagus cuniculus GN=PNPLA8 PE=1 SV=1 Back     alignment and function description
>sp|Q9NP80|PLPL8_HUMAN Calcium-independent phospholipase A2-gamma OS=Homo sapiens GN=PNPLA8 PE=1 SV=1 Back     alignment and function description
>sp|P97570|PLPL9_RAT 85/88 kDa calcium-independent phospholipase A2 OS=Rattus norvegicus GN=Pla2g6 PE=1 SV=2 Back     alignment and function description
>sp|P97819|PLPL9_MOUSE 85/88 kDa calcium-independent phospholipase A2 OS=Mus musculus GN=Pla2g6 PE=1 SV=3 Back     alignment and function description
>sp|O60733|PLPL9_HUMAN 85/88 kDa calcium-independent phospholipase A2 OS=Homo sapiens GN=PLA2G6 PE=1 SV=2 Back     alignment and function description
>sp|O74874|CCR4_SCHPO Glucose-repressible alcohol dehydrogenase transcriptional effector OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ccr4 PE=3 SV=1 Back     alignment and function description
>sp|Q5B778|CCR4_EMENI Glucose-repressible alcohol dehydrogenase transcriptional effector OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=ccr4 PE=3 SV=1 Back     alignment and function description
>sp|Q7KRY7|LAP4_DROME Protein lap4 OS=Drosophila melanogaster GN=scrib PE=1 SV=1 Back     alignment and function description
>sp|Q5A761|CCR4_CANAL Glucose-repressible alcohol dehydrogenase transcriptional effector OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CCR4 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1336
2555549451318 conserved hypothetical protein [Ricinus 0.985 0.999 0.797 0.0
3021440851286 unnamed protein product [Vitis vinifera] 0.960 0.997 0.763 0.0
1478331901286 hypothetical protein VITISV_030806 [Viti 0.960 0.997 0.763 0.0
4494547221328 PREDICTED: uncharacterized protein LOC10 0.992 0.998 0.762 0.0
3565645181333 PREDICTED: uncharacterized protein LOC10 0.988 0.990 0.751 0.0
3565200531332 PREDICTED: uncharacterized protein LOC10 0.988 0.990 0.750 0.0
3574802391425 Calcium-independent phospholipase A2-gam 0.979 0.918 0.718 0.0
2241428521319 predicted protein [Populus trichocarpa] 0.957 0.969 0.728 0.0
3341835671309 galactolipase/ phospholipase [Arabidopsi 0.962 0.982 0.740 0.0
2402543021311 galactolipase/ phospholipase [Arabidopsi 0.962 0.980 0.738 0.0
>gi|255554945|ref|XP_002518510.1| conserved hypothetical protein [Ricinus communis] gi|223542355|gb|EEF43897.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
 Score = 2140 bits (5544), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1064/1334 (79%), Positives = 1177/1334 (88%), Gaps = 17/1334 (1%)

Query: 3    SWGLGWKRPLEIFKLTLSYGTEEAGYDPFNRLSTSSSSSTSTSSLSSPTVMTRDPELGFR 62
            SWGLGWKRP EIF+LTL+YGTEE+  D  NR STSSS S S+SS +S +    D + G R
Sbjct: 2    SWGLGWKRPSEIFRLTLNYGTEES-EDDLNRTSTSSSGSFSSSSPTSLSSPPHDQDPGLR 60

Query: 63   IDLEWTSGEEEDQVALKLQSQLMVALPVPEDTVVVELAPQEEGDVATDAANVGVEMRVVK 122
            IDL+WT G++EDQVAL+LQSQLMVALP+P+D V V+L  +E         NVGVEM+VVK
Sbjct: 61   IDLDWTVGDDEDQVALRLQSQLMVALPLPQDCVTVDLNVKE-------GENVGVEMKVVK 113

Query: 123  RREPLRAVVLTKGVGSGHLSDGIGVLTRLMRSDLSTSGPGNNMGSGFCDHWKTVTAVSLC 182
            RREPLR ++L+KG GSG  SDGIG+LTRL+RS+L T G  +  G    +HW+ VT +SLC
Sbjct: 114  RREPLRGMILSKG-GSGQQSDGIGILTRLLRSNLVTDGVVSTCG----EHWRNVTLLSLC 168

Query: 183  GLGLSALPVDLTRLPVLEKLYLDNNKLSTLPPELGAMKNLKVLIVDNNMLVCVPVELREC 242
            G  LS LP +L  LP+LEKLYLDNN+LS LPPELG +K LKVL VD+N LV VPVELR+C
Sbjct: 169  GCCLSVLPAELIGLPLLEKLYLDNNRLSVLPPELGELKALKVLSVDHNALVSVPVELRQC 228

Query: 243  VGLVELSLEHNRLVRPLLDFRAMAELKILRLFGNPLEFLPEILPLLKLRHLSLANIRIVA 302
            VGLVELSLEHN+LVRPLLDFRAMAEL+ILRLFGNPLEFLPEILPL KLRHLSLANIRIVA
Sbjct: 229  VGLVELSLEHNKLVRPLLDFRAMAELQILRLFGNPLEFLPEILPLHKLRHLSLANIRIVA 288

Query: 303  DENLRSVNVQIEMENNSYFGASRHKLSAFFSLIFRFSSCHHPLLASALAKIMQDQENRVV 362
            DENLRSVNVQIEMEN+SYFGASRHKLSAFF+LIFRFSSCHHPLLASALAKI+QDQ NR+V
Sbjct: 289  DENLRSVNVQIEMENSSYFGASRHKLSAFFALIFRFSSCHHPLLASALAKIIQDQGNRIV 348

Query: 363  VGKDENAVRQLISMISSDNRHVVEQACSALSSLAGDVSVAMLLMKCDIMQPIIAVLKSFA 422
            VGKDENAVRQLISMISSDN+HVVEQACSALSSL+GDVSVAM LMKCDIMQPI +VLKS A
Sbjct: 349  VGKDENAVRQLISMISSDNQHVVEQACSALSSLSGDVSVAMQLMKCDIMQPIESVLKSVA 408

Query: 423  PEEVKSVLQVVGQLAFASDTVAQKMLTKDVLKSLKLLCAHKNPEVQRFALLAVGNLAFCL 482
             EEV SVLQVV  LAFASDTVAQKMLTKD+  + + +      +VQR ALLAVGNLAFCL
Sbjct: 409  QEEVISVLQVVATLAFASDTVAQKMLTKDIHLTFQFVF----DQVQRLALLAVGNLAFCL 464

Query: 483  ENRRILVTSESLRDLLMRLTVGPEPRVNKAAARALAILGENESLRRAIRGRQVPKQGLRI 542
            ENRRILVTSESLRDLL+RLTV  EP VNKAAARALAILGENE+LRRAIRGRQV KQGLRI
Sbjct: 465  ENRRILVTSESLRDLLLRLTVTSEPLVNKAAARALAILGENENLRRAIRGRQVAKQGLRI 524

Query: 543  LSMDGGGMKGLATVQILKEIEKGTGKRIHELFDLVCGTSTGGMLAIALAVKLMTLDQCEE 602
            L+MDGGGMKGLATVQILK IEKGTGKRIHELFDL+CGTSTGGMLA+AL +KLMTL QCEE
Sbjct: 525  LAMDGGGMKGLATVQILKAIEKGTGKRIHELFDLICGTSTGGMLAVALGIKLMTLSQCEE 584

Query: 603  IYKNLGKLVFAEPFPKDNEAATWREKLDQIYKSSSQSFRVVVHGSKHSADQFERLLKEMC 662
            IYKNLGKLVFAEP PKDNEAA+WREKLDQ+YKSSSQSFRVVVHGSKHSADQFERLLKEMC
Sbjct: 585  IYKNLGKLVFAEPTPKDNEAASWREKLDQLYKSSSQSFRVVVHGSKHSADQFERLLKEMC 644

Query: 663  ADEDGDLLIESSVKNIPKVFTVSTLVNVMPAQPFIFRNYQYPAGTPEVPFSISENSGITV 722
            ADEDGDLLI+S+VKNIPKVF VSTLV+VMPAQP++FRNYQYPAGTPEVP   SE+SG+TV
Sbjct: 645  ADEDGDLLIDSAVKNIPKVFVVSTLVSVMPAQPYVFRNYQYPAGTPEVPMPNSESSGVTV 704

Query: 723  LGSPTTGAQVGYKRSAFIGSCKHQVWQAIRASSAAPYYLDDFSDDVFRWQDGAIVANNPT 782
            LGSPT GAQVGYKRSAFIGSCKH VWQAIRASSAAPYYLDDFSDDV RWQDGAIVANNPT
Sbjct: 705  LGSPTIGAQVGYKRSAFIGSCKHHVWQAIRASSAAPYYLDDFSDDVNRWQDGAIVANNPT 764

Query: 783  IFAIREAQLLWPDTRIDCLVSIGCGSVPTKTRRGGWRYLDTGQVLIESACSVDRAEEALS 842
            IFA+REAQLLWPDT+IDCLVSIGCGSVPTK RRGGWRYLDTGQVLIESACSVDR EEALS
Sbjct: 765  IFAVREAQLLWPDTKIDCLVSIGCGSVPTKVRRGGWRYLDTGQVLIESACSVDRVEEALS 824

Query: 843  TLLPMLPEIQYYRFNPVDERCEMELDETDPAEWLKLEAAVDEYINNNSESFKNVCERLLL 902
            TLLPMLPEIQYYRFNPVDERC+MELDETDPA WLKLEAAVDEYI  NS++FKNVCERLLL
Sbjct: 825  TLLPMLPEIQYYRFNPVDERCDMELDETDPAVWLKLEAAVDEYIQTNSDAFKNVCERLLL 884

Query: 903  PFQQDEKWSENLKSQHFPRGKVSNTDEISPSLGWRRNTLLVEAMHSPDSGRVGHHARALE 962
            P+Q D+K+SENL++  FP+ KV+N+D  SPSLGWRRN LLVEA+HSPDSGRV HHARALE
Sbjct: 885  PYQHDDKFSENLRNHQFPKPKVANSDGSSPSLGWRRNVLLVEALHSPDSGRVMHHARALE 944

Query: 963  SFCASNGIRLSLLHGISGIGKSMPGATFPTPFSSPLITGSFPSSPLLYSPDVGPQRIGRI 1022
            SFC +NGIRLSL+ G SGI K  P  TFP+PF+SPLITGSFPSSPLL+SPD GP RIGRI
Sbjct: 945  SFCTNNGIRLSLMLGASGIAKIAPATTFPSPFTSPLITGSFPSSPLLFSPDFGPHRIGRI 1004

Query: 1023 DMVPPLSLDGLQAGKTFSSPPVSPKAHRQLSLHVRSLHEKLQSLPQVGIVHLCLQNDTVG 1082
            DMVPPLSLDG+Q+ K  +SPP SP   RQLSL VRSLHEKLQ+ PQVGIVHL LQND+VG
Sbjct: 1005 DMVPPLSLDGVQSVKNAASPPRSPSGRRQLSLPVRSLHEKLQNTPQVGIVHLALQNDSVG 1064

Query: 1083 SILSWQNDVFVVAEPGEHADKFLQSVKSSLLSVMRSNRRKGASVLSNISTIADLIHFRPY 1142
            SI+SWQNDVFVVAEPG+ A+KFLQSVK SLLS+MRS RRK  S  +NIST+ADL+ ++ Y
Sbjct: 1065 SIISWQNDVFVVAEPGDLANKFLQSVKFSLLSMMRSRRRKVPSFFANISTVADLVRYKTY 1124

Query: 1143 FQVGNVVHRYIGRQTQVMEDDHEIAAYMFRRTVPSMHLTPDDVRWMIGAWRERIIICTGT 1202
            FQVGNVVHRYIGRQTQVMEDD EI AYMFRRTVPSMHLTPDDVRWM+GAWR+RIIICTGT
Sbjct: 1125 FQVGNVVHRYIGRQTQVMEDDQEIGAYMFRRTVPSMHLTPDDVRWMVGAWRDRIIICTGT 1184

Query: 1203 YGPTPPVVKAFLDSGAKAVVCPSAEPQEMSLTSFHGSGEFNVVENGRFEIGEEEAEDEDV 1262
            YGP P ++KAFLDSGAKAVVCPSA+  E+ LTS HGS EF+V+ENGRFEIGEEEAEDE+ 
Sbjct: 1185 YGPIPTLIKAFLDSGAKAVVCPSADALEIPLTSTHGSEEFHVLENGRFEIGEEEAEDEEA 1244

Query: 1263 EPSSPVSDWEDSEPEKSGEHLMGVWDDEEEELSQFICHLYDFLFREGARVDAALQKALAS 1322
            EP SP SDWEDS+ EK+GE   G WDDEE+ELSQF+CHLYD +F+EGA+VDAAL+ ALAS
Sbjct: 1245 EPVSPRSDWEDSDLEKNGERATGFWDDEEDELSQFVCHLYDSIFQEGAKVDAALRNALAS 1304

Query: 1323 HRKLRYICHLPGIR 1336
            HR+LRY CHL GI+
Sbjct: 1305 HRRLRYSCHLSGIQ 1318

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|302144085|emb|CBI23190.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|147833190|emb|CAN68639.1| hypothetical protein VITISV_030806 [Vitis vinifera] Back     alignment and taxonomy information
>gi|449454722|ref|XP_004145103.1| PREDICTED: uncharacterized protein LOC101211840 [Cucumis sativus] gi|449471727|ref|XP_004153391.1| PREDICTED: tryptophan synthase beta chain 2, chloroplastic-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|356564518|ref|XP_003550500.1| PREDICTED: uncharacterized protein LOC100818519 [Glycine max] Back     alignment and taxonomy information
>gi|356520053|ref|XP_003528680.1| PREDICTED: uncharacterized protein LOC100788345 [Glycine max] Back     alignment and taxonomy information
>gi|357480239|ref|XP_003610405.1| Calcium-independent phospholipase A2-gamma [Medicago truncatula] gi|355511460|gb|AES92602.1| Calcium-independent phospholipase A2-gamma [Medicago truncatula] Back     alignment and taxonomy information
>gi|224142852|ref|XP_002335975.1| predicted protein [Populus trichocarpa] gi|222836541|gb|EEE74948.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|334183567|ref|NP_001185288.1| galactolipase/ phospholipase [Arabidopsis thaliana] gi|332195775|gb|AEE33896.1| galactolipase/ phospholipase [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|240254302|ref|NP_176378.4| galactolipase/ phospholipase [Arabidopsis thaliana] gi|332195774|gb|AEE33895.1| galactolipase/ phospholipase [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1336
TAIR|locus:20368081311 AT1G61850 [Arabidopsis thalian 0.914 0.932 0.728 0.0
UNIPROTKB|E1BVG7782 E1BVG7 "Uncharacterized protei 0.120 0.205 0.335 7.5e-39
ZFIN|ZDB-GENE-070705-553694 pnpla8 "patatin-like phospholi 0.121 0.233 0.383 1.7e-38
MGI|MGI:1914702776 Pnpla8 "patatin-like phospholi 0.119 0.204 0.365 5.4e-38
UNIPROTKB|Q9NP80782 PNPLA8 "Calcium-independent ph 0.117 0.200 0.372 4.1e-37
UNIPROTKB|E1BE78784 PNPLA8 "Uncharacterized protei 0.119 0.202 0.365 6.8e-35
UNIPROTKB|F6Y4R5713 PNPLA8 "Uncharacterized protei 0.119 0.223 0.365 1.3e-34
RGD|1311444776 Pnpla8 "patatin-like phospholi 0.132 0.228 0.343 1.7e-34
UNIPROTKB|E2QZP1784 PNPLA8 "Uncharacterized protei 0.119 0.202 0.365 1.9e-34
WB|WBGene00022233546 Y73B6BL.4 [Caenorhabditis eleg 0.123 0.302 0.365 7e-34
TAIR|locus:2036808 AT1G61850 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 4566 (1612.4 bits), Expect = 0., P = 0.
 Identities = 906/1243 (72%), Positives = 1027/1243 (82%)

Query:    56 DPELGFRIDLEWTSGEEEDQVALKLQSQLMVALPVPEDTVVVELAPQEEGDVATDAANVG 115
             DPELGFRIDL+WT+G+ EDQVAL+L+SQLMVALP P DTVVVEL    + D      NVG
Sbjct:    13 DPELGFRIDLDWTAGDSEDQVALRLESQLMVALPAPHDTVVVELKGIGDDDEG-GLENVG 71

Query:   116 VEMRVVKRREPLRAVVLTKGVGSGHLSDGIGVLTRLMRSDLSTSG---PGNNMGSGFCDH 172
             +EMRV KRREPLRAV L K VGSG   DG+GVLTRLMRSD+  +    P  ++ S    H
Sbjct:    72 LEMRVEKRREPLRAVTLMKAVGSGQQYDGVGVLTRLMRSDMMPAAIPAPAIDVASSCGVH 131

Query:   173 WKTVTAVSLCGLGLSALPVDLTRLPVLEKLYLDNNKLSTLPPELGAMKNLKVLIVDNNML 232
             WKTVT++SL G GL  +PV++T LP+LEKL L++NKLS LPPE+G +KNLK+L VDNNML
Sbjct:   132 WKTVTSLSLSGCGLLVMPVEVTELPLLEKLCLEHNKLSVLPPEIGKLKNLKILRVDNNML 191

Query:   233 VCVPVELRECVGLVELSLEHNRLVRPLLDFRAMAELKILRLFGNXXXXXXXXXXXXXXXX 292
             + VPVELR+CVGLVELSLEHN+LVRPLLDFRAMA L+ILRLFGN                
Sbjct:   192 ISVPVELRQCVGLVELSLEHNKLVRPLLDFRAMAGLRILRLFGNPLEFLPEILPLHQLRH 251

Query:   293 XSLANIRIVADENLRSVNVQIEMENNSYFGASRHKLSAFFSLIFRFSSCHHPLLASALAK 352
              SL NIRIV+DENLRSVNVQIE EN SYFGASRHKLSAF  LIFR SSCHHPLLAS L K
Sbjct:   252 LSLVNIRIVSDENLRSVNVQIETENTSYFGASRHKLSAFSPLIFRSSSCHHPLLASTLVK 311

Query:   353 IMQDQENRVVVGKDENAVRQLISMISSDNRHVVEQACSALSSLAGDVSVAMLLMKCDIMQ 412
             IMQD+ NR V+GKDENAVRQLISMI+SDN+HVVEQAC ALSSLA DV VAM LMKCDIM+
Sbjct:   312 IMQDEGNRSVIGKDENAVRQLISMITSDNQHVVEQACVALSSLARDVGVAMQLMKCDIMK 371

Query:   413 PIIAVLKSFAPEEVKSVLQVVGQLAFASDTVAQKMLTKDVLKSLKLLCAHKNPEVQRFAL 472
             P   VLKS +P+EV SVLQVV  LAF SD+V+QKMLTKD+LK+LK LCAHKNPEVQR AL
Sbjct:   372 PTETVLKSSSPDEVISVLQVVVTLAFVSDSVSQKMLTKDMLKALKSLCAHKNPEVQRQAL 431

Query:   473 LAVGNLAFCLENRRILVTSESLRDLLMRLTVGPEPRVNKAAARALAILGENESLRRAIRG 532
             LAVGNLAFCLENRRIL+TSESLR+LLMRL V PEPRVNKAAARALAILGENE LRR+I+G
Sbjct:   432 LAVGNLAFCLENRRILITSESLRELLMRLIVTPEPRVNKAAARALAILGENEILRRSIKG 491

Query:   533 RQVPKQGLRILSMDGGGMKGLATVQILKEIEKGTGKRIHELFDLVCGTSTGGMLAIALAV 592
             RQVPKQGLRIL+MDGGGMKGLATVQILKEIEKG+GK IHELFDL+CGTSTGGMLAIAL V
Sbjct:   492 RQVPKQGLRILTMDGGGMKGLATVQILKEIEKGSGKPIHELFDLICGTSTGGMLAIALGV 551

Query:   593 KLMTLDQCEEIYKNLGKLVFAEPFPKDNEAATWREKLDQIYKSSSQSFRVVVHGSKHSAD 652
             KLMTL+QCEEIYKNLGKLVFAE  PKDNEAA+WREKLDQ+YKSSSQSFRVV+HGSKHSA+
Sbjct:   552 KLMTLEQCEEIYKNLGKLVFAESVPKDNEAASWREKLDQLYKSSSQSFRVVIHGSKHSAN 611

Query:   653 QFERLLKEMCADEDGDLLIESSVKNIPKVFTVSTLVNVMPAQPFIFRNYQYPAGTPEVPF 712
             +FERLLKEMCADEDGDLLIES+VKN+PKVF VSTLV+VMPAQPFIFRNYQYP GTPE+ +
Sbjct:   612 EFERLLKEMCADEDGDLLIESAVKNVPKVFVVSTLVSVMPAQPFIFRNYQYPVGTPEMSY 671

Query:   713 SISENSGITVLGSPTTGAQVGY-KRSAFIGSCKHQVWQAIRASSAAPYYLDDFS--DDVF 769
             + S++SG + L S T   Q GY K+SAF+GSCKHQVWQAIRASSAAPYYLDDFS   + +
Sbjct:   672 AFSDHSGGSTLTSSTASDQAGYYKQSAFMGSCKHQVWQAIRASSAAPYYLDDFSVGTNSY 731

Query:   770 RWQDGAIVANNPTIFAIREAQLLWPDTRIDCLVSIGCGSVPTKTRRGGWRYLDTGQVLIE 829
             RWQDGAIVANNPTIFAIREAQLLWPDT+IDCLVSIG GSVPT+ R+GGWRYLDTGQVLIE
Sbjct:   732 RWQDGAIVANNPTIFAIREAQLLWPDTKIDCLVSIGSGSVPTRVRKGGWRYLDTGQVLIE 791

Query:   830 SACSVDRAEEALSTLLPMLPEIQYYRFNPVDERCEMELDETDPAEWLKLEAAVDEYINNN 889
             SACSV+R EEALSTLLPMLPEIQY+RFNPVD+RC MELDETDPA WLKLEAA++E+I +N
Sbjct:   792 SACSVERVEEALSTLLPMLPEIQYFRFNPVDDRCGMELDETDPAIWLKLEAAIEEFIQSN 851

Query:   890 SESFKNVCERLLLPFQQDEKWSENLKSQHFPRGKVSNTD-EISPSLGWRRNTLLVEAMHS 948
              + FKNVCERL LPF  DEKW +NLK + F  GK+ N+  E SPSLGWRRN LL+EA HS
Sbjct:   852 PQVFKNVCERLTLPFLNDEKWCDNLKPR-FMNGKLPNSRVESSPSLGWRRNVLLMEAQHS 910

Query:   949 PDSGRVGHHARALESFCASNGIRLSLLHGIS--GIGKSMPGATFPTPFSSPLITGSFPSS 1006
             PDSGRV +HARALESFC++NGI+LS LH  +  G  K  PG  FPTPF+SPLITGS P S
Sbjct:   911 PDSGRVKYHARALESFCSNNGIKLSSLHTTATPGCQKPSPGTAFPTPFTSPLITGSLPPS 970

Query:  1007 PLLYSPDVGPQRIGRIDMVPPLSLDGLQAGKTFSSPPVSPKAHRQLSLHVRSLHEKLQSL 1066
             PLL++P++GPQ+  RIDMVPPLSLDG   GKT  SPP SP   RQL L +R +HEKLQ+L
Sbjct:   971 PLLFTPELGPQKFNRIDMVPPLSLDGGHVGKTVMSPPSSPPRQRQLYLPLRQMHEKLQNL 1030

Query:  1067 PQVGIVHLCLQNDTVGSILSWQNDVFVVAEPGEHADKFLQSVKSSLLSVMRSNRRKGASV 1126
             PQVGI+HL LQND+ GSILSWQNDVFVVAEPG+ ADKFLQSVK S+LSVM+SNRRK ASV
Sbjct:  1031 PQVGILHLSLQNDSNGSILSWQNDVFVVAEPGDLADKFLQSVKVSILSVMQSNRRKAASV 1090

Query:  1127 LSNISTIADLIHFRPYFQVGNVVHRYIGRQTQVMEDDHEIAAYMFRRTVPSMHLTPDDVR 1186
             LSNI +I+DL+  +  FQVGN++HRYIGRQT VMEDD EIA++MFRRTVPS HLTPDD+R
Sbjct:  1091 LSNICSISDLVRSKKCFQVGNIIHRYIGRQTLVMEDDQEIASFMFRRTVPSAHLTPDDIR 1150

Query:  1187 WMIGAWRERIIICTGTYGPTPPVVKAFLDSGAKAVVCPSAEPQEMSLTSFHGSGEFNVXX 1246
             WM+GAWR+RII+ +GT+GPT  VVKAFLDSGAKAV+ PS EPQE  L +  GS E+N+  
Sbjct:  1151 WMVGAWRDRIIVFSGTFGPTQAVVKAFLDSGAKAVIGPSNEPQETPLITSQGSSEYNIGD 1210

Query:  1247 XXXXXXXXXX----------XXXXXXXPSSPVSDWEDSEPEKS 1279
                                        P +P SDWEDS+ EK+
Sbjct:  1211 QNGKFEIGEEEDEDEEVNEETEREEMEPPTPTSDWEDSDHEKT 1253
GO:0005634 "nucleus" evidence=ISM
GO:0006629 "lipid metabolic process" evidence=IEA
GO:0008152 "metabolic process" evidence=IEA
GO:0004620 "phospholipase activity" evidence=IDA
GO:0009620 "response to fungus" evidence=IMP
GO:0009695 "jasmonic acid biosynthetic process" evidence=IMP
GO:0047714 "galactolipase activity" evidence=IDA
GO:0010228 "vegetative to reproductive phase transition of meristem" evidence=RCA
GO:0016926 "protein desumoylation" evidence=RCA
GO:0050665 "hydrogen peroxide biosynthetic process" evidence=RCA
UNIPROTKB|E1BVG7 E1BVG7 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-070705-553 pnpla8 "patatin-like phospholipase domain containing 8" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
MGI|MGI:1914702 Pnpla8 "patatin-like phospholipase domain containing 8" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|Q9NP80 PNPLA8 "Calcium-independent phospholipase A2-gamma" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E1BE78 PNPLA8 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F6Y4R5 PNPLA8 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
RGD|1311444 Pnpla8 "patatin-like phospholipase domain containing 8" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|E2QZP1 PNPLA8 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
WB|WBGene00022233 Y73B6BL.4 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00006893001
SubName- Full=Chromosome chr10 scaffold_179, whole genome shotgun sequence; (1286 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1336
cd07211308 cd07211, Pat_PNPLA8, Patatin-like phospholipase do 1e-145
cd07216309 cd07216, Pat17_PNPLA8_PNPLA9_like3, Patatin-like p 9e-40
cd07212312 cd07212, Pat_PNPLA9, Patatin-like phospholipase do 4e-39
cd07199258 cd07199, Pat17_PNPLA8_PNPLA9_like, Patatin-like ph 8e-26
cd07199258 cd07199, Pat17_PNPLA8_PNPLA9_like, Patatin-like ph 5e-20
pfam01734189 pfam01734, Patatin, Patatin-like phospholipase 7e-18
COG3621394 COG3621, COG3621, Patatin [General function predic 6e-16
cd07217344 cd07217, Pat17_PNPLA8_PNPLA9_like4, Patatin-like p 1e-13
cd07214349 cd07214, Pat17_isozyme_like, Patatin-like phosphol 8e-13
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 3e-12
cd00020120 cd00020, ARM, Armadillo/beta-catenin-like repeats 2e-10
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 3e-10
cd07215329 cd07215, Pat17_PNPLA8_PNPLA9_like2, Patatin-like p 2e-09
cd07213288 cd07213, Pat17_PNPLA8_PNPLA9_like1, Patatin-like p 7e-09
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 1e-07
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 9e-07
PRK15370754 PRK15370, PRK15370, E3 ubiquitin-protein ligase Sl 4e-06
cd07215329 cd07215, Pat17_PNPLA8_PNPLA9_like2, Patatin-like p 6e-06
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 4e-05
COG5064526 COG5064, SRP1, Karyopherin (importin) alpha [Intra 4e-05
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 1e-04
pfam1279943 pfam12799, LRR_4, Leucine Rich repeats (2 copies) 1e-04
pfam1364688 pfam13646, HEAT_2, HEAT repeats 3e-04
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 4e-04
PLN00113968 PLN00113, PLN00113, leucine-rich repeat receptor-l 5e-04
cd07207194 cd07207, Pat_ExoU_VipD_like, ExoU and VipD-like pr 8e-04
cd00020120 cd00020, ARM, Armadillo/beta-catenin-like repeats 0.001
pfam0051441 pfam00514, Arm, Armadillo/beta-catenin-like repeat 0.001
cd13394597 cd13394, Syo1_like, Fungal symportin 1 (syo1) and 0.001
PRK15370754 PRK15370, PRK15370, E3 ubiquitin-protein ligase Sl 0.002
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 0.003
PLN00113968 PLN00113, PLN00113, leucine-rich repeat receptor-l 0.003
PRK15370754 PRK15370, PRK15370, E3 ubiquitin-protein ligase Sl 0.004
pfam1279943 pfam12799, LRR_4, Leucine Rich repeats (2 copies) 0.004
>gnl|CDD|132850 cd07211, Pat_PNPLA8, Patatin-like phospholipase domain containing protein 8 Back     alignment and domain information 
 Score =  441 bits (1136), Expect = e-145
 Identities = 151/360 (41%), Positives = 208/360 (57%), Gaps = 55/360 (15%)

Query: 533 RQVPKQGLRILSMDGGGMKGLATVQILKEIEKGTGKRIHELFDLVCGTSTGGMLAIALAV 592
             V  +G+RILS+DGGG +G+  ++IL++IEK TGK IHELFD +CG STG +LA  L +
Sbjct: 1   PPVKGRGIRILSIDGGGTRGVVALEILRKIEKLTGKPIHELFDYICGVSTGAILAFLLGL 60

Query: 593 KLMTLDQCEEIYKNLGKLVFAEPFPKDNEAATWREKLDQIYKSSSQSFRVVVHGSKHSAD 652
           K M+LD+CEE+Y+ LGK VF++                      S + R+V+  + +  +
Sbjct: 61  KKMSLDECEELYRKLGKDVFSQNTY------------------ISGTSRLVLSHAYYDTE 102

Query: 653 QFERLLKEMCADEDGDLLIESSVKNIPKVFTVSTLVNVMPAQPFIFRNYQYPAGTPEVPF 712
            +E++LKEM   ++  L+  S+  N PKV  VST VN  P +P++FRNY +P GT     
Sbjct: 103 TWEKILKEMMGSDE--LIDTSADPNCPKVACVSTQVNRTPLKPYVFRNYNHPPGT----- 155

Query: 713 SISENSGITVLGSPTTGAQVGYKRSAFIGSCKHQVWQAIRASSAAPYYLDDFSDDVFRWQ 772
                                  RS ++GSCKH++W+AIRASSAAP Y ++F       Q
Sbjct: 156 -----------------------RSHYLGSCKHKLWEAIRASSAAPGYFEEFKLGNNLHQ 192

Query: 773 DGAIVANNPTIFAIREAQLLWPDTRIDCLVSIGCGSVPTKTR--RGGWRYLDTGQV-LIE 829
           DG ++ANNPT  A+ EA+LLWPDT I CLVS+G G  P+  R   GG+  L T  + LI+
Sbjct: 193 DGGLLANNPTALALHEAKLLWPDTPIQCLVSVGTGRYPSSVRLETGGYTSLKTKLLNLID 252

Query: 830 SACSVDRAEEALSTLLPMLPEIQYYRFNPVDERCEMELDETDPAEWLKLEAAVDEYINNN 889
           SA   +R   AL  L   LP   Y+RFNPV   C +ELDET P +  +L+    EYI  N
Sbjct: 253 SATDTERVHTALDDL---LPPDVYFRFNPVMSEC-VELDETRPEKLDQLQDDTLEYIKRN 308

PNPLA8 is a Ca-independent myocardial phospholipase which maintains mitochondrial integrity. PNPLA8 is also known as iPLA2-gamma. In humans, it is predominantly expressed in heart tissue. iPLA2-gamma can catalyze both phospholipase A1 and A2 reactions (PLA1 and PLA2 respectively). This family includes PNPLA8 (iPLA2-gamma) from Homo sapiens and iPLA2-2 from Mus musculus. Length = 308
>gnl|CDD|132855 cd07216, Pat17_PNPLA8_PNPLA9_like3, Patatin-like phospholipase Back     alignment and domain information
>gnl|CDD|132851 cd07212, Pat_PNPLA9, Patatin-like phospholipase domain containing protein 9 Back     alignment and domain information
>gnl|CDD|132838 cd07199, Pat17_PNPLA8_PNPLA9_like, Patatin-like phospholipase; includes PNPLA8, PNPLA9, and Pat17 Back     alignment and domain information
>gnl|CDD|132838 cd07199, Pat17_PNPLA8_PNPLA9_like, Patatin-like phospholipase; includes PNPLA8, PNPLA9, and Pat17 Back     alignment and domain information
>gnl|CDD|216671 pfam01734, Patatin, Patatin-like phospholipase Back     alignment and domain information
>gnl|CDD|226148 COG3621, COG3621, Patatin [General function prediction only] Back     alignment and domain information
>gnl|CDD|132856 cd07217, Pat17_PNPLA8_PNPLA9_like4, Patatin-like phospholipase Back     alignment and domain information
>gnl|CDD|132853 cd07214, Pat17_isozyme_like, Patatin-like phospholipase of plants Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|237987 cd00020, ARM, Armadillo/beta-catenin-like repeats Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|132854 cd07215, Pat17_PNPLA8_PNPLA9_like2, Patatin-like phospholipase of bacteria Back     alignment and domain information
>gnl|CDD|132852 cd07213, Pat17_PNPLA8_PNPLA9_like1, Patatin-like phospholipase Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|185268 PRK15370, PRK15370, E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>gnl|CDD|132854 cd07215, Pat17_PNPLA8_PNPLA9_like2, Patatin-like phospholipase of bacteria Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|227396 COG5064, SRP1, Karyopherin (importin) alpha [Intracellular trafficking and secretion] Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|205079 pfam12799, LRR_4, Leucine Rich repeats (2 copies) Back     alignment and domain information
>gnl|CDD|222285 pfam13646, HEAT_2, HEAT repeats Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|132846 cd07207, Pat_ExoU_VipD_like, ExoU and VipD-like proteins; homologus to patatin, cPLA2, and iPLA2 Back     alignment and domain information
>gnl|CDD|237987 cd00020, ARM, Armadillo/beta-catenin-like repeats Back     alignment and domain information
>gnl|CDD|201276 pfam00514, Arm, Armadillo/beta-catenin-like repeat Back     alignment and domain information
>gnl|CDD|240521 cd13394, Syo1_like, Fungal symportin 1 (syo1) and similar proteins Back     alignment and domain information
>gnl|CDD|185268 PRK15370, PRK15370, E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|185268 PRK15370, PRK15370, E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>gnl|CDD|205079 pfam12799, LRR_4, Leucine Rich repeats (2 copies) Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 1336
KOG4231763 consensus Intracellular membrane-bound Ca2+-indepe 100.0
cd07211308 Pat_PNPLA8 Patatin-like phospholipase domain conta 100.0
cd07215329 Pat17_PNPLA8_PNPLA9_like2 Patatin-like phospholipa 100.0
cd07216309 Pat17_PNPLA8_PNPLA9_like3 Patatin-like phospholipa 100.0
cd07212312 Pat_PNPLA9 Patatin-like phospholipase domain conta 100.0
cd07214349 Pat17_isozyme_like Patatin-like phospholipase of p 100.0
cd07213288 Pat17_PNPLA8_PNPLA9_like1 Patatin-like phospholipa 100.0
cd07199258 Pat17_PNPLA8_PNPLA9_like Patatin-like phospholipas 100.0
cd07217344 Pat17_PNPLA8_PNPLA9_like4 Patatin-like phospholipa 100.0
COG3621394 Patatin [General function prediction only] 99.97
cd07225306 Pat_PNPLA6_PNPLA7 Patatin-like phospholipase domai 99.93
cd07207194 Pat_ExoU_VipD_like ExoU and VipD-like proteins; ho 99.93
cd07205175 Pat_PNPLA6_PNPLA7_NTE1_like Patatin-like phospholi 99.92
cd07210221 Pat_hypo_W_succinogenes_WS1459_like Hypothetical p 99.91
cd07228175 Pat_NTE_like_bacteria Bacterial patatin-like phosp 99.9
cd07209215 Pat_hypo_Ecoli_Z1214_like Hypothetical patatin sim 99.89
KOG04441255 consensus Cytoskeletal regulator Flightless-I (con 99.89
KOG4194873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.88
KOG04441255 consensus Cytoskeletal regulator Flightless-I (con 99.88
cd07227269 Pat_Fungal_NTE1 Fungal patatin-like phospholipase 99.87
PLN00113968 leucine-rich repeat receptor-like protein kinase; 99.87
PLN00113968 leucine-rich repeat receptor-like protein kinase; 99.87
KOG4194873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.87
cd07208266 Pat_hypo_Ecoli_yjju_like Hypothetical patatin simi 99.86
PRK10279300 hypothetical protein; Provisional 99.86
PRK15387788 E3 ubiquitin-protein ligase SspH2; Provisional 99.85
cd07230421 Pat_TGL4-5_like Triacylglycerol lipase 4 and 5. TG 99.83
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.82
cd07198172 Patatin Patatin-like phospholipase. Patatin is a s 99.82
cd07232407 Pat_PLPL Patain-like phospholipase. Patatin-like p 99.81
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.81
PRK15370754 E3 ubiquitin-protein ligase SlrP; Provisional 99.81
PF01734204 Patatin: Patatin-like phospholipase This Prosite f 99.8
cd07221252 Pat_PNPLA3 Patatin-like phospholipase domain conta 99.78
COG1752306 RssA Predicted esterase of the alpha-beta hydrolas 99.78
cd07222246 Pat_PNPLA4 Patatin-like phospholipase domain conta 99.78
cd07218245 Pat_iPLA2 Calcium-independent phospholipase A2; Cl 99.77
cd07219382 Pat_PNPLA1 Patatin-like phospholipase domain conta 99.77
cd07204243 Pat_PNPLA_like Patatin-like phospholipase domain c 99.76
PRK15387788 E3 ubiquitin-protein ligase SspH2; Provisional 99.75
cd07220249 Pat_PNPLA2 Patatin-like phospholipase domain conta 99.73
cd07224233 Pat_like Patatin-like phospholipase. Patatin-like 99.71
cd07206298 Pat_TGL3-4-5_SDP1 Triacylglycerol lipase 3, 4, and 99.69
KOG06181081 consensus Serine/threonine phosphatase 2C containi 99.68
PRK15370754 E3 ubiquitin-protein ligase SlrP; Provisional 99.66
cd07229391 Pat_TGL3_like Triacylglycerol lipase 3. Triacylgly 99.64
KOG29681158 consensus Predicted esterase of the alpha-beta hyd 99.63
cd07231323 Pat_SDP1-like Sugar-Dependent 1 like lipase. Sugar 99.63
KOG0617264 consensus Ras suppressor protein (contains leucine 99.63
KOG06181081 consensus Serine/threonine phosphatase 2C containi 99.63
PLN032101153 Resistant to P. syringae 6; Provisional 99.62
COG4667292 Predicted esterase of the alpha-beta hydrolase sup 99.6
cd01819155 Patatin_and_cPLA2 Patatins and Phospholipases. Pat 99.6
KOG0617264 consensus Ras suppressor protein (contains leucine 99.6
KOG0513503 consensus Ca2+-independent phospholipase A2 [Lipid 99.59
cd07223405 Pat_PNPLA5-mammals Patatin-like phospholipase doma 99.58
KOG4237498 consensus Extracellular matrix protein slit, conta 99.58
PLN032101153 Resistant to P. syringae 6; Provisional 99.56
TIGR03607739 patatin-related protein. This bacterial protein fa 99.49
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.38
KOG4237498 consensus Extracellular matrix protein slit, conta 99.35
KOG2214543 consensus Predicted esterase of the alpha-beta hyd 99.34
KOG0532722 consensus Leucine-rich repeat (LRR) protein, conta 99.34
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.33
KOG0513503 consensus Ca2+-independent phospholipase A2 [Lipid 99.3
KOG0532722 consensus Leucine-rich repeat (LRR) protein, conta 99.25
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.21
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 99.18
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.17
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.17
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.15
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 99.14
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.1
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.06
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.94
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.89
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.87
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.85
KOG18591096 consensus Leucine-rich repeat proteins [General fu 98.6
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.58
KOG18591096 consensus Leucine-rich repeat proteins [General fu 98.57
PLN03150623 hypothetical protein; Provisional 98.47
PLN03150623 hypothetical protein; Provisional 98.47
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.33
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.32
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.26
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.19
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.17
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.07
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 98.02
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.01
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.0
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 97.99
PRK15386426 type III secretion protein GogB; Provisional 97.84
KOG3773354 consensus Adiponutrin and related vesicular transp 97.84
PRK15386426 type III secretion protein GogB; Provisional 97.81
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 97.79
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 97.76
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.7
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.57
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 97.53
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.52
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 97.51
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 97.47
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 97.11
KOG2123388 consensus Uncharacterized conserved protein [Funct 97.1
cd00147438 cPLA2_like Cytosolic phospholipase A2, catalytic d 96.59
KOG2123388 consensus Uncharacterized conserved protein [Funct 96.28
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 96.03
KOG4308478 consensus LRR-containing protein [Function unknown 96.0
PF12770287 CHAT: CHAT domain 95.9
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 95.59
cd00020120 ARM Armadillo/beta-catenin-like repeats. An approx 95.58
KOG4341483 consensus F-box protein containing LRR [General fu 95.05
KOG4308478 consensus LRR-containing protein [Function unknown 95.03
KOG4224550 consensus Armadillo repeat protein VAC8 required f 94.17
KOG0166514 consensus Karyopherin (importin) alpha [Intracellu 93.37
KOG0473326 consensus Leucine-rich repeat protein [Function un 93.03
KOG0473326 consensus Leucine-rich repeat protein [Function un 92.91
KOG1947482 consensus Leucine rich repeat proteins, some prote 92.5
KOG1947482 consensus Leucine rich repeat proteins, some prote 91.74
KOG4224550 consensus Armadillo repeat protein VAC8 required f 91.51
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 91.38
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 91.18
PF04826254 Arm_2: Armadillo-like; InterPro: IPR006911 This en 91.15
PLN03200 2102 cellulose synthase-interactive protein; Provisiona 90.48
cd07202430 cPLA2_Grp-IVC Group IVC cytoplasmic phospholipase 89.83
KOG1048717 consensus Neural adherens junction protein Plakoph 89.65
PLN03200 2102 cellulose synthase-interactive protein; Provisiona 89.54
PF05804708 KAP: Kinesin-associated protein (KAP) 88.65
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 86.84
PF05804708 KAP: Kinesin-associated protein (KAP) 86.57
KOG4341483 consensus F-box protein containing LRR [General fu 85.75
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 85.6
KOG4231763 consensus Intracellular membrane-bound Ca2+-indepe 85.31
COG5064526 SRP1 Karyopherin (importin) alpha [Intracellular t 80.36
>KOG4231 consensus Intracellular membrane-bound Ca2+-independent phospholipase A2 [Lipid transport and metabolism] Back     alignment and domain information 
Probab=100.00  E-value=2e-95  Score=816.68  Aligned_cols=761  Identities=65%  Similarity=0.989  Sum_probs=604.7

Q ss_pred             cCCCCchhHHHHHHhhhhhhcCCCCCCceEEeccCCCCCCccccccccccchhhhCCCCCCcEEEeeCCCCCCCCccccc
Q 000712           67 WTSGEEEDQVALKLQSQLMVALPVPEDTVVVELAPQEEGDVATDAANVGVEMRVVKRREPLRAVVLTKGVGSGHLSDGIG  146 (1336)
Q Consensus        67 ~~~~~~~~~~~~~l~s~l~~~Lp~~~~~~~l~l~~~~~~~~g~~~~~~~~~~~~l~~l~~L~~L~Ls~N~l~~~~p~~l~  146 (1336)
                      |+.++.+|+++..+.+++|.++|.+.+.+++.++...   ++ +.+++.+.+..-.+...++...+-.-.-++..-+..+
T Consensus         1 ~t~~~s~d~~~~~l~~~~~v~~~~~~~~~~~~~~~~~---~~-~l~~v~l~~~~~~~~~~~r~~~~~~~~~s~~~y~~~~   76 (763)
T KOG4231|consen    1 WTAGDSEDQVALRLESQLMVALPAPHDTVVVELKDDD---EG-GLENVGLEMRVEKRREPLRAVTLMKAVGSGQQYDGVG   76 (763)
T ss_pred             CCcccchhHHHHHhhhhhhhccCCCCceEEEEecccc---cc-ccchhhhhhhhhhcccchhhhHHHhhhcCCcccCCcc
Confidence            7888999999999999999999999999999998522   22 5566666666555555555443332222232223333


Q ss_pred             CCCCcCEEeCCCCCCCCCCCCccccCCCCCcEEEcCCCCCCccccccCCCCCCcEEEcCCCCCCCCccccCCCCCCcEEE
Q 000712          147 VLTRLMRSDLSTSGPGNNMGSGFCDHWKTVTAVSLCGLGLSALPVDLTRLPVLEKLYLDNNKLSTLPPELGAMKNLKVLI  226 (1336)
Q Consensus       147 ~L~~L~~L~Ls~N~l~~~~~~~~~~~L~~L~~L~Ls~N~L~~lp~~l~~L~~L~~L~Ls~N~L~~lp~~l~~L~~L~~L~  226 (1336)
                      .+.+|-.+-++--.--+..-....-.+...+.+.+++|.+-..|.                       .+..|+.|+.+.
T Consensus        77 ~~~~l~~~~~a~~ap~~~~~~~~~~~~~~~t~~s~s~~~~~~~~~-----------------------~vt~l~~~~~~~  133 (763)
T KOG4231|consen   77 VLTRLMMMPAAIPAPAIDVASSCGVHWKTVTSLSLSGCGLLVMPV-----------------------EVTELPLLEKLC  133 (763)
T ss_pred             hheeeeeeeccCCCcchhhhhceeeeeeeeeecccccceeccChH-----------------------HHHhhhhhhHHH
Confidence            444444443332110011111111123344444455554444444                       444444555555


Q ss_pred             ccCCcCccccccccCCCCCCEEEeccccccCCccccCCCCCCcEEEccCCCCCCCC-CCCCCCCCCEEEccCCCCCCCcc
Q 000712          227 VDNNMLVCVPVELRECVGLVELSLEHNRLVRPLLDFRAMAELKILRLFGNPLEFLP-EILPLLKLRHLSLANIRIVADEN  305 (1336)
Q Consensus       227 Ls~N~L~~lp~~l~~L~~L~~L~Ls~N~l~~~~~~l~~L~~L~~L~Ls~N~L~~lp-~l~~l~~L~~L~Ls~N~l~~~~~  305 (1336)
                      +-.|+++.+|..++++.++..+.+.     ..+..+..+.-+-.+.+.+|.+...+ .+..                   
T Consensus       134 ~~~~k~s~~~~li~k~~~~~i~r~~-----s~~d~l~~~~pf~e~s~~~~~~~~p~g~~~~-------------------  189 (763)
T KOG4231|consen  134 LEHNKLSVLPPLIGKLKNLKILRVD-----SVPDELRQCVPFVELSLEHNKLVRPLGDFRS-------------------  189 (763)
T ss_pred             HHHhhhccchhhhhhhhhHHHhccC-----CccccccccCCchhhhhhccCccCCCccccc-------------------
Confidence            5555555444444444444333322     11122333333333334444433221 1100                   


Q ss_pred             cccccccccCCCCCeeccCCCCCccccccccccCCCCchhhHHHHHhhhhcCCCcccccccccccccCcEEEcCCCcchh
Q 000712          306 LRSVNVQIEMENNSYFGASRHKLSAFFSLIFRFSSCHHPLLASALAKIMQDQENRVVVGKDENAVRQLISMISSDNRHVV  385 (1336)
Q Consensus       306 L~~L~~~l~L~~L~~L~ls~N~L~~~~~~l~~Ls~l~~~~l~~~L~~lL~Ls~N~l~lp~~l~~L~~L~~L~Ls~N~~l~  385 (1336)
                      +..     .-.+-.++.-+...|+...+.+|.-++|..+.+...+.+...+.+|...+...-+...++....=|+ .+++
T Consensus       190 ~~~-----~~~~ts~fg~S~~~lSn~~~~~Fk~~~~~~~~~~~~fv~k~e~e~n~~~iGk~~~~I~~~~~~ieS~-~hvV  263 (763)
T KOG4231|consen  190 LGQ-----RAENTSYFGASRHKLSNFSPLIFKSSSCHHPLLASTFVKKMEDEGNRSVIGKDENAIRQLISMIESD-QHVV  263 (763)
T ss_pred             ccC-----cccccccccchhhhhhccchHhhccccccchhHHHHHHHHhhCcccceeecccchhhhhhccccccc-chhh
Confidence            000     1123344555666777777888888889999888888888899999987776666667777766665 7789


Q ss_pred             HHHhhhhccCccChhhhcccccccCcchhHhhhcCCChhhHhhhhhhhhccccccchHHHhhhchHHHHHHHHHHhcCCh
Q 000712          386 EQACSALSSLAGDVSVAMLLMKCDIMQPIIAVLKSFAPEEVKSVLQVVGQLAFASDTVAQKMLTKDVLKSLKLLCAHKNP  465 (1336)
Q Consensus       386 ~~~~~~L~~Lp~~~~~l~~L~~L~i~~~~l~~L~s~~~~~~~~~l~~L~~L~~~~~~i~~~l~~~~lL~~L~~l~~~~~~  465 (1336)
                      +.+|..+..+.........|...+++......++...+. +...++.+..+++.++..++++..+..++.|++++.++|+
T Consensus       264 ek~~~~~~s~~~~~~~t~ql~k~~l~~pTe~v~~l~~~~-I~~l~~~v~~~~~~s~s~~Qe~~~K~~~~~lk~~~a~~n~  342 (763)
T KOG4231|consen  264 EKACVALSSLARDVGVTMQLMKCDLMKPTETVLKLSSPD-IISLLQVVVTLAFVSDSVSQEMLTKDMLKALKSLCAHKNP  342 (763)
T ss_pred             cccccccccHHHHHHHHHHHHHHHhcCcchhhhhhcccc-HhhHHHHHhcCCchhhhHHhhhhHHHHHHHHHHHhcccCh
Confidence            999999999988888999999999999877777777766 7888899999999999999999999999999999999999


Q ss_pred             hhhhHHHhhhcccccccccchhhhchhhHHHHHHHhccCCChhhHHHHHHHHHHhccchhhhHhhcCCCCCCCCceEEEe
Q 000712          466 EVQRFALLAVGNLAFCLENRRILVTSESLRDLLMRLTVGPEPRVNKAAARALAILGENESLRRAIRGRQVPKQGLRILSM  545 (1336)
Q Consensus       466 ~Vq~~aL~al~~laf~~e~r~~~~~se~L~~~L~~l~~s~~~~v~~~a~~~La~Lgen~~lRr~i~~~~~~~~~~rILsL  545 (1336)
                      ++|+.+++++++++||.++|+.+.|++.|+..++++.....+++++.+..+++.+++++-+|+.+++||++++|+|||++
T Consensus       343 ~l~~qa~~~v~~~~~~~~~r~~~~tsp~l~~~~~~~i~~~~~~~~~~~~~a~~~~~~~eil~~~~~~~~vkg~G~rILSi  422 (763)
T KOG4231|consen  343 ELQRQALLAVGNLAFCLENRRILITSPSLRELLMRLIVTPEPRVNKAAARALAILGENEILRRSIKGRQVKGQGLRILSI  422 (763)
T ss_pred             HHHHHHHHHHHHheecccccccccCChHHHHHHHHHhcccccccchhhhHHHHHhhhhHHHHhhccccccCCCceEEEEe
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             cCCchhHHHHHHHHHHHHHhcCCCcccccceEEeechHHHHHHHHHcccCCHHHHHHHHHHhccccccCCCCCchhhHHH
Q 000712          546 DGGGMKGLATVQILKEIEKGTGKRIHELFDLVCGTSTGGMLAIALAVKLMTLDQCEEIYKNLGKLVFAEPFPKDNEAATW  625 (1336)
Q Consensus       546 DGGGiRGl~~l~iL~~Le~~~g~~i~~~FDlIaGTStGgIiA~~La~~~~s~~e~~~~y~~l~~~IF~~~~~~~~~~~~w  625 (1336)
                      ||||+||++++++|+.||+..|++||+.||+|||+|||||+|++|+..+|+++||+++|+++++.+|++..+.+++...|
T Consensus       423 DGGGtrG~~~lqiL~kieklsgKpIheLFD~ICGvSTG~ilA~~Lg~k~m~l~eCeEiY~~lgk~vFsq~v~~g~~~~sw  502 (763)
T KOG4231|consen  423 DGGGTRGLATLQILKKIEKLSGKPIHELFDLICGVSTGGILAIALGVKLMTLEECEEIYKNLGKLVFSQSVPKGNEAASW  502 (763)
T ss_pred             cCCCccchhHHHHHHHHHHhcCCcHHHHHHHHhccCchHHHHHHHHhcCccHHHHHHHHHHHhHHHhhccccccchhhee
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999998877777


Q ss_pred             HHHHHHHhhhccccceeeecCCCcchHHHHHHHHHHhcCCCcchhhhhhhcCCCeEEEEEEeeccCC-CcEEEeecCCCC
Q 000712          626 REKLDQIYKSSSQSFRVVVHGSKHSADQFERLLKEMCADEDGDLLIESSVKNIPKVFTVSTLVNVMP-AQPFIFRNYQYP  704 (1336)
Q Consensus       626 ~~~~~~~~~~~~~~~r~~~~~~~y~~~~Le~~Lk~~~~~~~g~~~~~~~~~~~~kv~vvsT~~d~~~-~~p~lFrny~~~  704 (1336)
                      .                   .++|+++.+|++||++++ +++++...+..+++||+++|+|.++..+ .+||+||||++|
T Consensus       503 ~-------------------Hs~y~~n~we~iLKem~g-ed~~mi~tsr~~~~PkvavVStiVn~~pT~qpfIFRNY~hp  562 (763)
T KOG4231|consen  503 I-------------------HSKYSANEWERILKEMCG-EDGDMIITSRVKNVPKVAVVSTIVNVMPTAQPFIFRNYQHP  562 (763)
T ss_pred             h-------------------hhhcchHHHHHHHHHHhh-hhhhHHHhhccCCCCceeehhhhhhcCCCccceeeeccCCC
Confidence            3                   478999999999999998 5577777777889999999999999554 899999999999


Q ss_pred             CCCCCCCccccCCCCccccCCCCCCcccccccccccCCCcccHHHHHHHhcCCCCCCcceeeCCcccccCcccCCchHHH
Q 000712          705 AGTPEVPFSISENSGITVLGSPTTGAQVGYKRSAFIGSCKHQVWQAIRASSAAPYYLDDFSDDVFRWQDGAIVANNPTIF  784 (1336)
Q Consensus       705 ~~~~~~~~~~~~~~~~~~~~s~~~~~~~~~~~~~~~~~~~~~lwdA~RASSAAP~yF~p~~i~~~~~vDGGl~aNNPt~~  784 (1336)
                      .+.                            .++|.|+|++.+|+|+|||+|||+||..|..++..++|||+++|||+..
T Consensus       563 ~G~----------------------------~Shy~Ggc~h~~WqAIrASsAAP~Yf~e~~lgn~l~QDGgi~aNNPta~  614 (763)
T KOG4231|consen  563 VGT----------------------------QSHYMGGCKHQVWQAIRASSAAPYYFDEFSLGNYLWQDGGIVANNPTAF  614 (763)
T ss_pred             CCc----------------------------chhhcccchHHHHHHHHhcccCCcchhhhccccceeccCcEeecCccHH
Confidence            765                            4678999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHhCCCCCCCEEEEeCCCCCCCCcCCCCcccccccchhhhhhhcHHHHHHHHHHHcccCCCCCEEEEccCCCCCC
Q 000712          785 AIREAQLLWPDTRIDCLVSIGCGSVPTKTRRGGWRYLDTGQVLIESACSVDRAEEALSTLLPMLPEIQYYRFNPVDERCE  864 (1336)
Q Consensus       785 Ai~EA~~l~p~~~i~~VVSIGTG~~~~~~~~~~w~~l~~~~~li~~~~s~d~v~~~~~~l~~~l~~~~YfRfnp~~~~~~  864 (1336)
                      ||+||+.+||+.+++|+||||||..++..+.++|.+...++.++++.++.+.+++.+.++.+++++..||||||.+.++ 
T Consensus       615 A~hEaklLWPD~~i~C~VSiGsGr~~t~Vr~~tv~yts~~~kL~~~i~SatdtEevh~~l~~mLPe~~YfRFNPvm~~~-  693 (763)
T KOG4231|consen  615 AIHEAKLLWPDTKIDCLVSIGSGRVPTRVRKGTVRYTSTGQKLIESICSATDTEEVHSTLLPMLPEIQYFRFNPVMDRC-  693 (763)
T ss_pred             HhhhhhccCCCCCccEEEEecCCcccccccCCceEEecHHHHHHHHHhcccchHHHHHhhhccCCchheEecchhhhcc-
Confidence            9999999999999999999999999999988999999999999988888888888888888999999999999999875 


Q ss_pred             CCCCCCCHHHHHHHHHHHHHHHHhhHHHHHHHHHHhcCCCCChhhHHhhhhcccCCCCccCCccccCCccccc
Q 000712          865 MELDETDPAEWLKLEAAVDEYINNNSESFKNVCERLLLPFQQDEKWSENLKSQHFPRGKVSNTDEISPSLGWR  937 (1336)
Q Consensus       865 i~LDe~~~~~~~~l~~~t~~Yl~~n~~~~~~v~~~Ll~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  937 (1336)
                      ++|||++++.|.+|+.++++|++.|.++|+++|++|..++..+++|-++...  +...|.+.- +..+.++|+
T Consensus       694 ~~LDE~d~e~l~ql~~~~e~yI~rN~qk~k~vaerL~l~~~~~qk~~~~~~~--wm~lK~~~y-e~~p~~~~~  763 (763)
T KOG4231|consen  694 MELDETDPEILLQLEAAIEEYIQRNPQKFKNVAERLTLPFLNDQKWCDLKPR--WMNLKLPRY-ESSPSLGWR  763 (763)
T ss_pred             cCcCccCHHHHHHHHHHHHHHHHhChHHHHHHHHHhcCCcchhHHHhhhhHH--HHhccCccc-cCCcccccC
Confidence            9999999999999999999999999999999999999999999999832111  233344321 344566664

>cd07211 Pat_PNPLA8 Patatin-like phospholipase domain containing protein 8 Back     alignment and domain information
>cd07215 Pat17_PNPLA8_PNPLA9_like2 Patatin-like phospholipase of bacteria Back     alignment and domain information
>cd07216 Pat17_PNPLA8_PNPLA9_like3 Patatin-like phospholipase Back     alignment and domain information
>cd07212 Pat_PNPLA9 Patatin-like phospholipase domain containing protein 9 Back     alignment and domain information
>cd07214 Pat17_isozyme_like Patatin-like phospholipase of plants Back     alignment and domain information
>cd07213 Pat17_PNPLA8_PNPLA9_like1 Patatin-like phospholipase Back     alignment and domain information
>cd07199 Pat17_PNPLA8_PNPLA9_like Patatin-like phospholipase; includes PNPLA8, PNPLA9, and Pat17 Back     alignment and domain information
>cd07217 Pat17_PNPLA8_PNPLA9_like4 Patatin-like phospholipase Back     alignment and domain information
>COG3621 Patatin [General function prediction only] Back     alignment and domain information
>cd07225 Pat_PNPLA6_PNPLA7 Patatin-like phospholipase domain containing protein 6 and protein 7 Back     alignment and domain information
>cd07207 Pat_ExoU_VipD_like ExoU and VipD-like proteins; homologus to patatin, cPLA2, and iPLA2 Back     alignment and domain information
>cd07205 Pat_PNPLA6_PNPLA7_NTE1_like Patatin-like phospholipase domain containing protein 6, protein 7, and fungal NTE1 Back     alignment and domain information
>cd07210 Pat_hypo_W_succinogenes_WS1459_like Hypothetical patatin similar to WS1459 of Wolinella succinogenes Back     alignment and domain information
>cd07228 Pat_NTE_like_bacteria Bacterial patatin-like phospholipase domain containing protein 6 Back     alignment and domain information
>cd07209 Pat_hypo_Ecoli_Z1214_like Hypothetical patatin similar to Z1214 protein of Escherichia coli Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>cd07227 Pat_Fungal_NTE1 Fungal patatin-like phospholipase domain containing protein 6 Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>cd07208 Pat_hypo_Ecoli_yjju_like Hypothetical patatin similar to yjju protein of Escherichia coli Back     alignment and domain information
>PRK10279 hypothetical protein; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>cd07230 Pat_TGL4-5_like Triacylglycerol lipase 4 and 5 Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>cd07198 Patatin Patatin-like phospholipase Back     alignment and domain information
>cd07232 Pat_PLPL Patain-like phospholipase Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PF01734 Patatin: Patatin-like phospholipase This Prosite family is a subset of the Pfam family; InterPro: IPR002641 This domain is structurally and functionally related to the animal cytosolic phospholipase A2 Back     alignment and domain information
>cd07221 Pat_PNPLA3 Patatin-like phospholipase domain containing protein 3 Back     alignment and domain information
>COG1752 RssA Predicted esterase of the alpha-beta hydrolase superfamily [General function prediction only] Back     alignment and domain information
>cd07222 Pat_PNPLA4 Patatin-like phospholipase domain containing protein 4 Back     alignment and domain information
>cd07218 Pat_iPLA2 Calcium-independent phospholipase A2; Classified as Group IVA-1 PLA2 Back     alignment and domain information
>cd07219 Pat_PNPLA1 Patatin-like phospholipase domain containing protein 1 Back     alignment and domain information
>cd07204 Pat_PNPLA_like Patatin-like phospholipase domain containing protein family Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>cd07220 Pat_PNPLA2 Patatin-like phospholipase domain containing protein 2 Back     alignment and domain information
>cd07224 Pat_like Patatin-like phospholipase Back     alignment and domain information
>cd07206 Pat_TGL3-4-5_SDP1 Triacylglycerol lipase 3, 4, and 5 and Sugar-Dependent 1 lipase Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>cd07229 Pat_TGL3_like Triacylglycerol lipase 3 Back     alignment and domain information
>KOG2968 consensus Predicted esterase of the alpha-beta hydrolase superfamily (Neuropathy target esterase), contains cAMP-binding domains [General function prediction only] Back     alignment and domain information
>cd07231 Pat_SDP1-like Sugar-Dependent 1 like lipase Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>COG4667 Predicted esterase of the alpha-beta hydrolase superfamily [General function prediction only] Back     alignment and domain information
>cd01819 Patatin_and_cPLA2 Patatins and Phospholipases Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0513 consensus Ca2+-independent phospholipase A2 [Lipid transport and metabolism] Back     alignment and domain information
>cd07223 Pat_PNPLA5-mammals Patatin-like phospholipase domain containing protein 5 Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>TIGR03607 patatin-related protein Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG2214 consensus Predicted esterase of the alpha-beta hydrolase superfamily [General function prediction only] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG0513 consensus Ca2+-independent phospholipase A2 [Lipid transport and metabolism] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG3773 consensus Adiponutrin and related vesicular transport proteins; predicted alpha/beta hydrolase [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>cd00147 cPLA2_like Cytosolic phospholipase A2, catalytic domain; hydrolyses arachidonyl phospholipids Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>PF12770 CHAT: CHAT domain Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>cd00020 ARM Armadillo/beta-catenin-like repeats Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>KOG4224 consensus Armadillo repeat protein VAC8 required for vacuole fusion, inheritance and cytosol-to-vacuole protein targeting [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0166 consensus Karyopherin (importin) alpha [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG4224 consensus Armadillo repeat protein VAC8 required for vacuole fusion, inheritance and cytosol-to-vacuole protein targeting [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF04826 Arm_2: Armadillo-like; InterPro: IPR006911 This entry consists of mammalian proteins of unknown function Back     alignment and domain information
>PLN03200 cellulose synthase-interactive protein; Provisional Back     alignment and domain information
>cd07202 cPLA2_Grp-IVC Group IVC cytoplasmic phospholipase A2; catalytic domain; Ca-independent Back     alignment and domain information
>KOG1048 consensus Neural adherens junction protein Plakophilin and related Armadillo repeat proteins [Signal transduction mechanisms; Extracellular structures] Back     alignment and domain information
>PLN03200 cellulose synthase-interactive protein; Provisional Back     alignment and domain information
>PF05804 KAP: Kinesin-associated protein (KAP) Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>PF05804 KAP: Kinesin-associated protein (KAP) Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>KOG4231 consensus Intracellular membrane-bound Ca2+-independent phospholipase A2 [Lipid transport and metabolism] Back     alignment and domain information
>COG5064 SRP1 Karyopherin (importin) alpha [Intracellular trafficking and secretion] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1336
4b8c_D727 Nuclease Module Of The Yeast Ccr4-Not Complex Lengt 1e-06
2o6q_A270 Structural Diversity Of The Hagfish Variable Lympho 1e-04
>pdb|4B8C|D Chain D, Nuclease Module Of The Yeast Ccr4-Not Complex Length = 727 Back     alignment and structure 
Iteration: 1

 Score = 52.8 bits (125), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 29/99 (29%), Positives = 49/99 (49%)
Query: 178 AVSLCGLGLSALPVDLTRLPVLEKLYLDNNKLSTLPPELGAMKNLKVLIVDNNMLVCVPV 237
           A+ L  L +  +  ++ +   L +LYL+ N L+ LP E+  + NL+VL + +N L  +P 
Sbjct: 228 ALDLSNLQIFNISANIFKYDFLTRLYLNGNSLTELPAEIKNLSNLRVLDLSHNRLTSLPA 287
Query: 238 ELRECVGLVELSLEHNRLVRPLLDFRAMAELKILRLFGN 276
           EL  C  L       N +     +F  +  L+ L + GN
Sbjct: 288 ELGSCFQLKYFYFFDNMVTTLPWEFGNLCNLQFLGVEGN 326
>pdb|2O6Q|A Chain A, Structural Diversity Of The Hagfish Variable Lymphocyte Receptors A29 Length = 270 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1336
1oxw_A373 Patatin; alpha/beta class fold with approximately 2e-43
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 6e-23
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 8e-23
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 3e-21
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 5e-21
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-11
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-06
3now_A810 UNC-45 protein, SD10334P; armadillo repeat, HSP90, 2e-21
3now_A810 UNC-45 protein, SD10334P; armadillo repeat, HSP90, 5e-05
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 7e-20
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-16
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-14
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-10
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-09
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 7e-07
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 7e-18
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 3e-15
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 3e-14
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 9e-14
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-11
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-10
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 4e-10
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 9e-18
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 4e-16
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 4e-15
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-14
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 7e-13
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 3e-12
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 3e-10
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-05
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 1e-17
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 4e-08
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 1e-04
2z6g_A780 B-catenin; FULL-length, beta-catenin, cell adhesio 5e-17
2z6g_A780 B-catenin; FULL-length, beta-catenin, cell adhesio 8e-16
2z6g_A780 B-catenin; FULL-length, beta-catenin, cell adhesio 4e-15
2z6g_A780 B-catenin; FULL-length, beta-catenin, cell adhesio 6e-14
2z6g_A780 B-catenin; FULL-length, beta-catenin, cell adhesio 7e-12
2z6g_A780 B-catenin; FULL-length, beta-catenin, cell adhesio 3e-11
2z6g_A780 B-catenin; FULL-length, beta-catenin, cell adhesio 9e-10
2z6g_A780 B-catenin; FULL-length, beta-catenin, cell adhesio 5e-08
2jdq_A450 Importin alpha-1 subunit; transport, PB2 subunit, 7e-17
2jdq_A450 Importin alpha-1 subunit; transport, PB2 subunit, 5e-16
2jdq_A450 Importin alpha-1 subunit; transport, PB2 subunit, 3e-11
2jdq_A450 Importin alpha-1 subunit; transport, PB2 subunit, 3e-09
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 7e-17
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 7e-16
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 5e-12
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 6e-11
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-10
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 7e-09
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-05
1wa5_B530 Importin alpha subunit; nuclear transport/complex, 9e-17
1wa5_B530 Importin alpha subunit; nuclear transport/complex, 2e-15
1wa5_B530 Importin alpha subunit; nuclear transport/complex, 5e-09
2z6h_A644 Catenin beta-1, beta-catenin; C-terminal domain, a 1e-16
2z6h_A644 Catenin beta-1, beta-catenin; C-terminal domain, a 1e-16
2z6h_A644 Catenin beta-1, beta-catenin; C-terminal domain, a 1e-13
2z6h_A644 Catenin beta-1, beta-catenin; C-terminal domain, a 1e-11
2z6h_A644 Catenin beta-1, beta-catenin; C-terminal domain, a 2e-10
2z6h_A644 Catenin beta-1, beta-catenin; C-terminal domain, a 7e-10
1jdh_A529 Beta-catenin; beta-catenin, protein-protein comple 2e-16
1jdh_A529 Beta-catenin; beta-catenin, protein-protein comple 2e-16
1jdh_A529 Beta-catenin; beta-catenin, protein-protein comple 2e-14
1jdh_A529 Beta-catenin; beta-catenin, protein-protein comple 5e-10
1jdh_A529 Beta-catenin; beta-catenin, protein-protein comple 8e-10
1jdh_A529 Beta-catenin; beta-catenin, protein-protein comple 9e-09
4db8_A252 Armadillo-repeat protein; solenoid repeat, de novo 2e-16
4db8_A252 Armadillo-repeat protein; solenoid repeat, de novo 4e-12
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 2e-16
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 2e-14
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 3e-14
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 7e-14
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 1e-12
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 2e-12
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 3e-16
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 1e-15
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 7e-15
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 3e-07
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 3e-16
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 4e-15
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-14
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 5e-14
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-13
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-12
3oqs_A510 Importin subunit alpha-2; importin alpha, karyophe 5e-16
3oqs_A510 Importin subunit alpha-2; importin alpha, karyophe 5e-12
3oqs_A510 Importin subunit alpha-2; importin alpha, karyophe 9e-09
3oqs_A510 Importin subunit alpha-2; importin alpha, karyophe 2e-07
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 5e-16
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-15
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 5e-14
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 3e-07
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-15
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 9e-15
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-14
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 6e-13
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-12
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 5e-12
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 7e-11
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 3e-08
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-15
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 5e-13
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 7e-12
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 1e-10
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 4e-10
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 4e-10
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-09
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 5e-07
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-15
4fmz_A347 Internalin; leucine rich repeat, structural genomi 6e-15
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-14
4fmz_A347 Internalin; leucine rich repeat, structural genomi 6e-14
4fmz_A347 Internalin; leucine rich repeat, structural genomi 3e-13
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-11
4fmz_A347 Internalin; leucine rich repeat, structural genomi 7e-11
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-08
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-07
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-04
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 3e-15
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 3e-10
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 5e-10
4db6_A210 Armadillo repeat protein; solenoid repeat, armadil 5e-15
4db6_A210 Armadillo repeat protein; solenoid repeat, armadil 3e-14
4db6_A210 Armadillo repeat protein; solenoid repeat, armadil 3e-11
4db6_A210 Armadillo repeat protein; solenoid repeat, armadil 7e-06
4db6_A210 Armadillo repeat protein; solenoid repeat, armadil 9e-04
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 7e-15
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 3e-13
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 4e-11
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 3e-09
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 2e-07
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 7e-15
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 8e-15
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-14
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 4e-13
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 9e-10
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-04
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 9e-15
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 8e-14
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-12
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 4e-12
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 3e-09
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-05
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-14
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-14
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 7e-12
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 6e-11
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-09
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 4e-07
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-05
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-04
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 6e-04
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-14
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-14
1o6v_A466 Internalin A; bacterial infection, extracellular r 5e-14
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-12
1o6v_A466 Internalin A; bacterial infection, extracellular r 3e-12
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-11
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-10
1o6v_A466 Internalin A; bacterial infection, extracellular r 3e-08
1o6v_A466 Internalin A; bacterial infection, extracellular r 3e-08
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-14
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-14
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-13
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-08
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 4e-06
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 5e-04
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-14
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-12
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 8e-12
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 4e-06
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-05
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-14
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 6e-13
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-12
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-11
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 5e-11
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 3e-10
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 5e-10
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 5e-10
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 6e-10
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-09
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-07
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-06
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 6e-05
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 3e-14
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-12
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-12
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 3e-12
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 8e-12
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 5e-05
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 4e-14
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 2e-12
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 9e-11
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 4e-09
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 7e-07
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 5e-14
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 6e-14
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 4e-12
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 6e-09
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 9e-06
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 6e-14
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 1e-11
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 4e-11
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 2e-06
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 6e-14
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 5e-13
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 1e-12
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 8e-11
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 5e-06
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 9e-14
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-13
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 5e-13
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-12
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 6e-12
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-10
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-09
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 9e-09
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-08
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 9e-05
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 1e-13
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 1e-12
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 7e-12
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 7e-11
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 7e-06
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-13
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 9e-13
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-12
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 4e-12
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 7e-07
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-06
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 2e-13
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 2e-13
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 2e-09
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 2e-13
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 4e-12
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 5e-12
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-13
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 9e-13
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-10
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-10
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-10
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-09
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 9e-07
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-06
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-06
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-13
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 5e-12
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 1e-08
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-08
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 9e-07
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 3e-04
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 5e-13
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 3e-11
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 1e-12
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 2e-10
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 5e-10
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-12
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-11
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 4e-11
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-10
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-09
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 5e-09
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-08
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-04
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 7e-12
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 1e-09
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 2e-08
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 1e-04
3nmw_A354 APC variant protein; ARMADIILO repeats domain, cel 7e-12
3nmw_A354 APC variant protein; ARMADIILO repeats domain, cel 4e-11
3nmw_A354 APC variant protein; ARMADIILO repeats domain, cel 6e-11
3nmz_A458 APC variant protein; protein-protein complex, arma 8e-12
3nmz_A458 APC variant protein; protein-protein complex, arma 1e-10
3nmz_A458 APC variant protein; protein-protein complex, arma 1e-09
3nmz_A458 APC variant protein; protein-protein complex, arma 5e-09
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 1e-11
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 2e-09
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-11
4ezg_A197 Putative uncharacterized protein; internalin-A, le 5e-10
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-08
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-04
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 1e-11
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 3e-11
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 1e-09
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 2e-08
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 5e-04
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 1e-11
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-09
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-07
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 9e-06
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 2e-11
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 3e-10
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 3e-08
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 5e-04
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 2e-11
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 2e-11
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 7e-11
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-10
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 3e-10
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 5e-09
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-06
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 6e-06
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 6e-11
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 1e-10
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-10
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 1e-06
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-10
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 6e-08
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 3e-07
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 3e-04
1xqr_A296 HSPBP1 protein; armadillo repeat, superhelical twi 2e-10
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 3e-10
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 2e-08
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 4e-04
1xm9_A457 Plakophilin 1; armadillo repeat, cell adhesion; 2. 3e-10
1xm9_A457 Plakophilin 1; armadillo repeat, cell adhesion; 2. 4e-08
1xm9_A457 Plakophilin 1; armadillo repeat, cell adhesion; 2. 1e-06
1xm9_A457 Plakophilin 1; armadillo repeat, cell adhesion; 2. 6e-04
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 5e-10
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 6e-06
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 7e-05
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 4e-04
1vt4_I1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-10
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-10
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 9e-10
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-07
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 7e-10
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 5e-08
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 2e-05
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 9e-10
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 2e-08
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 1e-07
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 1e-04
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 1e-09
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 4e-09
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 1e-07
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 6e-06
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 5e-05
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 5e-04
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-09
3tt9_A233 Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} 3e-09
3tt9_A233 Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} 1e-07
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 5e-09
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 4e-06
3l6x_A584 Catenin delta-1; catenin, armadillo, ARM, JMD, CE 2e-08
3l6x_A584 Catenin delta-1; catenin, armadillo, ARM, JMD, CE 2e-05
3l6x_A584 Catenin delta-1; catenin, armadillo, ARM, JMD, CE 2e-04
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 2e-08
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 1e-07
2qk1_A249 Protein STU2; STU2P, XMAP215, DIS1, TOG, CH-TOG, h 4e-08
3m19_A251 Variable lymphocyte receptor A diversity region; a 1e-07
3m19_A251 Variable lymphocyte receptor A diversity region; a 1e-06
3m19_A251 Variable lymphocyte receptor A diversity region; a 2e-06
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 3e-07
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 7e-05
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 4e-04
1w8a_A192 SLIT protein; signaling protein, secreted protein, 1e-06
1w8a_A192 SLIT protein; signaling protein, secreted protein, 6e-06
3ltj_A201 Alpharep-4; protein engineering, heat-like repeat, 5e-06
3ltj_A201 Alpharep-4; protein engineering, heat-like repeat, 3e-05
3ltj_A201 Alpharep-4; protein engineering, heat-like repeat, 2e-04
3ltm_A211 Alpha-REP4; protein engineering, heat-like repeat, 5e-06
3ltm_A211 Alpha-REP4; protein engineering, heat-like repeat, 7e-06
3ltm_A211 Alpha-REP4; protein engineering, heat-like repeat, 5e-05
2qk2_A242 LP04448P; mini spindles, MSPS, XMAP215, DIS1, STU2 5e-06
3tu3_B711 EXOU; type III secretion system, SPC infectious di 5e-06
2db0_A253 253AA long hypothetical protein; heat repeats, hel 9e-06
1oyz_A280 Hypothetical protein YIBA; structural genomics, PS 1e-05
1oyz_A280 Hypothetical protein YIBA; structural genomics, PS 8e-05
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-05
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 2e-05
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 1e-04
3e6j_A229 Variable lymphocyte receptor diversity region; var 2e-05
3e6j_A229 Variable lymphocyte receptor diversity region; var 2e-04
1b3u_A588 Protein (protein phosphatase PP2A); scaffold prote 6e-05
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 6e-05
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 6e-05
3opb_A778 SWI5-dependent HO expression protein 4; heat and a 3e-04
1te4_A131 Conserved protein MTH187; methanobacterium thermoa 4e-04
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 8e-04
>1oxw_A Patatin; alpha/beta class fold with approximately three layers; 2.20A {Solanum cardiophyllum} SCOP: c.19.1.3 Length = 373 Back     alignment and structure
 Score =  162 bits (409), Expect = 2e-43
 Identities = 64/419 (15%), Positives = 126/419 (30%), Gaps = 118/419 (28%)

Query: 531 RGRQVPKQGLRILSMDGGGMKGLATVQILKEIEK-------GTGKRIHELFDLVCGTSTG 583
                  + + +LS+DGGG++G+    IL+ +E            R+ + FD++ GTSTG
Sbjct: 7   HAMAQLGEMVTVLSIDGGGIRGIIPATILEFLEGQLQEMDNNADARLADYFDVIGGTSTG 66

Query: 584 GMLAIALAVK------LMTLDQCEEIYKNLGKLVFAEPFPKDNEAATWREKLDQIYKSSS 637
           G+L   ++             +    Y   G  +F                         
Sbjct: 67  GLLTAMISTPNENNRPFAAAKEIVPFYFEHGPQIF------------------------- 101

Query: 638 QSFRVVVHGSKHSADQFERLLKEMCADEDGDLLIESSVKNIPKVFTVSTLVNVMPAQPFI 697
            +    + G K+      ++L+E      G+  +  ++        V +  ++   +P I
Sbjct: 102 -NPSGQILGPKYDGKYLMQVLQEKL----GETRVHQALTE-----VVISSFDIKTNKPVI 151

Query: 698 FRNYQYPAGTPEVPFSISENSGITVLGSPTTGAQVGYKRSAFIGSCKHQVWQAIRASSAA 757
           F                                               +++    +++AA
Sbjct: 152 FTKSNLANSP----------------------------------ELDAKMYDISYSTAAA 177

Query: 758 PYYLDDFSDDVFRWQ---------DGAIVA-NNPTIFAIREAQLLWP-----------DT 796
           P Y                     DGA+    +P + +I  A  L             + 
Sbjct: 178 PTYFPPHYFVTNTSNGDEYEFNLVDGAVATVADPALLSISVATRLAQKDPAFASIRSLNY 237

Query: 797 RIDCLVSIGCGSVPTKTRR------GGWRYLDTGQVL--IESACSVDRAEEALSTLLPML 848
           +   L+S+G G+     +         W  +    V+  +  A S    +  LST    L
Sbjct: 238 KKMLLLSLGTGTTSEFDKTYTAKEAATWTAVHWMLVIQKMTDAASSYMTDYYLSTAFQAL 297

Query: 849 -PEIQYYRFN-PVDERCEMELDETDPAEWLKLEAAVDEYIN-----NNSESFKNVCERL 900
             +  Y R           E+D+   A    L    +  +      +N E+++   +R 
Sbjct: 298 DSKNNYLRVQENALTGTTTEMDDASEANMELLVQVGENLLKKPVSEDNPETYEEALKRF 356
>3now_A UNC-45 protein, SD10334P; armadillo repeat, HSP90, myosin, tetra-tricopeptide repeat, binding protein required for myosin function; 2.99A {Drosophila melanogaster} Length = 810 Back     alignment and structure
>3now_A UNC-45 protein, SD10334P; armadillo repeat, HSP90, myosin, tetra-tricopeptide repeat, binding protein required for myosin function; 2.99A {Drosophila melanogaster} Length = 810 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Length = 780 Back     alignment and structure
>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Length = 780 Back     alignment and structure
>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Length = 780 Back     alignment and structure
>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Length = 780 Back     alignment and structure
>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Length = 780 Back     alignment and structure
>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Length = 780 Back     alignment and structure
>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Length = 780 Back     alignment and structure
>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Length = 780 Back     alignment and structure
>2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A Length = 450 Back     alignment and structure
>2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A Length = 450 Back     alignment and structure
>2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A Length = 450 Back     alignment and structure
>2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A Length = 450 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1wa5_B Importin alpha subunit; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1un0_A 2c1t_A 1bk5_A 1ee5_A 1bk6_A 1ee4_A Length = 530 Back     alignment and structure
>1wa5_B Importin alpha subunit; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1un0_A 2c1t_A 1bk5_A 1ee5_A 1bk6_A 1ee4_A Length = 530 Back     alignment and structure
>1wa5_B Importin alpha subunit; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1un0_A 2c1t_A 1bk5_A 1ee5_A 1bk6_A 1ee4_A Length = 530 Back     alignment and structure
>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Length = 644 Back     alignment and structure
>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Length = 644 Back     alignment and structure
>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Length = 644 Back     alignment and structure
>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Length = 644 Back     alignment and structure
>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Length = 644 Back     alignment and structure
>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Length = 644 Back     alignment and structure
>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Length = 529 Back     alignment and structure
>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Length = 529 Back     alignment and structure
>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Length = 529 Back     alignment and structure
>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Length = 529 Back     alignment and structure
>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Length = 529 Back     alignment and structure
>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Length = 529 Back     alignment and structure
>4db8_A Armadillo-repeat protein; solenoid repeat, de novo protein; 2.50A {Synthetic construct} Length = 252 Back     alignment and structure
>4db8_A Armadillo-repeat protein; solenoid repeat, de novo protein; 2.50A {Synthetic construct} Length = 252 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3oqs_A Importin subunit alpha-2; importin alpha, karyopherin alpha, nuclear localisation SIGN recognition, chloride intracellular channel 4, CLIC4 NLS; 2.00A {Mus musculus} PDB: 3rz9_A 3rzx_A 1q1s_C 1q1t_C 3tpo_A 3knd_A 1ejy_I 1iq1_C 1ejl_I 1pjn_B 1pjm_B 3q5u_A 3fey_C 3fex_C 1ial_A 1y2a_C 3btr_C 3l3q_A* 3ve6_A 2c1m_A ... Length = 510 Back     alignment and structure
>3oqs_A Importin subunit alpha-2; importin alpha, karyopherin alpha, nuclear localisation SIGN recognition, chloride intracellular channel 4, CLIC4 NLS; 2.00A {Mus musculus} PDB: 3rz9_A 3rzx_A 1q1s_C 1q1t_C 3tpo_A 3knd_A 1ejy_I 1iq1_C 1ejl_I 1pjn_B 1pjm_B 3q5u_A 3fey_C 3fex_C 1ial_A 1y2a_C 3btr_C 3l3q_A* 3ve6_A 2c1m_A ... Length = 510 Back     alignment and structure
>3oqs_A Importin subunit alpha-2; importin alpha, karyopherin alpha, nuclear localisation SIGN recognition, chloride intracellular channel 4, CLIC4 NLS; 2.00A {Mus musculus} PDB: 3rz9_A 3rzx_A 1q1s_C 1q1t_C 3tpo_A 3knd_A 1ejy_I 1iq1_C 1ejl_I 1pjn_B 1pjm_B 3q5u_A 3fey_C 3fex_C 1ial_A 1y2a_C 3btr_C 3l3q_A* 3ve6_A 2c1m_A ... Length = 510 Back     alignment and structure
>3oqs_A Importin subunit alpha-2; importin alpha, karyopherin alpha, nuclear localisation SIGN recognition, chloride intracellular channel 4, CLIC4 NLS; 2.00A {Mus musculus} PDB: 3rz9_A 3rzx_A 1q1s_C 1q1t_C 3tpo_A 3knd_A 1ejy_I 1iq1_C 1ejl_I 1pjn_B 1pjm_B 3q5u_A 3fey_C 3fex_C 1ial_A 1y2a_C 3btr_C 3l3q_A* 3ve6_A 2c1m_A ... Length = 510 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>4db6_A Armadillo repeat protein; solenoid repeat, armadillo repeat motif, de novo protein; 1.80A {Synthetic construct} PDB: 4db9_A 4dba_A Length = 210 Back     alignment and structure
>4db6_A Armadillo repeat protein; solenoid repeat, armadillo repeat motif, de novo protein; 1.80A {Synthetic construct} PDB: 4db9_A 4dba_A Length = 210 Back     alignment and structure
>4db6_A Armadillo repeat protein; solenoid repeat, armadillo repeat motif, de novo protein; 1.80A {Synthetic construct} PDB: 4db9_A 4dba_A Length = 210 Back     alignment and structure
>4db6_A Armadillo repeat protein; solenoid repeat, armadillo repeat motif, de novo protein; 1.80A {Synthetic construct} PDB: 4db9_A 4dba_A Length = 210 Back     alignment and structure
>4db6_A Armadillo repeat protein; solenoid repeat, armadillo repeat motif, de novo protein; 1.80A {Synthetic construct} PDB: 4db9_A 4dba_A Length = 210 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>3nmw_A APC variant protein; ARMADIILO repeats domain, cell adhesion-cell cycle complex; 1.60A {Homo sapiens} PDB: 3nmx_A 3t7u_A 3au3_A 3qhe_A Length = 354 Back     alignment and structure
>3nmw_A APC variant protein; ARMADIILO repeats domain, cell adhesion-cell cycle complex; 1.60A {Homo sapiens} PDB: 3nmx_A 3t7u_A 3au3_A 3qhe_A Length = 354 Back     alignment and structure
>3nmw_A APC variant protein; ARMADIILO repeats domain, cell adhesion-cell cycle complex; 1.60A {Homo sapiens} PDB: 3nmx_A 3t7u_A 3au3_A 3qhe_A Length = 354 Back     alignment and structure
>3nmz_A APC variant protein; protein-protein complex, armadillo repeats, cell adhesion-CE complex; 3.01A {Homo sapiens} Length = 458 Back     alignment and structure
>3nmz_A APC variant protein; protein-protein complex, armadillo repeats, cell adhesion-CE complex; 3.01A {Homo sapiens} Length = 458 Back     alignment and structure
>3nmz_A APC variant protein; protein-protein complex, armadillo repeats, cell adhesion-CE complex; 3.01A {Homo sapiens} Length = 458 Back     alignment and structure
>3nmz_A APC variant protein; protein-protein complex, armadillo repeats, cell adhesion-CE complex; 3.01A {Homo sapiens} Length = 458 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>1xqr_A HSPBP1 protein; armadillo repeat, superhelical twist, chaperone; 2.10A {Homo sapiens} SCOP: a.118.1.21 PDB: 1xqs_A* Length = 296 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>1xm9_A Plakophilin 1; armadillo repeat, cell adhesion; 2.80A {Homo sapiens} SCOP: a.118.1.24 Length = 457 Back     alignment and structure
>1xm9_A Plakophilin 1; armadillo repeat, cell adhesion; 2.80A {Homo sapiens} SCOP: a.118.1.24 Length = 457 Back     alignment and structure
>1xm9_A Plakophilin 1; armadillo repeat, cell adhesion; 2.80A {Homo sapiens} SCOP: a.118.1.24 Length = 457 Back     alignment and structure
>1xm9_A Plakophilin 1; armadillo repeat, cell adhesion; 2.80A {Homo sapiens} SCOP: a.118.1.24 Length = 457 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>3tt9_A Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} Length = 233 Back     alignment and structure
>3tt9_A Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} Length = 233 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>3l6x_A Catenin delta-1; catenin, armadillo, ARM, JMD, CE adhesion, complex, cell-CELL adhesion, ARVCF, delta-catenin DP120, JAC-1, cell membrane, membrane; 2.40A {Homo sapiens} PDB: 3l6y_A Length = 584 Back     alignment and structure
>3l6x_A Catenin delta-1; catenin, armadillo, ARM, JMD, CE adhesion, complex, cell-CELL adhesion, ARVCF, delta-catenin DP120, JAC-1, cell membrane, membrane; 2.40A {Homo sapiens} PDB: 3l6y_A Length = 584 Back     alignment and structure
>3l6x_A Catenin delta-1; catenin, armadillo, ARM, JMD, CE adhesion, complex, cell-CELL adhesion, ARVCF, delta-catenin DP120, JAC-1, cell membrane, membrane; 2.40A {Homo sapiens} PDB: 3l6y_A Length = 584 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2qk1_A Protein STU2; STU2P, XMAP215, DIS1, TOG, CH-TOG, heat repeat, microtubule plus END, +TIP, protein binding; 1.70A {Saccharomyces cerevisiae} Length = 249 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>3ltj_A Alpharep-4; protein engineering, heat-like repeat, protein binding; 1.80A {Synthetic} Length = 201 Back     alignment and structure
>3ltj_A Alpharep-4; protein engineering, heat-like repeat, protein binding; 1.80A {Synthetic} Length = 201 Back     alignment and structure
>3ltj_A Alpharep-4; protein engineering, heat-like repeat, protein binding; 1.80A {Synthetic} Length = 201 Back     alignment and structure
>3ltm_A Alpha-REP4; protein engineering, heat-like repeat, protein binding; HET: 1PE 12P; 2.15A {Synthetic} Length = 211 Back     alignment and structure
>3ltm_A Alpha-REP4; protein engineering, heat-like repeat, protein binding; HET: 1PE 12P; 2.15A {Synthetic} Length = 211 Back     alignment and structure
>3ltm_A Alpha-REP4; protein engineering, heat-like repeat, protein binding; HET: 1PE 12P; 2.15A {Synthetic} Length = 211 Back     alignment and structure
>2qk2_A LP04448P; mini spindles, MSPS, XMAP215, DIS1, STU2, heat repeat, micro plus END, +TIP, protein binding; 2.10A {Drosophila melanogaster} Length = 242 Back     alignment and structure
>3tu3_B EXOU; type III secretion system, SPC infectious diseases, structural genomics, center for struct genomics of infectious diseases, csgid; 1.92A {Pseudomonas aeruginosa} PDB: 4akx_B* Length = 711 Back     alignment and structure
>2db0_A 253AA long hypothetical protein; heat repeats, helical structure, structural genomics; 2.20A {Pyrococcus horikoshii} Length = 253 Back     alignment and structure
>1oyz_A Hypothetical protein YIBA; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.10A {Escherichia coli} SCOP: a.118.1.16 Length = 280 Back     alignment and structure
>1oyz_A Hypothetical protein YIBA; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.10A {Escherichia coli} SCOP: a.118.1.16 Length = 280 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>1b3u_A Protein (protein phosphatase PP2A); scaffold protein, phosphorylation, heat repeat; 2.30A {Homo sapiens} SCOP: a.118.1.2 PDB: 2ie4_A* 2ie3_A* 2npp_A* 3k7v_A* 3k7w_A* 3fga_A* 2pf4_A 2iae_A 2nym_A* 2nyl_A* 3dw8_A* 2pkg_A 3c5w_A Length = 588 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>3opb_A SWI5-dependent HO expression protein 4; heat and arm fold, myosin folding and function, myosin bindi protein, protein binding; 2.90A {Saccharomyces cerevisiae} Length = 778 Back     alignment and structure
>1te4_A Conserved protein MTH187; methanobacterium thermoautotrophicum, structural proteomics, heat-like repeat; NMR {Methanothermobacterthermautotrophicus} SCOP: a.118.1.16 Length = 131 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

No hit with probability above 80.00

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 1336
d1oxwa_360 c.19.1.3 (A:) Patatin {Heartleaf nightshade (Solan 1e-28
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 4e-10
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 3e-07
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-05
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 0.004
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 9e-10
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 5e-08
d1jdha_529 a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) 1e-08
d1jdha_529 a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) 1e-07
d1jdha_529 a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) 3e-06
d1jdha_529 a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) 5e-05
d1jdha_529 a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) 3e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 2e-08
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 2e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 3e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 4e-04
d1xm9a1457 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo 6e-08
d1xm9a1457 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo 3e-07
d1xm9a1457 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo 5e-07
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 1e-07
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 4e-05
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 0.002
d1xqra1264 a.118.1.21 (A:87-350) Hsp70-binding protein 1 (Hsp 5e-07
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 5e-07
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 8e-07
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 4e-05
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 3e-04
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 0.004
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 7e-07
d1q1sc_434 a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus 2e-06
d1q1sc_434 a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus 0.002
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 1e-05
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 4e-05
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 6e-05
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 5e-04
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 0.003
d1ibrb_458 a.118.1.1 (B:) Importin beta {Human (Homo sapiens) 2e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 3e-04
d1b3ua_588 a.118.1.2 (A:) Constant regulatory domain of prote 5e-04
d1b3ua_588 a.118.1.2 (A:) Constant regulatory domain of prote 0.002
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 6e-04
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 8e-04
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 8e-04
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 0.002
d2omxa2199 c.10.2.1 (A:37-235) Internalin B {Listeria monocyt 0.001
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 0.002
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 0.004
>d1oxwa_ c.19.1.3 (A:) Patatin {Heartleaf nightshade (Solanum cardiophyllum) [TaxId: 160510]} Length = 360 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: FabD/lysophospholipase-like
superfamily: FabD/lysophospholipase-like
family: Patatin
domain: Patatin
species: Heartleaf nightshade (Solanum cardiophyllum) [TaxId: 160510]

 Score =  116 bits (291), Expect = 1e-28
 Identities = 64/406 (15%), Positives = 128/406 (31%), Gaps = 106/406 (26%)

Query: 538 QGLRILSMDGGGMKGLATVQILKEIEK-------GTGKRIHELFDLVCGTSTGGMLAIAL 590
           + + +LS+DGGG++G+    IL+ +E            R+ + FD++ GTSTGG+L   +
Sbjct: 3   EMVTVLSIDGGGIRGIIPATILEFLEGQLQEMDNNADARLADYFDVIGGTSTGGLLTAMI 62

Query: 591 AVKLMTLDQCEEIYKNLGKLVFAEPFPKDNEAATWREKLDQIYKSSSQSFRVVVHGSKHS 650
           +      ++     K +    F       N +                       G K+ 
Sbjct: 63  STP-NENNRPFAAAKEIVPFYFEHGPQIFNPSGQIL-------------------GPKYD 102

Query: 651 ADQFERLLKEMCADEDGDLLIESSVKNIPKVFTVSTLVNVMPAQPFIFRNYQYPAGTPEV 710
                ++L+E      G+  +  ++  +          ++   +P IF            
Sbjct: 103 GKYLMQVLQEKL----GETRVHQALTEVVISSF-----DIKTNKPVIFTKSNLANSP--- 150

Query: 711 PFSISENSGITVLGSPTTGAQVGYKRSAFIGSCKHQVWQAIRASSAAP-----YYLDDFS 765
                                              +++    +++AAP     +Y    +
Sbjct: 151 -------------------------------ELDAKMYDISYSTAAAPTYFPPHYFVTNT 179

Query: 766 DD----VFRWQDGAIVAN-NPTIFAIREAQLLWP-----------DTRIDCLVSIGCGSV 809
            +     F   DGA+    +P + +I  A  L             + +   L+S+G G+ 
Sbjct: 180 SNGDEYEFNLVDGAVATVADPALLSISVATRLAQKDPAFASIRSLNYKKMLLLSLGTGTT 239

Query: 810 PTKTRR------GGWRYLDTGQVLIE--SACSVDRAEEALSTLLPML-PEIQYYRFNP-V 859
               +         W  +    V+ +   A S    +  LST    L  +  Y R     
Sbjct: 240 SEFDKTYTAKEAATWTAVHWMLVIQKMTDAASSYMTDYYLSTAFQALDSKNNYLRVQENA 299

Query: 860 DERCEMELDETDPAEWLKLEAAVDEYINN-----NSESFKNVCERL 900
                 E+D+   A    L    +  +       N E+++   +R 
Sbjct: 300 LTGTTTEMDDASEANMELLVQVGENLLKKPVSEDNPETYEEALKRF 345
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} Length = 529 Back     information, alignment and structure
>d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} Length = 529 Back     information, alignment and structure
>d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} Length = 529 Back     information, alignment and structure
>d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} Length = 529 Back     information, alignment and structure
>d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} Length = 529 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1xm9a1 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 457 Back     information, alignment and structure
>d1xm9a1 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 457 Back     information, alignment and structure
>d1xm9a1 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 457 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1xqra1 a.118.1.21 (A:87-350) Hsp70-binding protein 1 (HspBP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 264 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1q1sc_ a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 434 Back     information, alignment and structure
>d1q1sc_ a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 434 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1ibrb_ a.118.1.1 (B:) Importin beta {Human (Homo sapiens) [TaxId: 9606]} Length = 458 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1b3ua_ a.118.1.2 (A:) Constant regulatory domain of protein phosphatase 2a, pr65alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 588 Back     information, alignment and structure
>d1b3ua_ a.118.1.2 (A:) Constant regulatory domain of protein phosphatase 2a, pr65alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 588 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 199 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query1336
d1oxwa_360 Patatin {Heartleaf nightshade (Solanum cardiophyll 100.0
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.93
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.92
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.9
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.88
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.88
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.87
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.87
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.85
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.84
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.81
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.8
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.78
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.77
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.77
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.77
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.76
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.76
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.7
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.62
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.6
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.57
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.56
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.49
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.48
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.45
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.43
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.39
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.38
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.37
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.35
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.32
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.29
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.26
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.18
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.12
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.09
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.93
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.72
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.67
d1xm9a1457 Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} 97.21
d1xqra1264 Hsp70-binding protein 1 (HspBP1) {Human (Homo sapi 97.21
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.07
d1q1sc_434 Importin alpha {Mouse (Mus musculus) [TaxId: 10090 96.74
d1jdha_529 beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} 96.71
d1xqra1264 Hsp70-binding protein 1 (HspBP1) {Human (Homo sapi 96.7
d1jdha_529 beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} 96.68
d1wa5b_503 Karyopherin alpha {Baker's yeast (Saccharomyces ce 96.59
d1wa5b_503 Karyopherin alpha {Baker's yeast (Saccharomyces ce 96.53
d1cjya2580 Cytosolic phospholipase A2 catalytic domain {Human 96.46
d1q1sc_434 Importin alpha {Mouse (Mus musculus) [TaxId: 10090 95.7
d1xm9a1457 Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} 95.6
>d1oxwa_ c.19.1.3 (A:) Patatin {Heartleaf nightshade (Solanum cardiophyllum) [TaxId: 160510]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: FabD/lysophospholipase-like
superfamily: FabD/lysophospholipase-like
family: Patatin
domain: Patatin
species: Heartleaf nightshade (Solanum cardiophyllum) [TaxId: 160510]

Probab=100.00  E-value=0  Score=344.62  Aligned_cols=297  Identities=22%  Similarity=0.343  Sum_probs=228.8

Q ss_pred             CCCCEEEEECCCCHHHHHHHHHHHHHHHHC-------CCCCCCCCCEEEEECHHHHHHHHHHCC------CCCHHHHHHH
Q ss_conf             997339994287045899999999999721-------997445556399602689999999816------6789999999
Q 000712          537 KQGLRILSMDGGGMKGLATVQILKEIEKGT-------GKRIHELFDLVCGTSTGGMLAIALAVK------LMTLDQCEEI  603 (1336)
Q Consensus       537 ~~g~rILsLDGGGiRGl~~l~iL~~Le~~~-------g~~i~~~FDlI~GTStGgIiA~~La~~------~~s~~e~~~~  603 (1336)
                      ++.+|||||||||+||++++++|++||+..       +++++++||+|+|||+|||+|++++.+      .+..+++.+.
T Consensus         2 ~~~v~iLsldGGG~rG~~~~~vL~~L~~~~~~~~~~~~~~~~d~fD~i~GTS~Gaiia~~la~g~~~~~~~~~~~~~~~~   81 (360)
T d1oxwa_           2 GEMVTVLSIDGGGIRGIIPATILEFLEGQLQEMDNNADARLADYFDVIGGTSTGGLLTAMISTPNENNRPFAAAKEIVPF   81 (360)
T ss_dssp             CSCEEEEEECCCGGGGHHHHHHHHHHHHHHHHHTTCTTCCHHHHCSEEEECTHHHHHHHHHHSBCTTSSBSSCGGGHHHH
T ss_pred             CCCEEEEEECCCHHHHHHHHHHHHHHHHCCCCCCCCCCCCHHHHCCEEEEECHHHHHHHHHHCCCCCHHHHHHHHHHHHH
T ss_conf             97008999898789999999999999974972346679971420999999639999999998699703189999999999


Q ss_pred             HHHHCCCCCCCCCCCCHHHHHHHHHHHHHHHHCCCCCEEEECCCCCCHHHHHHHHHHHHCCCCCCHHHHHHHCCCCEEEE
Q ss_conf             99806333358999852567788877778530244523653278852589999999983077862013322038893999
Q 000712          604 YKNLGKLVFAEPFPKDNEAATWREKLDQIYKSSSQSFRVVVHGSKHSADQFERLLKEMCADEDGDLLIESSVKNIPKVFT  683 (1336)
Q Consensus       604 y~~l~~~iF~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ky~~~~Le~~Lke~~~~~~g~~~~~~~~~~~~kv~V  683 (1336)
                      |......+|....                          ...+++|+.+.++.++++.|+    +..+.+..   .++.+
T Consensus        82 ~~~~~~~~f~~~~--------------------------~~~~~~~~~~~l~~~l~~~~~----~~~~~~~~---~~~~~  128 (360)
T d1oxwa_          82 YFEHGPQIFNPSG--------------------------QILGPKYDGKYLMQVLQEKLG----ETRVHQAL---TEVVI  128 (360)
T ss_dssp             HHHHHHHHTCCCC--------------------------CSSSCSCCCHHHHHHHHHHHT----TCBGGGCS---SEEEE
T ss_pred             HHHHCCHHHHCCC--------------------------CCCCCCCCHHHHHHHHHHHHC----CCHHHHCC---CCCEE
T ss_conf             9861210100123--------------------------346764546999999999958----70133216---75326


Q ss_pred             EEEEECCCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHCCCCCCCCC
Q ss_conf             99862157990899425889999999876556788732148998776445443334477763099999881389999965
Q 000712          684 VSTLVNVMPAQPFIFRNYQYPAGTPEVPFSISENSGITVLGSPTTGAQVGYKRSAFIGSCKHQVWQAIRASSAAPYYLDD  763 (1336)
Q Consensus       684 v~t~~d~~~~~p~lFrnY~~~~~~~~~~~~~~~~~~~~~~~s~~~~~~~~~~~~~~~~~~~~~IweA~RASSAAP~yF~p  763 (1336)
                      +  .++..++++++|++|+....+                                  ..+.++|+|+|||||+|+||+|
T Consensus       129 ~--a~~~~~~~~~~~~~~~~~~~~----------------------------------~~~~~l~~a~~ASsA~P~~F~p  172 (360)
T d1oxwa_         129 S--SFDIKTNKPVIFTKSNLANSP----------------------------------ELDAKMYDISYSTAAAPTYFPP  172 (360)
T ss_dssp             E--EEETTTTEEEEEESSSTTTCG----------------------------------GGCCBHHHHHHHHHCCTTTSCC
T ss_pred             E--ECCCCCCCEEEEECCCCCCCC----------------------------------CCCCHHHHHHHHHHCCCCCCCC
T ss_conf             7--301588874897364435688----------------------------------6322698861155138877787


Q ss_pred             EEECC---------CCCCCCCCCC-CCHHHHHHHHHHHHCCCCC-----------CCEEEEECCCCCCCCCC------CC
Q ss_conf             35088---------3222575567-7429999999999399998-----------77999938999999767------88
Q 000712          764 FSDDV---------FRWQDGAIVA-NNPTIFAIREAQLLWPDTR-----------IDCLVSIGCGSVPTKTR------RG  816 (1336)
Q Consensus       764 v~i~g---------~~yvDGGi~~-NNP~~~Ai~Ea~~l~p~~~-----------i~~VVSIGTG~~~~~~~------~~  816 (1336)
                      +++.+         ..|+|||+.. |||+.+|+.|+..+|+..+           ..+++|+|||..+....      ..
T Consensus       173 ~~~~~~~~~~~~~~~~~~Dgg~~~~nnp~~~a~~e~~~l~~~~~~~~~~~~~~~~~~~~~s~gtg~~~~~~~~~~~~~~~  252 (360)
T d1oxwa_         173 HYFVTNTSNGDEYEFNLVDGAVATVADPALLSISVATRLAQKDPAFASIRSLNYKKMLLLSLGTGTTSEFDKTYTAKEAA  252 (360)
T ss_dssp             EEEEEECTTSCEEEEEEEEGGGGTCSSCHHHHHHHHHHHTTTCGGGTTSTTCCGGGEEEEEECCCCBCTTSSCCCHHHHT
T ss_pred             EEEECCCCCCCCEEEEECCCCHHHCCCCHHHHHHHHHHHCCCCCCCCCCCCCCCCCEEEECCCCCCCCCCCCCCCHHHHH
T ss_conf             79732247787326774033542256726778999987624675322245677663155314666664333332124420


Q ss_pred             CCCCCCCCCHHHH--HHHCHHHHHHHHHHHCCCCC-CCCEEEECCCC-CCCCCCCCCCCHHHHHHHHHHHHHHHHH----
Q ss_conf             8410136411455--21117999999998805599-99879982589-9787889989988899999999999984----
Q 000712          817 GWRYLDTGQVLIE--SACSVDRAEEALSTLLPMLP-EIQYYRFNPVD-ERCEMELDETDPAEWLKLEAAVDEYINN----  888 (1336)
Q Consensus       817 ~w~~l~~~~~li~--~~~~~d~v~~~~~~~~~~~~-~~~YfRfnp~~-~~~~i~LDe~~~~~l~~l~~~t~~yl~~----  888 (1336)
                      .|+...|...+.+  .....+.++++++..++... +.+||||||.. ....+.+|+++++.+.+|...+++|+++    
T Consensus       253 ~~g~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~Y~R~~~~~~~~~~~~lDd~s~~~l~~l~~~g~~~~~~~~~~  332 (360)
T d1oxwa_         253 TWTAVHWMLVIQKMTDAASSYMTDYYLSTAFQALDSKNNYLRVQENALTGTTTEMDDASEANMELLVQVGENLLKKPVSE  332 (360)
T ss_dssp             TCCHHHHHTTHHHHHHHHHHHHHHHHHHHHHHHTTCGGGEEEECCCCBCGGGGCTTCCCHHHHHHHHHHHHHHHTSBSSS
T ss_pred             HCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHH
T ss_conf             01167689999999876559999999999987447988479974886656541146899999999999999999633034


Q ss_pred             -----HHHHHHHHHHHHCC
Q ss_conf             -----19999999999609
Q 000712          889 -----NSESFKNVCERLLL  902 (1336)
Q Consensus       889 -----n~~~l~~i~~~Ll~  902 (1336)
                           +++.++++++.|..
T Consensus       333 ~~~~~~~~~L~~~~~~L~~  351 (360)
T d1oxwa_         333 DNPETYEEALKRFAKLLSD  351 (360)
T ss_dssp             SCCCBHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHH
T ss_conf             3066799999999999999
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1xm9a1 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xqra1 a.118.1.21 (A:87-350) Hsp70-binding protein 1 (HspBP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1q1sc_ a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xqra1 a.118.1.21 (A:87-350) Hsp70-binding protein 1 (HspBP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wa5b_ a.118.1.1 (B:) Karyopherin alpha {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wa5b_ a.118.1.1 (B:) Karyopherin alpha {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1cjya2 c.19.1.2 (A:142-721) Cytosolic phospholipase A2 catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q1sc_ a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1xm9a1 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure