Citrus Sinensis ID: 000742


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------1000------1010------1020------1030------1040------1050------1060------1070------1080------1090------1100------1110------1120------1130------1140------1150------1160------1170------1180------1190------1200------1210------1220------1230------1240------1250------1260------1270------1280------1290------1300------1310---
MGRDEMQMSEAKRAYRSAKEEGNRQEEARWANVIGDILKNRGEYVEALKWFRIDYDVSVKYLPEKHLLPTCQSLGEVYLRLEHFKDALIYQVKKHLELAKDASDLVEQQRACTQLGRTYYEMFLRSDDDHYSIRNAKKYFKSAMKLAQTLKENPATSRSSFLKEYIDAHNNIGMLQMELDNLEEAKKFLIRGLEICNEEEVSEDDDGRSRLHHNLGNVYMELRMWDKSREHIEQDIIICKKIEHCQGEAKGYINLGELHYRVQKYDEAILCYQKALNLAQSMEDEDALASQIDQNIETVKKAIEVMDELKKEEQNLKKLTRNMIIAKGTSQERKYLLQQNASLDRLIEKSSMIFAWLKHCEYAKRKKRIASELCDKGKLSDSFLVIGESYQKLRKFNKAIKWYTKSWEMYKSIGNLEGQALAKVNMGNVLDSNGDWAGALDAFQEGYRIAVEANLPSVQLSALENMHYSHMIRFDNIEEARRLQHEIDKLKESKSEDLEAYDVARDCCSETDTEGNDHLPDVRSSACFPAEMSKSDSGRSKTLAGLEEVEDDEPLISFLRSSERLPKLKRAYVEKQNIPTEPRELTPKTLSKSTNSQQTGGGRKRIRVVLSDDEGDIDNEEGLKGRLQKCPVEGVATFDAINSKSGSASPAHKFQDVPAADFKCTNSSENPINVEESTCSHKFTSSNPTNQYGNAIRCTGKVFIASDVNDDQCVTFRIDDDLIHLEVHSCICDDKLDIESLKVELACLYYLQLPKEKISKGLLPIIQHMKYGGRSLESFDAFKDQLGKDIIEVSIDGWVQKRLMKLYIECCKELSEAPNMKLLKKLYISEVEDEVIVSECELQDISVTPLLNALHTHKTVALLDLSHNLLGNGTMEKLQQFFISSCQNYVDLTLDLHCNRFGPTTLFQICECPVLFTRLGVLNLSGNRLTDACGSYLSTILKNCKVLYSLNIENCSITSRTIQKVADALGAESTLAQLCIGYNSPVTGNAITNLLVKLDTLKSFSELNLNGLKLSKPVVDRLCQLAKTSCLTHLMLGCTNLGSDGSLQLVESLFSRAQESVKLDLSYCGLESTCIHKFTASVSLVHGILELNLGGNPIMKEGANALASLLMNPQCCLKVLVLSKCQLGLAGVLQLIKALSENDTLEELNLADNASKELTLQQNLSSVNSENLQPALKTSDCVSKEVDTDQHGLFAMNTDCNDLEVADSEDDKIRVESAASGFDNSCTSSCQKNSSFECQFVQELSSAIGMAKPLQLLDLSNNGFSTQAVKTLYCAWSSRSGAGPAWKHIKEQIIHFSVEGNKCCRVKPCCRKN
cccHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHccccHHHHHHHHHHccHHHHccccccHHHHHHcccHHHHHHHHHHHHHHHHccccccccccHHHHHHHcccHHHHHHHHHHHHccccccccccccHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEccccEEEEEcccccccHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHccccccccccHHHcccccHHHHccccccccccHHHHHHHHcccccHHHHHHHHHHccccccccEEccccccccccHHHHHHHHcccccccEEEcccccccHHHHHHHHHHHHccccccccEEEccccccccHHHHHHHHHHccccccccEEEcccccccccHHHHHHHHHcccccccEEEcccccccHHHHHHHHHHHcccccccEEEcccccccccHHHHHHHHHccccccccEEEcccccccHHHHHHHHHHHcccccccEEccccccccHHHHHHHHHHccccccccEEEcccccccHHHHHHHHHHHcccccccEEEccccccccHHHHHHHHHcccccccccEEEcccccccHHHHHHHHHHHcccccccccccccccccHHHHHHHHcccccccHHHHHccccccccccccccccccccccccccccccccccHHHHHHHHHHcccccccccccccccccHHHHHHHHHHHHccccccccccccccccHHHHHHHHHHHccccccccccccccccccccccccccccccccccccc
ccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHcHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHccHEccHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHcccccccEEEEEEEcccccccccHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHEEEcccHHHHHHHHHHHHHHHHHHcHHHHHcccccHccccccccccccccccccccccccccccccccccccccccccccccccEHHEEccccccccccccccccccccccccccccccccccccccccccccEEEEEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccEEccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEcccEEEEEcccccccccccHHHHHHHHHHHHHHccccHHHccccHHHHHHHHHccccccccccHHHHccccEEEEEEcccccccHHHHHHHHHHHHcccHHHHHHHHHHHccccccEEEccccccHHHHHHHHHHHHccccccEEEccccccccHHHHHHHHHHccccccccEEEEHHccccccHHHHHHHHHHHHccccccEEEccccccccHHHHHHHHHHcccHHHHHEEHHHccccHHHHHHHHHHHHccccccEEEccccccccHHHHHHHHHHcccccccEEEEEEcccccHHHHHHHHHHHHcccccEEEccccccHHHHHHHHHHHHccccccccEEEcccccccHHHHHcHHHHHHHcccccEEEccccccHHHHHHHHHHHHHcccccccEEEccccccEHHHHHHHHHHHHHcccccEEEccccEcHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHccccccHccccccccccccHHHcccccccccccHccccccccHHHHHHHHHHHHccccccEEEcccccccHHHHHHHHHHHHccccccccHcccccEEEEEEEccccccccccccccc
MGRDEMQMSEAKRAYRSAKEEGNRQEEARWANVIGDILKNRGEYVEALKWFRIDYDvsvkylpekhllptcqSLGEVYLRLEHFKDALIYQVKKHLELAKDASDLVEQQRACTQLGRTYYEMFLRSDDDHYSIRNAKKYFKSAMKLAQTlkenpatsrSSFLKEYIDAHNNIGMLQMELDNLEEAKKFLIRGLeicneeevsedddgrsrlhhnLGNVYMELRMWDKSREHIEQDIIICKKIEHCQGEAKGYINLGELHYRVQKYDEAILCYQKALNLAQSMEDEDALASQIDQNIETVKKAIEVMDELKKEEQNLKKLTRNMIIAKGTSQERKYLLQQNASLDRLIEKSSMIFAWLKHCEYAKRKKRIASelcdkgklsdsFLVIGESYQKLRKFNKAIKWYTKSWEMYKSIGNLEGQALAKVNmgnvldsngdwaGALDAFQEGYRIAVEANLPSVQLSALENMHYSHMIRFDNIEEARRLQHEIDKlkesksedleaYDVARDCcsetdtegndhlpdvrssacfpaemsksdsgrsktlagleeveddeplisFLRSSERLPKLKRAYVEkqniptepreltpktlskstnsqqtgggrkrirvvlsddegdidneeglkgrlqkcpvegvatfdainsksgsaspahkfqdvpaadfkctnssenpinveestcshkftssnptnqygnairctgkvfiasdvnddqcvtfridddlIHLEVHScicddkldIESLKVELACLYYLqlpkekiskgllPIIQhmkyggrsleSFDAFKDQLGKDIIEVSIDGWVQKRLMKLYIECCKELSEAPNMKLLKKLYISEVEDEVIVSecelqdisvtplLNALHTHKTVALLDLShnllgngtMEKLQQFFISSCQNYVDLTLDlhcnrfgpttlfqicecpvlFTRLGvlnlsgnrltdACGSYLSTILKNCKVLYSlniencsitSRTIQKVADALGAESTLAQLCigynspvtgNAITNLLVKLDTLKSFSelnlnglklskPVVDRLCQLAKTSCLTHLMlgctnlgsdgsLQLVESLFSRAQESVKLDlsycglestcihkFTASVSLVHGILelnlggnpiMKEGANALASLLMNPQCCLKVLVLSKCQLGLAGVLQLIKALsendtleelnladnASKELTLQQNlssvnsenlqpalktsdcvskevdtdqhglfamntdcndlevadseddkIRVESaasgfdnsctsscqknssFECQFVQELSSaigmakplqlldlsnngfsTQAVKTLYCAwssrsgagpawkHIKEQIIHFSVegnkccrvkpccrkn
mgrdemqmseAKRAYrsakeegnrqeearwANVIGDILKNRGEYVEALKWFRIDYDVSVKYLPEKHLLPTCQSLGEVYLRLEHFKDALIYQVKKHLELAKDASDLVEQQRACTQLGRTYYEMFLRSDDDHYSIRNAKKYFKSAMKLAQTLkenpatsrSSFLKEYIDAHNNIGMLQMELDNLEEAKKFLIRGLEICneeevsedddgrsrlhhNLGNVYMELRMWDKSREHIEQDIIICKKIEHCQGEAKGYINLGELHYRVQKYDEAILCYQKALNLAQSMEDEDALASQIDQNIETVKKAIEVMDELKKEEQNLKKLTRNmiiakgtsqeRKYLLQQNASLDRLIEKSSMIFAWLKHCEYAKRKKRIAselcdkgklsdsfLVIGESYQKLRKFNKAIKWYTKSWEMYKSIGNLEGQALAKVNMGNVLDSNGDWAGALDAFQEGYRIAVEANLPSVQLSALENMHYSHMIRFDNIEEARRLQHEIDKlkesksedleaYDVARDCCSEtdtegndhlpdvRSSACfpaemsksdsgrSKTLagleeveddeplisflrsserlpklkrayvekqniptepreltpktlskstnsqqtgggrkrirvvlsddegdidneeglkgrlqkcpVEGVATFDAINSKSGSASPAHKFQDVPAADFKCTNSSENPINVEESTCSHKftssnptnqygNAIRCTGKVFIASDVNDDQCVTFRIDDDLIHLEVHSCICDDKLDIESLKVELACLYYLQLPKEKISKGLLPIIQHMKYGGRSLESFDAFKDQLGKDIIEVSIDGWVQKRLMKLYIECCKELSEAPNMKLLKKLYISEVEDEVIVSECELQDISVTPLLNALHTHKTVALLDLSHNLLGNGTMEKLQQFFISSCQNYVDLTLDLHCNRFGPTTLFQICECPVLFTRLGVLNLSGNRLTDACGSYLSTILKNCKVLYSLNIENCSITSRTIQKVADALGAESTLAQLCIGYNSPVTGNAITNLLVKLDTLKSFSELNLNGLKLSKPVVDRLCQLAKTSCLTHLMLGCTNLGSDGSLQLVESLFSRAQESVKLDLSYCGLESTCIHKFTASVSLVHGILELNLGGNPIMKEGANALASLLMNPQCCLKVLVLSKCQLGLAGVLQLIKALSENDTLEELNLADNASKELTLQQNLSSVNSENLQPALKTSDCVSKEVDTDQHGLFAMNTDCNDLEVADSEDDKIRVESAASGFDNSCTSSCQKNSSFECQFVQELSSAIGMAKPLQLLDLSNNGFSTQAVKTLYCAWSSRSGAGPAWKHIKEQIIHFsvegnkccrvkpccrkn
MGRDEMQMSEAKRAYRSAKEEGNRQEEARWANVIGDILKNRGEYVEALKWFRIDYDVSVKYLPEKHLLPTCQSLGEVYLRLEHFKDALIYQVKKHLELAKDASDLVEQQRACTQLGRTYYEMFLRSDDDHYSIRNAKKYFKSAMKLAQTLKENPATSRSSFLKEYIDAHNNIGMLQMELDNLEEAKKFLIRGLEICNEEEVSEDDDGRSRLHHNLGNVYMELRMWDKSREHIEQDIIICKKIEHCQGEAKGYINLGELHYRVQKYDEAILCYQKALNLAQSMEDEDALASQIDQNIETVKKAIEVMDelkkeeqnlkklTRNMIIAKGTSQERKYLLQQNASLDRLIEKSSMIFAWLKHCEYAKRKKRIASELCDKGKLSDSFLVIGESYQKLRKFNKAIKWYTKSWEMYKSIGNLEGQALAKVNMGNVLDSNGDWAGALDAFQEGYRIAVEANLPSVQLSALENMHYSHMIRFDNIEEARRLQHEIDKLKESKSEDLEAYDVARDCCSETDTEGNDHLPDVRSSACFPAEMSKSDSGRSKTLAGLEEVEDDEPLISFLRSSERLPKLKRAYVEKQNIPTEPRELTPKTLSKSTNSQQTGGGRKRIRVVLSDDEGDIDNEEGLKGRLQKCPVEGVATFDAINSKSGSASPAHKFQDVPAADFKCTNSSENPINVEESTCSHKFTSSNPTNQYGNAIRCTGKVFIASDVNDDQCVTFRIDDDLIHLEVHSCICDDKLDIESLKVELACLYYLQLPKEKISKGLLPIIQHMKYGGRSLESFDAFKDQLGKDIIEVSIDGWVQKRLMKLYIECCKELSEAPNMKLLKKLYisevedevivseceLQDISVTPLLNALHTHKTVALLDLSHNLLGNGTMEKLQQFFISSCQNYVDLTLDLHCNRFGPTTLFQICECPVLFTRLGVLNLSGNRLTDACGSYLSTILKNCKVLYSLNIENCSITSRTIQKVADALGAESTLAQLCIGYNSPVTGNAITNLLVKLDTLKSFSELNLNGLKLSKPVVDRLCQLAKTSCLTHLMLGCTNLGSDGSLQLVESLFSRAQESVKLDLSYCGLESTCIHKFTASVSLVHGILELNLGGNPIMKEGANALASLLMNPQCCLKVLVLSKCQLGLAGVLQLIKALSENDTLEELNLADNASKELTLQQNLSSVNSENLQPALKTSDCVSKEVDTDQHGLFAMNTDCNDLEVADSEDDKIRVESAASGFDNSCTSSCQKNSSFECQFVQELSSAIGMAKPLQLLDLSNNGFSTQAVKTLYCAWSSRSGAGPAWKHIKEQIIHFSVEGNKCCRVKPCCRKN
****************************RWANVIGDILKNRGEYVEALKWFRIDYDVSVKYLPEKHLLPTCQSLGEVYLRLEHFKDALIYQVKKHLELAKDASDLVEQQRACTQLGRTYYEMFLRSDDDHYSIRNAKKYFKSAMKL**************FLKEYIDAHNNIGMLQMELDNLEEAKKFLIRGLEICN*************LHHNLGNVYMELRMWDKSREHIEQDIIICKKIEHCQGEAKGYINLGELHYRVQKYDEAILCYQKALNLA*****************************************RNMIIAKG****RKYLLQQNASLDRLIEKSSMIFAWLKHCEYAKRKKRIASELCDKGKLSDSFLVIGESYQKLRKFNKAIKWYTKSWEMYKSIGNLEGQALAKVNMGNVLDSNGDWAGALDAFQEGYRIAVEANLPSVQLSALENMHYSHMIRFDNIEE******************************************************************************************************************************************************CPVEGVATF****************************************************QYGNAIRCTGKVFIASDVNDDQCVTFRIDDDLIHLEVHSCICDDKLDIESLKVELACLYYLQLPKEKISKGLLPIIQHMKYGGRSLESFDAFKDQLGKDIIEVSIDGWVQKRLMKLYIECCKELSEAPNMKLLKKLYISEVEDEVIVSECELQDISVTPLLNALHTHKTVALLDLSHNLLGNGTMEKLQQFFISSCQNYVDLTLDLHCNRFGPTTLFQICECPVLFTRLGVLNLSGNRLTDACGSYLSTILKNCKVLYSLNIENCSITSRTIQKVADALGAESTLAQLCIGYNSPVTGNAITNLLVKLDTLKSFSELNLNGLKLSKPVVDRLCQLAKTSCLTHLMLGCTNLGSDGSLQLVESLFSRAQESVKLDLSYCGLESTCIHKFTASVSLVHGILELNLGGNPIMKEGANALASLLMNPQCCLKVLVLSKCQLGLAGVLQLIKALSEN*************************************************GLFAMNTDC***********************************FECQFVQELSSAIGMAKPLQLLDLSNNGFSTQAVKTLYCAWSSRSGAGPAWKHIKEQIIHFSVEGNKCCRVKPCC***
MGRDEMQMSEAKRAYRSAKEEGNRQEEARWANVIGDILKNRGEYVEALKWFRIDYDVSVKYLPEKHLLPTCQSLGEVYLRLEHFKDALIYQVKKHLELAKDASDLVEQQRACTQLGRTYYEMFLRSDDDHYSIRNAKKYFKSAMKLAQTLKENPATSRSSFLKEYIDAHNNIGMLQMELDNLEEAKKFLIRGLEICNEEEVSEDDDGRSRLHHNLGNVYMELRMWDKSREHIEQDIIICKKIEHCQGEAKGYINLGELHYRVQKYDEAILCYQKALNLAQSMEDEDALASQIDQNIETVKKAIEVMDELKKEEQNLKKLTRNMIIAKGTSQERKYLLQQNASLDRLIEKSSMIFAWLKHCEYAKRKKRIASELCDKGKLSDSFLVIGESYQKLRKFNKAIKWYTKSWEMYKSIGNLEGQALAKVNMGNVLDSNGDWAGALDAFQEGYRIAVEANLPSVQLSALENMHYSHMIRFDNIEEARRLQHE***************DVARDCCSETDTEGNDHLPDVRSSAC*****************GLEEVEDDEPLISFLRSSERLPK**********************************GRK***VV*******************************************************************************************************CVTFRIDDDLIHLEVHSCICDDKLDIESLKVELACLYYLQLP************QHMKYGGRSLESFDAFKDQLGKDIIEVSIDGWVQKRLMKLYIECCKELSEAPNMKLLKKLYISEVEDEVIVSECELQDISVTPLLNALHTHKTVALLDLSHNLLGNGTMEKLQQFFISSCQNYVDLTLDLHCNRFGPTTLFQICECPVLFTRLGVLNLSGNRLTDACGSYLSTILKNCKVLYSLNIENCSITSRTIQKVADALGAESTLAQLCIGYNSPVTGNAITNLLVKLDTLKSFSELNLNGLKLSKPVVDRLCQLAKTSCLTHLMLGCTNLGSDGSLQLVESLFSRAQESVKLDLSYCGLESTCIHKFTASVSLVHGILELNLGGNPIMKEGANALASLLMNPQCCLKVLVLSKCQLGLAGVLQLIKALSENDTLEELNLADNASKELTLQQNLSSVNSENLQPALKTSDCVSKEVDTDQHGLFAMNTDCNDLEV****DDKIRVESAASGFDNSCTSSCQKNSSFECQFVQELSSAIGMAKPLQLLDLSNNGFSTQAVKTLYCAWSSRSG**PAWKHIKEQIIHFSVEGNKCCRVKPCCR**
**************************EARWANVIGDILKNRGEYVEALKWFRIDYDVSVKYLPEKHLLPTCQSLGEVYLRLEHFKDALIYQVKKHLELAKDASDLVEQQRACTQLGRTYYEMFLRSDDDHYSIRNAKKYFKSAMKLAQTLKENPATSRSSFLKEYIDAHNNIGMLQMELDNLEEAKKFLIRGLEICNE*********RSRLHHNLGNVYMELRMWDKSREHIEQDIIICKKIEHCQGEAKGYINLGELHYRVQKYDEAILCYQKALNLAQSMEDEDALASQIDQNIETVKKAIEVMDELKKEEQNLKKLTRNMIIAKGTSQERKYLLQQNASLDRLIEKSSMIFAWLKHCEYAKRKKRIASELCDKGKLSDSFLVIGESYQKLRKFNKAIKWYTKSWEMYKSIGNLEGQALAKVNMGNVLDSNGDWAGALDAFQEGYRIAVEANLPSVQLSALENMHYSHMIRFDNIEEARRLQHEIDKLKESKSEDLEAYDVARDCCSETDTEGNDHLPDVRSSACFP*************LAGLEEVEDDEPLISFLRSSERLPKLKRAYVEKQNIPTEPRELT*****************KRIRVVLSDDEGDIDNEEGLKGRLQKCPVEGVATFDAINS********HKFQDVPAADFKCTNSSENPINVEESTCSHKFTSSNPTNQYGNAIRCTGKVFIASDVNDDQCVTFRIDDDLIHLEVHSCICDDKLDIESLKVELACLYYLQLPKEKISKGLLPIIQHMKYGGRSLESFDAFKDQLGKDIIEVSIDGWVQKRLMKLYIECCKELSEAPNMKLLKKLYISEVEDEVIVSECELQDISVTPLLNALHTHKTVALLDLSHNLLGNGTMEKLQQFFISSCQNYVDLTLDLHCNRFGPTTLFQICECPVLFTRLGVLNLSGNRLTDACGSYLSTILKNCKVLYSLNIENCSITSRTIQKVADALGAESTLAQLCIGYNSPVTGNAITNLLVKLDTLKSFSELNLNGLKLSKPVVDRLCQLAKTSCLTHLMLGCTNLGSDGSLQLVESLFSRAQESVKLDLSYCGLESTCIHKFTASVSLVHGILELNLGGNPIMKEGANALASLLMNPQCCLKVLVLSKCQLGLAGVLQLIKALSENDTLEELNLADNASKELTLQQNLSSVNSENLQPALKTSDCVSKEVDTDQHGLFAMNTDCNDLEVADSEDDKIRVESAASGFDNSCTSSCQKNSSFECQFVQELSSAIGMAKPLQLLDLSNNGFSTQAVKTLYCAWSSRSGAGPAWKHIKEQIIHFSVEGNKCCRVKPCCRKN
*****MQMSEAKRAYRSAKEEGNRQEEARWANVIGDILKNRGEYVEALKWFRIDYDVSVKYLPEKHLLPTCQSLGEVYLRLEHFKDALIYQVKKHLELAKDASDLVEQQRACTQLGRTYYEMFLRSDDDHYSIRNAKKYFKSAMKLAQTLKENPATSRSSFLKEYIDAHNNIGMLQMELDNLEEAKKFLIRGLEICNEEEVSEDDDGRSRLHHNLGNVYMELRMWDKSREHIEQDIIICKKIEHCQGEAKGYINLGELHYRVQKYDEAILCYQKALNLAQSMEDEDALASQIDQNIETVKKAIEVMDELKKEEQNLKKLTRNMIIAKGTSQERKYLLQQNASLDRLIEKSSMIFAWLKHCEYAKRKKRIASELCDKGKLSDSFLVIGESYQKLRKFNKAIKWYTKSWEMYKSIGNLEGQALAKVNMGNVLDSNGDWAGALDAFQEGYRIAVEANLPSVQLSALENMHYSHMIRFDNIEEARRLQHEIDKLKESKSEDLEAYDV*********************************************VEDDEPLISFLRS***************************************GGRKRIRVVLSDD*******************************************************ENP*************************************NDDQCVTFRIDDDLIHLEVHSCICDDKLDIESLKVELACLYYLQLPKEKISKGLLPIIQHMKYGGRSLESFDAFKDQLGKDIIEVSIDGWVQKRLMKLYIECCKELSEAPNMKLLKKLYISEVEDEVIVSECELQDISVTPLLNALHTHKTVALLDLSHNLLGNGTMEKLQQFFISSCQNYVDLTLDLHCNRFGPTTLFQICECPVLFTRLGVLNLSGNRLTDACGSYLSTILKNCKVLYSLNIENCSITSRTIQKVADALGAESTLAQLCIGYNSPVTGNAITNLLVKLDTLKSFSELNLNGLKLSKPVVDRLCQLAKTSCLTHLMLGCTNLGSDGSLQLVESLFSRAQESVKLDLSYCGLESTCIHKFTASVSLVHGILELNLGGNPIMKEGANALASLLMNPQCCLKVLVLSKCQLGLAGVLQLIKALSENDTLEELNLADNASKELTLQQNLSSVNSENLQPALKTSDCVSKEVDTDQHGLFAMNTDCNDLEVADSEDDKIRVESAASGFDNSCTSSCQKNSSFECQFVQELSSAIGMAKPLQLLDLSNNGFSTQAVKTLYCAWSSRSGAGPAWKHIKEQIIHFSVEGNKCCRVKPCC***
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxRWANVIGDILKNRGEYVEALKWFRIDYDVSVKYLPEKHLLPTCQSLGEVYLRLEHFKDALIYQVKKHLELAKDASDLVEQQRACTQLGRTYYEMFLRSDDDHYSIRNAKKYFKSAMKLAQTLKENPATSRSSFLKExxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxEVSEDDDGRSRLHHNLGNVYMELRMWDKSREHIEQDIIICKKIEHCQGEAKGYINLGELHYRVQKYDEAILCYQKALNLAQSMEDEDALASQxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxSQERKYLLQQNASLDRLIEKSSMIFAWLKHCEYAKRKKRIASELCDKGKLSDSFLVIGESYQKLRKFNKAIKWYTKSWEMYKSIGNLEGQALAKVNMGNVLDSNGDWAGALDAFQEGYRIAVEANLPSVQLSALENMHYSHMIRFDNIEExxxxxxxxxxxxxxxxxxxxxYDVARDCCSETDTEGNDHLPDVRSSACFPAEMSKSDSGRSKTLAGLEEVEDDEPLISFLRSSERLPKLKRAYVEKQNIPTEPRELTPKTLSKSTNSQQTGGGRKRIRVVLSDDEGDIDNEEGLKGRLQKCPVEGVATFDAINSKSGSASPAHKFQDVPAADFKCTNSSENPINVEESTCSHKFTSSNPTNQYGNAIRCTGKVFIASDVNDDQCVTFRIDDDLIHLEVHSCICDDKLDIESLKVELACLYYLQLPKEKISKGLLPIIQHMKYGGRSLESFDAFKDQLGKDIIEVSIDGWVQKRLMKLYIECCKELSEAPNMKLLKKLYISEVEDEVIVSECELQDISVTPLLNALHTHKTVALLDLSHNLLGNGTMEKLQQFFISSCQNYVDLTLDLHCNRFGPTTLFQICECPVLFTRLGVLNLSGNRLTDACGSYLSTILKNCKVLYSLNIENCSITSRTIQKVADALGAESTLAQLCIGYNSPVTGNAITNLLVKLDTLKSFSELNLNGLKLSKPVVDRLCQLAKTSCLTHLMLGCTNLGSDGSLQLVESLFSRAQESVKLDLSYCGLESTCIHKFTASVSLVHGILELNLGGNPIMKEGANALASLLMNPQCCLKVLVLSKCQLGLAGVLQLIKALSENDTLEELNLADNASKELTLQQNLSSVNSENLQPALKTSDCVSKEVDTDQHGLFAMNTDCNDLEVADSEDDKIRVESAASGFDNSCTSSCQKNSSFECQFVQELSSAIGMAKPLQLLDLSNNGFSTQAVKTLYCAWSSRSGAGPAWKHIKEQIIHFSVEGNKCCRVKPCCRKN
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query1313 2.2.26 [Sep-21-2011]
Q6Q4D01311 Protein TONSOKU OS=Arabid yes no 0.969 0.971 0.551 0.0
Q96AY4 2481 Tetratricopeptide repeat yes no 0.335 0.177 0.221 3e-17
Q0P5G11374 Tonsoku-like protein OS=B no no 0.249 0.238 0.264 5e-14
D4A6151367 Tonsoku-like protein OS=R no no 0.251 0.241 0.271 9e-13
A9JR78 1427 Tonsoku-like protein OS=D no no 0.172 0.158 0.241 3e-12
Q96HA71378 Tonsoku-like protein OS=H no no 0.250 0.238 0.25 3e-11
Q80XJ3 1691 Tetratricopeptide repeat no no 0.259 0.201 0.2 2e-10
Q6NZL61363 Tonsoku-like protein OS=M no no 0.207 0.200 0.271 6e-10
Q9R080673 G-protein-signaling modul no no 0.172 0.337 0.235 7e-08
Q6IR34673 G-protein-signaling modul no no 0.172 0.337 0.231 1e-07
>sp|Q6Q4D0|TONS_ARATH Protein TONSOKU OS=Arabidopsis thaliana GN=TSK PE=1 SV=2 Back     alignment and function desciption
 Score = 1346 bits (3484), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 745/1351 (55%), Positives = 962/1351 (71%), Gaps = 78/1351 (5%)

Query: 1    MGRDEMQMSEAKRAYRSAKEEGNRQEEARWANVIGDILKNRGEYVEALKWFRIDYDVSVK 60
            MGR  + ++ AKRAYR A+E G+R+E+ARWAN +GDILKN GEYV+ALKWFRIDYD+SVK
Sbjct: 1    MGR--LDVAAAKRAYRKAEEVGDRREQARWANNVGDILKNHGEYVDALKWFRIDYDISVK 58

Query: 61   YLPEKHLLPTCQSLGEVYLRLEHFKDALIYQVKKHLELAKDASDLVEQQRACTQLGRTYY 120
            YLP K LLPTCQSLGE+YLRLE+F++ALIYQ KKHL+LA++A+D VE+QRACTQLGRTY+
Sbjct: 59   YLPGKDLLPTCQSLGEIYLRLENFEEALIYQ-KKHLQLAEEANDTVEKQRACTQLGRTYH 117

Query: 121  EMFLRSDDDHYSIRNAKKYFKSAMKLAQTLKENPATSRSS-FLKEYIDAHNNIGMLQMEL 179
            EMFL+S+DD  +I++AKKYFK AM+LAQ LKE P    SS FL+EYI+AHNNIGML ++L
Sbjct: 118  EMFLKSEDDCEAIQSAKKYFKKAMELAQILKEKPPPGESSGFLEEYINAHNNIGMLDLDL 177

Query: 180  DNLEEAKKFLIRGLEICNEEEVSEDDDGRSRLHHNLGNVYMELRMWDKSREHIEQDIIIC 239
            DN E A+  L +GL+IC+EEEV E D  RSRLHHNLGNV+M LR WD++++HIE DI IC
Sbjct: 178  DNPEAARTILKKGLQICDEEEVREYDAARSRLHHNLGNVFMALRSWDEAKKHIEMDINIC 237

Query: 240  KKIEHCQGEAKGYINLGELHYRVQKYDEAILCYQKALNLAQSMEDEDALASQIDQNIETV 299
             KI H QGEAKGYINL ELH + QKY +A+LCY KA +LA+SM+DE AL  QI+ N + V
Sbjct: 238  HKINHVQGEAKGYINLAELHNKTQKYIDALLCYGKASSLAKSMQDESALVEQIEHNTKIV 297

Query: 300  KKAIEVMDELKKEEQNLKKLTRNMIIAKGTSQERKYLLQQNASLDRLIEKSSMIFAWLKH 359
            KK+++VM+EL++EE  LKKL+  M  AKGTS+ERK +LQ NA L  LI+KSSM+FAWLKH
Sbjct: 298  KKSMKVMEELREEELMLKKLSAEMTDAKGTSEERKSMLQVNACLGSLIDKSSMVFAWLKH 357

Query: 360  CEYAKRKKRIASELCDKGKLSDSFLVIGESYQKLRKFNKAIKWYTKSWEMYKSIGNLEGQ 419
             +Y+KRKK+I+ ELCDK KLSD+F+++GESYQ LR F K++KW+ +S+E +++IGNLEGQ
Sbjct: 358  LQYSKRKKKISDELCDKEKLSDAFMIVGESYQNLRNFRKSLKWFIRSYEGHEAIGNLEGQ 417

Query: 420  ALAKVNMGNVLDSNGDWAGALDAFQEGYRIAVEANLPSVQLSALENMHYSHMIRFDNIEE 479
            ALAK+N+GN LD  G+W GAL A++EGYRIA++ANLPS+QLSALE++HY HM+RF N ++
Sbjct: 418  ALAKINIGNGLDCIGEWTGALQAYEEGYRIALKANLPSIQLSALEDIHYIHMMRFGNAQK 477

Query: 480  ARRLQHEIDKLKESKSEDLEAYDVARDCCSETDTEGNDHLPDVRSSACFPAEMSKSDSGR 539
            A  L+  I  LKES+  + +A    +D CSETD+EG+ ++ + R +AC   +    +S R
Sbjct: 478  ASELKETIQNLKESEHAE-KAECSTQDECSETDSEGHANVSNDRPNACSSPQT--PNSLR 534

Query: 540  SKTLAGLEEVEDDEPLISFLRSSERLPKLKRAYVEKQNIPTEPRELTPKTLSKSTNSQQT 599
            S+ LA L+E  DD PLISFL+  +RL K K+    KQ+  T+    T K  S   +SQQT
Sbjct: 535  SERLADLDEANDDVPLISFLQPGKRLFKRKQV-SGKQDADTDQ---TKKDFSVVADSQQT 590

Query: 600  GGGRKRIRVVLSDDEGDIDNEEGLKGRLQKCP---------------------------V 632
              GRKRIRV+LSDDE + + E G       CP                            
Sbjct: 591  VAGRKRIRVILSDDESETEYELG-------CPKDSSHKVLRQNEEVSEESMYFDGAINYT 643

Query: 633  EGVATFDAINSKSGSASPAHKFQDVPAADFKCTNSSENPINVEESTCSHKFTSSNPTNQY 692
            +  A  D +   S S +P H  +  P     C + S N I VE +    K +  +  +  
Sbjct: 644  DNRAIQDNVEEGSCSYTPLHPIKVAPNVS-NCRSLSNN-IAVETTGRRKKGSQCDVGDSN 701

Query: 693  GNAIRCTGKV--FIASDVNDDQCVTFRIDDDLIHLEVHSCICDDKLDIESLKVELACLYY 750
            G + +    +  F A    +D+ +   I+++  H+ + SC  DD    ES+KVEL CLYY
Sbjct: 702  GTSCKTGAALVNFHAYSKTEDRKIKIEIENE--HIALDSCSHDD----ESVKVELTCLYY 755

Query: 751  LQLPKEKISKGLLPIIQHMKYGGR---SLESFDAFKDQLGKDIIEVSIDGWVQKRLMKLY 807
            LQLP ++ SKGLLPII H++YGGR    LE +   +D     +IE S+DGWV KRLMKLY
Sbjct: 756  LQLPDDEKSKGLLPIIHHLEYGGRVLKPLELYAILRDSSENVVIEASVDGWVHKRLMKLY 815

Query: 808  IECCKELSEAPNMKLLKKLYISEVEDEVIVSECELQDISVTPLLNALHTHKTVALLDLSH 867
            ++CC+ LSE P+MKLLKKLYISEVED++ VSECELQDIS  PLL ALH H  +A+LDLSH
Sbjct: 816  MDCCQSLSEKPSMKLLKKLYISEVEDDINVSECELQDISAAPLLCALHVH-NIAMLDLSH 874

Query: 868  NLLGNGTMEKLQQFFISSCQNYVDLTLDLHCNRFGPTTLFQICECPVLFTRLGVLNLSGN 927
            N+LGNGTMEKL+Q F SS Q Y  LTLDLHCNRFGPT LFQICECPVLFTRL VLN+S N
Sbjct: 875  NMLGNGTMEKLKQLFASSSQMYGALTLDLHCNRFGPTALFQICECPVLFTRLEVLNVSRN 934

Query: 928  RLTDACGSYLSTILKNCKVLYSLNIENCSITSRTIQKVADALGAESTLAQLCIGYNSPVT 987
            RLTDACGSYLSTI+KNC+ LYSLN+E+CS+TSRTIQKVA+AL ++S L+QLCIGYN+PV+
Sbjct: 935  RLTDACGSYLSTIVKNCRALYSLNVEHCSLTSRTIQKVANALDSKSGLSQLCIGYNNPVS 994

Query: 988  GNAITNLLVKLDTLKSFSELNLNGLKLSKPVVDRLCQLAKTSCLTHLMLGCTNLGSDGSL 1047
            G++I NLL KL TL SF+EL++NG+KLS  VVD L  L KT  L+ L++G + +G+DG++
Sbjct: 995  GSSIQNLLAKLATLSSFAELSMNGIKLSSQVVDSLYALVKTPSLSKLLVGSSGIGTDGAI 1054

Query: 1048 QLVESLFSRAQESVKLDLSYCGLESTCIHKFTASVSLVHGILELNLGGNPIMKEGANALA 1107
            ++ ESL  + +E+VKLDLS CGL S+   K    V+L   ILE N+GGNPI +EG +AL 
Sbjct: 1055 KVTESLCYQKEETVKLDLSCCGLASSFFIKLNQDVTLTSSILEFNVGGNPITEEGISALG 1114

Query: 1108 SLLMNPQCCLKVLVLSKCQLGLAGVLQLIKALSENDTLEELNLADNAS--KELTLQQNLS 1165
             LL NP   +KVL+LSKC L LAG+L +I+ALS+N  LEELNL+DNA    E    Q + 
Sbjct: 1115 ELLRNPCSNIKVLILSKCHLKLAGLLCIIQALSDNKNLEELNLSDNAKIEDETVFGQPVK 1174

Query: 1166 --SVNSENLQPALKTSDCVSKEVDTDQHGLFAMNTDCNDLEVADSEDDKIRVESAASGFD 1223
              SV  E      K+   + KE +     L   N +C+DLEVADSED++I   +A S   
Sbjct: 1175 ERSVMVEQEHGTCKSVTSMDKEQE-----LCETNMECDDLEVADSEDEQIEEGTATS--- 1226

Query: 1224 NSCTSSCQKNSSFECQFVQELSSAIGMAKPLQLLDLSNNGFSTQAVKTLYCAWSSRSG-A 1282
             S  S  +KN       V+ELS+A+ MA  L++LDLSNNGFS +A++TLY +WSS S   
Sbjct: 1227 -SSLSLPRKN-----HIVKELSTALSMANQLKILDLSNNGFSVEALETLYMSWSSSSSRT 1280

Query: 1283 GPAWKHIKEQIIHFSVEGNKCCRVKPCCRKN 1313
            G A +H+KE+ +HF VEG  CC VK CCRK+
Sbjct: 1281 GIAQRHVKEETVHFYVEGKMCCGVKSCCRKD 1311




Required for cell arrangement in root and shoot apical meristems. Involved in structural and functional stabilization of chromatin and may represent a link between response to DNA damage and epigenetic gene silencing.
Arabidopsis thaliana (taxid: 3702)
>sp|Q96AY4|TTC28_HUMAN Tetratricopeptide repeat protein 28 OS=Homo sapiens GN=TTC28 PE=1 SV=4 Back     alignment and function description
>sp|Q0P5G1|TONSL_BOVIN Tonsoku-like protein OS=Bos taurus GN=TONSL PE=2 SV=1 Back     alignment and function description
>sp|D4A615|TONSL_RAT Tonsoku-like protein OS=Rattus norvegicus GN=Tonsl PE=3 SV=1 Back     alignment and function description
>sp|A9JR78|TONSL_DANRE Tonsoku-like protein OS=Danio rerio GN=tonsl PE=2 SV=1 Back     alignment and function description
>sp|Q96HA7|TONSL_HUMAN Tonsoku-like protein OS=Homo sapiens GN=TONSL PE=1 SV=2 Back     alignment and function description
>sp|Q80XJ3|TTC28_MOUSE Tetratricopeptide repeat protein 28 OS=Mus musculus GN=Ttc28 PE=2 SV=2 Back     alignment and function description
>sp|Q6NZL6|TONSL_MOUSE Tonsoku-like protein OS=Mus musculus GN=Tonsl PE=2 SV=2 Back     alignment and function description
>sp|Q9R080|GPSM1_RAT G-protein-signaling modulator 1 OS=Rattus norvegicus GN=Gpsm1 PE=1 SV=2 Back     alignment and function description
>sp|Q6IR34|GPSM1_MOUSE G-protein-signaling modulator 1 OS=Mus musculus GN=Gpsm1 PE=1 SV=3 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1313
2240933421353 predicted protein [Populus trichocarpa] 0.996 0.967 0.672 0.0
2254315451309 PREDICTED: protein TONSOKU-like [Vitis v 0.984 0.987 0.676 0.0
2960885841342 unnamed protein product [Vitis vinifera] 0.979 0.958 0.659 0.0
2555523461327 brushy protein, putative [Ricinus commun 0.982 0.972 0.643 0.0
3565285401318 PREDICTED: protein TONSOKU-like [Glycine 0.972 0.968 0.607 0.0
4494618831342 PREDICTED: protein TONSOKU-like [Cucumis 0.989 0.967 0.608 0.0
4495168221342 PREDICTED: LOW QUALITY PROTEIN: protein 0.989 0.967 0.606 0.0
3565111551301 PREDICTED: protein TONSOKU-like [Glycine 0.959 0.968 0.602 0.0
657365331370 TONSOKU protein [Nicotiana tabacum] 0.993 0.951 0.560 0.0
847824441311 TPA: 3g18730 protein [Arabidopsis thalia 0.969 0.971 0.551 0.0
>gi|224093342|ref|XP_002309890.1| predicted protein [Populus trichocarpa] gi|222852793|gb|EEE90340.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score = 1791 bits (4639), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 911/1355 (67%), Positives = 1064/1355 (78%), Gaps = 46/1355 (3%)

Query: 1    MGRDEMQMSEAKRAYRSAKEEGNRQEEARWANVIGDILKNRGEYVEALKWFRIDYDVSVK 60
            + ++E +M  AKRA+ +A+E GN QEEARWAN+IGD+ KNRGEYV+ALKW RIDY++S K
Sbjct: 3    ISKEEQEMQTAKRAFVNAREVGNHQEEARWANLIGDMYKNRGEYVKALKWLRIDYEISNK 62

Query: 61   YLPEKHLLPTCQSLGEVYLRLEHFKDALIYQVKKHLELAKDASDLVEQQRACTQLGRTYY 120
            YLPEK LLPTCQS+G+VYLRL  FK AL+YQ KKHL+LAKDA+DLVEQQRA TQLGRTY+
Sbjct: 63   YLPEKQLLPTCQSIGDVYLRLHDFKHALVYQ-KKHLDLAKDANDLVEQQRASTQLGRTYH 121

Query: 121  EMFLRSDDDHYSIRNAKKYFKSAMKLAQTLKENPATSRSSFLKEYIDAHNNIGMLQMELD 180
            EMFL+SD+DH SIRNAKKYFKSAMKLAQ+LKENP T++SSFLKEYIDAHNNIGM++M+LD
Sbjct: 122  EMFLKSDNDHSSIRNAKKYFKSAMKLAQSLKENPHTNKSSFLKEYIDAHNNIGMIEMDLD 181

Query: 181  NLEEAKKFLIRGLEICNEEEVSEDDDGRSRLHHNLGNVYMELRMWDKSREHIEQDIIICK 240
            NLEEAKK L RGLEIC+EEEV  DDDGRSRLHHNLGNVYMEL++WDK++EHI++DI IC 
Sbjct: 182  NLEEAKKILARGLEICDEEEVDADDDGRSRLHHNLGNVYMELKVWDKAQEHIKKDIRICN 241

Query: 241  KIEHCQGEAKGYINLGELHYRVQKYDEAILCYQKALNLAQSMEDEDALASQIDQNIETVK 300
            +I HCQGEAKGYINLGELHYR QKY+EA LCY KAL+LA+SMEDED L  +I  NI TVK
Sbjct: 242  RIGHCQGEAKGYINLGELHYRAQKYEEANLCYHKALDLAKSMEDEDTLVKEIGHNIGTVK 301

Query: 301  KAIEVMDELKKEEQNLKKLTRNMIIAKGTSQERKYLLQQNASLDRLIEKSSMIFAWLKHC 360
            +A++VMDELKKEEQNLKKLTR+++ A+GT  ERK LLQQNASLD LIEKSS+I AW KH 
Sbjct: 302  EAMKVMDELKKEEQNLKKLTRSIVTARGTHHERKCLLQQNASLDCLIEKSSIILAWSKHH 361

Query: 361  EYAKRKKRIASELCDKGKLSDSFLVIGESYQKLRKFNKAIKWYTKSWEMYKSIGNLEGQA 420
            E+AKRKKRIASELCDK KL DSFL++GESYQKLRKF KAIKW+ KSWE YKSI NLEGQA
Sbjct: 362  EFAKRKKRIASELCDKEKLGDSFLLLGESYQKLRKFKKAIKWFMKSWETYKSISNLEGQA 421

Query: 421  LAKVNMGNVLDSNGDWAGALDAFQEGYRIAVEANLPSVQLSALENMHYSHMIRFDNIEEA 480
            LAK+N+G+VLD +GDW GAL+AF+EGYRIAV ANLPSVQLSALENMHYSHMIRFDN EEA
Sbjct: 422  LAKINIGDVLDCDGDWMGALNAFEEGYRIAVNANLPSVQLSALENMHYSHMIRFDNEEEA 481

Query: 481  RRLQHEIDKLKESKSEDLEAYDVARDCCSETDTEGNDHLPDVRSSACFPAEMSKSDSGRS 540
            RRLQHEI++LK SK+ +LE  ++A DCCSETDT+G+DHL D RS+A    E++KS S RS
Sbjct: 482  RRLQHEIERLK-SKNTELERQNLATDCCSETDTDGDDHLSDCRSNASCSQEINKSGSARS 540

Query: 541  KTLAGLEEVEDDEPLISFLRSSERLPKLKRAYVEKQNIPTEPRELTPKTLSKSTNSQQTG 600
            K+LAG E ++DD PLIS LRS +  P  K    E  N  T P E +PK  SK+ + QQT 
Sbjct: 541  KSLAGAEGLDDDLPLISLLRSHKNSPGTKSTQEEMHNTSTWPTEASPKCFSKTASDQQTV 600

Query: 601  GGRKRIRVVLSDDEGDI-DNEEGLKGRLQKCPVEGVATFDAINSKSGSASPAHKFQDVPA 659
              RKRIR+VLSDDE ++ DN +G + RL +CP E VAT +     S  A  A  FQ V  
Sbjct: 601  LSRKRIRIVLSDDEDEMHDNVDGSRERLNRCPPEDVATSNGFMGASNPAISACAFQGVST 660

Query: 660  ADFKCTNSSENPINVEESTCSHKFTSSNPTNQYGNAIRCTG--KVFIASDV--------- 708
               KC  SS NP N EEST S+K  S       G   R +   +V  A D+         
Sbjct: 661  VASKCATSSWNPNNNEESTSSYKSQSPKIVTPKGKVFRSSSNNEVVFACDLAASGSKCDV 720

Query: 709  --------------------NDDQCVTFRIDDDLIHLEVHSCICDDKLDIESLKVELACL 748
                                +D+QC+ FRID+DLI ++  S +  DKL IES+ VELACL
Sbjct: 721  SENLTHKNNAAHLRLHNSENDDNQCIVFRIDNDLIQVDAASYLAFDKLSIESMTVELACL 780

Query: 749  YYLQLPKEKISKGLLPIIQHMKYGGR---SLESFDAFKDQLGKDIIEVSIDGWVQKRLMK 805
            YYLQLP EK SKGLLPI+QHMK  GR   S+E+F+  K   G  +IEVSI+GWVQKRLMK
Sbjct: 781  YYLQLPTEKRSKGLLPIVQHMKCHGRVLDSIEAFETLKGDQGNILIEVSINGWVQKRLMK 840

Query: 806  LYIECCKELSEAPNMKLLKKLYISEVEDEVIVSECELQDISVTPLLNALHTHKTVALLDL 865
            LYI+CC+ELSEAPNMKLLKKLYISEVEDEVI SECELQDISVTPLLNAL THKTVA++DL
Sbjct: 841  LYIDCCEELSEAPNMKLLKKLYISEVEDEVIGSECELQDISVTPLLNALDTHKTVAVIDL 900

Query: 866  SHNLLGNGTMEKLQQFFISSCQNYVDLTLDLHCNRFGPTTLFQICECPVLFTRLGVLNLS 925
            SHN LGNGTMEKLQQ F++S Q Y DLTLDLHCNRFGPT LFQICECPVLF RL VLN+S
Sbjct: 901  SHNFLGNGTMEKLQQ-FLTSGQKYGDLTLDLHCNRFGPTALFQICECPVLFARLEVLNIS 959

Query: 926  GNRLTDACGSYLSTILKNCKVLYSLNIENCSITSRTIQKVADALGAESTLAQLCIGYNSP 985
            GNRLTDACGSYLSTIL+NC+ LYSLNIE CSIT+R+IQKVADAL A   LAQL IGYN+P
Sbjct: 960  GNRLTDACGSYLSTILENCRALYSLNIERCSITTRSIQKVADALNASLVLAQLSIGYNNP 1019

Query: 986  VTGNAITNLLVKLDTLKSFSELNLNGLKLSKPVVDRLCQLAKTSCLTHLMLGCTNLGSDG 1045
            V+GNAI NLL KL TLKSF+ LNL+GLKL+KPVVD LCQLAKTSCL+ LMLG T +G+DG
Sbjct: 1020 VSGNAIINLLAKLATLKSFAALNLSGLKLTKPVVDSLCQLAKTSCLSRLMLGSTGIGTDG 1079

Query: 1046 SLQLVESLFSRAQESVKLDLSYCGLESTCIHKFTASVSLVHGILELNLGGNPIMKEGANA 1105
            +LQL  SLF  +QESVKLDLSYCGL     H  +   +L+ GILELNL GNPIM+EG NA
Sbjct: 1080 ALQLTASLFEGSQESVKLDLSYCGLMPAYTHMLSTD-TLICGILELNLAGNPIMQEGTNA 1138

Query: 1106 LASLLMNPQCCLKVLVLSKCQLGLAGVLQLIKALSENDTLEELNLADNASKELTLQQNLS 1165
            + SLL NPQCCLKVLVL+KCQLGL G+LQ+I+AL+END LEEL+LADNA+ E T      
Sbjct: 1139 MVSLLTNPQCCLKVLVLNKCQLGLTGILQMIQALAENDCLEELHLADNANLEKTYMIQYD 1198

Query: 1166 SVN---SENLQPALKTSD----CVSKEVDTDQHGLFAMNTDCNDLEVADSEDDKIRVESA 1218
            S     S+ LQP L  S+     V KE D+D+ G+  MNT+CN LEVADSED  IR E+A
Sbjct: 1199 STKGSCSDILQPNLNKSESSKMSVPKESDSDKQGVCVMNTECNQLEVADSEDGPIRAEAA 1258

Query: 1219 ASGFDNSCTSSCQKNSSFECQFVQELSSAIGMAKPLQLLDLSNNGFSTQAVKTLYCAWSS 1278
             S FD+SCTSSCQKNS  ECQF+QEL++AI MAK LQ ++L NNGF+TQ  + LY AWSS
Sbjct: 1259 PSDFDDSCTSSCQKNSLLECQFIQELTTAISMAKQLQFMELGNNGFTTQVAEALYTAWSS 1318

Query: 1279 RSGAGPAWKHIKEQIIHFSVEGNKCCRVKPCCRKN 1313
            R   G AW+HI++Q IHFS+E NKCCR KPCCR++
Sbjct: 1319 RLENGLAWRHIEDQTIHFSMETNKCCRAKPCCRRD 1353




Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|225431545|ref|XP_002275533.1| PREDICTED: protein TONSOKU-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|296088584|emb|CBI37575.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|255552346|ref|XP_002517217.1| brushy protein, putative [Ricinus communis] gi|223543588|gb|EEF45117.1| brushy protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|356528540|ref|XP_003532859.1| PREDICTED: protein TONSOKU-like [Glycine max] Back     alignment and taxonomy information
>gi|449461883|ref|XP_004148671.1| PREDICTED: protein TONSOKU-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449516822|ref|XP_004165445.1| PREDICTED: LOW QUALITY PROTEIN: protein TONSOKU-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|356511155|ref|XP_003524295.1| PREDICTED: protein TONSOKU-like [Glycine max] Back     alignment and taxonomy information
>gi|65736533|dbj|BAD98515.1| TONSOKU protein [Nicotiana tabacum] Back     alignment and taxonomy information
>gi|84782444|tpe|CAE30337.1| TPA: 3g18730 protein [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1313
TAIR|locus:20940191311 TSK "TONSOKU" [Arabidopsis tha 0.976 0.977 0.543 0.0
ZFIN|ZDB-GENE-041111-230 1427 zgc:171416 "zgc:171416" [Danio 0.209 0.192 0.228 2e-25
UNIPROTKB|Q0P5G11374 TONSL "Tonsoku-like protein" [ 0.226 0.216 0.280 3.8e-25
RGD|13074831367 Tonsl "tonsoku-like, DNA repai 0.268 0.257 0.260 2.3e-24
UNIPROTKB|I3LJX91384 TONSL "Uncharacterized protein 0.226 0.215 0.265 3.9e-24
UNIPROTKB|Q96HA71378 TONSL "Tonsoku-like protein" [ 0.232 0.221 0.274 1.4e-22
UNIPROTKB|E2RN921324 TONSL "Uncharacterized protein 0.227 0.225 0.266 5e-22
MGI|MGI:19199991363 Tonsl "tonsoku-like, DNA repai 0.233 0.225 0.263 2e-19
UNIPROTKB|G3MYV61037 Bt.111263 "Uncharacterized pro 0.173 0.219 0.310 2.7e-13
UNIPROTKB|Q5ZIY8456 RNH1 "Uncharacterized protein" 0.264 0.760 0.245 8.3e-13
TAIR|locus:2094019 TSK "TONSOKU" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 3453 (1220.6 bits), Expect = 0., P = 0.
 Identities = 730/1342 (54%), Positives = 945/1342 (70%)

Query:     1 MGRDEMQMSEAKRAYRSAKEEGNRQEEARWANVIGDILKNRGEYVEALKWFRIDYDVSVK 60
             MGR  + ++ AKRAYR A+E G+R+E+ARWAN +GDILKN GEYV+ALKWFRIDYD+SVK
Sbjct:     1 MGR--LDVAAAKRAYRKAEEVGDRREQARWANNVGDILKNHGEYVDALKWFRIDYDISVK 58

Query:    61 YLPEKHLLPTCQSLGEVYLRLEHFKDALIYQVKKHLELAKDASDLVEQQRACTQLGRTYY 120
             YLP K LLPTCQSLGE+YLRLE+F++ALIYQ KKHL+LA++A+D VE+QRACTQLGRTY+
Sbjct:    59 YLPGKDLLPTCQSLGEIYLRLENFEEALIYQ-KKHLQLAEEANDTVEKQRACTQLGRTYH 117

Query:   121 EMFLRSDDDHYSIRNAKKYFKSAMKLAQTLKENPATSRSS-FLKEYIDAHNNIGMLQMEL 179
             EMFL+S+DD  +I++AKKYFK AM+LAQ LKE P    SS FL+EYI+AHNNIGML ++L
Sbjct:   118 EMFLKSEDDCEAIQSAKKYFKKAMELAQILKEKPPPGESSGFLEEYINAHNNIGMLDLDL 177

Query:   180 DNLEEAKKFLIRGLEICNEEEVSEDDDGRSRLHHNLGNVYMELRMWDKSREHIEQDIIIC 239
             DN E A+  L +GL+IC+EEEV E D  RSRLHHNLGNV+M LR WD++++HIE DI IC
Sbjct:   178 DNPEAARTILKKGLQICDEEEVREYDAARSRLHHNLGNVFMALRSWDEAKKHIEMDINIC 237

Query:   240 KKIEHCQGEAKGYINLGELHYRVQKYDEAILCYQKALNLAQSMEDEDALASQIDQNIETV 299
              KI H QGEAKGYINL ELH + QKY +A+LCY KA +LA+SM+DE AL  QI+ N + V
Sbjct:   238 HKINHVQGEAKGYINLAELHNKTQKYIDALLCYGKASSLAKSMQDESALVEQIEHNTKIV 297

Query:   300 KKAIEVMDXXXXXXXXXXXXTRNMIIAKGTSQERKYLLQQNASLDRLIEKSSMIFAWLKH 359
             KK+++VM+            +  M  AKGTS+ERK +LQ NA L  LI+KSSM+FAWLKH
Sbjct:   298 KKSMKVMEELREEELMLKKLSAEMTDAKGTSEERKSMLQVNACLGSLIDKSSMVFAWLKH 357

Query:   360 CEYAKRKKRIASELCDKGKLSDSFLVIGESYQKLRKFNKAIKWYTKSWEMYKSIGNLEGQ 419
              +Y+KRKK+I+ ELCDK KLSD+F+++GESYQ LR F K++KW+ +S+E +++IGNLEGQ
Sbjct:   358 LQYSKRKKKISDELCDKEKLSDAFMIVGESYQNLRNFRKSLKWFIRSYEGHEAIGNLEGQ 417

Query:   420 ALAKVNMGNVLDSNGDWAGALDAFQEGYRIAVEANLPSVQLSALENMHYSHMIRFDNIEE 479
             ALAK+N+GN LD  G+W GAL A++EGYRIA++ANLPS+QLSALE++HY HM+RF N ++
Sbjct:   418 ALAKINIGNGLDCIGEWTGALQAYEEGYRIALKANLPSIQLSALEDIHYIHMMRFGNAQK 477

Query:   480 ARRLQHEIDKLKESKSEDLEAYDVARDCCSETDTEGNDHLPDVRSSACFPAEMSKSDSGR 539
             A  L+  I  LKES+  + +A    +D CSETD+EG+ ++ + R +AC  +     +S R
Sbjct:   478 ASELKETIQNLKESEHAE-KAECSTQDECSETDSEGHANVSNDRPNAC--SSPQTPNSLR 534

Query:   540 SKTLAGLEEVEDDEPLISFLRSSERLPKLKRAYVEKQNIPTEPRELTPKTLSKSTNSQQT 599
             S+ LA L+E  DD PLISFL+  +RL K K+    KQ+  T+    T K  S   +SQQT
Sbjct:   535 SERLADLDEANDDVPLISFLQPGKRLFKRKQVS-GKQDADTDQ---TKKDFSVVADSQQT 590

Query:   600 GGGRKRIRVVLSDDEGDIDNEEGL-KGRLQKC--PVEGVAT----FD-AINS-------- 643
               GRKRIRV+LSDDE + + E G  K    K     E V+     FD AIN         
Sbjct:   591 VAGRKRIRVILSDDESETEYELGCPKDSSHKVLRQNEEVSEESMYFDGAINYTDNRAIQD 650

Query:   644 --KSGSAS--PAHKFQDVPAADFKCTNSSENPINVEESTCSHKFTSSNPTNQYGNAIRCT 699
               + GS S  P H  +  P     C + S N I VE +    K +  +  +  G + + T
Sbjct:   651 NVEEGSCSYTPLHPIKVAPNVS-NCRSLSNN-IAVETTGRRKKGSQCDVGDSNGTSCK-T 707

Query:   700 GKVFI---ASDVNDDQCVTFRIDDDLIHLEVHSCICDDKLDIESLKVELACLYYLQLPKE 756
             G   +   A    +D+ +   I+++  H+ + SC  DD    ES+KVEL CLYYLQLP +
Sbjct:   708 GAALVNFHAYSKTEDRKIKIEIENE--HIALDSCSHDD----ESVKVELTCLYYLQLPDD 761

Query:   757 KISKGLLPIIQHMKYGGRSLESFDAF---KDQLGKDIIEVSIDGWVQKRLMKLYIECCKE 813
             + SKGLLPII H++YGGR L+  + +   +D     +IE S+DGWV KRLMKLY++CC+ 
Sbjct:   762 EKSKGLLPIIHHLEYGGRVLKPLELYAILRDSSENVVIEASVDGWVHKRLMKLYMDCCQS 821

Query:   814 LSEAPNMKLLKKLYXXXXXXXXXXXXXXLQDISVTPLLNALHTHKTVALLDLSHNLLGNG 873
             LSE P+MKLLKKLY              LQDIS  PLL ALH H  +A+LDLSHN+LGNG
Sbjct:   822 LSEKPSMKLLKKLYISEVEDDINVSECELQDISAAPLLCALHVHN-IAMLDLSHNMLGNG 880

Query:   874 TMEKLQQFFISSCQNYVDLTLDLHCNRFGPTTLFQICECPVLFTRLGVLNLSGNRLTDAC 933
             TMEKL+Q F SS Q Y  LTLDLHCNRFGPT LFQICECPVLFTRL VLN+S NRLTDAC
Sbjct:   881 TMEKLKQLFASSSQMYGALTLDLHCNRFGPTALFQICECPVLFTRLEVLNVSRNRLTDAC 940

Query:   934 GSYLSTILKNCKVLYSLNIENCSITSRTIQKVADALGAESTLAQLCIGYNSPVTGNAITN 993
             GSYLSTI+KNC+ LYSLN+E+CS+TSRTIQKVA+AL ++S L+QLCIGYN+PV+G++I N
Sbjct:   941 GSYLSTIVKNCRALYSLNVEHCSLTSRTIQKVANALDSKSGLSQLCIGYNNPVSGSSIQN 1000

Query:   994 LLVKLDTLKSFSELNLNGLKLSKPVVDRLCQLAKTSCLTHLMLGCTNLGSDGSLQLVESL 1053
             LL KL TL SF+EL++NG+KLS  VVD L  L KT  L+ L++G + +G+DG++++ ESL
Sbjct:  1001 LLAKLATLSSFAELSMNGIKLSSQVVDSLYALVKTPSLSKLLVGSSGIGTDGAIKVTESL 1060

Query:  1054 FSRAQESVKLDLSYCGLESTCIHKFTASVSLVHGILELNLGGNPIMKEGANALASLLMNP 1113
               + +E+VKLDLS CGL S+   K    V+L   ILE N+GGNPI +EG +AL  LL NP
Sbjct:  1061 CYQKEETVKLDLSCCGLASSFFIKLNQDVTLTSSILEFNVGGNPITEEGISALGELLRNP 1120

Query:  1114 QCCLKVLVLSKCQLGLAGVLQLIKALSENDTLEELNLADNASKELTLQQNLSSVNSENLQ 1173
                +KVL+LSKC L LAG+L +I+ALS+N  LEELNL+DNA  E         V   ++ 
Sbjct:  1121 CSNIKVLILSKCHLKLAGLLCIIQALSDNKNLEELNLSDNAKIEDETVFG-QPVKERSVM 1179

Query:  1174 PALKTSDCVS-KEVDTDQHGLFAMNTDCNDLEVADSEDDKIRVESAASGFDNSCTSSCQK 1232
                +   C S   +D +Q  L   N +C+DLEVADSED++I   +A S    S  S  +K
Sbjct:  1180 VEQEHGTCKSVTSMDKEQE-LCETNMECDDLEVADSEDEQIEEGTATS----SSLSLPRK 1234

Query:  1233 NSSFECQFVQELSSAIGMAKPLQLLDLSNNGFSTQAVKTLYCAWSSRSG-AGPAWKHIKE 1291
             N       V+ELS+A+ MA  L++LDLSNNGFS +A++TLY +WSS S   G A +H+KE
Sbjct:  1235 N-----HIVKELSTALSMANQLKILDLSNNGFSVEALETLYMSWSSSSSRTGIAQRHVKE 1289

Query:  1292 QIIHFSVEGNKCCRVKPCCRKN 1313
             + +HF VEG  CC VK CCRK+
Sbjct:  1290 ETVHFYVEGKMCCGVKSCCRKD 1311




GO:0005634 "nucleus" evidence=ISM;IDA
GO:0009934 "regulation of meristem structural organization" evidence=IMP
GO:0009933 "meristem structural organization" evidence=IMP
GO:0051301 "cell division" evidence=IMP
GO:0000086 "G2/M transition of mitotic cell cycle" evidence=IMP
GO:0005515 "protein binding" evidence=IPI
GO:0016020 "membrane" evidence=IDA
ZFIN|ZDB-GENE-041111-230 zgc:171416 "zgc:171416" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|Q0P5G1 TONSL "Tonsoku-like protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
RGD|1307483 Tonsl "tonsoku-like, DNA repair protein" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|I3LJX9 TONSL "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|Q96HA7 TONSL "Tonsoku-like protein" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E2RN92 TONSL "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
MGI|MGI:1919999 Tonsl "tonsoku-like, DNA repair protein" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|G3MYV6 Bt.111263 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q5ZIY8 RNH1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q6Q4D0TONS_ARATHNo assigned EC number0.55140.96950.9710yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
fgenesh4_pg.C_LG_VII000331
hypothetical protein (1353 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1313
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 2e-11
pfam1342478 pfam13424, TPR_12, Tetratricopeptide repeat 4e-09
cd00189100 cd00189, TPR, Tetratricopeptide repeat domain; typ 3e-08
COG0457291 COG0457, NrfG, FOG: TPR repeat [General function p 7e-08
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 5e-06
cd00189100 cd00189, TPR, Tetratricopeptide repeat domain; typ 2e-05
pfam1341469 pfam13414, TPR_11, TPR repeat 3e-05
pfam0051534 pfam00515, TPR_1, Tetratricopeptide repeat 5e-05
pfam1342478 pfam13424, TPR_12, Tetratricopeptide repeat 6e-05
pfam1342478 pfam13424, TPR_12, Tetratricopeptide repeat 8e-05
cd00189100 cd00189, TPR, Tetratricopeptide repeat domain; typ 1e-04
smart0002834 smart00028, TPR, Tetratricopeptide repeats 1e-04
pfam0771934 pfam07719, TPR_2, Tetratricopeptide repeat 1e-04
COG0457291 COG0457, NrfG, FOG: TPR repeat [General function p 9e-04
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 0.002
cd00189100 cd00189, TPR, Tetratricopeptide repeat domain; typ 0.004
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
 Score = 67.0 bits (164), Expect = 2e-11
 Identities = 80/324 (24%), Positives = 123/324 (37%), Gaps = 16/324 (4%)

Query: 810  CCKELSEAPNMKLLKKLYISEVEDEVIVSECELQDISVTPLLNALHTHKTVALLDLSHNL 869
              + L      +LL KL   +V     +    L + +   L +AL    ++  L LS N 
Sbjct: 6    KGELLKTERATELLPKLLCLQVLR---LEGNTLGEEAAKALASALRPQPSLKELCLSLNE 62

Query: 870  LGNGT--MEKLQQFFISSCQNYVDLTLDLHCNRFGPTT--LFQICECPVLFTRLGVLNLS 925
             G     ++ L Q     C       LDL  N  GP    + +     +  + L  L L+
Sbjct: 63   TGRIPRGLQSLLQGLTKGCGLQ---ELDLSDNALGPDGCGVLESL---LRSSSLQELKLN 116

Query: 926  GNRLTDACGSYLSTILKNCKV-LYSLNIENCSITSRTIQKVADALGAESTLAQLCIGYNS 984
             N L D     L+  LK+    L  L +    +   + + +A AL A   L +L +  N+
Sbjct: 117  NNGLGDRGLRLLAKGLKDLPPALEKLVLGRNRLEGASCEALAKALRANRDLKELNLA-NN 175

Query: 985  PVTGNAITNLLVKLDTLKSFSELNLNGLKLSKPVVDRLCQ-LAKTSCLTHLMLGCTNLGS 1043
             +    I  L   L    +   L+LN   L+      L + LA    L  L LG  NL  
Sbjct: 176  GIGDAGIRALAEGLKANCNLEVLDLNNNGLTDEGASALAETLASLKSLEVLNLGDNNLTD 235

Query: 1044 DGSLQLVESLFSRAQESVKLDLSYCGLESTCIHKFTASVSLVHGILELNLGGNPIMKEGA 1103
             G+  L  +L S     + L LS   +           ++    +LEL+L GN   +EGA
Sbjct: 236  AGAAALASALLSPNISLLTLSLSCNDITDDGAKDLAEVLAEKESLLELDLRGNKFGEEGA 295

Query: 1104 NALASLLMNPQCCLKVLVLSKCQL 1127
              LA  L+ P   L+ L +     
Sbjct: 296  QLLAESLLEPGNELESLWVKDDSF 319


LRRs are 20-29 residue sequence motifs present in many proteins that participate in protein-protein interactions and have different functions and cellular locations. LRRs correspond to structural units consisting of a beta strand (LxxLxLxxN/CxL conserved pattern) and an alpha helix. This alignment contains 12 strands corresponding to 11 full repeats, consistent with the extent observed in the subfamily acting as Ran GTPase Activating Proteins (RanGAP1). Length = 319

>gnl|CDD|205602 pfam13424, TPR_12, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here Back     alignment and domain information
>gnl|CDD|223533 COG0457, NrfG, FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here Back     alignment and domain information
>gnl|CDD|222112 pfam13414, TPR_11, TPR repeat Back     alignment and domain information
>gnl|CDD|201277 pfam00515, TPR_1, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|205602 pfam13424, TPR_12, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|205602 pfam13424, TPR_12, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here Back     alignment and domain information
>gnl|CDD|197478 smart00028, TPR, Tetratricopeptide repeats Back     alignment and domain information
>gnl|CDD|191825 pfam07719, TPR_2, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|223533 COG0457, NrfG, FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 1313
KOG4626966 consensus O-linked N-acetylglucosamine transferase 100.0
KOG4626966 consensus O-linked N-acetylglucosamine transferase 100.0
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.95
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.95
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 99.95
KOG1130639 consensus Predicted G-alpha GTPase interaction pro 99.93
KOG1130639 consensus Predicted G-alpha GTPase interaction pro 99.93
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 99.93
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.93
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.93
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.92
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.92
PRK114471157 cellulose synthase subunit BcsC; Provisional 99.92
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.91
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 99.9
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.9
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 99.9
KOG0547606 consensus Translocase of outer mitochondrial membr 99.89
PRK114471157 cellulose synthase subunit BcsC; Provisional 99.89
KOG20021018 consensus TPR-containing nuclear phosphoprotein th 99.88
KOG20021018 consensus TPR-containing nuclear phosphoprotein th 99.88
PRK15174656 Vi polysaccharide export protein VexE; Provisional 99.88
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 99.88
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.86
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 99.86
KOG0547606 consensus Translocase of outer mitochondrial membr 99.85
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.84
KOG0624504 consensus dsRNA-activated protein kinase inhibitor 99.84
KOG1126638 consensus DNA-binding cell division cycle control 99.82
PRK15174656 Vi polysaccharide export protein VexE; Provisional 99.82
KOG2003840 consensus TPR repeat-containing protein [General f 99.82
PRK10049765 pgaA outer membrane protein PgaA; Provisional 99.81
PRK11788389 tetratricopeptide repeat protein; Provisional 99.8
PRK10049765 pgaA outer membrane protein PgaA; Provisional 99.78
KOG1126638 consensus DNA-binding cell division cycle control 99.78
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 99.77
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.76
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 99.76
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.76
PRK11788389 tetratricopeptide repeat protein; Provisional 99.74
KOG2003840 consensus TPR repeat-containing protein [General f 99.74
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 99.73
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 99.73
KOG1941518 consensus Acetylcholine receptor-associated protei 99.72
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.72
KOG4308478 consensus LRR-containing protein [Function unknown 99.72
PRK09782987 bacteriophage N4 receptor, outer membrane subunit; 99.7
KOG1941518 consensus Acetylcholine receptor-associated protei 99.7
KOG2076895 consensus RNA polymerase III transcription factor 99.69
KOG4308478 consensus LRR-containing protein [Function unknown 99.69
PRK09782987 bacteriophage N4 receptor, outer membrane subunit; 99.67
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.66
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.66
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 99.65
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 99.64
PRK14574822 hmsH outer membrane protein; Provisional 99.64
KOG2076895 consensus RNA polymerase III transcription factor 99.61
KOG4237498 consensus Extracellular matrix protein slit, conta 99.6
PRK04841903 transcriptional regulator MalT; Provisional 99.6
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 99.6
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 99.59
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 99.59
PRK12370553 invasion protein regulator; Provisional 99.58
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.58
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.58
PLN032181060 maturation of RBCL 1; Provisional 99.57
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 99.57
KOG4162799 consensus Predicted calmodulin-binding protein [Si 99.56
PRK12370553 invasion protein regulator; Provisional 99.55
KOG4237498 consensus Extracellular matrix protein slit, conta 99.55
KOG1156700 consensus N-terminal acetyltransferase [Chromatin 99.54
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.54
cd05804355 StaR_like StaR_like; a well-conserved protein foun 99.54
KOG0624504 consensus dsRNA-activated protein kinase inhibitor 99.54
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.54
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.53
PRK14574822 hmsH outer membrane protein; Provisional 99.53
PLN03081697 pentatricopeptide (PPR) repeat-containing protein; 99.52
PRK04841903 transcriptional regulator MalT; Provisional 99.52
KOG1129478 consensus TPR repeat-containing protein [General f 99.52
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 99.52
PRK11189296 lipoprotein NlpI; Provisional 99.52
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 99.51
PRK11189296 lipoprotein NlpI; Provisional 99.5
KOG1129478 consensus TPR repeat-containing protein [General f 99.5
PRK10747398 putative protoheme IX biogenesis protein; Provisio 99.49
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.49
PLN03081697 pentatricopeptide (PPR) repeat-containing protein; 99.47
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.46
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 99.46
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 99.45
PLN032181060 maturation of RBCL 1; Provisional 99.45
KOG2376652 consensus Signal recognition particle, subunit Srp 99.45
KOG0495913 consensus HAT repeat protein [RNA processing and m 99.43
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.43
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.42
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 99.42
KOG11271238 consensus TPR repeat-containing protein [RNA proce 99.42
PLN03077857 Protein ECB2; Provisional 99.42
KOG1125579 consensus TPR repeat-containing protein [General f 99.41
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 99.41
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 99.41
KOG1125579 consensus TPR repeat-containing protein [General f 99.4
KOG4162799 consensus Predicted calmodulin-binding protein [Si 99.4
KOG4341483 consensus F-box protein containing LRR [General fu 99.39
KOG11271238 consensus TPR repeat-containing protein [RNA proce 99.38
PLN03077857 Protein ECB2; Provisional 99.37
KOG0495913 consensus HAT repeat protein [RNA processing and m 99.37
KOG4341483 consensus F-box protein containing LRR [General fu 99.37
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 99.37
KOG3785557 consensus Uncharacterized conserved protein [Funct 99.34
KOG36171416 consensus WD40 and TPR repeat-containing protein [ 99.32
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 99.3
PRK10747398 putative protoheme IX biogenesis protein; Provisio 99.29
cd05804355 StaR_like StaR_like; a well-conserved protein foun 99.29
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 99.28
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 99.27
KOG1156700 consensus N-terminal acetyltransferase [Chromatin 99.25
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 99.24
KOG2300629 consensus Uncharacterized conserved protein [Funct 99.23
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 99.23
KOG1915677 consensus Cell cycle control protein (crooked neck 99.21
KOG4340459 consensus Uncharacterized conserved protein [Funct 99.18
PF12569517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 99.16
KOG36171416 consensus WD40 and TPR repeat-containing protein [ 99.15
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 99.15
PLN02789320 farnesyltranstransferase 99.13
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 99.13
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 99.12
PLN02789320 farnesyltranstransferase 99.09
KOG2376652 consensus Signal recognition particle, subunit Srp 99.08
PRK14720906 transcript cleavage factor/unknown domain fusion p 99.08
KOG2300629 consensus Uncharacterized conserved protein [Funct 99.02
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 98.98
PRK15359144 type III secretion system chaperone protein SscB; 98.98
KOG3785557 consensus Uncharacterized conserved protein [Funct 98.97
PRK10370198 formate-dependent nitrite reductase complex subuni 98.94
KOG2047835 consensus mRNA splicing factor [RNA processing and 98.94
KOG0617264 consensus Ras suppressor protein (contains leucine 98.94
PRK15359144 type III secretion system chaperone protein SscB; 98.92
KOG1915677 consensus Cell cycle control protein (crooked neck 98.9
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 98.89
PF12569517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 98.88
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.88
KOG2047835 consensus mRNA splicing factor [RNA processing and 98.86
PRK15179694 Vi polysaccharide biosynthesis protein TviE; Provi 98.85
KOG1128777 consensus Uncharacterized conserved protein, conta 98.85
KOG0617264 consensus Ras suppressor protein (contains leucine 98.84
PRK14720906 transcript cleavage factor/unknown domain fusion p 98.84
PF10345608 Cohesin_load: Cohesin loading factor; InterPro: IP 98.83
PRK10370198 formate-dependent nitrite reductase complex subuni 98.82
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 98.81
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 98.81
PF10345608 Cohesin_load: Cohesin loading factor; InterPro: IP 98.79
KOG1585308 consensus Protein required for fusion of vesicles 98.78
KOG1586288 consensus Protein required for fusion of vesicles 98.78
KOG0553304 consensus TPR repeat-containing protein [General f 98.77
PRK15179694 Vi polysaccharide biosynthesis protein TviE; Provi 98.76
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 98.75
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 98.75
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.75
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.74
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 98.74
KOG36161636 consensus Selective LIM binding factor [Transcript 98.74
KOG1585308 consensus Protein required for fusion of vesicles 98.73
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 98.71
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 98.71
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 98.7
KOG3060289 consensus Uncharacterized conserved protein [Funct 98.7
TIGR02552135 LcrH_SycD type III secretion low calcium response 98.7
KOG0553304 consensus TPR repeat-containing protein [General f 98.69
KOG36161636 consensus Selective LIM binding factor [Transcript 98.67
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.66
KOG1128777 consensus Uncharacterized conserved protein, conta 98.57
KOG3060289 consensus Uncharacterized conserved protein [Funct 98.55
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.55
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 98.51
CHL00033168 ycf3 photosystem I assembly protein Ycf3 98.51
PRK02603172 photosystem I assembly protein Ycf3; Provisional 98.49
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 98.48
CHL00033168 ycf3 photosystem I assembly protein Ycf3 98.48
KOG1586288 consensus Protein required for fusion of vesicles 98.48
TIGR02552135 LcrH_SycD type III secretion low calcium response 98.45
PRK02603172 photosystem I assembly protein Ycf3; Provisional 98.44
PLN03088356 SGT1, suppressor of G2 allele of SKP1; Provisional 98.42
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 98.4
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 98.39
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 98.39
KOG2471696 consensus TPR repeat-containing protein [General f 98.37
KOG4340459 consensus Uncharacterized conserved protein [Funct 98.37
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 98.36
COG4785297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 98.35
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 98.35
KOG1947482 consensus Leucine rich repeat proteins, some prote 98.32
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 98.31
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 98.28
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 98.28
COG4783484 Putative Zn-dependent protease, contains TPR repea 98.26
COG4105254 ComL DNA uptake lipoprotein [General function pred 98.26
cd00189100 TPR Tetratricopeptide repeat domain; typically con 98.26
COG4783484 Putative Zn-dependent protease, contains TPR repea 98.25
PLN03088356 SGT1, suppressor of G2 allele of SKP1; Provisional 98.25
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.23
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 98.23
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.21
COG2909894 MalT ATP-dependent transcriptional regulator [Tran 98.18
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 98.18
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.17
PRK10803263 tol-pal system protein YbgF; Provisional 98.16
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 98.16
KOG1947482 consensus Leucine rich repeat proteins, some prote 98.15
PF12688120 TPR_5: Tetratrico peptide repeat 98.15
KOG4234271 consensus TPR repeat-containing protein [General f 98.14
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 98.13
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.12
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 98.12
KOG2471696 consensus TPR repeat-containing protein [General f 98.11
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 98.1
COG2909894 MalT ATP-dependent transcriptional regulator [Tran 98.09
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.09
COG4785297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 98.08
COG4105254 ComL DNA uptake lipoprotein [General function pred 98.07
COG0457291 NrfG FOG: TPR repeat [General function prediction 98.05
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.04
PRK10153517 DNA-binding transcriptional activator CadC; Provis 98.04
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 98.04
KOG2982 418 consensus Uncharacterized conserved protein [Funct 98.03
cd00189100 TPR Tetratricopeptide repeat domain; typically con 98.0
PF12688120 TPR_5: Tetratrico peptide repeat 97.98
COG3898531 Uncharacterized membrane-bound protein [Function u 97.92
PRK15331165 chaperone protein SicA; Provisional 97.9
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 97.9
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 97.89
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.89
PRK10803263 tol-pal system protein YbgF; Provisional 97.89
KOG4555175 consensus TPR repeat-containing protein [Function 97.87
PRK10153517 DNA-binding transcriptional activator CadC; Provis 97.85
COG0457291 NrfG FOG: TPR repeat [General function prediction 97.85
PLN03150623 hypothetical protein; Provisional 97.82
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 97.8
KOG4555175 consensus TPR repeat-containing protein [Function 97.8
KOG1464440 consensus COP9 signalosome, subunit CSN2 [Posttran 97.79
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.77
COG5159421 RPN6 26S proteasome regulatory complex component [ 97.76
KOG4648536 consensus Uncharacterized conserved protein, conta 97.71
PLN03150623 hypothetical protein; Provisional 97.69
COG1729262 Uncharacterized protein conserved in bacteria [Fun 97.68
KOG4242553 consensus Predicted myosin-I-binding protein [Cell 97.68
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 97.67
KOG20411189 consensus WD40 repeat protein [General function pr 97.67
KOG1464440 consensus COP9 signalosome, subunit CSN2 [Posttran 97.67
KOG1550552 consensus Extracellular protein SEL-1 and related 97.66
PLN03098453 LPA1 LOW PSII ACCUMULATION1; Provisional 97.63
PRK15331165 chaperone protein SicA; Provisional 97.62
COG1729262 Uncharacterized protein conserved in bacteria [Fun 97.6
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.58
COG4235287 Cytochrome c biogenesis factor [Posttranslational 97.57
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 97.57
KOG4648536 consensus Uncharacterized conserved protein, conta 97.57
PF13512142 TPR_18: Tetratricopeptide repeat 97.57
PF08631278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 97.56
PRK11906458 transcriptional regulator; Provisional 97.54
COG4235287 Cytochrome c biogenesis factor [Posttranslational 97.54
COG3898531 Uncharacterized membrane-bound protein [Function u 97.54
KOG1463411 consensus 26S proteasome regulatory complex, subun 97.53
PRK11906458 transcriptional regulator; Provisional 97.53
COG4700251 Uncharacterized protein conserved in bacteria cont 97.52
KOG4234271 consensus TPR repeat-containing protein [General f 97.51
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 97.51
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 97.48
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 97.45
PLN03098453 LPA1 LOW PSII ACCUMULATION1; Provisional 97.43
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 97.43
KOG2610491 consensus Uncharacterized conserved protein [Funct 97.42
KOG2796366 consensus Uncharacterized conserved protein [Funct 97.4
PF13512142 TPR_18: Tetratricopeptide repeat 97.38
PF1337173 TPR_9: Tetratricopeptide repeat 97.38
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 97.34
KOG20411189 consensus WD40 repeat protein [General function pr 97.34
COG5159421 RPN6 26S proteasome regulatory complex component [ 97.33
KOG1463411 consensus 26S proteasome regulatory complex, subun 97.33
KOG1550552 consensus Extracellular protein SEL-1 and related 97.31
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 97.29
COG4700251 Uncharacterized protein conserved in bacteria cont 97.26
KOG4242553 consensus Predicted myosin-I-binding protein [Cell 97.25
PF1337173 TPR_9: Tetratricopeptide repeat 97.22
KOG09851666 consensus Vesicle coat protein clathrin, heavy cha 97.2
PF12968144 DUF3856: Domain of Unknown Function (DUF3856); Int 97.17
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 97.16
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 97.15
KOG3783546 consensus Uncharacterized conserved protein [Funct 97.14
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 97.12
KOG2796366 consensus Uncharacterized conserved protein [Funct 97.11
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.08
PF12968144 DUF3856: Domain of Unknown Function (DUF3856); Int 97.08
PF08631278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 97.06
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.04
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.01
PF1286294 Apc5: Anaphase-promoting complex subunit 5 96.98
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 96.98
KOG09851666 consensus Vesicle coat protein clathrin, heavy cha 96.95
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 96.93
KOG2053932 consensus Mitochondrial inheritance and actin cyto 96.91
KOG0551390 consensus Hsp90 co-chaperone CNS1 (contains TPR re 96.9
KOG18391236 consensus Uncharacterized protein CLU1/cluA/TIF31 96.89
PF04184539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 96.88
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 96.87
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 96.86
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 96.82
KOG4642284 consensus Chaperone-dependent E3 ubiquitin protein 96.82
COG2976207 Uncharacterized protein conserved in bacteria [Fun 96.82
KOG2123 388 consensus Uncharacterized conserved protein [Funct 96.77
KOG0545329 consensus Aryl-hydrocarbon receptor-interacting pr 96.71
KOG18391236 consensus Uncharacterized protein CLU1/cluA/TIF31 96.71
KOG2053932 consensus Mitochondrial inheritance and actin cyto 96.7
KOG3783546 consensus Uncharacterized conserved protein [Funct 96.68
PF06552186 TOM20_plant: Plant specific mitochondrial import r 96.65
COG0790292 FOG: TPR repeat, SEL1 subfamily [General function 96.65
KOG2123388 consensus Uncharacterized conserved protein [Funct 96.62
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 96.59
PF09986214 DUF2225: Uncharacterized protein conserved in bact 96.57
KOG4322482 consensus Anaphase-promoting complex (APC), subuni 96.57
PF07079549 DUF1347: Protein of unknown function (DUF1347); In 96.57
PF04184539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 96.54
COG2976207 Uncharacterized protein conserved in bacteria [Fun 96.5
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 96.49
PF1286294 Apc5: Anaphase-promoting complex subunit 5 96.43
PF09986214 DUF2225: Uncharacterized protein conserved in bact 96.37
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 96.34
PF06552186 TOM20_plant: Plant specific mitochondrial import r 96.29
KOG0551390 consensus Hsp90 co-chaperone CNS1 (contains TPR re 96.26
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 96.25
PF02259352 FAT: FAT domain; InterPro: IPR003151 The FAT domai 96.23
KOG4642284 consensus Chaperone-dependent E3 ubiquitin protein 96.21
smart0036828 LRR_RI Leucine rich repeat, ribonuclease inhibitor 96.16
PF11817247 Foie-gras_1: Foie gras liver health family 1; Inte 96.08
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 96.03
PRK15386 426 type III secretion protein GogB; Provisional 96.0
smart0036828 LRR_RI Leucine rich repeat, ribonuclease inhibitor 95.92
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 95.82
PF02259352 FAT: FAT domain; InterPro: IPR003151 The FAT domai 95.8
PRK15386426 type III secretion protein GogB; Provisional 95.76
KOG08902382 consensus Protein kinase of the PI-3 kinase family 95.75
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 95.75
KOG15381081 consensus Uncharacterized conserved protein WDR10, 95.67
PF1342844 TPR_14: Tetratricopeptide repeat 95.63
PF1342844 TPR_14: Tetratricopeptide repeat 95.61
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 95.61
KOG0545329 consensus Aryl-hydrocarbon receptor-interacting pr 95.58
PF03704146 BTAD: Bacterial transcriptional activator domain; 95.57
COG0790292 FOG: TPR repeat, SEL1 subfamily [General function 95.56
PF1343134 TPR_17: Tetratricopeptide repeat 95.52
PRK13184932 pknD serine/threonine-protein kinase; Reviewed 95.5
PF13281374 DUF4071: Domain of unknown function (DUF4071) 95.44
KOG3864221 consensus Uncharacterized conserved protein [Funct 95.37
KOG4507886 consensus Uncharacterized conserved protein, conta 95.37
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 95.29
PF03704146 BTAD: Bacterial transcriptional activator domain; 95.28
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 95.26
KOG2610491 consensus Uncharacterized conserved protein [Funct 95.26
PF13281374 DUF4071: Domain of unknown function (DUF4071) 95.19
PF11817247 Foie-gras_1: Foie gras liver health family 1; Inte 95.17
PF05843280 Suf: Suppressor of forked protein (Suf); InterPro: 95.15
KOG3864221 consensus Uncharacterized conserved protein [Funct 95.09
KOG0376476 consensus Serine-threonine phosphatase 2A, catalyt 95.01
PRK13184932 pknD serine/threonine-protein kinase; Reviewed 94.89
PF1343134 TPR_17: Tetratricopeptide repeat 94.86
KOG3735353 consensus Tropomodulin and leiomodulin [Cytoskelet 94.57
KOG1308377 consensus Hsp70-interacting protein Hip/Transient 94.46
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 94.45
KOG4014248 consensus Uncharacterized conserved protein (conta 94.41
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 94.34
KOG4322482 consensus Anaphase-promoting complex (APC), subuni 94.33
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 94.15
KOG08902382 consensus Protein kinase of the PI-3 kinase family 94.03
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 93.99
KOG4014248 consensus Uncharacterized conserved protein (conta 93.96
COG5187412 RPN7 26S proteasome regulatory complex component, 93.91
KOG4814872 consensus Uncharacterized conserved protein [Funct 93.85
PF05843280 Suf: Suppressor of forked protein (Suf); InterPro: 93.82
KOG2581493 consensus 26S proteasome regulatory complex, subun 93.74
PF1057980 Rapsyn_N: Rapsyn N-terminal myristoylation and lin 93.61
KOG0376476 consensus Serine-threonine phosphatase 2A, catalyt 93.6
PF1057980 Rapsyn_N: Rapsyn N-terminal myristoylation and lin 93.56
KOG3735353 consensus Tropomodulin and leiomodulin [Cytoskelet 93.5
KOG0687393 consensus 26S proteasome regulatory complex, subun 93.04
KOG0687393 consensus 26S proteasome regulatory complex, subun 92.94
PF00244236 14-3-3: 14-3-3 protein; InterPro: IPR023410 The 14 92.83
KOG15381081 consensus Uncharacterized conserved protein WDR10, 92.65
PF12739414 TRAPPC-Trs85: ER-Golgi trafficking TRAPP I complex 92.33
KOG2581493 consensus 26S proteasome regulatory complex, subun 92.17
KOG2114933 consensus Vacuolar assembly/sorting protein PEP5/V 92.16
KOG2114933 consensus Vacuolar assembly/sorting protein PEP5/V 92.05
COG5187412 RPN7 26S proteasome regulatory complex component, 92.0
KOG1308377 consensus Hsp70-interacting protein Hip/Transient 91.93
PF1317433 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ 91.82
PF1317433 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ 91.8
PF086261185 TRAPPC9-Trs120: Transport protein Trs120 or TRAPPC 91.75
KOG1497399 consensus COP9 signalosome, subunit CSN4 [Posttran 91.55
COG3118304 Thioredoxin domain-containing protein [Posttransla 91.32
KOG4814872 consensus Uncharacterized conserved protein [Funct 91.06
PF12739414 TRAPPC-Trs85: ER-Golgi trafficking TRAPP I complex 90.86
PF1051638 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetrat 90.49
KOG19201265 consensus IkappaB kinase complex, IKAP component [ 89.79
PF11207203 DUF2989: Protein of unknown function (DUF2989); In 89.37
PF00244236 14-3-3: 14-3-3 protein; InterPro: IPR023410 The 14 89.17
smart0002834 TPR Tetratricopeptide repeats. Repeats present in 89.16
PF04781111 DUF627: Protein of unknown function (DUF627); Inte 88.96
KOG1914656 consensus mRNA cleavage and polyadenylation factor 88.82
PF04910360 Tcf25: Transcriptional repressor TCF25; InterPro: 88.82
PF086261185 TRAPPC9-Trs120: Transport protein Trs120 or TRAPPC 88.73
PF11207203 DUF2989: Protein of unknown function (DUF2989); In 88.49
COG4649221 Uncharacterized protein conserved in bacteria [Fun 88.43
PF07079549 DUF1347: Protein of unknown function (DUF1347); In 88.36
PF1051638 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetrat 88.21
KOG0686466 consensus COP9 signalosome, subunit CSN1 [Posttran 87.69
smart0002834 TPR Tetratricopeptide repeats. Repeats present in 87.69
KOG4507886 consensus Uncharacterized conserved protein, conta 87.33
PF1485353 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repe 87.14
COG4649221 Uncharacterized protein conserved in bacteria [Fun 86.83
COG3118304 Thioredoxin domain-containing protein [Posttransla 86.7
smart0036726 LRR_CC Leucine-rich repeat - CC (cysteine-containi 86.67
PF04910360 Tcf25: Transcriptional repressor TCF25; InterPro: 86.52
smart00101244 14_3_3 14-3-3 homologues. 14-3-3 homologues mediat 86.49
cd0268075 MIT_calpain7_2 MIT: domain contained within Microt 86.39
KOG0686466 consensus COP9 signalosome, subunit CSN1 [Posttran 86.35
smart0036726 LRR_CC Leucine-rich repeat - CC (cysteine-containi 85.91
PF04781111 DUF627: Protein of unknown function (DUF627); Inte 85.82
cd0268275 MIT_AAA_Arch MIT: domain contained within Microtub 85.22
COG3014449 Uncharacterized protein conserved in bacteria [Fun 85.21
PF04190260 DUF410: Protein of unknown function (DUF410) ; Int 85.16
PF15015569 NYD-SP12_N: Spermatogenesis-associated, N-terminal 84.74
PF04190260 DUF410: Protein of unknown function (DUF410) ; Int 84.45
PF08424321 NRDE-2: NRDE-2, necessary for RNA interference; In 84.33
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 84.04
PF1485353 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repe 83.69
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 82.48
KOG1914656 consensus mRNA cleavage and polyadenylation factor 81.74
COG5107660 RNA14 Pre-mRNA 3'-end processing (cleavage and pol 81.68
PF10952140 DUF2753: Protein of unknown function (DUF2753); In 81.67
PRK10941269 hypothetical protein; Provisional 81.53
PF05053618 Menin: Menin; InterPro: IPR007747 MEN1, the gene r 81.32
KOG3824472 consensus Huntingtin interacting protein HYPE [Gen 81.07
KOG0128881 consensus RNA-binding protein SART3 (RRM superfami 80.89
cd09034345 BRO1_Alix_like Protein-interacting Bro1-like domai 80.65
PF10952140 DUF2753: Protein of unknown function (DUF2753); In 80.14
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
Probab=100.00  E-value=2.9e-34  Score=316.19  Aligned_cols=358  Identities=20%  Similarity=0.239  Sum_probs=181.0

Q ss_pred             hhhHHHHHHHHHHHHHhcCcHHHHHHHHHHHHHHHHhCCHHHHHHHHHHHHHHHHhhCCCCCchhHHHHHHHHHHHccCh
Q 000742            5 EMQMSEAKRAYRSAKEEGNRQEEARWANVIGDILKNRGEYVEALKWFRIDYDVSVKYLPEKHLLPTCQSLGEVYLRLEHF   84 (1313)
Q Consensus         5 ~~~~~~A~~~l~~a~~~~~~~~~a~~~~~lg~~y~~~g~~~eAl~~~~~al~~~~~~~~~~~~~~~~~~lg~~y~~~g~~   84 (1313)
                      .|+++.|+..|+.+++.+|...++  |.++|.++...|+.+.|...|.+|+++.      ++..-+...+|..+..+|+.
T Consensus       129 rg~~~~al~~y~~aiel~p~fida--~inla~al~~~~~~~~a~~~~~~alqln------P~l~ca~s~lgnLlka~Grl  200 (966)
T KOG4626|consen  129 RGQLQDALALYRAAIELKPKFIDA--YINLAAALVTQGDLELAVQCFFEALQLN------PDLYCARSDLGNLLKAEGRL  200 (966)
T ss_pred             hchHHHHHHHHHHHHhcCchhhHH--HhhHHHHHHhcCCCcccHHHHHHHHhcC------cchhhhhcchhHHHHhhccc
Confidence            344455555555555555444444  4455555555555555555555554444      22244444455555555555


Q ss_pred             HHHHHHHHHHHHHHHHHhcCHHHHHHHHHHHHHHHHHHhccCCcchhhHHHHHHHHHHHHHHHHHhccCCCCCcchhhHH
Q 000742           85 KDALIYQVKKHLELAKDASDLVEQQRACTQLGRTYYEMFLRSDDDHYSIRNAKKYFKSAMKLAQTLKENPATSRSSFLKE  164 (1313)
Q Consensus        85 ~~A~~~~~~kal~l~~~~~~~~~~a~a~~~lg~~y~~l~~~~~~~~~~~~~A~~~~~~Al~l~~~~~~~~~~~~~~~~p~  164 (1313)
                      .+|...| .+|++..|..      +.+|.++|-++...        |+...|+++|++|+++               .|.
T Consensus       201 ~ea~~cY-lkAi~~qp~f------AiawsnLg~~f~~~--------Gei~~aiq~y~eAvkl---------------dP~  250 (966)
T KOG4626|consen  201 EEAKACY-LKAIETQPCF------AIAWSNLGCVFNAQ--------GEIWLAIQHYEEAVKL---------------DPN  250 (966)
T ss_pred             chhHHHH-HHHHhhCCce------eeeehhcchHHhhc--------chHHHHHHHHHHhhcC---------------CCc
Confidence            5555555 5555444322      23445555555444        5555555555555544               334


Q ss_pred             HHHHHHHHHHHHHHcCCHHHHHHHHHHHHhHhhhhccCCCchHHHHHHHHHHHHHHHcCCHHHHHHHHHHHHHHHHHhch
Q 000742          165 YIDAHNNIGMLQMELDNLEEAKKFLIRGLEICNEEEVSEDDDGRSRLHHNLGNVYMELRMWDKSREHIEQDIIICKKIEH  244 (1313)
Q Consensus       165 ~~~~~~~la~~y~~~g~~~~A~~~~~~al~~~~~~~~~~~~~~~~~~~~~lg~~y~~~g~~~~A~~~~~kal~~~~~~~~  244 (1313)
                      ++.+|.++|.+|...+.|++|+..|.+|+.+         .+..+.++-++|.+|+.+|..+-|+..|++|+++.+    
T Consensus       251 f~dAYiNLGnV~ke~~~~d~Avs~Y~rAl~l---------rpn~A~a~gNla~iYyeqG~ldlAI~~Ykral~~~P----  317 (966)
T KOG4626|consen  251 FLDAYINLGNVYKEARIFDRAVSCYLRALNL---------RPNHAVAHGNLACIYYEQGLLDLAIDTYKRALELQP----  317 (966)
T ss_pred             chHHHhhHHHHHHHHhcchHHHHHHHHHHhc---------CCcchhhccceEEEEeccccHHHHHHHHHHHHhcCC----
Confidence            4555555555555555555555555555544         333445555555555555555555555555555533    


Q ss_pred             hhhHHHHHHHHHHHHHHhcCHHHHHHHHHHHHHHHHHccChhHHHHHHHHhHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q 000742          245 CQGEAKGYINLGELHYRVQKYDEAILCYQKALNLAQSMEDEDALASQIDQNIETVKKAIEVMDELKKEEQNLKKLTRNMI  324 (1313)
Q Consensus       245 ~~~~~~~~~~la~~~~~~g~~~~A~~~~~kal~~~~~~~~~~~~~~~~~~~lg~~~~a~~~~~~a~~~~~~~~~l~~~l~  324 (1313)
                        ....+|.++|.++...|+..+|..+|.+|+.+.+...+....++.+|...|.+..|...|.++.+..+..        
T Consensus       318 --~F~~Ay~NlanALkd~G~V~ea~~cYnkaL~l~p~hadam~NLgni~~E~~~~e~A~~ly~~al~v~p~~--------  387 (966)
T KOG4626|consen  318 --NFPDAYNNLANALKDKGSVTEAVDCYNKALRLCPNHADAMNNLGNIYREQGKIEEATRLYLKALEVFPEF--------  387 (966)
T ss_pred             --CchHHHhHHHHHHHhccchHHHHHHHHHHHHhCCccHHHHHHHHHHHHHhccchHHHHHHHHHHhhChhh--------
Confidence              4445555555555555555555555555555555444433333333333333333333333322211111        


Q ss_pred             HhhCCchHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhCCchhhHHHHHHHHHHHHHhhCHHHHHHHHH
Q 000742          325 IAKGTSQERKYLLQQNASLDRLIEKSSMIFAWLKHCEYAKRKKRIASELCDKGKLSDSFLVIGESYQKLRKFNKAIKWYT  404 (1313)
Q Consensus       325 ~~~~~~~~a~~~~~~~~~l~~L~~~~~~~~~~~~A~~~~~~a~~i~~~~~~~~~~a~~~~~lg~~y~~~g~~~~A~~~~~  404 (1313)
                                     +....+|+..|...+++++|+..|++++.|.      |..+++|.++|..|..+|+.+.|+..|.
T Consensus       388 ---------------aaa~nNLa~i~kqqgnl~~Ai~~YkealrI~------P~fAda~~NmGnt~ke~g~v~~A~q~y~  446 (966)
T KOG4626|consen  388 ---------------AAAHNNLASIYKQQGNLDDAIMCYKEALRIK------PTFADALSNMGNTYKEMGDVSAAIQCYT  446 (966)
T ss_pred             ---------------hhhhhhHHHHHHhcccHHHHHHHHHHHHhcC------chHHHHHHhcchHHHHhhhHHHHHHHHH
Confidence                           1224555666666666666666666665543      3344666666666666666666666666


Q ss_pred             HHHHHHHHhCCchhHHHHHHHHHHHHHHcCCHHHHHHHHHHHHHHH
Q 000742          405 KSWEMYKSIGNLEGQALAKVNMGNVLDSNGDWAGALDAFQEGYRIA  450 (1313)
Q Consensus       405 kal~l~~~~~~~~~~~~~~~~lg~~y~~~g~~~~A~~~~~kAl~i~  450 (1313)
                      +|+.+.+      ..+.++.++|.+|...|+..+|+..|++|+++.
T Consensus       447 rAI~~nP------t~AeAhsNLasi~kDsGni~~AI~sY~~aLklk  486 (966)
T KOG4626|consen  447 RAIQINP------TFAEAHSNLASIYKDSGNIPEAIQSYRTALKLK  486 (966)
T ss_pred             HHHhcCc------HHHHHHhhHHHHhhccCCcHHHHHHHHHHHccC
Confidence            6665533      445556666666666666666666666666553



>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>KOG2300 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>KOG2300 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>PF10345 Cohesin_load: Cohesin loading factor; InterPro: IPR019440 Cohesin loading factor is a conserved protein that has been characterised in fungi Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>PF10345 Cohesin_load: Cohesin loading factor; InterPro: IPR019440 Cohesin loading factor is a conserved protein that has been characterised in fungi Back     alignment and domain information
>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1586 consensus Protein required for fusion of vesicles in vesicular transport, alpha-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>KOG1586 consensus Protein required for fusion of vesicles in vesicular transport, alpha-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>KOG2471 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>COG2909 MalT ATP-dependent transcriptional regulator [Transcription] Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>KOG4234 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>KOG2471 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>COG2909 MalT ATP-dependent transcriptional regulator [Transcription] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG1464 consensus COP9 signalosome, subunit CSN2 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>COG5159 RPN6 26S proteasome regulatory complex component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG4242 consensus Predicted myosin-I-binding protein [Cell motility] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1464 consensus COP9 signalosome, subunit CSN2 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG1550 consensus Extracellular protein SEL-1 and related proteins [Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>KOG1463 consensus 26S proteasome regulatory complex, subunit RPN6/PSMD11 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>KOG4234 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>COG5159 RPN6 26S proteasome regulatory complex component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1463 consensus 26S proteasome regulatory complex, subunit RPN6/PSMD11 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1550 consensus Extracellular protein SEL-1 and related proteins [Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>KOG4242 consensus Predicted myosin-I-binding protein [Cell motility] Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF12968 DUF3856: Domain of Unknown Function (DUF3856); InterPro: IPR024552 This domain of unknown function is found in a small group of tetratricopeptide-like proteins, which includes the uncharacterised protein Q8KAL8 from SWISSPROT Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG3783 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>PF12968 DUF3856: Domain of Unknown Function (DUF3856); InterPro: IPR024552 This domain of unknown function is found in a small group of tetratricopeptide-like proteins, which includes the uncharacterised protein Q8KAL8 from SWISSPROT Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>PF12862 Apc5: Anaphase-promoting complex subunit 5 Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>KOG0551 consensus Hsp90 co-chaperone CNS1 (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1839 consensus Uncharacterized protein CLU1/cluA/TIF31 involved in mitochondrial morphology/distribution, also found associated with eIF-3 [General function prediction only] Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG4642 consensus Chaperone-dependent E3 ubiquitin protein ligase (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG2976 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0545 consensus Aryl-hydrocarbon receptor-interacting protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1839 consensus Uncharacterized protein CLU1/cluA/TIF31 involved in mitochondrial morphology/distribution, also found associated with eIF-3 [General function prediction only] Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>KOG3783 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins Back     alignment and domain information
>COG0790 FOG: TPR repeat, SEL1 subfamily [General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function Back     alignment and domain information
>KOG4322 consensus Anaphase-promoting complex (APC), subunit 5 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>COG2976 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>PF12862 Apc5: Anaphase-promoting complex subunit 5 Back     alignment and domain information
>PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins Back     alignment and domain information
>KOG0551 consensus Hsp90 co-chaperone CNS1 (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases Back     alignment and domain information
>KOG4642 consensus Chaperone-dependent E3 ubiquitin protein ligase (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00368 LRR_RI Leucine rich repeat, ribonuclease inhibitor type Back     alignment and domain information
>PF11817 Foie-gras_1: Foie gras liver health family 1; InterPro: IPR021773 Mutating the gene foie gras in zebrafish has been shown to affect development; the mutants develop large, lipid-filled hepatocytes in the liver, resembling those in individuals with fatty liver disease [] Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>smart00368 LRR_RI Leucine rich repeat, ribonuclease inhibitor type Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG0890 consensus Protein kinase of the PI-3 kinase family involved in mitotic growth, DNA repair and meiotic recombination [Signal transduction mechanisms; Chromatin structure and dynamics; Replication, recombination and repair; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>KOG0545 consensus Aryl-hydrocarbon receptor-interacting protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>COG0790 FOG: TPR repeat, SEL1 subfamily [General function prediction only] Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>PRK13184 pknD serine/threonine-protein kinase; Reviewed Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4507 consensus Uncharacterized conserved protein, contains TPR repeats [Function unknown] Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>PF11817 Foie-gras_1: Foie gras liver health family 1; InterPro: IPR021773 Mutating the gene foie gras in zebrafish has been shown to affect development; the mutants develop large, lipid-filled hepatocytes in the liver, resembling those in individuals with fatty liver disease [] Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0376 consensus Serine-threonine phosphatase 2A, catalytic subunit [General function prediction only] Back     alignment and domain information
>PRK13184 pknD serine/threonine-protein kinase; Reviewed Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>KOG3735 consensus Tropomodulin and leiomodulin [Cytoskeleton] Back     alignment and domain information
>KOG1308 consensus Hsp70-interacting protein Hip/Transient component of progesterone receptor complexes and an Hsp70-binding protein [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG4014 consensus Uncharacterized conserved protein (contains TPR repeat) [Function unknown] Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information
>KOG4322 consensus Anaphase-promoting complex (APC), subunit 5 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>KOG0890 consensus Protein kinase of the PI-3 kinase family involved in mitotic growth, DNA repair and meiotic recombination [Signal transduction mechanisms; Chromatin structure and dynamics; Replication, recombination and repair; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>KOG4014 consensus Uncharacterized conserved protein (contains TPR repeat) [Function unknown] Back     alignment and domain information
>COG5187 RPN7 26S proteasome regulatory complex component, contains PCI domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4814 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>KOG2581 consensus 26S proteasome regulatory complex, subunit RPN3/PSMD3 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF10579 Rapsyn_N: Rapsyn N-terminal myristoylation and linker region; InterPro: IPR019568 Neuromuscular junction formation relies upon the clustering of acetylcholine receptors and other proteins in the muscle membrane Back     alignment and domain information
>KOG0376 consensus Serine-threonine phosphatase 2A, catalytic subunit [General function prediction only] Back     alignment and domain information
>PF10579 Rapsyn_N: Rapsyn N-terminal myristoylation and linker region; InterPro: IPR019568 Neuromuscular junction formation relies upon the clustering of acetylcholine receptors and other proteins in the muscle membrane Back     alignment and domain information
>KOG3735 consensus Tropomodulin and leiomodulin [Cytoskeleton] Back     alignment and domain information
>KOG0687 consensus 26S proteasome regulatory complex, subunit RPN7/PSMD6 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0687 consensus 26S proteasome regulatory complex, subunit RPN7/PSMD6 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF00244 14-3-3: 14-3-3 protein; InterPro: IPR023410 The 14-3-3 proteins are a large family of approximately 30kDa acidic proteins which exist primarily as homo- and heterodimeric within all eukaryotic cells [, ] Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>PF12739 TRAPPC-Trs85: ER-Golgi trafficking TRAPP I complex 85 kDa subunit; InterPro: IPR024420 This entry represents Trs85, a subunit of the TRAPP III complex [] Back     alignment and domain information
>KOG2581 consensus 26S proteasome regulatory complex, subunit RPN3/PSMD3 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG5187 RPN7 26S proteasome regulatory complex component, contains PCI domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1308 consensus Hsp70-interacting protein Hip/Transient component of progesterone receptor complexes and an Hsp70-binding protein [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A Back     alignment and domain information
>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A Back     alignment and domain information
>PF08626 TRAPPC9-Trs120: Transport protein Trs120 or TRAPPC9, TRAPP II complex subunit; InterPro: IPR013935 The trafficking protein particle complex TRAPP is a multi-protein complex needed in the early stages of the secretory pathway Back     alignment and domain information
>KOG1497 consensus COP9 signalosome, subunit CSN4 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4814 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF12739 TRAPPC-Trs85: ER-Golgi trafficking TRAPP I complex 85 kDa subunit; InterPro: IPR024420 This entry represents Trs85, a subunit of the TRAPP III complex [] Back     alignment and domain information
>PF10516 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetratrico peptide repeat region (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information
>PF11207 DUF2989: Protein of unknown function (DUF2989); InterPro: IPR021372 Some members in this bacterial family of proteins are annotated as lipoproteins however this cannot be confirmed Back     alignment and domain information
>PF00244 14-3-3: 14-3-3 protein; InterPro: IPR023410 The 14-3-3 proteins are a large family of approximately 30kDa acidic proteins which exist primarily as homo- and heterodimeric within all eukaryotic cells [, ] Back     alignment and domain information
>smart00028 TPR Tetratricopeptide repeats Back     alignment and domain information
>PF04781 DUF627: Protein of unknown function (DUF627); InterPro: IPR006866 This domain represents the N-terminal region of several plant proteins of unknown function Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>PF04910 Tcf25: Transcriptional repressor TCF25; InterPro: IPR006994 This entry appears to represent a novel family of basic helix-loop-helix (bHLH) proteins that control differentiation and development of a variety of organs [, ] Back     alignment and domain information
>PF08626 TRAPPC9-Trs120: Transport protein Trs120 or TRAPPC9, TRAPP II complex subunit; InterPro: IPR013935 The trafficking protein particle complex TRAPP is a multi-protein complex needed in the early stages of the secretory pathway Back     alignment and domain information
>PF11207 DUF2989: Protein of unknown function (DUF2989); InterPro: IPR021372 Some members in this bacterial family of proteins are annotated as lipoproteins however this cannot be confirmed Back     alignment and domain information
>COG4649 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>PF10516 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetratrico peptide repeat region (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>KOG0686 consensus COP9 signalosome, subunit CSN1 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>smart00028 TPR Tetratricopeptide repeats Back     alignment and domain information
>KOG4507 consensus Uncharacterized conserved protein, contains TPR repeats [Function unknown] Back     alignment and domain information
>PF14853 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repeat; PDB: 1IYG_A 1PC2_A 1NZN_A 3UUX_C 1Y8M_A 2PQR_A 2PQN_A 3O48_A Back     alignment and domain information
>COG4649 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily Back     alignment and domain information
>PF04910 Tcf25: Transcriptional repressor TCF25; InterPro: IPR006994 This entry appears to represent a novel family of basic helix-loop-helix (bHLH) proteins that control differentiation and development of a variety of organs [, ] Back     alignment and domain information
>smart00101 14_3_3 14-3-3 homologues Back     alignment and domain information
>cd02680 MIT_calpain7_2 MIT: domain contained within Microtubule Interacting and Trafficking molecules Back     alignment and domain information
>KOG0686 consensus COP9 signalosome, subunit CSN1 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily Back     alignment and domain information
>PF04781 DUF627: Protein of unknown function (DUF627); InterPro: IPR006866 This domain represents the N-terminal region of several plant proteins of unknown function Back     alignment and domain information
>cd02682 MIT_AAA_Arch MIT: domain contained within Microtubule Interacting and Trafficking molecules Back     alignment and domain information
>COG3014 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF04190 DUF410: Protein of unknown function (DUF410) ; InterPro: IPR007317 This is a family of conserved eukaryotic proteins with undetermined function Back     alignment and domain information
>PF15015 NYD-SP12_N: Spermatogenesis-associated, N-terminal Back     alignment and domain information
>PF04190 DUF410: Protein of unknown function (DUF410) ; InterPro: IPR007317 This is a family of conserved eukaryotic proteins with undetermined function Back     alignment and domain information
>PF08424 NRDE-2: NRDE-2, necessary for RNA interference; InterPro: IPR013633 This is domain is found in eukaryotic proteins of unknown function Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF14853 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repeat; PDB: 1IYG_A 1PC2_A 1NZN_A 3UUX_C 1Y8M_A 2PQR_A 2PQN_A 3O48_A Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] Back     alignment and domain information
>PF10952 DUF2753: Protein of unknown function (DUF2753); InterPro: IPR020206 This entry represents a group of uncharacterised proteins Back     alignment and domain information
>PRK10941 hypothetical protein; Provisional Back     alignment and domain information
>PF05053 Menin: Menin; InterPro: IPR007747 MEN1, the gene responsible for multiple endocrine neoplasia type 1, is a tumour suppressor gene that encodes a protein called Menin which may be an atypical GTPase stimulated by nm23 [] Back     alignment and domain information
>KOG3824 consensus Huntingtin interacting protein HYPE [General function prediction only] Back     alignment and domain information
>KOG0128 consensus RNA-binding protein SART3 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>cd09034 BRO1_Alix_like Protein-interacting Bro1-like domain of mammalian Alix and related domains Back     alignment and domain information
>PF10952 DUF2753: Protein of unknown function (DUF2753); InterPro: IPR020206 This entry represents a group of uncharacterised proteins Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1313
3tsr_E457 X-Ray Structure Of Mouse Ribonuclease Inhibitor Com 6e-08
3sf4_A406 Crystal Structure Of The Complex Between The Conser 5e-07
3sf4_A406 Crystal Structure Of The Complex Between The Conser 1e-06
2bnh_A457 Porcine Ribonuclease Inhibitor Length = 457 1e-06
4g2v_A340 Structure Complex Of Lgn Binding With Frmpd1 Length 3e-06
4g2v_A340 Structure Complex Of Lgn Binding With Frmpd1 Length 1e-05
3ro2_A338 Structures Of The LgnNUMA COMPLEX Length = 338 3e-06
3ro2_A338 Structures Of The LgnNUMA COMPLEX Length = 338 2e-05
4a1s_A411 Crystallographic Structure Of The Pins:insc Complex 4e-06
1a4y_A460 Ribonuclease Inhibitor-Angiogenin Complex Length = 9e-06
1z7x_W461 X-Ray Structure Of Human Ribonuclease Inhibitor Com 1e-05
3ro3_A164 Crystal Structure Of LgnMINSCUTEABLE COMPLEX Length 1e-04
1na0_A125 Design Of Stable Alpha-Helical Arrays From An Ideal 4e-04
2fo7_A136 Crystal Structure Of An 8 Repeat Consensus Tpr Supe 5e-04
2wqh_A125 Crystal Structure Of Ctpr3y3 Length = 125 6e-04
>pdb|3TSR|E Chain E, X-Ray Structure Of Mouse Ribonuclease Inhibitor Complexed With Mouse Ribonuclease 1 Length = 457 Back     alignment and structure

Iteration: 1

Score = 44.7 bits (104), Expect = 3e-04, Method: Compositional matrix adjust. Identities = 67/254 (26%), Positives = 105/254 (41%), Gaps = 34/254 (13%) Query: 922 LNLSGNRLTDACGSYLSTILKN--CKVLYSLNIENCSITSRTIQKVADALGAESTLAQLC 979 L+L N L D + L+N CK+ L+++NC +T + L + STL +L Sbjct: 57 LSLRTNELGDGGVGLVLQGLQNPTCKI-QKLSLQNCGLTEAGCGILPGMLRSLSTLRELH 115 Query: 980 IGYNSPVTGNAITNLLVKLDTLKSFSELNLNGLKLSKPVVDRL----CQLAKTSC----- 1030 + N G+A LL + GL+ + +++L C L TSC Sbjct: 116 LNDNP--MGDAGLKLLCE-------------GLQDPQCRLEKLQLEYCNLTATSCEPLAS 160 Query: 1031 -------LTHLMLGCTNLGSDGSLQLVESLFSRAQESVKLDLSYCGLESTCIHKFTASVS 1083 L+L +L G L + L A + L L CG+ + V+ Sbjct: 161 VLRVKADFKELVLSNNDLHEPGVRILCQGLKDSACQLESLKLENCGITAANCKDLCDVVA 220 Query: 1084 LVHGILELNLGGNPIMKEGANALASLLMNPQCCLKVLVLSKCQLGLAGVLQLIKALSEND 1143 + EL+L N + G AL L+ P C L+ L L +C + G L + L Sbjct: 221 SKASLQELDLSSNKLGNAGIAALCPGLLLPSCKLRTLWLWECDITAEGCKDLCRVLRAKQ 280 Query: 1144 TLEELNLADNASKE 1157 +L+EL+LA N K+ Sbjct: 281 SLKELSLASNELKD 294
>pdb|3SF4|A Chain A, Crystal Structure Of The Complex Between The Conserved Cell Polarity Proteins Inscuteable And Lgn Length = 406 Back     alignment and structure
>pdb|3SF4|A Chain A, Crystal Structure Of The Complex Between The Conserved Cell Polarity Proteins Inscuteable And Lgn Length = 406 Back     alignment and structure
>pdb|2BNH|A Chain A, Porcine Ribonuclease Inhibitor Length = 457 Back     alignment and structure
>pdb|4G2V|A Chain A, Structure Complex Of Lgn Binding With Frmpd1 Length = 340 Back     alignment and structure
>pdb|4G2V|A Chain A, Structure Complex Of Lgn Binding With Frmpd1 Length = 340 Back     alignment and structure
>pdb|3RO2|A Chain A, Structures Of The LgnNUMA COMPLEX Length = 338 Back     alignment and structure
>pdb|3RO2|A Chain A, Structures Of The LgnNUMA COMPLEX Length = 338 Back     alignment and structure
>pdb|4A1S|A Chain A, Crystallographic Structure Of The Pins:insc Complex Length = 411 Back     alignment and structure
>pdb|1A4Y|A Chain A, Ribonuclease Inhibitor-Angiogenin Complex Length = 460 Back     alignment and structure
>pdb|1Z7X|W Chain W, X-Ray Structure Of Human Ribonuclease Inhibitor Complexed With Ribonuclease I Length = 461 Back     alignment and structure
>pdb|3RO3|A Chain A, Crystal Structure Of LgnMINSCUTEABLE COMPLEX Length = 164 Back     alignment and structure
>pdb|1NA0|A Chain A, Design Of Stable Alpha-Helical Arrays From An Idealized Tpr Motif Length = 125 Back     alignment and structure
>pdb|2FO7|A Chain A, Crystal Structure Of An 8 Repeat Consensus Tpr Superhelix (Trigonal Crystal Form) Length = 136 Back     alignment and structure
>pdb|2WQH|A Chain A, Crystal Structure Of Ctpr3y3 Length = 125 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1313
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 6e-43
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 7e-37
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 2e-36
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 1e-34
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 4e-34
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 6e-31
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 5e-16
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 3e-11
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 2e-06
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 1e-05
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 9e-34
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 2e-30
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 3e-30
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 1e-29
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 3e-16
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 4e-12
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 8e-09
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 6e-08
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 3e-05
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 1e-33
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 1e-30
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 1e-30
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 6e-28
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 1e-26
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 8e-23
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 2e-09
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 2e-31
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 2e-30
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 1e-29
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 4e-25
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 2e-20
3goz_A 362 Leucine-rich repeat-containing protein; LEGL7, NES 5e-11
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 4e-30
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 2e-23
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 6e-17
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 3e-16
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 4e-14
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 7e-13
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 4e-12
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 2e-09
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 6e-30
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 7e-25
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 6e-19
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 4e-10
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 1e-06
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 5e-28
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 3e-26
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 2e-24
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 2e-13
2ca6_A 386 RAN GTPase-activating protein 1; GAP, GTPase activ 3e-05
3q15_A378 PSP28, response regulator aspartate phosphatase H; 2e-26
3q15_A378 PSP28, response regulator aspartate phosphatase H; 2e-23
3q15_A378 PSP28, response regulator aspartate phosphatase H; 4e-21
3q15_A378 PSP28, response regulator aspartate phosphatase H; 5e-11
3q15_A378 PSP28, response regulator aspartate phosphatase H; 8e-10
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 2e-24
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 9e-21
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 3e-24
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 6e-21
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 3e-15
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 3e-14
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 8e-11
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 1e-10
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 1e-10
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 4e-10
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 2e-09
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 9e-04
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 5e-19
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 8e-16
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 4e-12
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 7e-06
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 8e-06
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 3e-05
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 8e-19
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 3e-10
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 2e-07
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 1e-18
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 2e-12
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 3e-12
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 2e-11
4g1t_A472 Interferon-induced protein with tetratricopeptide 3e-18
4g1t_A472 Interferon-induced protein with tetratricopeptide 3e-15
4g1t_A472 Interferon-induced protein with tetratricopeptide 5e-06
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 2e-17
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 3e-14
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 2e-13
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 1e-10
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 6e-17
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 7e-17
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 1e-16
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 6e-16
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 1e-14
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 5e-06
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 4e-05
2gw1_A514 Mitochondrial precursor proteins import receptor; 5e-16
2gw1_A514 Mitochondrial precursor proteins import receptor; 1e-14
2gw1_A514 Mitochondrial precursor proteins import receptor; 1e-14
2gw1_A514 Mitochondrial precursor proteins import receptor; 1e-13
2gw1_A514 Mitochondrial precursor proteins import receptor; 1e-12
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 5e-15
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 1e-04
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 7e-15
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 2e-13
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 9e-13
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 2e-12
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 2e-11
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 2e-14
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 2e-13
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 3e-13
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 5e-14
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 5e-13
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 2e-11
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 8e-04
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 7e-14
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 5e-13
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 1e-11
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 2e-05
4eqf_A365 PEX5-related protein; accessory protein, tetratric 1e-13
4eqf_A365 PEX5-related protein; accessory protein, tetratric 2e-10
4eqf_A365 PEX5-related protein; accessory protein, tetratric 4e-10
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 1e-13
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 7e-12
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 3e-10
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 1e-13
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 3e-13
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 2e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-13
1vt4_I1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-13
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-11
1vt4_I1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-07
1vt4_I1221 APAF-1 related killer DARK; drosophila apoptosome, 8e-06
3u4t_A272 TPR repeat-containing protein; structural genomics 3e-13
3u4t_A272 TPR repeat-containing protein; structural genomics 1e-12
3u4t_A272 TPR repeat-containing protein; structural genomics 2e-12
3u4t_A272 TPR repeat-containing protein; structural genomics 2e-12
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 4e-13
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 3e-08
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 6e-13
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 2e-10
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 1e-08
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 6e-05
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 2e-12
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 3e-06
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 3e-12
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 2e-10
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 1e-09
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 9e-08
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 9e-04
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 5e-12
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 6e-12
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 5e-10
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 6e-12
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 9e-11
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 1e-08
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 2e-06
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 7e-05
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 6e-12
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 9e-11
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 7e-06
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 7e-12
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 7e-12
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 5e-11
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 1e-10
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 7e-12
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 6e-10
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 4e-09
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 1e-11
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 3e-10
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-11
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-10
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-10
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 3e-08
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-06
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 4e-11
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 4e-07
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 3e-05
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 5e-11
2vsy_A568 XCC0866; transferase, glycosyl transferase, GT-B, 5e-11
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 1e-10
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 5e-10
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 6e-10
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 1e-10
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 2e-10
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 2e-07
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 1e-10
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 2e-10
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 5e-10
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 1e-07
3ugm_A1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 2e-10
3ugm_A1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 2e-08
3ugm_A1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 1e-07
3ugm_A1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 2e-07
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-10
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 4e-09
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-08
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 4e-04
3tax_A723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 2e-10
3tax_A723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 2e-08
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-10
4fmz_A347 Internalin; leucine rich repeat, structural genomi 6e-08
4fmz_A347 Internalin; leucine rich repeat, structural genomi 4e-04
4fmz_A347 Internalin; leucine rich repeat, structural genomi 7e-04
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 2e-10
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 6e-09
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 5e-10
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-07
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 7e-07
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-04
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 6e-10
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 2e-09
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 1e-04
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 7e-10
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 4e-09
2kat_A115 Uncharacterized protein; NESG, structure, structur 2e-09
2kat_A115 Uncharacterized protein; NESG, structure, structur 1e-04
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-09
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-08
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 3e-07
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-09
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-09
1o6v_A466 Internalin A; bacterial infection, extracellular r 7e-09
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 4e-09
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 2e-06
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 4e-06
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 1e-04
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 7e-09
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 1e-08
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 2e-08
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 1e-07
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 7e-09
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 4e-06
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 7e-04
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 8e-09
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 4e-08
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 5e-08
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 5e-08
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 3e-07
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 1e-05
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 7e-05
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 9e-09
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 7e-08
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-07
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-06
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-08
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-08
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 7e-08
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 7e-07
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-06
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-04
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-04
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 4e-08
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 5e-08
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 6e-08
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 1e-04
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 9e-08
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 9e-08
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-07
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-06
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-05
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 2e-07
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 3e-04
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-06
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 2e-06
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 2e-06
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 2e-06
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-06
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-04
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 2e-06
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 5e-05
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 3e-06
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 3e-06
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 4e-06
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 4e-06
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 2e-04
3q49_B137 STIP1 homology and U box-containing protein 1; E3 7e-06
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 8e-06
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 8e-06
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 9e-06
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 4e-05
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 1e-05
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-05
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-04
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-05
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 2e-05
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-05
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 2e-05
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 3e-05
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 4e-05
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 3e-05
3k9i_A117 BH0479 protein; putative protein binding protein, 3e-05
3k9i_A117 BH0479 protein; putative protein binding protein, 3e-04
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 4e-05
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 4e-05
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 5e-05
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 6e-05
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 9e-05
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 1e-04
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-04
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 2e-04
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-04
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 2e-04
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 5e-04
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 2e-04
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 2e-04
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 4e-04
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 5e-04
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 5e-04
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 6e-04
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
 Score =  162 bits (413), Expect = 6e-43
 Identities = 101/474 (21%), Positives = 164/474 (34%), Gaps = 64/474 (13%)

Query: 803  LMKLYIECCKELSEAPNMKLLKKLYISEVEDEVIVSECELQDISVTPLLNALHTHKTVAL 862
            +  L I+C + LS+A   +LL  L   +    V + +C L +     + +AL  +  +A 
Sbjct: 5    IQSLDIQCEE-LSDARWAELLPLLQQCQ---VVRLDDCGLTEARCKDISSALRVNPALAE 60

Query: 863  LDLSHNLLGNGTMEKLQQFFISSCQNYVDLTLDLHCNRFGPTTLFQICECPVLFTRLGVL 922
            L+L  N LG+  +  + Q   +         L L            +         L  L
Sbjct: 61   LNLRSNELGDVGVHCVLQGLQTPSCKI--QKLSLQNCCLTGAGCGVLSSTLRTLPTLQEL 118

Query: 923  NLSGNRLTDACGSYLST-ILKNCKVLYSLNIENCSITSRTIQKVADALGAESTLAQLCIG 981
            +LS N L DA    L   +L     L  L +E CS+++ + + +A  L A+    +L + 
Sbjct: 119  HLSDNLLGDAGLQLLCEGLLDPQCRLEKLQLEYCSLSAASCEPLASVLRAKPDFKELTVS 178

Query: 982  YNSPVTGNAITNLLVKL--DTLKSFSELNLNGLKLSKPVVDRLCQ-LAKTSCLTHLMLGC 1038
             N      A   +L +   D+      L L    ++      LC  +A  + L  L LG 
Sbjct: 179  NNDI--NEAGVRVLCQGLKDSPCQLEALKLESCGVTSDNCRDLCGIVASKASLRELALGS 236

Query: 1039 TNLGSDGSLQLVESLFSRAQESVKLDLSYCGLESTCIHKFTASVSLVHGILELNLGGNPI 1098
              LG  G  +L   L   +     L +  CG+ +         +     + EL+L GN +
Sbjct: 237  NKLGDVGMAELCPGLLHPSSRLRTLWIWECGITAKGCGDLCRVLRAKESLKELSLAGNEL 296

Query: 1099 MKEGANALASLLMNPQCCLKVLVLSKCQLGLAGVLQLIKALSENDTLEELNLADNASKEL 1158
              EGA  L   L+ P C L+ L +  C    A        L++N  L EL +++N     
Sbjct: 297  GDEGARLLCETLLEPGCQLESLWVKSCSFTAACCSHFSSVLAQNRFLLELQISNN----- 351

Query: 1159 TLQQNLSSVNSENLQPALKTSDCVSKEVDTDQHGLFAMNTDCNDLEVADSEDDKIRVESA 1218
                 L       L   L     V + +                L               
Sbjct: 352  ----RLEDAGVRELCQGLGQPGSVLRVL---------------WLA-------------- 378

Query: 1219 ASGFDNSCTSSCQKNSSFECQFVQELSSAIGMAKPLQLLDLSNNGFSTQAVKTL 1272
                D   + S              L++ +     L+ LDLSNN      +  L
Sbjct: 379  ----DCDVSDSS----------CSSLAATLLANHSLRELDLSNNCLGDAGILQL 418


>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Length = 411 Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Length = 411 Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Length = 411 Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Length = 411 Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Length = 411 Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Length = 411 Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Length = 411 Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Length = 411 Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Length = 406 Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Length = 406 Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Length = 406 Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Length = 406 Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Length = 406 Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Length = 406 Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Length = 406 Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Length = 406 Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Length = 406 Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Length = 338 Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Length = 338 Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Length = 338 Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Length = 338 Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Length = 338 Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Length = 338 Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Length = 338 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Length = 203 Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Length = 203 Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Length = 203 Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Length = 203 Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Length = 203 Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Length = 203 Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Length = 203 Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Length = 203 Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Length = 383 Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Length = 383 Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Length = 383 Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Length = 383 Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Length = 383 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Length = 378 Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Length = 378 Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Length = 378 Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Length = 378 Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Length = 378 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Length = 164 Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Length = 164 Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Length = 164 Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Length = 164 Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Length = 164 Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Length = 164 Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Length = 164 Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Length = 164 Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Length = 164 Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Length = 164 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Length = 307 Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Length = 307 Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Length = 307 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Length = 252 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Length = 252 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Length = 252 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Length = 252 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Length = 208 Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Length = 208 Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Length = 208 Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Length = 311 Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Length = 311 Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Length = 311 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Length = 217 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Length = 217 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Length = 293 Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Length = 293 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Length = 225 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Length = 225 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Length = 225 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Length = 225 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Length = 225 Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Length = 283 Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Length = 283 Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Length = 283 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Length = 185 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Length = 185 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Length = 185 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Length = 185 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Length = 185 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Length = 142 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Length = 136 Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Length = 136 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Length = 125 Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Length = 568 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Length = 474 Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Length = 474 Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Length = 474 Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Length = 148 Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Length = 373 Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Length = 373 Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Length = 373 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3tax_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; thiocarbamate crosslink, covalent inhibitor, gylcosyltransfe inhibitor, O-GLCNAC transferase; HET: UDP; 1.88A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* Length = 723 Back     alignment and structure
>3tax_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; thiocarbamate crosslink, covalent inhibitor, gylcosyltransfe inhibitor, O-GLCNAC transferase; HET: UDP; 1.88A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* Length = 723 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Length = 213 Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Length = 213 Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Length = 115 Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Length = 115 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Length = 292 Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Length = 292 Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Length = 292 Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Length = 292 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Length = 197 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Length = 197 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Length = 197 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Length = 197 Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Length = 100 Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Length = 100 Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Length = 100 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Length = 127 Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Length = 112 Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Length = 112 Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Length = 131 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Length = 91 Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Length = 177 Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Length = 372 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Length = 121 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Length = 121 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Length = 291 Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Length = 198 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Length = 137 Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Length = 131 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Length = 336 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Length = 117 Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Length = 117 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Length = 281 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Length = 164 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Length = 159 Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Length = 162 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Length = 338 Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Length = 99 Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Length = 151 Back     alignment and structure

Structure Templates Detected by HHsearch ?

No hit with probability above 80.00


Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 1313
d1hz4a_366 a.118.8.2 (A:) Transcription factor MalT domain II 3e-17
d1hz4a_366 a.118.8.2 (A:) Transcription factor MalT domain II 1e-08
d1hz4a_366 a.118.8.2 (A:) Transcription factor MalT domain II 0.003
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 6e-15
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 8e-10
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 4e-04
d1ya0a1497 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [T 2e-10
d1ya0a1497 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [T 0.001
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 2e-09
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 6e-09
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 7e-09
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 3e-07
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 5e-07
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 4e-06
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 4e-06
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 1e-05
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 2e-05
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 4e-04
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.001
d2hr2a1156 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {C 5e-08
d1fcha_323 a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting 5e-08
d1fcha_323 a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting 7e-06
d1fcha_323 a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting 7e-06
d1qqea_290 a.118.8.1 (A:) Vesicular transport protein sec17 { 1e-07
d1qqea_290 a.118.8.1 (A:) Vesicular transport protein sec17 { 2e-07
d1qqea_290 a.118.8.1 (A:) Vesicular transport protein sec17 { 1e-06
d1qqea_290 a.118.8.1 (A:) Vesicular transport protein sec17 { 3e-06
d1xnfa_259 a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli 1e-06
d1xnfa_259 a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli 1e-05
d1xnfa_259 a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli 4e-05
d1elra_128 a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9 1e-05
d1kt1a1168 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {M 1e-05
d2c2la1201 a.118.8.1 (A:24-224) STIP1 homology and U box-cont 1e-05
d1dcea1334 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltr 2e-05
d1dcea1334 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltr 2e-05
d1hh8a_192 a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF- 1e-04
d1hh8a_192 a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF- 7e-04
d1zbpa1264 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {V 1e-04
d1zbpa1264 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {V 0.003
d1ihga1169 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos tau 1e-04
d1nzna_122 a.118.8.1 (A:) Mitochondria fission protein Fis1 { 4e-04
d1pgva_167 c.10.1.1 (A:) Tropomodulin C-terminal domain {nema 5e-04
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 9e-04
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 0.002
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 0.001
d2h6fa1315 a.118.6.1 (A:55-369) Protein farnesyltransferase a 0.002
d1ouva_265 a.118.18.1 (A:) Cysteine rich protein C (HcpC) {He 0.003
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 0.004
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Length = 366 Back     information, alignment and structure

class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Transcription factor MalT domain III
domain: Transcription factor MalT domain III
species: Escherichia coli [TaxId: 562]
 Score = 83.0 bits (203), Expect = 3e-17
 Identities = 35/344 (10%), Positives = 106/344 (30%), Gaps = 32/344 (9%)

Query: 7   QMSEAKRAYRSA---KEEGNRQEEARWANVIGDILKNRGEYVEALKWFRIDYDVSVKYLP 63
              EA+R  + A      G         +V+G++L  +GE   +L   +    ++ ++  
Sbjct: 27  NPDEAERLAKLALEELPPGWFYSRIVATSVLGEVLHCKGELTRSLALMQQTEQMARQHDV 86

Query: 64  EKHLLPTCQSLGEVYLRLEHFKDAL--------IYQVKKHLELAKDASDLVEQQRACTQL 115
             + L +     E+       + A         +   +   +L      +  + +     
Sbjct: 87  WHYALWSLIQQSEILFAQGFLQTAWETQEKAFQLINEQHLEQLPMHEFLVRIRAQLLWAW 146

Query: 116 GR-----TYYEMFLRSDDDHYSIRNAKKYFKSAMKLAQTLKENPATSRSSFLKEYI---- 166
            R           +     +   +  +               + A S+ + L+  +    
Sbjct: 147 ARLDEAEASARSGIEVLSSYQPQQQLQCLAMLIQCSLARGDLDNARSQLNRLENLLGNGK 206

Query: 167 -------DAHNNIGMLQMELDNLEEAKKFLIRGLEICNEEEVSEDDDGRSRLHHNLGNVY 219
                  +A+    +      +   A  +L    +         ++        N+    
Sbjct: 207 YHSDWISNANKVRVIYWQMTGDKAAAANWLRHTAKPEFA-----NNHFLQGQWRNIARAQ 261

Query: 220 MELRMWDKSREHIEQDIIICKKIEHCQGEAKGYINLGELHYRVQKYDEAILCYQKALNLA 279
           + L  ++ +   +E+     + +       +  + L +L+++  +  +A      AL LA
Sbjct: 262 ILLGEFEPAEIVLEELNENARSLRLMSDLNRNLLLLNQLYWQAGRKSDAQRVLLDALKLA 321

Query: 280 QSMEDEDALASQIDQNIETVKKAIEVMDELKKEEQNLKKLTRNM 323
                      + +   + +++ I++    + E+   +++ R +
Sbjct: 322 NRTGFISHFVIEGEAMAQQLRQLIQLNTLPELEQHRAQRILREI 365


>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Length = 366 Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Length = 366 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Length = 497 Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Length = 497 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Length = 156 Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Length = 323 Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Length = 323 Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Length = 323 Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 290 Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 290 Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 290 Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 290 Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Length = 259 Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Length = 259 Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Length = 259 Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Length = 128 Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Length = 168 Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 201 Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 334 Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 334 Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Length = 192 Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Length = 192 Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Length = 264 Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Length = 264 Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Length = 169 Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Length = 122 Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 167 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 315 Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Length = 265 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query1313
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 100.0
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 100.0
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.97
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.96
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.96
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.96
d1hz4a_366 Transcription factor MalT domain III {Escherichia 99.95
d1hz4a_366 Transcription factor MalT domain III {Escherichia 99.92
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.92
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.9
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 99.82
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 99.8
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 99.79
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.78
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.77
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 99.77
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.76
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 99.76
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.75
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 99.73
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 99.72
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 99.66
d1ya0a1497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 99.61
d1ya0a1497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 99.58
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.55
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.55
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.55
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.55
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.46
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 99.42
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 99.37
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 99.37
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 99.35
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.35
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.3
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.3
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 99.29
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 99.29
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 99.29
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.29
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.27
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 99.27
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 99.27
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 99.24
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.22
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 99.21
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 99.2
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 99.19
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 99.19
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 99.18
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 99.18
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 99.18
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.17
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 99.12
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 99.11
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.09
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 99.08
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.08
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.08
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 99.08
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 99.07
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.06
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 99.04
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.03
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.01
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 98.99
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 98.97
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.96
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 98.83
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 98.77
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 98.72
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 98.68
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 98.65
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 98.65
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 98.62
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 98.6
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 98.54
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 98.51
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 98.45
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 98.4
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 98.38
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 98.37
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 98.35
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 98.34
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 98.29
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 98.13
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 98.04
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 97.98
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 97.86
d2ifga3156 High affinity nerve growth factor receptor, N-term 97.75
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 97.55
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.47
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 96.34
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 96.3
d2o8pa1220 14-3-3 domain containing protein cgd7_2470 {Crypto 80.18
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: RNI-like
family: 28-residue LRR
domain: Ribonuclease inhibitor
species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00  E-value=2.1e-33  Score=258.45  Aligned_cols=411  Identities=24%  Similarity=0.303  Sum_probs=322.2

Q ss_pred             HHHCCCCCHHHHHHHHHHCCCCCEEEECCCCCCCCCHHHHHHHHHCCCCCCEEEECCCCCCHHHHHHHHHHHHHCCCCCC
Q ss_conf             88508880699999985036777698248998947889899975149995889802799997899999999971146764
Q 000742          811 CKELSEAPNMKLLKKLYISEVEDEVIVSECELQDISVTPLLNALHTHKTVALLDLSHNLLGNGTMEKLQQFFISSCQNYV  890 (1313)
Q Consensus       811 c~~l~~~~~~~~l~~l~~~~~~~~L~ls~~~l~~~~~~~l~~~L~~~~~L~~L~Ls~n~l~~~~~~~L~~~~~~~~~~~~  890 (1313)
                      |..++...+.+++..+.+++.   |+|++|++++.++..++.+|..+++|+.|||++|.|++.++..+...+..  ....
T Consensus        11 ~~~i~~~~~~~l~~~l~~l~~---L~L~~~~i~~~~~~~l~~~L~~~~~L~~LdLs~N~i~~~~~~~l~~~l~~--~~~~   85 (460)
T d1z7xw1          11 CEELSDARWAELLPLLQQCQV---VRLDDCGLTEARCKDISSALRVNPALAELNLRSNELGDVGVHCVLQGLQT--PSCK   85 (460)
T ss_dssp             SCCCCHHHHHHHHHHHTTCSE---EEEESSCCCHHHHHHHHHHHHTCTTCCEEECTTCCCHHHHHHHHHHTTCS--TTCC
T ss_pred             CCCCCHHHHHHHHHHCCCCCE---EEECCCCCCHHHHHHHHHHHHCCCCCCEEECCCCCCCHHHHHHHHHHHHC--CCCC
T ss_conf             895886899999976779999---98289999889999999998539998889795985972899999999843--7887


Q ss_pred             CEEEECCCCCCCHHHHHHHHHCCCCCCCCCEEEECCCCCCHHHHHHHHHHHHCCC-CCCEEEEECCCCCHHHHHHHHHHH
Q ss_conf             4199802799997889999710327998588980399999369999999873199-976899425999988899999998
Q 000742          891 DLTLDLHCNRFGPTTLFQICECPVLFTRLGVLNLSGNRLTDACGSYLSTILKNCK-VLYSLNIENCSITSRTIQKVADAL  969 (1313)
Q Consensus       891 l~~L~Ls~n~l~~~~~~~l~~~l~~~~~L~~L~Ls~n~l~~~~~~~l~~~l~~~~-~L~~L~L~~~~l~~~~~~~l~~~l  969 (1313)
                      ++.|+|++|++++.+...++..+..+++|++|+|++|.+++.++..+...+.... ....+......+...+...+...+
T Consensus        86 L~~L~L~~n~it~~~~~~l~~~l~~~~~L~~L~L~~N~i~~~~~~~l~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~l  165 (460)
T d1z7xw1          86 IQKLSLQNCCLTGAGCGVLSSTLRTLPTLQELHLSDNLLGDAGLQLLCEGLLDPQCRLEKLQLEYCSLSAASCEPLASVL  165 (460)
T ss_dssp             CCEEECTTSCCBGGGHHHHHHHTTSCTTCCEEECCSSBCHHHHHHHHHHHHTSTTCCCCEEECTTSCCBGGGHHHHHHHH
T ss_pred             CCEEECCCCCCCCCCCCCCCCHHHCCCCCCCCCCCCCCCHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCHHHHCCCCCCC
T ss_conf             78877888775432210121100003432002444332023455554430135543332222223222001100112223


Q ss_pred             HCCCCCCEEEECCCCCCCHHHHHHHHHHHCC-CCCCCEEECCCCCCCHHHHHHHHH-HHHCCCCCEEECCCCCCCCCHHH
Q ss_conf             1499966888078889890259999986104-886664654798899579999999-85159865887457779971199
Q 000742          970 GAESTLAQLCIGYNSPVTGNAITNLLVKLDT-LKSFSELNLNGLKLSKPVVDRLCQ-LAKTSCLTHLMLGCTNLGSDGSL 1047 (1313)
Q Consensus       970 ~~~~~L~~L~Ls~n~~~~~~~~~~l~~~l~~-~~~L~~L~L~~~~l~~~~~~~l~~-~~~~~~L~~L~Ls~n~i~~~~~~ 1047 (1313)
                      ..+..++.++++.+. ....+...+...+.. ...+..+.+..+.+.......+.. +...+.++.+.++.|.+.+.++.
T Consensus       166 ~~~~~~~~~~ls~~~-~~~~~~~~~~~~l~~~~~~~~~l~~~~~~~~~~~~~~~~~~l~~~~~~~~l~~~~n~~~~~~~~  244 (460)
T d1z7xw1         166 RAKPDFKELTVSNND-INEAGVRVLCQGLKDSPCQLEALKLESCGVTSDNCRDLCGIVASKASLRELALGSNKLGDVGMA  244 (460)
T ss_dssp             HHCTTCCEEECCSSB-CHHHHHHHHHHHHHHSCCCCCEEECTTSCCBTTHHHHHHHHHHHCTTCCEEECCSSBCHHHHHH
T ss_pred             CCCCCCCCCCCCCCC-CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHCCCCCCCCCCCCCCCCHHHCCCCCCCCC
T ss_conf             333222223322221-2455554323433211221001241124542101101223322222210010021122334420


Q ss_pred             HHHHHHHCCCCCCCEEECCCCCCCHHHHHHHHHHHHCCCCCCEEECCCCCCCHHHHHHHHHHHCCCCCCEEEEEEECCCC
Q ss_conf             99999841899410998257989936899999997307983389766999993889999998419999624998103779
Q 000742         1048 QLVESLFSRAQESVKLDLSYCGLESTCIHKFTASVSLVHGILELNLGGNPIMKEGANALASLLMNPQCCLKVLVLSKCQL 1127 (1313)
Q Consensus      1048 ~l~~~l~~~~~~L~~L~Ls~n~l~~~~~~~l~~~l~~~~~L~~LdLs~N~i~~~~~~~l~~~l~~~~~~L~~L~Ls~n~i 1127 (1313)
                      ............++.+++++|.++......+...+..++.+..+++++|.+++.+...++..+....+.|+.+++++|.+
T Consensus       245 ~~~~~~~~~~~~l~~l~l~~n~i~~~~~~~~~~~l~~~~~l~~l~l~~n~i~~~~~~~l~~~l~~~~~~L~~l~l~~~~l  324 (460)
T d1z7xw1         245 ELCPGLLHPSSRLRTLWIWECGITAKGCGDLCRVLRAKESLKELSLAGNELGDEGARLLCETLLEPGCQLESLWVKSCSF  324 (460)
T ss_dssp             HHHHHHTSTTCCCCEEECTTSCCCHHHHHHHHHHHHHCTTCCEEECTTCCCHHHHHHHHHHHHTSTTCCCCEEECTTSCC
T ss_pred             HHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHCCCCCCCCCCCCCCCCCCCH
T ss_conf             11000111111100001345433212334332211123433344444333224564211101233344433332333410


Q ss_pred             CHHHHHHHHHHHHCCCCCCEEECCCCCCCHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             98889999998622998469973489998033542100123357765433454445453311110111247778421014
Q 000742         1128 GLAGVLQLIKALSENDTLEELNLADNASKELTLQQNLSSVNSENLQPALKTSDCVSKEVDTDQHGLFAMNTDCNDLEVAD 1207 (1313)
Q Consensus      1128 ~~~g~~~l~~~l~~~~~L~~L~Ls~N~i~~~~~~~~~~~l~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~L~~L~ 1207 (1313)
                      +..++..++..+..+++|++|+|++|.|++.|+..+...+                             ....+.|+.|+
T Consensus       325 ~~~~~~~l~~~~~~~~~L~~L~Ls~N~i~~~g~~~l~~~l-----------------------------~~~~~~L~~L~  375 (460)
T d1z7xw1         325 TAACCSHFSSVLAQNRFLLELQISNNRLEDAGVRELCQGL-----------------------------GQPGSVLRVLW  375 (460)
T ss_dssp             BGGGHHHHHHHHHHCSSCCEEECCSSBCHHHHHHHHHHHH-----------------------------TSTTCCCCEEE
T ss_pred             HHHHHHHCCCCCCCCCCHHHHHEEEECCCCCCCCHHHHHH-----------------------------HCCCCCCCEEE
T ss_conf             2334432133221101111320121013576640011122-----------------------------04567778898


Q ss_pred             CCCCCCHHHHCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHCCCCCCEECCCCCCCCHHHHHHHHHHHHCC
Q ss_conf             678510121001368987654355588630004899999976145676301888888889999999997228
Q 000742         1208 SEDDKIRVESAASGFDNSCTSSCQKNSSFECQFVQELSSAIGMAKPLQLLDLSNNGFSTQAVKTLYCAWSSR 1279 (1313)
Q Consensus      1208 L~~n~i~~~~~~~~~~~~~~~~L~~L~L~~n~~~~~l~~~l~~~~~L~~L~Ls~N~~~~~~~~~l~~~l~~~ 1279 (1313)
                      |++|.|+...                       ...++..+..+++|++|+|++|.|+++|+..|..++..+
T Consensus       376 Ls~n~i~~~~-----------------------~~~l~~~l~~~~~L~~L~Ls~N~i~~~g~~~l~~~l~~~  424 (460)
T d1z7xw1         376 LADCDVSDSS-----------------------CSSLAATLLANHSLRELDLSNNCLGDAGILQLVESVRQP  424 (460)
T ss_dssp             CTTSCCCHHH-----------------------HHHHHHHHHHCCCCCEEECCSSSCCHHHHHHHHHHHTST
T ss_pred             CCCCCCCHHH-----------------------HHHHHHHHHCCCCCCEEECCCCCCCHHHHHHHHHHHHHC
T ss_conf             9799797599-----------------------999999996299889898999969879999999999747



>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2o8pa1 a.118.7.1 (A:8-227) 14-3-3 domain containing protein cgd7_2470 {Cryptosporidium parvum [TaxId: 5807]} Back     information, alignment and structure