Citrus Sinensis ID: 000751


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------1000------1010------1020------1030------1040------1050------1060------1070------1080------1090------1100------1110------1120------1130------1140------1150------1160------1170------1180------1190------1200------1210------1220------1230------1240------1250------1260------1270------1280------1290------1300---
MLNLKYIWGFPVPKFVDCLVVAFGVEVWLSELALYIVYIAGGVFAAGWIEVSCWILTGERQTAVIRSRYVQVLLNQDMSFFDTYGNNGDIVSQVLSDVLLIQSALSEKVGNYIHNMATFFSGLAIAFVNCWQIALITLCTGPFIVAAGGISNIFLHRLAENIQDAYAEAASIAEQAVSYIRTLYAFTNETLAKYSYATSLQATLRYGILISLVQGLGLGFTYGLAICSCALQLWVGRFLVTHNKAHGGEIVTALFAVILSGLGLNQAATNFYSFDQGRIAAYRLYEMISRSSSTTNYDGNTLPSVHGNIEFRNVYFSYLSRPEIPILSGFYLTVPAKKAVALVGRNGSGKSSIIPLMERFYDPTLGEVLLDGENIKNLKLEWLRSQIGLVTQEPALLSLSIRDNIAYGRDATLDQIEEAAKIAHAHTFISSLEKGYETQVGRAGLALTEEQKIKLSIARAVLLNPSILLLDEVTGGLDFEAERAVQEALDLLMLGRSTIIIARRLSLIRNADYIAVMDEGRLFEMGTHDELLATGDLYAELLKCEEAAKLPRRMPVRNYKETSTFQIEKDSSASHSFQEPSSPKMLKSPSLQRVGIYRPTDGAFDSQESPKVLSPPSEKMLENGMPMDAADKEPSIRRQDSFEMRLPELPKIDVHSSNRQTSNGSDPESPISPLLTSDPKNERSHSQTFSRPHSHSDDFPTKVREEESKHQKAPSFWRLAELSFAEWLYAVLGSIGAAIFGSFNPLLAYVIGLIVTAYYKPEERHHLREEVNKWCLIIACMGVVTVVANFLQHFYFGIMGEKMTERVRRMMFSAMLRNEVGWFDEEENSADTLSMRLANDATFVRAAFSNRLSIFIQDSAAVIVAVIIGMLLEWRLALVALATLPILSLSAIAQKLWLAGFSRGIQKMHRKASLVLEDAVRNIYTVVAFCAGNKVMELYRLQLKKIFTKSFLHGMAIGFAFGFSQFLLFACNALLLWYTGKSVRDGYMDLPTALKEYMVFSFATFALVEPFGLAPYILKRRKSLISVFEIIDRVPKIDPDDSSAVKPPNVYGSIELKNVDFCYPSRPEVLVLSNFSLKVNGGQTVAVVGVSGSGKSTIISLIERFYDPVAGQVLLDGRDLKLYNLRWLRNHLGLVQQEPIIFSTTIRENIIYARHNASEAEVKEAARIANAHHFISSLPHGYDTHVGMRGVDLTPGQKQRIAIARVVLKNAPILLLDEASSSIESESSRVVQEALDTLIMGNKTTILIAHRAAMMRHVDNIVVLNGGRIVEEGTHDSLLAKNGLYVRLMQPHYGKGLRQHRLV
ccccHHHHHcccHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHccccccccccccccccccEEEEEEEEEEEccccccccccccccEEEccccEEEEEccccccHHHHHHHHHHHccccccEEEEcccccccccHHHHHHcccEEccccccccccHHHHHHccccccHHHHHHHHHHHHHHHHHHHccccccccccccccccccHHHHHHHHHHHHccccccEEcccccccccHHHHHHHHHHHHHHHccccEEEEcccccccccccEEEEEEccEEEEEccHHHHHHcccHHHHHHccccccccccccccccccccccHHHcccccccccccccccccccccccccccccccccccccccccccccccccccHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHcccccccccccccccccccccEEEEEEEEEEcccccccccccccEEEEEcccEEEEEccccccHHHHHHHHHHcccccccEEEEcccccccccHHHHHHHccccccccccccccHHHHHHcccccccHHHHHHHHHHcccHHHHHccccccccccccccccccHHHHHHHHHHHHHHcccccEEcccccccccHHHHHHHHHHHHHHHccccEEEEEEccHHHHHcccEEEEEEccEEEEEcccHHHHHccccHHHHHHHHHcccccccccc
cHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccEEEEEEEEccccccccccEEEEEEEEccccEEEEEccccccHHHHHHHHcccccccEEEEEEccEEHHHEcHHHHHHHEEEEcccccccccEHHHHHHccccccHHHHHHHHHHHccHHHHHccccHHHcEcccccccccHHHHHHHHHHHHHcccccEEEEEcccccccHHHHHHHHHHHHHHHccccEEEEEEEcEEEccccEEEEEEccEEEEEccHHHHHHcccHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEccccHHHHccccccEccccccccccccccccccccccccccccccccccccHHHcccccccccccccccccccccccccccccccccHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccEEEEEEEEccccccccccEEEEEEEEccccEEEEEccccccHHHHHHHHcccccccEEEEEEccEEHHHEcHHHHHHHEEEEcccccccccEHHHHHHccccccccHHHHHHHHHHHccHHHHccccHHHcEcccccccccHHHHHHHHHHHHHcccccEEEEEcccccccHHHHHHHHHHHHHHHccccEEEEEEEEcHHEccccEEEEEEccEEEEcccHHHHHHccccHHHHHHHHcccccHHcccc
mlnlkyiwgfpvpkfVDCLVVAFGVEVWLSELALYIVYIAGGVFAAGWIEVSCWILTGERQTAVIRSRYVQVLLNQDMSffdtygnngdIVSQVLSDVLLIQSALSEKVGNYIHNMATFFSGLAIAFVNCWQIALITLCTGPFIVAAGGISNIFLHRLAENIQDAYAEAASIAEQAVSYIRTLYAFTNETLAKYSYATSLQATLRYGILISLVQGLGLGFTYGLAICSCALQLWVGRFLVTHNKAHGGEIVTALFAVILSGLGLNQAATNFYSFDQGRIAAYRLYEMISrsssttnydgntlpsvhgniefrnvyfsylsrpeipilsgfyltvpAKKAVALvgrngsgkssiiplmerfydptlgevlldgeniknlKLEWLRSQIglvtqepallslsirdniaygrdATLDQIEEAAKIAHAHTFISSLEKGYETQVGRAGLALTEEQKIKLSIARAVLLNPSILLLDEVTGGLDFEAERAVQEALDLLMLGRSTIIIARRLSLIRNADYIAvmdegrlfemgthdeLLATGDLYAELLKCEeaaklprrmpvrnyketstfqiekdssashsfqepsspkmlkspslqrvgiyrptdgafdsqespkvlsppsekmlengmpmdaadkepsirrqdsfemrlpelpkidvhssnrqtsngsdpespisplltsdpknershsqtfsrphshsddfptkvreeeskhqkapsfWRLAELSFAEWLYAVLGSIGAAIFGSFNPLLAYVIGLIVTayykpeerhhLREEVNKWCLIIACMGVVTVVANFLQHFYFGIMGEKMTERVRRMMFSAMLRnevgwfdeeensADTLSMRLANDATFVRAAFSNRLSIFIQDSAAVIVAVIIGMLLEWRLALVALATLPILSLSAIAQKLWLAGFSRGIQKMHRKASLVLEDAVRNIYTVVAFCAGNKVMELYRLQLKKIFTKSFLHGMAIGFAFGFSQFLLFACNALLLWytgksvrdgymDLPTALKEYMVFSFATfalvepfglapYILKRRKSLISVFEIidrvpkidpddssavkppnvygsielknvdfcypsrpevlVLSNfslkvnggqTVAVVGVSGSGKSTIISLIErfydpvagqvlldgrdlklYNLRWLRNhlglvqqepiifSTTIRENIIYARHNASEAEVKEAARIANAHHFisslphgydthvgmrgvdltpgqkQRIAIARVVLKNAPillldeasssiesesSRVVQEALDTLIMGNKTTILIAHRAAMMRHVDNIVVLnggriveegthdsllaknglyvrlmqphygkglrqhrlv
mlnlkyiwgfpvPKFVDCLVVAFGVEVWLSELALYIVYIAGGVFAAGWIEVSCWILTGERQTAVIRSRYVQVLLNQDMSFFDTYGNNGDIVSQVLSDVLLIQSALSEKVGNYIHNMATFFSGLAIAFVNCWQIALITLCTGPFIVAAGGISNIFLHRLAENIQDAYAEAASIAEQAVSYIRTLYAFTNETLAKYSYATSLQATLRYGILISLVQGLGLGFTYGLAICSCALQLWVGRFLVTHNKAHGGEIVTALFAVILSGLGLNQAATNFYSFDQGRIAAYRLYEMISRSSSTTNYDGNTLPSVHGNIEFRNVYFSYLSRPEIPILSGFYLTVPAKKAVALVgrngsgkssiiplmERFYDPTLGEVLLDGENIKNLKLEWLRSQIGLVTQEPALLSLSIRDNIAYGRDATLDQIEEAAKIAHAHTFISSLEKGYETQVGRAGLALTEEQKIKLSIARAVLLNPSILLLDEVTGGLDFEAERAVQEALDLLMLGRSTIIIARRLSLIRNADYIAVMDEGRLFEMGTHDELLATGDLYAELLKCEeaaklprrmpvrnYKETSTfqiekdssashsfqepsspkmlkspslQRVGIYRPtdgafdsqespkvlsppsekMLENGMPMDAADKEPSIRRQDSFEMRLpelpkidvhssnrqtsngsdpespispLLTSDPKNErshsqtfsrphshsddfPTKVREEeskhqkapsFWRLAELSFAEWLYAVLGSIGAAIFGSFNPLLAYVIGLIVTAYYKPEERHHLREEVNKWCLIIACMGVVTVVANFLQHFYFGIMGEKMTERVRRMMFSAMLRNEVGWFDEEENSADTLSMRLANDATFVRAAFSNRLSIFIQDSAAVIVAVIIGMLLEWRLALVALATLPILSLSAIAQKLWLAGFSRGIQKMHRKASLVLEDAVRNIYTVVAFCAGNKVMELYRLQLKKIFTKSFLHGMAIGFAFGFSQFLLFACNALLLWYTGKSVRDGYMDLPTALKEYMVFSFATFALVEPFGLAPYILKRRKSLISVFEIIDrvpkidpddssavkPPNVYGSIELKNVDFCYPSRPEVLVLSNFSLKVNGGQTVAVVGVSGSGKSTIISLIERFYDPVAGQVLLDGRDLKLYNLRWLRNHLGLVQQEPIIFSTTIRENIIYARHNASEAEVKEAARIANAHHFISSLPHGYDTHVGMRGVDLTPGQKQRIAIARVVLKNAPILLLDeasssiesessRVVQEALDTLIMGNKTTILIAHRAAMMRHVDNIVVLNGGRIVEEGTHDSLLAKNGLYVRLMQphygkglrqhrlv
MLNLKYIWGFPVPKFVDCLVVAFGVEVWLSELALYIVYIAGGVFAAGWIEVSCWILTGERQTAVIRSRYVQVLLNQDMSFFDTYGNNGDIVSQVLSDVLLIQSALSEKVGNYIHNMATFFSGLAIAFVNCWQIALITLCTGPFIVAAGGISNIFLHRLAENiqdayaeaasiaeqaVSYIRTLYAFTNETLAKYSYATSLQATLRYGILISLVQGLGLGFTYGLAICSCALQLWVGRFLVTHNKAHGGEIVTALFAVILSGLGLNQAATNFYSFDQGRIAAYRLYEMISRSSSTTNYDGNTLPSVHGNIEFRNVYFSYLSRPEIPILSGFYLTVPAKKAVALVGRNGSGKSSIIPLMERFYDPTLGEVLLDGENIKNLKLEWLRSQIGLVTQEPALLSLSIRDNIAYGRDATLDQIEEAAKIAHAHTFISSLEKGYETQVGRAGLALTEEQKIKLSIARAVLLNPSILLLDEVTGGLDFEAERAVQEALDLLMLGRSTIIIARRLSLIRNADYIAVMDEGRLFEMGTHDELLATGDLYAELLKCEEAAKLPRRMPVRNYKETSTFQIEKDSSASHSFQEpsspkmlkspslQRVGIYRPTDGAFDSQESPKVLSPPSEKMLENGMPMDAADKEPSIRRQDSFEMRLPELPKIDVHSSNRQTSNGSDPESPISPLLTSDPKNERSHSQTFSRPHSHSDDFPTKVREEESKHQKAPSFWRLAELSFAEWLYAVLGSIGAAIFGSFNPLLAYVIGLIVTAYYKPEERHHLREEVNKWCLIIACMGVVTVVANFLQHFYFGIMGEKMTERVRRMMFSAMLRNEVGWFDEEENSADTLSMRLANDATFVRAAFSNRLSIFIQDSAAVIVAVIIGMLLEWRLALVALATLPILSLSAIAQKLWLAGFSRGIQKMHRKASLVLEDAVRNIYTVVAFCAGNKVMELYRLQLKKIFTKSFLHGMAIGFAFGFSQFLLFACNALLLWYTGKSVRDGYMDLPTALKEYMVFSFATFALVEPFGLAPYILKRRKSLISVFEIIDRVPKIDPDDSSAVKPPNVYGSIELKNVDFCYPSRPEVLVLSNFSLKVNggqtvavvgvsgsgkstiisLIERFYDPVAGQVLLDGRDLKLYNLRWLRNHLGLVQQEPIIFSTTIRENIIYARHNASEAEVKEAARIANAHHFISSLPHGYDTHVGMRGVDLTPGQKQRIAIARVVLKNAPILLLDeasssiesessRVVQEALDTLIMGNKTTILIAHRAAMMRHVDNIVVLNGGRIVEEGTHDSLLAKNGLYVRLMQPHYGKGLRQHRLV
**NLKYIWGFPVPKFVDCLVVAFGVEVWLSELALYIVYIAGGVFAAGWIEVSCWILTGERQTAVIRSRYVQVLLNQDMSFFDTYGNNGDIVSQVLSDVLLIQSALSEKVGNYIHNMATFFSGLAIAFVNCWQIALITLCTGPFIVAAGGISNIFLHRLAENIQDAYAEAASIAEQAVSYIRTLYAFTNETLAKYSYATSLQATLRYGILISLVQGLGLGFTYGLAICSCALQLWVGRFLVTHNKAHGGEIVTALFAVILSGLGLNQAATNFYSFDQGRIAAYRLYEMISRSSSTTNYDGNTLPSVHGNIEFRNVYFSYLSRPEIPILSGFYLTVPAKKAVALVGRNGSGKSSIIPLMERFYDPTLGEVLLDGENIKNLKLEWLRSQIGLVTQEPALLSLSIRDNIAYGRDATLDQIEEAAKIAHAHTFISSLEKGYETQVGRAGLALTEEQKIKLSIARAVLLNPSILLLDEVTGGLDFEAERAVQEALDLLMLGRSTIIIARRLSLIRNADYIAVMDEGRLFEMGTHDELLATGDLYAELLKCEEAA**********************************************************************************************************************************************************************SFWRLAELSFAEWLYAVLGSIGAAIFGSFNPLLAYVIGLIVTAYYKPEERHHLREEVNKWCLIIACMGVVTVVANFLQHFYFGIMGEKMTERVRRMMFSAMLRNEVGWFDEEENSADTLSMRLANDATFVRAAFSNRLSIFIQDSAAVIVAVIIGMLLEWRLALVALATLPILSLSAIAQKLWLAGFSRGIQKMHRKASLVLEDAVRNIYTVVAFCAGNKVMELYRLQLKKIFTKSFLHGMAIGFAFGFSQFLLFACNALLLWYTGKSVRDGYMDLPTALKEYMVFSFATFALVEPFGLAPYILKRRKSLISVFEIIDRVPKI**********PNVYGSIELKNVDFCYPSRPEVLVLSNFSLKVNGGQTVAVVGVSGSGKSTIISLIERFYDPVAGQVLLDGRDLKLYNLRWLRNHLGLVQQEPIIFSTTIRENIIYARHNASEAEVKEAARIANAHHFISSLPHGYDTHVGMRGVDLTPGQKQRIAIARVVLKNAPILLLD************VVQEALDTLIMGNKTTILIAHRAAMMRHVDNIVVLNGGRIVEEGTHDSLLAKNGLYVRLMQPHYG*********
MLNLKYIWGFPVPKFVDCLVVAFGVEVWLSELALYIVYIAGGVFAAGWIEVSCWILTGERQTAVIRSRYVQVLLNQDMSFFDTYGNNGDIVSQVLSDVLLIQSALSEKVGNYIHNMATFFSGLAIAFVNCWQIALITLCTGPFIVAAGGISNIFLH**********AEAASIAEQAVSYIRTLYAFTNETLAKYSYATSLQATLRYGILISLVQGLGLGFTYGLAICSCALQLWVGRFLVTHNKAHGGEIVTALFAVILSGLGLNQAATNFYSFDQGRIAAYRLYEMIS**S*******N**PSVHGNIEFRNVYFSYLSRPEIPILSGFYLTVPAKKAVALVGRNGSGKSSIIPLMERFYDPTLGEVLLDGENIKNLKLEWLRSQIGLVTQEPALLSLSIRDNIAYGRDATLDQIEEAAKIAHAHTFISSLEKGYETQVGRAGLALTEEQKIKLSIARAVLLNPSILLLDEVTGGLDFEAERAVQEALDLLMLGRSTIIIARRLSLIRNADYIAVMDEGRLFEMGTHDELLATGDLYAE***************************************************QRVGIYRPTDGAFDSQESPKVLSPPSEKMLENGMPMDAADKEPSIRRQDSFEMRLPE*******************************************************************FWRLAELSFAEWLYAVLGSIGAAIFGSFNPLLAYVIGLIVTAYYKPEERHHLREEVNKWCLIIACMGVVTVVANFLQHFYFGIMGEKMTERVRRMMFSAMLRNEVGWFDEEENSADTLSMRLANDATFVRAAFSNRLSIFIQDSAAVIVAVIIGMLLEWRLALVALATLPILSLSAIAQKLWLA*************SLVLEDAVRNIYTVVAFCAGNKVMELYRLQLKKIFTKSFLHGMAIGFAFGFSQFLLFACNALLLWYTGKSVRDGYMDLPTALKEYMVFSFATFALVEPFGLAPYILKRRKSLISVFEIIDR***************NVYGSIELKNVDFCYPSRPEVLVLSNFSLKVNGGQTVAVVGVSGSGKSTIISLIERFYDPVAGQVLLDGRDLKLYNLRWLRNHLGLVQQEPIIFSTTIRENIIYARHNASEAEVKEAARIANAHHFISSLPHGYDTHVGMRGVDLTPGQKQRIAIARVVLKNAPILLLDEASSSIESESSRVVQEALDTLIMGNKTTILIAHRAAMMRHVDNIVVLNGGRIVEEGTHDSLLAKNGLYVR****************
MLNLKYIWGFPVPKFVDCLVVAFGVEVWLSELALYIVYIAGGVFAAGWIEVSCWILTGERQTAVIRSRYVQVLLNQDMSFFDTYGNNGDIVSQVLSDVLLIQSALSEKVGNYIHNMATFFSGLAIAFVNCWQIALITLCTGPFIVAAGGISNIFLHRLAENIQDAYAEAASIAEQAVSYIRTLYAFTNETLAKYSYATSLQATLRYGILISLVQGLGLGFTYGLAICSCALQLWVGRFLVTHNKAHGGEIVTALFAVILSGLGLNQAATNFYSFDQGRIAAYRLYEMISRSSSTTNYDGNTLPSVHGNIEFRNVYFSYLSRPEIPILSGFYLTVPAKKAVALVGRNGSGKSSIIPLMERFYDPTLGEVLLDGENIKNLKLEWLRSQIGLVTQEPALLSLSIRDNIAYGRDATLDQIEEAAKIAHAHTFISSLEKGYETQVGRAGLALTEEQKIKLSIARAVLLNPSILLLDEVTGGLDFEAERAVQEALDLLMLGRSTIIIARRLSLIRNADYIAVMDEGRLFEMGTHDELLATGDLYAELLKCEEAAKLPRRMPVRNYKE**************************SPSLQRVGIYRPTDGAFD**********PSEKMLENGMPMDAADKEPSIRRQDSFEMRLPELPKIDVH***************ISPLLTS*************************************SFWRLAELSFAEWLYAVLGSIGAAIFGSFNPLLAYVIGLIVTAYYKPEERHHLREEVNKWCLIIACMGVVTVVANFLQHFYFGIMGEKMTERVRRMMFSAMLRNEVGWFDEEENSADTLSMRLANDATFVRAAFSNRLSIFIQDSAAVIVAVIIGMLLEWRLALVALATLPILSLSAIAQKLWLAGFSRGIQKMHRKASLVLEDAVRNIYTVVAFCAGNKVMELYRLQLKKIFTKSFLHGMAIGFAFGFSQFLLFACNALLLWYTGKSVRDGYMDLPTALKEYMVFSFATFALVEPFGLAPYILKRRKSLISVFEIIDRVPKIDPDDSSAVKPPNVYGSIELKNVDFCYPSRPEVLVLSNFSLKVNGGQTVAVVGVSGSGKSTIISLIERFYDPVAGQVLLDGRDLKLYNLRWLRNHLGLVQQEPIIFSTTIRENIIYARHNASEAEVKEAARIANAHHFISSLPHGYDTHVGMRGVDLTPGQKQRIAIARVVLKNAPILLLDEAS*********VVQEALDTLIMGNKTTILIAHRAAMMRHVDNIVVLNGGRIVEEGTHDSLLAKNGLYVRLMQPHYGK********
MLNLKYIWGFPVPKFVDCLVVAFGVEVWLSELALYIVYIAGGVFAAGWIEVSCWILTGERQTAVIRSRYVQVLLNQDMSFFDTYGNNGDIVSQVLSDVLLIQSALSEKVGNYIHNMATFFSGLAIAFVNCWQIALITLCTGPFIVAAGGISNIFLHRLAENIQDAYAEAASIAEQAVSYIRTLYAFTNETLAKYSYATSLQATLRYGILISLVQGLGLGFTYGLAICSCALQLWVGRFLVTHNKAHGGEIVTALFAVILSGLGLNQAATNFYSFDQGRIAAYRLYEMISRSSSTTNYDGNTLPSVHGNIEFRNVYFSYLSRPEIPILSGFYLTVPAKKAVALVGRNGSGKSSIIPLMERFYDPTLGEVLLDGENIKNLKLEWLRSQIGLVTQEPALLSLSIRDNIAYGRDATLDQIEEAAKIAHAHTFISSLEKGYETQVGRAGLALTEEQKIKLSIARAVLLNPSILLLDEVTGGLDFEAERAVQEALDLLMLGRSTIIIARRLSLIRNADYIAVMDEGRLFEMGTHDELLATGDLYAELLKCEEA********************************************************************PSEKMLENGMPMDAADKEPSIRRQDSFEMRLPE***************************************************************KAPSFWRLAELSFAEWLYAVLGSIGAAIFGSFNPLLAYVIGLIVTAYYKPEERHHLREEVNKWCLIIACMGVVTVVANFLQHFYFGIMGEKMTERVRRMMFSAMLRNEVGWFDEEENSADTLSMRLANDATFVRAAFSNRLSIFIQDSAAVIVAVIIGMLLEWRLALVALATLPILSLSAIAQKLWLAGFSRGIQKMHRKASLVLEDAVRNIYTVVAFCAGNKVMELYRLQLKKIFTKSFLHGMAIGFAFGFSQFLLFACNALLLWYTGKSVRDGYMDLPTALKEYMVFSFATFALVEPFGLAPYILKRRKSLISVFEIIDRVPKIDPDDSSAVKPPNVYGSIELKNVDFCYPSRPEVLVLSNFSLKVNGGQTVAVVGVSGSGKSTIISLIERFYDPVAGQVLLDGRDLKLYNLRWLRNHLGLVQQEPIIFSTTIRENIIYARHNASEAEVKEAARIANAHHFISSLPHGYDTHVGMRGVDLTPGQKQRIAIARVVLKNAPILLLDEASSSIESESSRVVQEALDTLIMGNKTTILIAHRAAMMRHVDNIVVLNGGRIVEEGTHDSLLAKNGLYVRLMQPHYG*********
iiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHoooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLNLKYIWGFPVPKFVDCLVVAFGVEVWLSELALYIVYIAGGVFAAGWIEVSCWILTGERQTAVIRSRYVQVLLNQDMSFFDTYGNNGDIVSQVLSDVLLIQSALSEKVGNYIHNMATFFSGLAIAFVNCWQIALITLCTGPFIVAAGGISNIFxxxxxxxxxxxxxxxxxxxxxAVSYIRTLYAFTNETLAKYSYATSLQATLRYGILISLVQGLGLGFTYGLAICSCALQLWVGRFLVTHNKAHGGEIVTALFAVILSGLGLNQAATNFYSFDQGRIAAYRLYEMISRSSSTTNYDGNTLPSVHGNIEFRNVYFSYLSRPEIPILSGFYLTVPAKKAVALVGRNGSGKSSIIPLMERFYDPTLGEVLLDGENIKNLKLEWLRSQIGLVTQEPALLSLSIRDNIAYGRDATLDQIEEAAKIAHAHTFISSLEKGYETQVGRAGLALTEEQKIKLSIARAVLLNPSILLLDEVTGGLDFEAERAVQEALDLLMLGRSTIIIARRLSLIRNADYIAVMDEGRLFEMGTHDELLATGDLYAELLKCEEAAKLPRRMPVRNYKETSTFQIEKDSSASHSFQEPSSPKMLKSPSLQRVGIYRPTDGAFDSQESPKVLSPPSEKMLENGMPMDAADKEPSIRRQDSFEMRLPELPKIDVHSSNRQTSNGSDPESPISPLLTSDPKNERSHSQTFSRPHSHSDDFPTKVREEESKHQKAPSFWRLAELSFAEWLYAVLGSIGAAIFGSFNPLLAYVIGLIVTAYYKPEERHHLREEVNKWCLIIACMGVVTVVANFLQHFYFGIMGEKMTERVRRMMFSAMLRNEVGWFDEEENSADTLSMRLANDATFVRAAFSNRLSIFIQDSAAVIVAVIIGMLLEWRLALVALATLPILSLSAIAQKLWLAGFSRGIQKMHRKASLVLEDAVRNIYTVVAFCAGNKVMELYRLQLKKIFTKSFLHGMAIGFAFGFSQFLLFACNALLLWYTGKSVRDGYMDLPTALKEYMVFSFATFALVEPFGLAPYILKRRKSLISVFEIIDRVPKIDPDDSSAVKPPNVYGSIELKNVDFCYPSRPEVLVLSNFSLKVNGGQTVAVVGVSGSGKSTIISLIERFYDPVAGQVLLDGRDLKLYNLRWLRNHLGLVQQEPIIFSTTIRENIIYARHNASEAEVKEAARIANAHHFISSLPHGYDTHVGMRGVDLTPGQKQRIAIARVVLKNAPILLLDEASSSIESESSRVVQEALDTLIMGNKTTILIAHRAAMMRHVDNIVVLNGGRIVEEGTHDSLLAKNGLYVRLMQPHYGKGLRQHRLV
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query1303 2.2.26 [Sep-21-2011]
Q9M3B91408 ABC transporter B family yes no 0.975 0.902 0.870 0.0
Q8LPT11407 ABC transporter B family no no 0.977 0.905 0.863 0.0
O807251286 ABC transporter B family no no 0.909 0.921 0.380 0.0
P366191362 Leptomycin B resistance p yes no 0.919 0.879 0.321 1e-169
P347121321 Multidrug resistance prot yes no 0.881 0.869 0.309 1e-167
Q9ZR721286 ABC transporter B family no no 0.473 0.479 0.407 1e-145
Q8LPK21273 ABC transporter B family no no 0.475 0.487 0.429 1e-145
Q9SGY11227 ABC transporter B family no no 0.465 0.494 0.426 1e-144
Q9C7F81245 ABC transporter B family no no 0.437 0.457 0.441 1e-142
Q9LJX01252 ABC transporter B family no no 0.452 0.470 0.431 1e-142
>sp|Q9M3B9|AB20B_ARATH ABC transporter B family member 20 OS=Arabidopsis thaliana GN=ABCB20 PE=2 SV=1 Back     alignment and function desciption
 Score = 2269 bits (5880), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1114/1279 (87%), Positives = 1196/1279 (93%), Gaps = 8/1279 (0%)

Query: 29   LSELALYIVYIAGGVFAAGWIEVSCWILTGERQTAVIRSRYVQVLLNQDMSFFDTYGNNG 88
            L +L+L IVYIAGGVF +GWIEVSCWILTGERQTAVIRS+YVQVLLNQDMSFFDTYGNNG
Sbjct: 134  LVQLSLTIVYIAGGVFISGWIEVSCWILTGERQTAVIRSKYVQVLLNQDMSFFDTYGNNG 193

Query: 89   DIVSQVLSDVLLIQSALSEKVGNYIHNMATFFSGLAIAFVNCWQIALITLCTGPFIVAAG 148
            DIVSQVLSDVLLIQSALSEKVGNYIHNMATF SGL I FVNCW+IALITL TGPFIVAAG
Sbjct: 194  DIVSQVLSDVLLIQSALSEKVGNYIHNMATFISGLVIGFVNCWEIALITLATGPFIVAAG 253

Query: 149  GISNIFLHRLAENIQDAYAEAASIAEQAVSYIRTLYAFTNETLAKYSYATSLQATLRYGI 208
            GISNIFLHRLAENIQDAYAEAA IAEQA+SYIRTLYAFTNETLAKYSYATSLQATLRYGI
Sbjct: 254  GISNIFLHRLAENIQDAYAEAAGIAEQAISYIRTLYAFTNETLAKYSYATSLQATLRYGI 313

Query: 209  LISLVQGLGLGFTYGLAICSCALQLWVGRFLVTHNKAHGGEIVTALFAVILSGLGLNQAA 268
            LISLVQGLGLGFTYGLAICSCALQLW+GRF V + +A+GGEI+ ALFAVILSGLGLNQAA
Sbjct: 314  LISLVQGLGLGFTYGLAICSCALQLWIGRFFVHNGRANGGEIIAALFAVILSGLGLNQAA 373

Query: 269  TNFYSFDQGRIAAYRLYEMISRSSSTTNYDGNTLPSVHGNIEFRNVYFSYLSRPEIPILS 328
            TNFYSFDQGRIAAYRL+EMI+RSSS  N +G  L SV GNIEFRNVYFSYLSRPEIPILS
Sbjct: 374  TNFYSFDQGRIAAYRLFEMITRSSSVANQEGAVLASVQGNIEFRNVYFSYLSRPEIPILS 433

Query: 329  GFYLTVPAKKAVALVGRNGSGKSSIIPLMERFYDPTLGEVLLDGENIKNLKLEWLRSQIG 388
            GFYLTVPAKKAVALVGRNGSGKSSIIPLMERFYDPTLGEVLLDGENIKNLKLEWLRSQIG
Sbjct: 434  GFYLTVPAKKAVALVGRNGSGKSSIIPLMERFYDPTLGEVLLDGENIKNLKLEWLRSQIG 493

Query: 389  LVTQEPALLSLSIRDNIAYGRDATLDQIEEAAKIAHAHTFISSLEKGYETQVGRAGLALT 448
            LVTQEPALLSLSIR+NIAYGRDATLDQIEEAAK AHAHTFISSLEKGYETQVGRAGLA+T
Sbjct: 494  LVTQEPALLSLSIRENIAYGRDATLDQIEEAAKNAHAHTFISSLEKGYETQVGRAGLAMT 553

Query: 449  EEQKIKLSIARAVLLNPSILLLDEVTGGLDFEAERAVQEALDLLMLGRSTIIIARRLSLI 508
            EEQKIKLSIARAVLLNP+ILLLDEVTGGLDFEAER VQEALDLLMLGRSTIIIARRLSLI
Sbjct: 554  EEQKIKLSIARAVLLNPTILLLDEVTGGLDFEAERIVQEALDLLMLGRSTIIIARRLSLI 613

Query: 509  RNADYIAVMDEGRLFEMGTHDELLATGDLYAELLKCEEAAKLPRRMPVRNYKETSTFQIE 568
            +NADYIAVM+EG+L EMGTHDEL+  G LYAELLKCEEA KLPRRMPVRNYKE++ F++E
Sbjct: 614  KNADYIAVMEEGQLVEMGTHDELINLGGLYAELLKCEEATKLPRRMPVRNYKESAVFEVE 673

Query: 569  KDSSASHSFQEPSSPKMLKSPSLQR-VGIYRPTDGAFDSQESPKVLSPPSEKMLENGMPM 627
            +DSSA    QEPSSPKM+KSPSLQR  G++RP +  FD++ESPK  SP SEK  E+GM +
Sbjct: 674  RDSSAGCGVQEPSSPKMIKSPSLQRGSGVFRPQELCFDTEESPKAHSPASEKTGEDGMSL 733

Query: 628  DAADKEPSIRRQDSFEMRLPELPKIDVHSSNRQTSNGSDPESPISPLLTSDPKNERSHSQ 687
            D ADKEP+I+RQDSFEMRLP LPK+DV    +Q SNGS+PESP+SPLLTSDPKNERSHSQ
Sbjct: 734  DCADKEPTIKRQDSFEMRLPHLPKVDVQCP-QQKSNGSEPESPVSPLLTSDPKNERSHSQ 792

Query: 688  TFSRPHSHSDDFPTKVREEESK---HQKAPSFWRLAELSFAEWLYAVLGSIGAAIFGSFN 744
            TFSRP S  DD  TK   + SK   H+++PSFWRLA+LSF EWLYAVLGS+GAAIFGSFN
Sbjct: 793  TFSRPLSSPDD--TKANGKASKDAQHKESPSFWRLAQLSFPEWLYAVLGSLGAAIFGSFN 850

Query: 745  PLLAYVIGLIVTAYYKPEERHHLREEVNKWCLIIACMGVVTVVANFLQHFYFGIMGEKMT 804
            PLLAYVI L+VT YYK  +  HLREEV+KWCLIIACMG+VTVVANFLQHFYFGIMGEKMT
Sbjct: 851  PLLAYVIALVVTEYYK-SKGGHLREEVDKWCLIIACMGIVTVVANFLQHFYFGIMGEKMT 909

Query: 805  ERVRRMMFSAMLRNEVGWFDEEENSADTLSMRLANDATFVRAAFSNRLSIFIQDSAAVIV 864
            ERVRRMMFSAMLRNEVGWFD+EENS DTLSMRLANDATFVRAAFSNRLSIFIQDS AVIV
Sbjct: 910  ERVRRMMFSAMLRNEVGWFDDEENSPDTLSMRLANDATFVRAAFSNRLSIFIQDSFAVIV 969

Query: 865  AVIIGMLLEWRLALVALATLPILSLSAIAQKLWLAGFSRGIQKMHRKASLVLEDAVRNIY 924
            A++IG+LL WRLALVALATLPIL+LSAIAQKLWLAGFS+GIQ+MHRKASLVLEDAVRNIY
Sbjct: 970  ALLIGLLLGWRLALVALATLPILTLSAIAQKLWLAGFSKGIQEMHRKASLVLEDAVRNIY 1029

Query: 925  TVVAFCAGNKVMELYRLQLKKIFTKSFLHGMAIGFAFGFSQFLLFACNALLLWYTGKSVR 984
            TVVAFCAGNKVMELYR+QL++I  +S+LHGMAIGFAFGFSQFLLFACNALLLW T  SV 
Sbjct: 1030 TVVAFCAGNKVMELYRMQLQRILRQSYLHGMAIGFAFGFSQFLLFACNALLLWCTALSVN 1089

Query: 985  DGYMDLPTALKEYMVFSFATFALVEPFGLAPYILKRRKSLISVFEIIDRVPKIDPDDSSA 1044
             GYM L TA+ EYMVFSFATFALVEPFGLAPYILKRRKSLISVFEI+DRVP I+PDD+SA
Sbjct: 1090 RGYMKLSTAITEYMVFSFATFALVEPFGLAPYILKRRKSLISVFEIVDRVPTIEPDDNSA 1149

Query: 1045 VKPPNVYGSIELKNVDFCYPSRPEVLVLSNFSLKVNGGQTVAVVGVSGSGKSTIISLIER 1104
            +KPPNVYGSIELKNVDFCYP+RPE+LVLSNFSLK++GGQTVAVVGVSGSGKSTIISL+ER
Sbjct: 1150 LKPPNVYGSIELKNVDFCYPTRPEILVLSNFSLKISGGQTVAVVGVSGSGKSTIISLVER 1209

Query: 1105 FYDPVAGQVLLDGRDLKLYNLRWLRNHLGLVQQEPIIFSTTIRENIIYARHNASEAEVKE 1164
            +YDPVAGQVLLDGRDLKLYNLRWLR+H+GLVQQEPIIFSTTIRENIIYARHNASEAE+KE
Sbjct: 1210 YYDPVAGQVLLDGRDLKLYNLRWLRSHMGLVQQEPIIFSTTIRENIIYARHNASEAEMKE 1269

Query: 1165 AARIANAHHFISSLPHGYDTHVGMRGVDLTPGQKQRIAIARVVLKNAPILLLDEASSSIE 1224
            AARIANAHHFISSLPHGYDTH+GMRGV+LTPGQKQRIAIARVVLKNAPI+L+DEASSSIE
Sbjct: 1270 AARIANAHHFISSLPHGYDTHIGMRGVELTPGQKQRIAIARVVLKNAPIILIDEASSSIE 1329

Query: 1225 SESSRVVQEALDTLIMGNKTTILIAHRAAMMRHVDNIVVLNGGRIVEEGTHDSLLAKNGL 1284
            SESSRVVQEALDTLIMGNKTTILIAHRAAMMRHVDNIVVLNGGRIVEEGTHDSL AKNGL
Sbjct: 1330 SESSRVVQEALDTLIMGNKTTILIAHRAAMMRHVDNIVVLNGGRIVEEGTHDSLAAKNGL 1389

Query: 1285 YVRLMQPHYGKGLRQHRLV 1303
            YVRLMQPH+GKGLRQHRL+
Sbjct: 1390 YVRLMQPHFGKGLRQHRLI 1408





Arabidopsis thaliana (taxid: 3702)
>sp|Q8LPT1|AB6B_ARATH ABC transporter B family member 6 OS=Arabidopsis thaliana GN=ABCB6 PE=1 SV=2 Back     alignment and function description
>sp|O80725|AB4B_ARATH ABC transporter B family member 4 OS=Arabidopsis thaliana GN=ABCB4 PE=1 SV=1 Back     alignment and function description
>sp|P36619|PMD1_SCHPO Leptomycin B resistance protein pmd1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pmd1 PE=3 SV=2 Back     alignment and function description
>sp|P34712|PGP1_CAEEL Multidrug resistance protein pgp-1 OS=Caenorhabditis elegans GN=pgp-1 PE=1 SV=2 Back     alignment and function description
>sp|Q9ZR72|AB1B_ARATH ABC transporter B family member 1 OS=Arabidopsis thaliana GN=ABCB1 PE=1 SV=1 Back     alignment and function description
>sp|Q8LPK2|AB2B_ARATH ABC transporter B family member 2 OS=Arabidopsis thaliana GN=ABCB2 PE=1 SV=3 Back     alignment and function description
>sp|Q9SGY1|AB10B_ARATH ABC transporter B family member 10 OS=Arabidopsis thaliana GN=ABCB10 PE=1 SV=2 Back     alignment and function description
>sp|Q9C7F8|AB13B_ARATH ABC transporter B family member 13 OS=Arabidopsis thaliana GN=ABCB13 PE=3 SV=1 Back     alignment and function description
>sp|Q9LJX0|AB19B_ARATH ABC transporter B family member 19 OS=Arabidopsis thaliana GN=ABCB19 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1303
2241128511397 multidrug/pheromone exporter, MDR family 0.976 0.911 0.910 0.0
3565768431399 PREDICTED: ABC transporter B family memb 0.978 0.911 0.900 0.0
4494641901401 PREDICTED: ABC transporter B family memb 0.990 0.920 0.898 0.0
3565364961399 PREDICTED: ABC transporter B family memb 0.978 0.911 0.898 0.0
359486840 1410 PREDICTED: ABC transporter B family memb 0.977 0.903 0.897 0.0
3564996691402 PREDICTED: ABC transporter B family memb 0.977 0.908 0.901 0.0
3565689611402 PREDICTED: ABC transporter B family memb 0.977 0.908 0.897 0.0
2240982701398 multidrug/pheromone exporter, MDR family 0.975 0.909 0.903 0.0
297820292 1408 P-glycoprotein 20 [Arabidopsis lyrata su 0.976 0.904 0.874 0.0
15233244 1408 ABC transporter B family member 20 [Arab 0.975 0.902 0.870 0.0
>gi|224112851|ref|XP_002316309.1| multidrug/pheromone exporter, MDR family, ABC transporter family [Populus trichocarpa] gi|222865349|gb|EEF02480.1| multidrug/pheromone exporter, MDR family, ABC transporter family [Populus trichocarpa] Back     alignment and taxonomy information
 Score = 2371 bits (6145), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1163/1277 (91%), Positives = 1224/1277 (95%), Gaps = 4/1277 (0%)

Query: 29   LSELALYIVYIAGGVFAAGWIEVSCWILTGERQTAVIRSRYVQVLLNQDMSFFDTYGNNG 88
             + LA++IVY+A GVFAAGWIEVSCWILTGERQTAVIRS+YVQVLLNQDMSFFDTYGNNG
Sbjct: 123  FTNLAMHIVYLAVGVFAAGWIEVSCWILTGERQTAVIRSKYVQVLLNQDMSFFDTYGNNG 182

Query: 89   DIVSQVLSDVLLIQSALSEKVGNYIHNMATFFSGLAIAFVNCWQIALITLCTGPFIVAAG 148
            DIVSQVLSDVLLIQSALSEKVGNYIHNMATFFSGL I FVNCWQIALITL TGPFIVAAG
Sbjct: 183  DIVSQVLSDVLLIQSALSEKVGNYIHNMATFFSGLVIGFVNCWQIALITLATGPFIVAAG 242

Query: 149  GISNIFLHRLAENIQDAYAEAASIAEQAVSYIRTLYAFTNETLAKYSYATSLQATLRYGI 208
            GISNIFLHRLAE+IQDAYAEAASIAEQA+SY RTLYAFTNETLAKYSYATSLQATLRYGI
Sbjct: 243  GISNIFLHRLAESIQDAYAEAASIAEQALSYTRTLYAFTNETLAKYSYATSLQATLRYGI 302

Query: 209  LISLVQGLGLGFTYGLAICSCALQLWVGRFLVTHNKAHGGEIVTALFAVILSGLGLNQAA 268
            LISLVQGLGLGFTYGLAICSCALQLWVGRFLVT +KAHGGEIVTALFAVILSGLGLNQAA
Sbjct: 303  LISLVQGLGLGFTYGLAICSCALQLWVGRFLVTDHKAHGGEIVTALFAVILSGLGLNQAA 362

Query: 269  TNFYSFDQGRIAAYRLYEMISRSSSTTNYDGNTLPSVHGNIEFRNVYFSYLSRPEIPILS 328
            TNFYSFDQGRIAAYRL+EMISRSSST N DG++L +V GNIEFRNVYFSYLSRPEIPILS
Sbjct: 363  TNFYSFDQGRIAAYRLFEMISRSSSTVNQDGDSLVAVQGNIEFRNVYFSYLSRPEIPILS 422

Query: 329  GFYLTVPAKKAVALVGRNGSGKSSIIPLMERFYDPTLGEVLLDGENIKNLKLEWLRSQIG 388
            GFYLTVPAKKAVALVGRNGSGKSSIIPLMERFYDPTLGEVLLDGENIKNLKLE LRSQ+G
Sbjct: 423  GFYLTVPAKKAVALVGRNGSGKSSIIPLMERFYDPTLGEVLLDGENIKNLKLESLRSQVG 482

Query: 389  LVTQEPALLSLSIRDNIAYGRDATLDQIEEAAKIAHAHTFISSLEKGYETQVGRAGLALT 448
            LVTQEPALLSLSI DNI+YGRDAT+DQIEEAAKIAHAHTFISSLEKGYETQVGRAGLALT
Sbjct: 483  LVTQEPALLSLSIIDNISYGRDATMDQIEEAAKIAHAHTFISSLEKGYETQVGRAGLALT 542

Query: 449  EEQKIKLSIARAVLLNPSILLLDEVTGGLDFEAERAVQEALDLLMLGRSTIIIARRLSLI 508
            EEQKIKLSIARAVLLNP+ILLLDEVTGGLDFEAERAVQEALDLLMLGRSTIIIARRLSLI
Sbjct: 543  EEQKIKLSIARAVLLNPTILLLDEVTGGLDFEAERAVQEALDLLMLGRSTIIIARRLSLI 602

Query: 509  RNADYIAVMDEGRLFEMGTHDELLATGDLYAELLKCEEAAKLPRRMPVRNYKETSTFQIE 568
            RNADYIAVM+EG+L EMGTHDELL    LYAELLKCEEAAKLPRRMPVRNY ET+ FQ+E
Sbjct: 603  RNADYIAVMEEGQLVEMGTHDELLTLDGLYAELLKCEEAAKLPRRMPVRNYTETAAFQVE 662

Query: 569  KDSSASHSFQEPSSPKMLKSPSLQRV-GIYRPTDGAFDSQESPKVLSPPSEKMLENGMPM 627
            KDSS  HS+QEPSSPKM KSPSLQRV GI+RP DG F+SQESPKVLSPP EKM+ENG+P+
Sbjct: 663  KDSSTGHSYQEPSSPKMAKSPSLQRVPGIFRPPDGMFNSQESPKVLSPPPEKMIENGLPL 722

Query: 628  DAADKEPSIRRQDSFEMRLPELPKIDVHSSNRQTSNGSDPESPISPLLTSDPKNERSHSQ 687
            D ADKEPSIRRQDSFEMRLPELPKIDV S++R TSNGS PESP+SPLLTSDPKNERSHSQ
Sbjct: 723  DGADKEPSIRRQDSFEMRLPELPKIDVQSAHRHTSNGSGPESPVSPLLTSDPKNERSHSQ 782

Query: 688  TFSRPHSHSDDFPTKVRE-EESKHQKAPSFWRLAELSFAEWLYAVLGSIGAAIFGSFNPL 746
            TFSRPHSHSDD P KV+E  + KHQK P FWRLAELS AEWLYAVLGSIGAAIFGSFNPL
Sbjct: 783  TFSRPHSHSDDVPIKVKEARDVKHQKEPPFWRLAELSLAEWLYAVLGSIGAAIFGSFNPL 842

Query: 747  LAYVIGLIVTAYYKPEERHHLREEVNKWCLIIACMGVVTVVANFLQHFYFGIMGEKMTER 806
            LAYVI LIVTAYY+ E  HHLR++V++WCL+IA MG+VTVVANFLQHFYFGIMGEKMTER
Sbjct: 843  LAYVISLIVTAYYRQE--HHLRQDVDRWCLMIAIMGIVTVVANFLQHFYFGIMGEKMTER 900

Query: 807  VRRMMFSAMLRNEVGWFDEEENSADTLSMRLANDATFVRAAFSNRLSIFIQDSAAVIVAV 866
            VRRMMFSAMLRNEVGWFDEE+NSADTLSMRLANDATFVRAAFSNRLSIFIQDSAAVIVAV
Sbjct: 901  VRRMMFSAMLRNEVGWFDEEDNSADTLSMRLANDATFVRAAFSNRLSIFIQDSAAVIVAV 960

Query: 867  IIGMLLEWRLALVALATLPILSLSAIAQKLWLAGFSRGIQKMHRKASLVLEDAVRNIYTV 926
            +IGMLL+WRLALVALATLP+L++SAIAQKLWLAGFSRGIQ+MHRKASLVLEDAVRNIYTV
Sbjct: 961  VIGMLLQWRLALVALATLPVLTVSAIAQKLWLAGFSRGIQEMHRKASLVLEDAVRNIYTV 1020

Query: 927  VAFCAGNKVMELYRLQLKKIFTKSFLHGMAIGFAFGFSQFLLFACNALLLWYTGKSVRDG 986
            VAFCAGNKVMELYRLQLKKIF +SF+HGMAIGF FGFSQFLLFACNALLLWYT  S ++ 
Sbjct: 1021 VAFCAGNKVMELYRLQLKKIFKQSFVHGMAIGFGFGFSQFLLFACNALLLWYTAYSEKNL 1080

Query: 987  YMDLPTALKEYMVFSFATFALVEPFGLAPYILKRRKSLISVFEIIDRVPKIDPDDSSAVK 1046
            ++DL TALKEYMVFSFATFALVEPFGLAPYILKRRKSLISVFEIIDR PKIDPDD+SA+K
Sbjct: 1081 HVDLHTALKEYMVFSFATFALVEPFGLAPYILKRRKSLISVFEIIDREPKIDPDDNSALK 1140

Query: 1047 PPNVYGSIELKNVDFCYPSRPEVLVLSNFSLKVNGGQTVAVVGVSGSGKSTIISLIERFY 1106
            PPNVYGSIELKNVDFCYP+RPEVLVLSNFSLKVNGGQTVAVVGVSGSGKSTIISLIERFY
Sbjct: 1141 PPNVYGSIELKNVDFCYPTRPEVLVLSNFSLKVNGGQTVAVVGVSGSGKSTIISLIERFY 1200

Query: 1107 DPVAGQVLLDGRDLKLYNLRWLRNHLGLVQQEPIIFSTTIRENIIYARHNASEAEVKEAA 1166
            DPVAGQVLLDGRDLKLYNLRWLRNHLGLVQQEPIIFSTTI+ENIIYARHNASEAE+KEAA
Sbjct: 1201 DPVAGQVLLDGRDLKLYNLRWLRNHLGLVQQEPIIFSTTIKENIIYARHNASEAEMKEAA 1260

Query: 1167 RIANAHHFISSLPHGYDTHVGMRGVDLTPGQKQRIAIARVVLKNAPILLLDEASSSIESE 1226
            RIANAHHFISSLPHGYDTHVGMRGVDLTPGQKQRIAIARVVLKNAPILLLDEASSSIESE
Sbjct: 1261 RIANAHHFISSLPHGYDTHVGMRGVDLTPGQKQRIAIARVVLKNAPILLLDEASSSIESE 1320

Query: 1227 SSRVVQEALDTLIMGNKTTILIAHRAAMMRHVDNIVVLNGGRIVEEGTHDSLLAKNGLYV 1286
            SSRVVQEALDTL+MGNKTTILIAHRAAMMRHVDNIVVLNGGRIVEEGTH+SL+AKNGLYV
Sbjct: 1321 SSRVVQEALDTLVMGNKTTILIAHRAAMMRHVDNIVVLNGGRIVEEGTHNSLMAKNGLYV 1380

Query: 1287 RLMQPHYGKGLRQHRLV 1303
            RLMQPH+GKGLRQHRL+
Sbjct: 1381 RLMQPHFGKGLRQHRLI 1397




Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|356576843|ref|XP_003556539.1| PREDICTED: ABC transporter B family member 20-like [Glycine max] Back     alignment and taxonomy information
>gi|449464190|ref|XP_004149812.1| PREDICTED: ABC transporter B family member 20-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|356536496|ref|XP_003536773.1| PREDICTED: ABC transporter B family member 20-like [Glycine max] Back     alignment and taxonomy information
>gi|359486840|ref|XP_002284223.2| PREDICTED: ABC transporter B family member 20-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|356499669|ref|XP_003518659.1| PREDICTED: ABC transporter B family member 20-like [Glycine max] Back     alignment and taxonomy information
>gi|356568961|ref|XP_003552676.1| PREDICTED: ABC transporter B family member 20-like [Glycine max] Back     alignment and taxonomy information
>gi|224098270|ref|XP_002311144.1| multidrug/pheromone exporter, MDR family, ABC transporter family [Populus trichocarpa] gi|222850964|gb|EEE88511.1| multidrug/pheromone exporter, MDR family, ABC transporter family [Populus trichocarpa] Back     alignment and taxonomy information
>gi|297820292|ref|XP_002878029.1| P-glycoprotein 20 [Arabidopsis lyrata subsp. lyrata] gi|297323867|gb|EFH54288.1| P-glycoprotein 20 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|15233244|ref|NP_191092.1| ABC transporter B family member 20 [Arabidopsis thaliana] gi|75335876|sp|Q9M3B9.1|AB20B_ARATH RecName: Full=ABC transporter B family member 20; Short=ABC transporter ABCB.20; Short=AtABCB20; AltName: Full=Multidrug resistance protein 14; AltName: Full=P-glycoprotein 20 gi|7019665|emb|CAB75766.1| P-glycoprotein-like [Arabidopsis thaliana] gi|332645847|gb|AEE79368.1| ABC transporter B family member 20 [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1303
TAIR|locus:21006661408 ABCB20 "ATP-binding cassette B 0.975 0.902 0.827 0.0
TAIR|locus:20397471407 ABCB6 "ATP-binding cassette B6 0.977 0.905 0.819 0.0
UNIPROTKB|Q10N721411 LOC_Os03g17180 "ABC transporte 0.973 0.899 0.781 0.0
TAIR|locus:20579611286 ABCB1 "ATP-binding cassette B1 0.416 0.422 0.450 2.5e-252
UNIPROTKB|Q7EZL21344 P0705A05.112-2 "Putative P-gly 0.510 0.494 0.383 1.9e-247
UNIPROTKB|Q0JCP11259 Os04g0459000 "Os04g0459000 pro 0.399 0.413 0.458 1e-246
TAIR|locus:20907341252 ABCB19 "ATP-binding cassette B 0.447 0.465 0.408 1.9e-245
UNIPROTKB|Q8GU751264 mdr11 "MDR-like ABC transporte 0.402 0.415 0.459 1.2e-243
TAIR|locus:20199581227 PGP10 "P-glycoprotein 10" [Ara 0.466 0.495 0.401 6.8e-243
TAIR|locus:20104641245 ABCB13 "ATP-binding cassette B 0.481 0.504 0.391 6.3e-238
TAIR|locus:2100666 ABCB20 "ATP-binding cassette B20" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 5372 (1896.1 bits), Expect = 0., P = 0.
 Identities = 1058/1279 (82%), Positives = 1139/1279 (89%)

Query:    29 LSELALYIVYIAGGVFAAGWIEVSCWILTGERQTAVIRSRYVQVLLNQDMSFFDTYGNNG 88
             L +L+L IVYIAGGVF +GWIEVSCWILTGERQTAVIRS+YVQVLLNQDMSFFDTYGNNG
Sbjct:   134 LVQLSLTIVYIAGGVFISGWIEVSCWILTGERQTAVIRSKYVQVLLNQDMSFFDTYGNNG 193

Query:    89 DIVSQVLSDVLLIQSALSEKVGNYIHNMATFFSGLAIAFVNCWQIALITLCTGPFIVAAG 148
             DIVSQVLSDVLLIQSALSEKVGNYIHNMATF SGL I FVNCW+IALITL TGPFIVAAG
Sbjct:   194 DIVSQVLSDVLLIQSALSEKVGNYIHNMATFISGLVIGFVNCWEIALITLATGPFIVAAG 253

Query:   149 GISNIFLHRLAENXXXXXXXXXXXXXXXVSYIRTLYAFTNETLAKYSYATSLQATLRYGI 208
             GISNIFLHRLAEN               +SYIRTLYAFTNETLAKYSYATSLQATLRYGI
Sbjct:   254 GISNIFLHRLAENIQDAYAEAAGIAEQAISYIRTLYAFTNETLAKYSYATSLQATLRYGI 313

Query:   209 LISLVQGLGLGFTYGLAICSCALQLWVGRFLVTHNKAHGGEIVTALFAVILSGLGLNQAA 268
             LISLVQGLGLGFTYGLAICSCALQLW+GRF V + +A+GGEI+ ALFAVILSGLGLNQAA
Sbjct:   314 LISLVQGLGLGFTYGLAICSCALQLWIGRFFVHNGRANGGEIIAALFAVILSGLGLNQAA 373

Query:   269 TNFYSFDQGRIAAYRLYEMISRSSSTTNYDGNTLPSVHGNIEFRNVYFSYLSRPEIPILS 328
             TNFYSFDQGRIAAYRL+EMI+RSSS  N +G  L SV GNIEFRNVYFSYLSRPEIPILS
Sbjct:   374 TNFYSFDQGRIAAYRLFEMITRSSSVANQEGAVLASVQGNIEFRNVYFSYLSRPEIPILS 433

Query:   329 GFYLTVPAKKAVALVGRNGSGKSSIIPLMERFYDPTLGEVLLDGENIKNLKLEWLRSQIG 388
             GFYLTVPAKKAVALVGRNGSGKSSIIPLMERFYDPTLGEVLLDGENIKNLKLEWLRSQIG
Sbjct:   434 GFYLTVPAKKAVALVGRNGSGKSSIIPLMERFYDPTLGEVLLDGENIKNLKLEWLRSQIG 493

Query:   389 LVTQEPALLSLSIRDNIAYGRDATLDQIEEAAKIAHAHTFISSLEKGYETQVGRAGLALT 448
             LVTQEPALLSLSIR+NIAYGRDATLDQIEEAAK AHAHTFISSLEKGYETQVGRAGLA+T
Sbjct:   494 LVTQEPALLSLSIRENIAYGRDATLDQIEEAAKNAHAHTFISSLEKGYETQVGRAGLAMT 553

Query:   449 EEQKIKLSIARAVLLNPSILLLDEVTGGLDFEAERAVQEALDLLMLGRSTIIIARRLSLI 508
             EEQKIKLSIARAVLLNP+ILLLDEVTGGLDFEAER VQEALDLLMLGRSTIIIARRLSLI
Sbjct:   554 EEQKIKLSIARAVLLNPTILLLDEVTGGLDFEAERIVQEALDLLMLGRSTIIIARRLSLI 613

Query:   509 RNADYIAVMDEGRLFEMGTHDELLATGDLYAELLKCEEAAKLPRRMPVRNYKETSTFQIE 568
             +NADYIAVM+EG+L EMGTHDEL+  G LYAELLKCEEA KLPRRMPVRNYKE++ F++E
Sbjct:   614 KNADYIAVMEEGQLVEMGTHDELINLGGLYAELLKCEEATKLPRRMPVRNYKESAVFEVE 673

Query:   569 KDSSASHSFQEXXXXXXXXXXXXQR-VGIYRPTDGAFDSQESPKVLSPPSEKMLENGMPM 627
             +DSSA    QE            QR  G++RP +  FD++ESPK  SP SEK  E+GM +
Sbjct:   674 RDSSAGCGVQEPSSPKMIKSPSLQRGSGVFRPQELCFDTEESPKAHSPASEKTGEDGMSL 733

Query:   628 DAADKEPSIRRQDSFEMRLPELPKIDVHSSNRQTSNGSDPESPISPLLTSDPKNERSHSQ 687
             D ADKEP+I+RQDSFEMRLP LPK+DV    +Q SNGS+PESP+SPLLTSDPKNERSHSQ
Sbjct:   734 DCADKEPTIKRQDSFEMRLPHLPKVDVQCP-QQKSNGSEPESPVSPLLTSDPKNERSHSQ 792

Query:   688 TFSRPHSHSDDFPTKVREEESK---HQKAPSFWRLAELSFAEWLYAVLGSIGAAIFGSFN 744
             TFSRP S  DD  TK   + SK   H+++PSFWRLA+LSF EWLYAVLGS+GAAIFGSFN
Sbjct:   793 TFSRPLSSPDD--TKANGKASKDAQHKESPSFWRLAQLSFPEWLYAVLGSLGAAIFGSFN 850

Query:   745 PLLAYVIGLIVTAYYKPEERHHLREEVNKWCLIIACMGVVTVVANFLQHFYFGIMGEKMT 804
             PLLAYVI L+VT YYK  +  HLREEV+KWCLIIACMG+VTVVANFLQHFYFGIMGEKMT
Sbjct:   851 PLLAYVIALVVTEYYK-SKGGHLREEVDKWCLIIACMGIVTVVANFLQHFYFGIMGEKMT 909

Query:   805 ERVRRMMFSAMLRNEVGWFDEEENSADTLSMRLANDATFVRAAFSNRLSIFIQDSAAVIV 864
             ERVRRMMFSAMLRNEVGWFD+EENS DTLSMRLANDATFVRAAFSNRLSIFIQDS AVIV
Sbjct:   910 ERVRRMMFSAMLRNEVGWFDDEENSPDTLSMRLANDATFVRAAFSNRLSIFIQDSFAVIV 969

Query:   865 AVIIGMLLEWRLALVALATLPILSLSAIAQKLWLAGFSRGIQKMHRKASLVLEDAVRNIY 924
             A++IG+LL WRLALVALATLPIL+LSAIAQKLWLAGFS+GIQ+MHRKASLVLEDAVRNIY
Sbjct:   970 ALLIGLLLGWRLALVALATLPILTLSAIAQKLWLAGFSKGIQEMHRKASLVLEDAVRNIY 1029

Query:   925 TVVAFCAGNKVMELYRLQLKKIFTKSFLHGMAIGFAFGFSQFLLFACNALLLWYTGKSVR 984
             TVVAFCAGNKVMELYR+QL++I  +S+LHGMAIGFAFGFSQFLLFACNALLLW T  SV 
Sbjct:  1030 TVVAFCAGNKVMELYRMQLQRILRQSYLHGMAIGFAFGFSQFLLFACNALLLWCTALSVN 1089

Query:   985 DGYMDLPTALKEYMVFSFATFALVEPFGLAPYILKRRKSLISVFEIIDRVPKIDPDDSSA 1044
              GYM L TA+ EYMVFSFATFALVEPFGLAPYILKRRKSLISVFEI+DRVP I+PDD+SA
Sbjct:  1090 RGYMKLSTAITEYMVFSFATFALVEPFGLAPYILKRRKSLISVFEIVDRVPTIEPDDNSA 1149

Query:  1045 VKPPNVYGSIELKNVDFCYPSRPEVLVLSNFSLKVNXXXXXXXXXXXXXXXXXXXXLIER 1104
             +KPPNVYGSIELKNVDFCYP+RPE+LVLSNFSLK++                    L+ER
Sbjct:  1150 LKPPNVYGSIELKNVDFCYPTRPEILVLSNFSLKISGGQTVAVVGVSGSGKSTIISLVER 1209

Query:  1105 FYDPVAGQVLLDGRDLKLYNLRWLRNHLGLVQQEPIIFSTTIRENIIYARHNASEAEVKE 1164
             +YDPVAGQVLLDGRDLKLYNLRWLR+H+GLVQQEPIIFSTTIRENIIYARHNASEAE+KE
Sbjct:  1210 YYDPVAGQVLLDGRDLKLYNLRWLRSHMGLVQQEPIIFSTTIRENIIYARHNASEAEMKE 1269

Query:  1165 AARIANAHHFISSLPHGYDTHVGMRGVDLTPGQKQRIAIARVVLKNAPILLLDXXXXXXX 1224
             AARIANAHHFISSLPHGYDTH+GMRGV+LTPGQKQRIAIARVVLKNAPI+L+D       
Sbjct:  1270 AARIANAHHFISSLPHGYDTHIGMRGVELTPGQKQRIAIARVVLKNAPIILIDEASSSIE 1329

Query:  1225 XXXXRVVQEALDTLIMGNKTTILIAHRAAMMRHVDNIVVLNGGRIVEEGTHDSLLAKNGL 1284
                 RVVQEALDTLIMGNKTTILIAHRAAMMRHVDNIVVLNGGRIVEEGTHDSL AKNGL
Sbjct:  1330 SESSRVVQEALDTLIMGNKTTILIAHRAAMMRHVDNIVVLNGGRIVEEGTHDSLAAKNGL 1389

Query:  1285 YVRLMQPHYGKGLRQHRLV 1303
             YVRLMQPH+GKGLRQHRL+
Sbjct:  1390 YVRLMQPHFGKGLRQHRLI 1408


GO:0000166 "nucleotide binding" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA
GO:0005886 "plasma membrane" evidence=ISM;IDA
GO:0006200 "ATP catabolic process" evidence=IBA
GO:0006810 "transport" evidence=IEA
GO:0010315 "auxin efflux" evidence=IBA
GO:0010329 "auxin efflux transmembrane transporter activity" evidence=IBA
GO:0010540 "basipetal auxin transport" evidence=IBA
GO:0010541 "acropetal auxin transport" evidence=IBA
GO:0016021 "integral to membrane" evidence=IEA;IBA
GO:0016887 "ATPase activity" evidence=IEA
GO:0017111 "nucleoside-triphosphatase activity" evidence=IEA
GO:0042626 "ATPase activity, coupled to transmembrane movement of substances" evidence=IEA;ISS;IBA
GO:0055085 "transmembrane transport" evidence=IEA;IBA
GO:0005634 "nucleus" evidence=IDA
GO:0010048 "vernalization response" evidence=RCA
GO:0043481 "anthocyanin accumulation in tissues in response to UV light" evidence=RCA
GO:0048440 "carpel development" evidence=RCA
TAIR|locus:2039747 ABCB6 "ATP-binding cassette B6" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q10N72 LOC_Os03g17180 "ABC transporter family protein, putative, expressed" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
TAIR|locus:2057961 ABCB1 "ATP-binding cassette B1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q7EZL2 P0705A05.112-2 "Putative P-glycoprotein 1" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
UNIPROTKB|Q0JCP1 Os04g0459000 "Os04g0459000 protein" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
TAIR|locus:2090734 ABCB19 "ATP-binding cassette B19" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q8GU75 mdr11 "MDR-like ABC transporter" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
TAIR|locus:2019958 PGP10 "P-glycoprotein 10" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2010464 ABCB13 "ATP-binding cassette B13" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q8LPT1AB6B_ARATHNo assigned EC number0.86370.97770.9054nono
P36619PMD1_SCHPONo assigned EC number0.32130.91940.8795yesno
P34712PGP1_CAEEL3, ., 6, ., 3, ., 4, 40.30920.88180.8697yesno
Q9M3B9AB20B_ARATHNo assigned EC number0.87090.97540.9026yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.4.21LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
estExt_fgenesh4_pm.C_LG_X0835
multidrug/pheromone exporter, MDR family, ABC transporter family (1397 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1303
COG1132567 COG1132, MdlB, ABC-type multidrug transport system 1e-122
cd03249238 cd03249, ABC_MTABC3_MDL1_MDL2, ATP-binding cassett 1e-121
COG1132567 COG1132, MdlB, ABC-type multidrug transport system 1e-113
cd03249238 cd03249, ABC_MTABC3_MDL1_MDL2, ATP-binding cassett 1e-107
TIGR02204576 TIGR02204, MsbA_rel, ABC transporter, permease/ATP 1e-107
TIGR02204576 TIGR02204, MsbA_rel, ABC transporter, permease/ATP 1e-105
cd03251234 cd03251, ABCC_MsbA, ATP-binding cassette domain of 1e-104
TIGR02203571 TIGR02203, MsbA_lipidA, lipid A export permease/AT 1e-102
TIGR00958711 TIGR00958, 3a01208, Conjugate Transporter-2 (CT2) 1e-101
COG2274709 COG2274, SunT, ABC-type bacteriocin/lantibiotic ex 6e-98
TIGR00958711 TIGR00958, 3a01208, Conjugate Transporter-2 (CT2) 9e-98
cd03254229 cd03254, ABCC_Glucan_exporter_like, ATP-binding ca 4e-93
cd03251234 cd03251, ABCC_MsbA, ATP-binding cassette domain of 7e-89
cd03253236 cd03253, ABCC_ATM1_transporter, ATP-binding casset 5e-88
cd03254229 cd03254, ABCC_Glucan_exporter_like, ATP-binding ca 2e-86
COG2274709 COG2274, SunT, ABC-type bacteriocin/lantibiotic ex 9e-85
PRK11176582 PRK11176, PRK11176, lipid transporter ATP-binding/ 1e-84
cd03253236 cd03253, ABCC_ATM1_transporter, ATP-binding casset 2e-83
TIGR02203571 TIGR02203, MsbA_lipidA, lipid A export permease/AT 3e-81
PRK13657588 PRK13657, PRK13657, cyclic beta-1,2-glucan ABC tra 7e-77
PRK11176582 PRK11176, PRK11176, lipid transporter ATP-binding/ 2e-74
TIGR01846694 TIGR01846, type_I_sec_HlyB, type I secretion syste 1e-73
cd03252237 cd03252, ABCC_Hemolysin, ATP-binding cassette doma 2e-73
PRK13657588 PRK13657, PRK13657, cyclic beta-1,2-glucan ABC tra 9e-73
COG5265497 COG5265, ATM1, ABC-type transport system involved 8e-71
cd03248226 cd03248, ABCC_TAP, ATP-binding cassette domain of 8e-71
TIGR01846694 TIGR01846, type_I_sec_HlyB, type I secretion syste 9e-70
cd03252237 cd03252, ABCC_Hemolysin, ATP-binding cassette doma 1e-68
cd03228171 cd03228, ABCC_MRP_Like, ATP-binding cassette domai 1e-68
cd03248226 cd03248, ABCC_TAP, ATP-binding cassette domain of 1e-66
cd03245220 cd03245, ABCC_bacteriocin_exporters, ATP-binding c 1e-65
COG5265497 COG5265, ATM1, ABC-type transport system involved 2e-63
COG4987573 COG4987, CydC, ABC-type transport system involved 5e-62
PTZ002651466 PTZ00265, PTZ00265, multidrug resistance protein ( 6e-62
TIGR01192585 TIGR01192, chvA, glucan exporter ATP-binding prote 9e-61
TIGR03375694 TIGR03375, type_I_sec_LssB, type I secretion syste 1e-60
PRK11160574 PRK11160, PRK11160, cysteine/glutathione ABC trans 1e-59
TIGR03796710 TIGR03796, NHLM_micro_ABC1, NHLM bacteriocin syste 3e-58
cd03228171 cd03228, ABCC_MRP_Like, ATP-binding cassette domai 6e-58
TIGR01192585 TIGR01192, chvA, glucan exporter ATP-binding prote 4e-57
TIGR02857529 TIGR02857, CydD, thiol reductant ABC exporter, Cyd 1e-56
COG4988559 COG4988, CydD, ABC-type transport system involved 6e-56
cd03244221 cd03244, ABCC_MRP_domain2, ATP-binding cassette do 3e-55
cd03245220 cd03245, ABCC_bacteriocin_exporters, ATP-binding c 6e-54
TIGR03375694 TIGR03375, type_I_sec_LssB, type I secretion syste 2e-53
TIGR03796710 TIGR03796, NHLM_micro_ABC1, NHLM bacteriocin syste 3e-52
COG4988559 COG4988, CydD, ABC-type transport system involved 3e-52
TIGR01193708 TIGR01193, bacteriocin_ABC, ABC-type bacteriocin t 4e-52
TIGR01193708 TIGR01193, bacteriocin_ABC, ABC-type bacteriocin t 4e-50
TIGR03797686 TIGR03797, NHLM_micro_ABC2, NHLM bacteriocin syste 2e-49
PRK10790592 PRK10790, PRK10790, putative multidrug transporter 2e-49
PTZ002651466 PTZ00265, PTZ00265, multidrug resistance protein ( 4e-49
PRK10789569 PRK10789, PRK10789, putative multidrug transporter 4e-49
PRK11174588 PRK11174, PRK11174, cysteine/glutathione ABC trans 6e-47
TIGR02857529 TIGR02857, CydD, thiol reductant ABC exporter, Cyd 8e-47
COG4987573 COG4987, CydC, ABC-type transport system involved 2e-46
TIGR01842544 TIGR01842, type_I_sec_PrtD, type I secretion syste 4e-46
cd03244221 cd03244, ABCC_MRP_domain2, ATP-binding cassette do 1e-45
PRK11160574 PRK11160, PRK11160, cysteine/glutathione ABC trans 6e-45
PRK10790592 PRK10790, PRK10790, putative multidrug transporter 6e-45
TIGR01842544 TIGR01842, type_I_sec_PrtD, type I secretion syste 6e-45
TIGR03797686 TIGR03797, NHLM_micro_ABC2, NHLM bacteriocin syste 1e-44
PRK10789569 PRK10789, PRK10789, putative multidrug transporter 2e-44
PTZ00265 1466 PTZ00265, PTZ00265, multidrug resistance protein ( 5e-44
TIGR02868530 TIGR02868, CydC, thiol reductant ABC exporter, Cyd 9e-44
COG4618580 COG4618, ArpD, ABC-type protease/lipase transport 2e-43
COG4618580 COG4618, ArpD, ABC-type protease/lipase transport 7e-41
PRK11174588 PRK11174, PRK11174, cysteine/glutathione ABC trans 1e-39
cd03369207 cd03369, ABCC_NFT1, ATP-binding cassette domain 2 3e-39
cd03247178 cd03247, ABCC_cytochrome_bd, ATP-binding cassette 3e-38
cd03246173 cd03246, ABCC_Protease_Secretion, ATP-binding cass 5e-38
cd03225211 cd03225, ABC_cobalt_CbiO_domain1, First domain of 2e-36
cd03260227 cd03260, ABC_PstB_phosphate_transporter, ATP-bindi 6e-36
cd03250204 cd03250, ABCC_MRP_domain1, ATP-binding cassette do 1e-35
cd03369207 cd03369, ABCC_NFT1, ATP-binding cassette domain 2 2e-34
cd03260227 cd03260, ABC_PstB_phosphate_transporter, ATP-bindi 6e-34
PRK14250241 PRK14250, PRK14250, phosphate ABC transporter ATP- 7e-34
COG1136226 COG1136, SalX, ABC-type antimicrobial peptide tran 7e-33
pfam00664274 pfam00664, ABC_membrane, ABC transporter transmemb 8e-33
COG1135339 COG1135, AbcC, ABC-type metal ion transport system 2e-32
cd03247178 cd03247, ABCC_cytochrome_bd, ATP-binding cassette 6e-32
COG1131293 COG1131, CcmA, ABC-type multidrug transport system 7e-32
cd03259213 cd03259, ABC_Carb_Solutes_like, ATP-binding casset 2e-31
cd03225211 cd03225, ABC_cobalt_CbiO_domain1, First domain of 3e-31
COG1131293 COG1131, CcmA, ABC-type multidrug transport system 1e-30
TIGR009571522 TIGR00957, MRP_assoc_pro, multi drug resistance-as 1e-30
cd03288257 cd03288, ABCC_SUR2, ATP-binding cassette domain 2 1e-30
cd03261235 cd03261, ABC_Org_Solvent_Resistant, ATP-binding ca 1e-30
cd03246173 cd03246, ABCC_Protease_Secretion, ATP-binding cass 2e-30
COG1122235 COG1122, CbiO, ABC-type cobalt transport system, A 2e-30
COG1120258 COG1120, FepC, ABC-type cobalamin/Fe3+-siderophore 3e-30
cd03257228 cd03257, ABC_NikE_OppD_transporters, ATP-binding c 6e-30
TIGR02868530 TIGR02868, CydC, thiol reductant ABC exporter, Cyd 1e-29
COG1122235 COG1122, CbiO, ABC-type cobalt transport system, A 1e-29
cd03229178 cd03229, ABC_Class3, ATP-binding cassette domain o 2e-29
cd03261235 cd03261, ABC_Org_Solvent_Resistant, ATP-binding ca 3e-29
COG1117253 COG1117, PstB, ABC-type phosphate transport system 4e-29
cd03258233 cd03258, ABC_MetN_methionine_transporter, ATP-bind 5e-29
PLN03130 1622 PLN03130, PLN03130, ABC transporter C family membe 7e-29
PRK13632271 PRK13632, cbiO, cobalt transporter ATP-binding sub 8e-29
PTZ002651466 PTZ00265, PTZ00265, multidrug resistance protein ( 1e-28
COG1135339 COG1135, AbcC, ABC-type metal ion transport system 2e-28
PLN03130 1622 PLN03130, PLN03130, ABC transporter C family membe 2e-28
PLN031301622 PLN03130, PLN03130, ABC transporter C family membe 2e-28
cd03293220 cd03293, ABC_NrtD_SsuB_transporters, ATP-binding c 2e-28
COG3839338 COG3839, MalK, ABC-type sugar transport systems, A 2e-28
cd03255218 cd03255, ABC_MJ0796_LolCDE_FtsE, ATP-binding casse 4e-28
COG1123539 COG1123, COG1123, ATPase components of various ABC 5e-28
TIGR009571522 TIGR00957, MRP_assoc_pro, multi drug resistance-as 7e-28
cd03288257 cd03288, ABCC_SUR2, ATP-binding cassette domain 2 2e-27
cd00267157 cd00267, ABC_ATPase, ATP-binding cassette transpor 2e-27
PLN032321495 PLN03232, PLN03232, ABC transporter C family membe 2e-27
cd03295242 cd03295, ABC_OpuCA_Osmoprotection, ATP-binding cas 2e-27
PRK13632271 PRK13632, cbiO, cobalt transporter ATP-binding sub 3e-27
cd03256241 cd03256, ABC_PhnC_transporter, ATP-binding cassett 3e-27
cd03250204 cd03250, ABCC_MRP_domain1, ATP-binding cassette do 4e-27
COG1127263 COG1127, Ttg2A, ABC-type transport system involved 4e-27
cd00267157 cd00267, ABC_ATPase, ATP-binding cassette transpor 7e-27
COG1125309 COG1125, OpuBA, ABC-type proline/glycine betaine t 8e-27
TIGR03608206 TIGR03608, L_ocin_972_ABC, putative bacteriocin ex 1e-26
pfam00664274 pfam00664, ABC_membrane, ABC transporter transmemb 2e-26
COG1126240 COG1126, GlnQ, ABC-type polar amino acid transport 2e-26
cd03230173 cd03230, ABC_DR_subfamily_A, ATP-binding cassette 2e-26
COG3638258 COG3638, COG3638, ABC-type phosphate/phosphonate t 2e-26
TIGR00972247 TIGR00972, 3a0107s01c2, phosphate ABC transporter, 2e-26
cd03214180 cd03214, ABC_Iron-Siderophores_B12_Hemin, ATP-bind 3e-26
TIGR00957 1522 TIGR00957, MRP_assoc_pro, multi drug resistance-as 4e-26
cd03258233 cd03258, ABC_MetN_methionine_transporter, ATP-bind 5e-26
COG3842 352 COG3842, PotA, ABC-type spermidine/putrescine tran 6e-26
cd03229178 cd03229, ABC_Class3, ATP-binding cassette domain o 7e-26
cd03230173 cd03230, ABC_DR_subfamily_A, ATP-binding cassette 7e-26
cd03262213 cd03262, ABC_HisP_GlnQ, ATP-binding cassette domai 7e-26
cd03259213 cd03259, ABC_Carb_Solutes_like, ATP-binding casset 8e-26
COG1124252 COG1124, DppF, ABC-type dipeptide/oligopeptide/nic 1e-25
cd03257228 cd03257, ABC_NikE_OppD_transporters, ATP-binding c 2e-25
PLN032321495 PLN03232, PLN03232, ABC transporter C family membe 3e-25
cd03295242 cd03295, ABC_OpuCA_Osmoprotection, ATP-binding cas 3e-25
COG3842352 COG3842, PotA, ABC-type spermidine/putrescine tran 3e-25
TIGR02315243 TIGR02315, ABC_phnC, phosphonate ABC transporter, 3e-25
cd03219236 cd03219, ABC_Mj1267_LivG_branched, ATP-binding cas 5e-25
PRK13647274 PRK13647, cbiO, cobalt transporter ATP-binding sub 6e-25
COG1120258 COG1120, FepC, ABC-type cobalamin/Fe3+-siderophore 7e-25
COG1125309 COG1125, OpuBA, ABC-type proline/glycine betaine t 1e-24
PRK13635279 PRK13635, cbiO, cobalt transporter ATP-binding sub 3e-24
cd03219236 cd03219, ABC_Mj1267_LivG_branched, ATP-binding cas 4e-24
cd03292214 cd03292, ABC_FtsE_transporter, ATP-binding cassett 4e-24
PRK14250241 PRK14250, PRK14250, phosphate ABC transporter ATP- 5e-24
PRK10744260 PRK10744, pstB, phosphate transporter ATP-binding 5e-24
COG1118345 COG1118, CysA, ABC-type sulfate/molybdate transpor 8e-24
COG1136226 COG1136, SalX, ABC-type antimicrobial peptide tran 1e-23
cd03255218 cd03255, ABC_MJ0796_LolCDE_FtsE, ATP-binding casse 1e-23
COG1116248 COG1116, TauB, ABC-type nitrate/sulfonate/bicarbon 1e-23
PTZ002431560 PTZ00243, PTZ00243, ABC transporter; Provisional 2e-23
COG4175 386 COG4175, ProV, ABC-type proline/glycine betaine tr 2e-23
COG1121254 COG1121, ZnuC, ABC-type Mn/Zn transport systems, A 4e-23
PRK11153343 PRK11153, metN, DL-methionine transporter ATP-bind 4e-23
PRK13637287 PRK13637, cbiO, cobalt transporter ATP-binding sub 5e-23
cd03263220 cd03263, ABC_subfamily_A, ATP-binding cassette dom 5e-23
PRK13648269 PRK13648, cbiO, cobalt transporter ATP-binding sub 6e-23
COG1127263 COG1127, Ttg2A, ABC-type transport system involved 7e-23
cd03293220 cd03293, ABC_NrtD_SsuB_transporters, ATP-binding c 1e-22
COG1123 539 COG1123, COG1123, ATPase components of various ABC 1e-22
cd03292214 cd03292, ABC_FtsE_transporter, ATP-binding cassett 1e-22
COG0444316 COG0444, DppD, ABC-type dipeptide/oligopeptide/nic 1e-22
COG0411250 COG0411, LivG, ABC-type branched-chain amino acid 1e-22
COG2884223 COG2884, FtsE, Predicted ATPase involved in cell d 1e-22
cd03294269 cd03294, ABC_Pro_Gly_Betaine, ATP-binding cassette 1e-22
COG3839338 COG3839, MalK, ABC-type sugar transport systems, A 2e-22
PLN03232 1495 PLN03232, PLN03232, ABC transporter C family membe 2e-22
TIGR00972247 TIGR00972, 3a0107s01c2, phosphate ABC transporter, 2e-22
cd03294269 cd03294, ABC_Pro_Gly_Betaine, ATP-binding cassette 3e-22
cd03224222 cd03224, ABC_TM1139_LivF_branched, ATP-binding cas 3e-22
TIGR01186 363 TIGR01186, proV, glycine betaine/L-proline transpo 3e-22
COG1117253 COG1117, PstB, ABC-type phosphate transport system 4e-22
TIGR02314343 TIGR02314, ABC_MetN, D-methionine ABC transporter, 4e-22
cd03300232 cd03300, ABC_PotA_N, ATP-binding cassette domain o 4e-22
COG3840231 COG3840, ThiQ, ABC-type thiamine transport system, 5e-22
cd03299235 cd03299, ABC_ModC_like, ATP-binding cassette domai 6e-22
TIGR01166190 TIGR01166, cbiO, cobalt transport protein ATP-bind 8e-22
PRK13633280 PRK13633, PRK13633, cobalt transporter ATP-binding 1e-21
COG4555245 COG4555, NatA, ABC-type Na+ transport system, ATPa 1e-21
TIGR03864236 TIGR03864, PQQ_ABC_ATP, ABC transporter, ATP-bindi 1e-21
cd03235213 cd03235, ABC_Metallic_Cations, ATP-binding cassett 1e-21
COG1126240 COG1126, GlnQ, ABC-type polar amino acid transport 2e-21
COG0411250 COG0411, LivG, ABC-type branched-chain amino acid 2e-21
cd03213194 cd03213, ABCG_EPDR, Eye pigment and drug resistanc 3e-21
PRK09452 375 PRK09452, potA, putrescine/spermidine ABC transpor 3e-21
PRK13652277 PRK13652, cbiO, cobalt transporter ATP-binding sub 3e-21
cd03301213 cd03301, ABC_MalK_N, The N-terminal ATPase domain 4e-21
pfam00005119 pfam00005, ABC_tran, ABC transporter 4e-21
COG4598256 COG4598, HisP, ABC-type histidine transport system 5e-21
cd03214180 cd03214, ABC_Iron-Siderophores_B12_Hemin, ATP-bind 6e-21
PRK13648269 PRK13648, cbiO, cobalt transporter ATP-binding sub 6e-21
cd03234226 cd03234, ABCG_White, White pigment protein homolog 6e-21
cd03263220 cd03263, ABC_subfamily_A, ATP-binding cassette dom 7e-21
COG4619223 COG4619, COG4619, ABC-type uncharacterized transpo 7e-21
PLN031301622 PLN03130, PLN03130, ABC transporter C family membe 8e-21
PRK14270251 PRK14270, PRK14270, phosphate ABC transporter ATP- 9e-21
COG1116248 COG1116, TauB, ABC-type nitrate/sulfonate/bicarbon 1e-20
COG1129 500 COG1129, MglA, ABC-type sugar transport system, AT 1e-20
cd03298211 cd03298, ABC_ThiQ_thiamine_transporter, ATP-bindin 1e-20
PRK13647274 PRK13647, cbiO, cobalt transporter ATP-binding sub 2e-20
cd03224222 cd03224, ABC_TM1139_LivF_branched, ATP-binding cas 2e-20
TIGR03864236 TIGR03864, PQQ_ABC_ATP, ABC transporter, ATP-bindi 2e-20
PRK13639275 PRK13639, cbiO, cobalt transporter ATP-binding sub 2e-20
PRK10619257 PRK10619, PRK10619, histidine/lysine/arginine/orni 2e-20
PTZ00243 1560 PTZ00243, PTZ00243, ABC transporter; Provisional 3e-20
PRK11153343 PRK11153, metN, DL-methionine transporter ATP-bind 3e-20
TIGR01166190 TIGR01166, cbiO, cobalt transport protein ATP-bind 3e-20
TIGR012711490 TIGR01271, CFTR_protein, cystic fibrosis transmemb 3e-20
PRK14254285 PRK14254, PRK14254, phosphate ABC transporter ATP- 4e-20
PRK14262250 PRK14262, PRK14262, phosphate ABC transporter ATP- 4e-20
TIGR01277213 TIGR01277, thiQ, thiamine ABC transporter, ATP-bin 5e-20
PRK14251251 PRK14251, PRK14251, phosphate ABC transporter ATP- 9e-20
TIGR02673214 TIGR02673, FtsE, cell division ATP-binding protein 9e-20
COG3638258 COG3638, COG3638, ABC-type phosphate/phosphonate t 1e-19
PRK14269246 PRK14269, PRK14269, phosphate ABC transporter ATP- 1e-19
PRK14269246 PRK14269, PRK14269, phosphate ABC transporter ATP- 1e-19
PRK13650279 PRK13650, cbiO, cobalt transporter ATP-binding sub 1e-19
PRK13642277 PRK13642, cbiO, cobalt transporter ATP-binding sub 1e-19
COG2884223 COG2884, FtsE, Predicted ATPase involved in cell d 2e-19
cd03300232 cd03300, ABC_PotA_N, ATP-binding cassette domain o 2e-19
cd03299235 cd03299, ABC_ModC_like, ATP-binding cassette domai 2e-19
PRK13636283 PRK13636, cbiO, cobalt transporter ATP-binding sub 2e-19
PRK14257329 PRK14257, PRK14257, phosphate ABC transporter ATP- 2e-19
COG0410237 COG0410, LivF, ABC-type branched-chain amino acid 2e-19
PRK10535 648 PRK10535, PRK10535, macrolide transporter ATP-bind 2e-19
PRK14240250 PRK14240, PRK14240, phosphate transporter ATP-bind 2e-19
COG1124252 COG1124, DppF, ABC-type dipeptide/oligopeptide/nic 3e-19
COG4175386 COG4175, ProV, ABC-type proline/glycine betaine tr 3e-19
TIGR00968237 TIGR00968, 3a0106s01, sulfate ABC transporter, ATP 3e-19
PRK14235267 PRK14235, PRK14235, phosphate transporter ATP-bind 3e-19
cd03291282 cd03291, ABCC_CFTR1, ATP-binding cassette domain o 3e-19
TIGR03873256 TIGR03873, F420-0_ABC_ATP, proposed F420-0 ABC tra 3e-19
COG4525259 COG4525, TauB, ABC-type taurine transport system, 3e-19
TIGR01186363 TIGR01186, proV, glycine betaine/L-proline transpo 5e-19
PRK13652277 PRK13652, cbiO, cobalt transporter ATP-binding sub 5e-19
cd03289275 cd03289, ABCC_CFTR2, ATP-binding cassette domain 2 5e-19
cd03226205 cd03226, ABC_cobalt_CbiO_domain2, Second domain of 5e-19
PRK14236272 PRK14236, PRK14236, phosphate transporter ATP-bind 5e-19
COG0444316 COG0444, DppD, ABC-type dipeptide/oligopeptide/nic 6e-19
PRK14246257 PRK14246, PRK14246, phosphate ABC transporter ATP- 6e-19
PRK14261253 PRK14261, PRK14261, phosphate ABC transporter ATP- 7e-19
COG4167267 COG4167, SapF, ABC-type antimicrobial peptide tran 8e-19
PTZ002651466 PTZ00265, PTZ00265, multidrug resistance protein ( 1e-18
TIGR02673214 TIGR02673, FtsE, cell division ATP-binding protein 1e-18
COG0410237 COG0410, LivF, ABC-type branched-chain amino acid 1e-18
PRK13644274 PRK13644, cbiO, cobalt transporter ATP-binding sub 1e-18
PRK13641287 PRK13641, cbiO, cobalt transporter ATP-binding sub 1e-18
cd03290218 cd03290, ABCC_SUR1_N, ATP-binding cassette domain 1e-18
COG1123539 COG1123, COG1123, ATPase components of various ABC 2e-18
cd03226205 cd03226, ABC_cobalt_CbiO_domain2, Second domain of 2e-18
PRK14253249 PRK14253, PRK14253, phosphate ABC transporter ATP- 2e-18
PRK13649280 PRK13649, cbiO, cobalt transporter ATP-binding sub 2e-18
PRK14249251 PRK14249, PRK14249, phosphate ABC transporter ATP- 2e-18
cd03296239 cd03296, ABC_CysA_sulfate_importer, ATP-binding ca 2e-18
PRK09493240 PRK09493, glnQ, glutamine ABC transporter ATP-bind 2e-18
PRK11264250 PRK11264, PRK11264, putative amino-acid ABC transp 2e-18
cd03262213 cd03262, ABC_HisP_GlnQ, ATP-binding cassette domai 3e-18
PRK10070400 PRK10070, PRK10070, glycine betaine transporter AT 3e-18
TIGR02982220 TIGR02982, heterocyst_DevA, ABC exporter ATP-bindi 3e-18
TIGR01187 325 TIGR01187, potA, spermidine/putrescine ABC transpo 3e-18
COG1118345 COG1118, CysA, ABC-type sulfate/molybdate transpor 4e-18
PRK14266250 PRK14266, PRK14266, phosphate ABC transporter ATP- 4e-18
cd03268208 cd03268, ABC_BcrA_bacitracin_resist, ATP-binding c 4e-18
cd03216163 cd03216, ABC_Carb_Monos_I, First domain of the ATP 4e-18
PRK13646286 PRK13646, cbiO, cobalt transporter ATP-binding sub 6e-18
PRK10070 400 PRK10070, PRK10070, glycine betaine transporter AT 7e-18
PRK13637287 PRK13637, cbiO, cobalt transporter ATP-binding sub 8e-18
PRK14244251 PRK14244, PRK14244, phosphate ABC transporter ATP- 8e-18
PRK11231255 PRK11231, fecE, iron-dicitrate transporter ATP-bin 8e-18
PLN032321495 PLN03232, PLN03232, ABC transporter C family membe 1e-17
COG1129500 COG1129, MglA, ABC-type sugar transport system, AT 1e-17
PRK14242253 PRK14242, PRK14242, phosphate transporter ATP-bind 1e-17
COG3845 501 COG3845, COG3845, ABC-type uncharacterized transpo 1e-17
PRK15112267 PRK15112, PRK15112, antimicrobial peptide ABC syst 1e-17
PRK14245250 PRK14245, PRK14245, phosphate ABC transporter ATP- 1e-17
COG1123539 COG1123, COG1123, ATPase components of various ABC 2e-17
cd03256241 cd03256, ABC_PhnC_transporter, ATP-binding cassett 2e-17
PRK13635279 PRK13635, cbiO, cobalt transporter ATP-binding sub 2e-17
PTZ002431560 PTZ00243, PTZ00243, ABC transporter; Provisional 2e-17
COG4619223 COG4619, COG4619, ABC-type uncharacterized transpo 2e-17
TIGR009571522 TIGR00957, MRP_assoc_pro, multi drug resistance-as 3e-17
TIGR03608206 TIGR03608, L_ocin_972_ABC, putative bacteriocin ex 3e-17
PRK13642277 PRK13642, cbiO, cobalt transporter ATP-binding sub 3e-17
PRK14236272 PRK14236, PRK14236, phosphate transporter ATP-bind 3e-17
COG4172534 COG4172, COG4172, ABC-type uncharacterized transpo 3e-17
PRK10247225 PRK10247, PRK10247, putative ABC transporter ATP-b 3e-17
PRK14260259 PRK14260, PRK14260, phosphate ABC transporter ATP- 3e-17
cd03297214 cd03297, ABC_ModC_molybdenum_transporter, ATP-bind 3e-17
COG4167267 COG4167, SapF, ABC-type antimicrobial peptide tran 4e-17
PRK09536 402 PRK09536, btuD, corrinoid ABC transporter ATPase; 4e-17
PRK13634290 PRK13634, cbiO, cobalt transporter ATP-binding sub 4e-17
TIGR01271 1490 TIGR01271, CFTR_protein, cystic fibrosis transmemb 5e-17
cd03268208 cd03268, ABC_BcrA_bacitracin_resist, ATP-binding c 5e-17
TIGR01194555 TIGR01194, cyc_pep_trnsptr, cyclic peptide transpo 5e-17
TIGR02142354 TIGR02142, modC_ABC, molybdenum ABC transporter, A 5e-17
cd03235213 cd03235, ABC_Metallic_Cations, ATP-binding cassett 6e-17
PRK14237267 PRK14237, PRK14237, phosphate transporter ATP-bind 6e-17
TIGR02211221 TIGR02211, LolD_lipo_ex, lipoprotein releasing sys 7e-17
TIGR00968237 TIGR00968, 3a0106s01, sulfate ABC transporter, ATP 8e-17
PRK14244251 PRK14244, PRK14244, phosphate ABC transporter ATP- 9e-17
COG4181228 COG4181, COG4181, Predicted ABC-type transport sys 9e-17
PRK13650279 PRK13650, cbiO, cobalt transporter ATP-binding sub 1e-16
COG4525259 COG4525, TauB, ABC-type taurine transport system, 1e-16
cd03296239 cd03296, ABC_CysA_sulfate_importer, ATP-binding ca 1e-16
PRK10771232 PRK10771, thiQ, thiamine transporter ATP-binding s 1e-16
COG0396251 COG0396, sufC, Cysteine desulfurase activator ATPa 1e-16
cd03266218 cd03266, ABC_NatA_sodium_exporter, ATP-binding cas 1e-16
PRK14262250 PRK14262, PRK14262, phosphate ABC transporter ATP- 2e-16
PRK14271276 PRK14271, PRK14271, phosphate ABC transporter ATP- 2e-16
PRK14247250 PRK14247, PRK14247, phosphate ABC transporter ATP- 2e-16
PRK14252265 PRK14252, PRK14252, phosphate ABC transporter ATP- 2e-16
PRK14239252 PRK14239, PRK14239, phosphate transporter ATP-bind 2e-16
PRK10744260 PRK10744, pstB, phosphate transporter ATP-binding 3e-16
PRK14254285 PRK14254, PRK14254, phosphate ABC transporter ATP- 3e-16
PRK13636283 PRK13636, cbiO, cobalt transporter ATP-binding sub 3e-16
PRK13649280 PRK13649, cbiO, cobalt transporter ATP-binding sub 3e-16
PRK14245250 PRK14245, PRK14245, phosphate ABC transporter ATP- 3e-16
COG4161242 COG4161, ArtP, ABC-type arginine transport system, 3e-16
TIGR02142 354 TIGR02142, modC_ABC, molybdenum ABC transporter, A 5e-16
COG1119257 COG1119, ModF, ABC-type molybdenum transport syste 5e-16
PRK14240250 PRK14240, PRK14240, phosphate transporter ATP-bind 6e-16
COG1119257 COG1119, ModF, ABC-type molybdenum transport syste 6e-16
PRK10575265 PRK10575, PRK10575, iron-hydroxamate transporter A 6e-16
PRK14246257 PRK14246, PRK14246, phosphate ABC transporter ATP- 7e-16
COG4604252 COG4604, CeuD, ABC-type enterochelin transport sys 7e-16
TIGR02314343 TIGR02314, ABC_MetN, D-methionine ABC transporter, 9e-16
cd03264211 cd03264, ABC_drug_resistance_like, ABC-type multid 9e-16
PRK14266250 PRK14266, PRK14266, phosphate ABC transporter ATP- 1e-15
PRK13539207 PRK13539, PRK13539, cytochrome c biogenesis protei 1e-15
TIGR03265 353 TIGR03265, PhnT2, putative 2-aminoethylphosphonate 1e-15
PRK11607 377 PRK11607, potG, putrescine transporter ATP-binding 1e-15
COG4555245 COG4555, NatA, ABC-type Na+ transport system, ATPa 2e-15
PRK13639275 PRK13639, cbiO, cobalt transporter ATP-binding sub 2e-15
PRK14237267 PRK14237, PRK14237, phosphate transporter ATP-bind 2e-15
PRK14247250 PRK14247, PRK14247, phosphate ABC transporter ATP- 2e-15
PRK14273254 PRK14273, PRK14273, phosphate ABC transporter ATP- 2e-15
PRK14275286 PRK14275, PRK14275, phosphate ABC transporter ATP- 2e-15
COG1134249 COG1134, TagH, ABC-type polysaccharide/polyol phos 2e-15
PRK14243264 PRK14243, PRK14243, phosphate transporter ATP-bind 2e-15
PRK13645289 PRK13645, cbiO, cobalt transporter ATP-binding sub 2e-15
PTZ002431560 PTZ00243, PTZ00243, ABC transporter; Provisional 3e-15
PRK09452375 PRK09452, potA, putrescine/spermidine ABC transpor 3e-15
PRK14270251 PRK14270, PRK14270, phosphate ABC transporter ATP- 3e-15
COG4615546 COG4615, PvdE, ABC-type siderophore export system, 3e-15
TIGR03005252 TIGR03005, ectoine_ehuA, ectoine/hydroxyectoine AB 3e-15
PRK14249251 PRK14249, PRK14249, phosphate ABC transporter ATP- 4e-15
PRK14242253 PRK14242, PRK14242, phosphate transporter ATP-bind 4e-15
COG1134249 COG1134, TagH, ABC-type polysaccharide/polyol phos 4e-15
PRK13548258 PRK13548, hmuV, hemin importer ATP-binding subunit 4e-15
cd03231201 cd03231, ABC_CcmA_heme_exporter, Cytochrome c biog 4e-15
PRK14258261 PRK14258, PRK14258, phosphate ABC transporter ATP- 4e-15
TIGR02769265 TIGR02769, nickel_nikE, nickel import ATP-binding 4e-15
PRK13644274 PRK13644, cbiO, cobalt transporter ATP-binding sub 5e-15
TIGR02770230 TIGR02770, nickel_nikD, nickel import ATP-binding 5e-15
cd03217200 cd03217, ABC_FeS_Assembly, ABC-type transport syst 5e-15
PRK14264305 PRK14264, PRK14264, phosphate ABC transporter ATP- 6e-15
PRK11124242 PRK11124, artP, arginine transporter ATP-binding s 7e-15
TIGR03873256 TIGR03873, F420-0_ABC_ATP, proposed F420-0 ABC tra 8e-15
PRK14265274 PRK14265, PRK14265, phosphate ABC transporter ATP- 9e-15
TIGR03410230 TIGR03410, urea_trans_UrtE, urea ABC transporter, 9e-15
cd03297214 cd03297, ABC_ModC_molybdenum_transporter, ATP-bind 1e-14
PRK13645289 PRK13645, cbiO, cobalt transporter ATP-binding sub 1e-14
PRK14265274 PRK14265, PRK14265, phosphate ABC transporter ATP- 1e-14
PRK14274259 PRK14274, PRK14274, phosphate ABC transporter ATP- 1e-14
COG4148 352 COG4148, ModC, ABC-type molybdate transport system 1e-14
TIGR03258 362 TIGR03258, PhnT, 2-aminoethylphosphonate ABC trans 1e-14
PRK14268258 PRK14268, PRK14268, phosphate ABC transporter ATP- 1e-14
PRK13640282 PRK13640, cbiO, cobalt transporter ATP-binding sub 1e-14
COG4608268 COG4608, AppF, ABC-type oligopeptide transport sys 1e-14
PRK14255252 PRK14255, PRK14255, phosphate ABC transporter ATP- 1e-14
COG3840231 COG3840, ThiQ, ABC-type thiamine transport system, 2e-14
pfam00005119 pfam00005, ABC_tran, ABC transporter 2e-14
PRK14257329 PRK14257, PRK14257, phosphate ABC transporter ATP- 2e-14
PRK14253249 PRK14253, PRK14253, phosphate ABC transporter ATP- 2e-14
PRK14271276 PRK14271, PRK14271, phosphate ABC transporter ATP- 2e-14
COG1101263 COG1101, PhnK, ABC-type uncharacterized transport 2e-14
TIGR00955 617 TIGR00955, 3a01204, The Eye Pigment Precursor Tran 2e-14
COG4559259 COG4559, COG4559, ABC-type hemin transport system, 2e-14
PRK14241258 PRK14241, PRK14241, phosphate transporter ATP-bind 2e-14
cd03220224 cd03220, ABC_KpsT_Wzt, ATP-binding cassette compon 2e-14
cd03213194 cd03213, ABCG_EPDR, Eye pigment and drug resistanc 3e-14
TIGR01187325 TIGR01187, potA, spermidine/putrescine ABC transpo 3e-14
PRK09536402 PRK09536, btuD, corrinoid ABC transporter ATPase; 3e-14
COG0396251 COG0396, sufC, Cysteine desulfurase activator ATPa 3e-14
cd03218232 cd03218, ABC_YhbG, ATP-binding cassette component 3e-14
cd03301213 cd03301, ABC_MalK_N, The N-terminal ATPase domain 4e-14
PRK14273254 PRK14273, PRK14273, phosphate ABC transporter ATP- 4e-14
cd03217200 cd03217, ABC_FeS_Assembly, ABC-type transport syst 4e-14
TIGR03410230 TIGR03410, urea_trans_UrtE, urea ABC transporter, 4e-14
PRK14259269 PRK14259, PRK14259, phosphate ABC transporter ATP- 4e-14
TIGR02211221 TIGR02211, LolD_lipo_ex, lipoprotein releasing sys 5e-14
cd03291282 cd03291, ABCC_CFTR1, ATP-binding cassette domain o 6e-14
PRK14263261 PRK14263, PRK14263, phosphate ABC transporter ATP- 6e-14
TIGR012711490 TIGR01271, CFTR_protein, cystic fibrosis transmemb 7e-14
PRK14268258 PRK14268, PRK14268, phosphate ABC transporter ATP- 8e-14
PRK14256252 PRK14256, PRK14256, phosphate ABC transporter ATP- 8e-14
cd03290218 cd03290, ABCC_SUR1_N, ATP-binding cassette domain 9e-14
PRK14252265 PRK14252, PRK14252, phosphate ABC transporter ATP- 9e-14
PRK14248268 PRK14248, PRK14248, phosphate ABC transporter ATP- 9e-14
PRK14260259 PRK14260, PRK14260, phosphate ABC transporter ATP- 1e-13
PRK10575265 PRK10575, PRK10575, iron-hydroxamate transporter A 1e-13
PRK14243264 PRK14243, PRK14243, phosphate transporter ATP-bind 1e-13
COG4608268 COG4608, AppF, ABC-type oligopeptide transport sys 1e-13
PRK15439510 PRK15439, PRK15439, autoinducer 2 ABC transporter 1e-13
PRK13536340 PRK13536, PRK13536, nodulation factor exporter sub 1e-13
PRK13537306 PRK13537, PRK13537, nodulation ABC transporter Nod 1e-13
PRK14267253 PRK14267, PRK14267, phosphate ABC transporter ATP- 1e-13
PRK14272252 PRK14272, PRK14272, phosphate ABC transporter ATP- 1e-13
COG1121254 COG1121, ZnuC, ABC-type Mn/Zn transport systems, A 2e-13
PRK14261253 PRK14261, PRK14261, phosphate ABC transporter ATP- 2e-13
PRK13646286 PRK13646, cbiO, cobalt transporter ATP-binding sub 2e-13
COG4172534 COG4172, COG4172, ABC-type uncharacterized transpo 2e-13
PRK14239252 PRK14239, PRK14239, phosphate transporter ATP-bind 2e-13
COG4674249 COG4674, COG4674, Uncharacterized ABC-type transpo 2e-13
COG1137243 COG1137, YhbG, ABC-type (unclassified) transport s 2e-13
COG1137243 COG1137, YhbG, ABC-type (unclassified) transport s 2e-13
TIGR03740223 TIGR03740, galliderm_ABC, gallidermin-class lantib 2e-13
cd03264211 cd03264, ABC_drug_resistance_like, ABC-type multid 3e-13
TIGR01184230 TIGR01184, ntrCD, nitrate transport ATP-binding su 3e-13
COG4136213 COG4136, COG4136, ABC-type uncharacterized transpo 3e-13
COG0488530 COG0488, Uup, ATPase components of ABC transporter 3e-13
PRK11231255 PRK11231, fecE, iron-dicitrate transporter ATP-bin 4e-13
COG4172 534 COG4172, COG4172, ABC-type uncharacterized transpo 4e-13
PRK13651305 PRK13651, PRK13651, cobalt transporter ATP-binding 4e-13
PRK13631320 PRK13631, cbiO, cobalt transporter ATP-binding sub 4e-13
PRK13643288 PRK13643, cbiO, cobalt transporter ATP-binding sub 4e-13
PRK14264305 PRK14264, PRK14264, phosphate ABC transporter ATP- 5e-13
TIGR01288303 TIGR01288, nodI, ATP-binding ABC transporter famil 5e-13
TIGR02315243 TIGR02315, ABC_phnC, phosphonate ABC transporter, 6e-13
PRK10247225 PRK10247, PRK10247, putative ABC transporter ATP-b 6e-13
PRK13536340 PRK13536, PRK13536, nodulation factor exporter sub 6e-13
cd03265220 cd03265, ABC_DrrA, Daunorubicin/doxorubicin resist 6e-13
PRK14235267 PRK14235, PRK14235, phosphate transporter ATP-bind 7e-13
PRK09493240 PRK09493, glnQ, glutamine ABC transporter ATP-bind 7e-13
PRK14263261 PRK14263, PRK14263, phosphate ABC transporter ATP- 7e-13
PRK13638271 PRK13638, cbiO, cobalt transporter ATP-binding sub 7e-13
cd03220224 cd03220, ABC_KpsT_Wzt, ATP-binding cassette compon 8e-13
cd03218232 cd03218, ABC_YhbG, ATP-binding cassette component 9e-13
PRK11308327 PRK11308, dppF, dipeptide transporter ATP-binding 9e-13
PRK11607377 PRK11607, potG, putrescine transporter ATP-binding 1e-12
COG4148352 COG4148, ModC, ABC-type molybdate transport system 1e-12
PRK14255252 PRK14255, PRK14255, phosphate ABC transporter ATP- 1e-12
PRK11308327 PRK11308, dppF, dipeptide transporter ATP-binding 1e-12
TIGR03269 520 TIGR03269, met_CoM_red_A2, methyl coenzyme M reduc 1e-12
TIGR02324224 TIGR02324, CP_lyasePhnL, phosphonate C-P lyase sys 1e-12
PRK11300255 PRK11300, livG, leucine/isoleucine/valine transpor 1e-12
COG3845501 COG3845, COG3845, ABC-type uncharacterized transpo 2e-12
PRK15112267 PRK15112, PRK15112, antimicrobial peptide ABC syst 2e-12
COG4181228 COG4181, COG4181, Predicted ABC-type transport sys 2e-12
cd03266218 cd03266, ABC_NatA_sodium_exporter, ATP-binding cas 2e-12
PRK14275286 PRK14275, PRK14275, phosphate ABC transporter ATP- 2e-12
PRK14241258 PRK14241, PRK14241, phosphate transporter ATP-bind 2e-12
PRK14248268 PRK14248, PRK14248, phosphate ABC transporter ATP- 2e-12
TIGR01189198 TIGR01189, ccmA, heme ABC exporter, ATP-binding pr 2e-12
TIGR03415 382 TIGR03415, ABC_choXWV_ATP, choline ABC transporter 2e-12
PRK14238271 PRK14238, PRK14238, phosphate transporter ATP-bind 2e-12
cd03269210 cd03269, ABC_putative_ATPase, ATP-binding cassette 2e-12
TIGR03005252 TIGR03005, ectoine_ehuA, ectoine/hydroxyectoine AB 3e-12
PRK13537306 PRK13537, PRK13537, nodulation ABC transporter Nod 3e-12
PRK13631320 PRK13631, cbiO, cobalt transporter ATP-binding sub 3e-12
PRK11288 501 PRK11288, araG, L-arabinose transporter ATP-bindin 3e-12
COG4604252 COG4604, CeuD, ABC-type enterochelin transport sys 4e-12
PRK14258261 PRK14258, PRK14258, phosphate ABC transporter ATP- 4e-12
PRK14238271 PRK14238, PRK14238, phosphate transporter ATP-bind 4e-12
PRK11248255 PRK11248, tauB, taurine transporter ATP-binding su 4e-12
TIGR01978243 TIGR01978, sufC, FeS assembly ATPase SufC 4e-12
PRK14274259 PRK14274, PRK14274, phosphate ABC transporter ATP- 5e-12
PRK14256252 PRK14256, PRK14256, phosphate ABC transporter ATP- 5e-12
PRK11629233 PRK11629, lolD, lipoprotein transporter ATP-bindin 5e-12
PRK10419268 PRK10419, nikE, nickel transporter ATP-binding pro 5e-12
PRK11614237 PRK11614, livF, leucine/isoleucine/valine transpor 6e-12
PRK10851 353 PRK10851, PRK10851, sulfate/thiosulfate transporte 6e-12
PRK11000 369 PRK11000, PRK11000, maltose/maltodextrin transport 6e-12
PRK13634290 PRK13634, cbiO, cobalt transporter ATP-binding sub 9e-12
PRK13633280 PRK13633, PRK13633, cobalt transporter ATP-binding 1e-11
PRK13641287 PRK13641, cbiO, cobalt transporter ATP-binding sub 1e-11
TIGR02982220 TIGR02982, heterocyst_DevA, ABC exporter ATP-bindi 1e-11
COG1101263 COG1101, PhnK, ABC-type uncharacterized transport 1e-11
PRK14272252 PRK14272, PRK14272, phosphate ABC transporter ATP- 1e-11
COG0488530 COG0488, Uup, ATPase components of ABC transporter 1e-11
PRK09700 510 PRK09700, PRK09700, D-allose transporter ATP-bindi 1e-11
PRK09984262 PRK09984, PRK09984, phosphonate/organophosphate es 1e-11
COG4133209 COG4133, CcmA, ABC-type transport system involved 1e-11
PRK11831269 PRK11831, PRK11831, putative ABC transporter ATP-b 1e-11
cd03216163 cd03216, ABC_Carb_Monos_I, First domain of the ATP 2e-11
TIGR03265353 TIGR03265, PhnT2, putative 2-aminoethylphosphonate 2e-11
TIGR01288303 TIGR01288, nodI, ATP-binding ABC transporter famil 2e-11
PRK10908222 PRK10908, PRK10908, cell division protein FtsE; Pr 2e-11
cd03215182 cd03215, ABC_Carb_Monos_II, Second domain of the A 2e-11
TIGR01188302 TIGR01188, drrA, daunorubicin resistance ABC trans 2e-11
cd03298211 cd03298, ABC_ThiQ_thiamine_transporter, ATP-bindin 3e-11
PRK14251251 PRK14251, PRK14251, phosphate ABC transporter ATP- 3e-11
COG4161242 COG4161, ArtP, ABC-type arginine transport system, 3e-11
PRK13640282 PRK13640, cbiO, cobalt transporter ATP-binding sub 3e-11
COG4674249 COG4674, COG4674, Uncharacterized ABC-type transpo 3e-11
COG4598256 COG4598, HisP, ABC-type histidine transport system 4e-11
TIGR02769265 TIGR02769, nickel_nikE, nickel import ATP-binding 4e-11
TIGR01184230 TIGR01184, ntrCD, nitrate transport ATP-binding su 4e-11
TIGR01194555 TIGR01194, cyc_pep_trnsptr, cyclic peptide transpo 5e-11
PRK11432 351 PRK11432, fbpC, ferric transporter ATP-binding sub 6e-11
PRK10253265 PRK10253, PRK10253, iron-enterobactin transporter 7e-11
TIGR03522301 TIGR03522, GldA_ABC_ATP, gliding motility-associat 7e-11
TIGR01257 2272 TIGR01257, rim_protein, retinal-specific rim ABC t 8e-11
cd03267236 cd03267, ABC_NatA_like, ATP-binding cassette domai 8e-11
cd03289275 cd03289, ABCC_CFTR2, ATP-binding cassette domain 2 9e-11
PRK15134 529 PRK15134, PRK15134, microcin C ABC transporter ATP 9e-11
TIGR03258362 TIGR03258, PhnT, 2-aminoethylphosphonate ABC trans 2e-10
PRK14259269 PRK14259, PRK14259, phosphate ABC transporter ATP- 2e-10
PRK15439 510 PRK15439, PRK15439, autoinducer 2 ABC transporter 2e-10
PRK14267253 PRK14267, PRK14267, phosphate ABC transporter ATP- 2e-10
COG0488 530 COG0488, Uup, ATPase components of ABC transporter 2e-10
PRK13638271 PRK13638, cbiO, cobalt transporter ATP-binding sub 2e-10
COG4133209 COG4133, CcmA, ABC-type transport system involved 2e-10
TIGR01188302 TIGR01188, drrA, daunorubicin resistance ABC trans 2e-10
PRK13540200 PRK13540, PRK13540, cytochrome c biogenesis protei 2e-10
PRK15079331 PRK15079, PRK15079, oligopeptide ABC transporter A 2e-10
PRK10261623 PRK10261, PRK10261, glutathione transporter ATP-bi 2e-10
PRK11247257 PRK11247, ssuB, aliphatic sulfonates transport ATP 2e-10
TIGR01277213 TIGR01277, thiQ, thiamine ABC transporter, ATP-bin 3e-10
COG4172534 COG4172, COG4172, ABC-type uncharacterized transpo 3e-10
PRK13539207 PRK13539, PRK13539, cytochrome c biogenesis protei 4e-10
cd03231201 cd03231, ABC_CcmA_heme_exporter, Cytochrome c biog 4e-10
TIGR03740223 TIGR03740, galliderm_ABC, gallidermin-class lantib 4e-10
COG4178604 COG4178, COG4178, ABC-type uncharacterized transpo 4e-10
COG4586325 COG4586, COG4586, ABC-type uncharacterized transpo 4e-10
PRK11432351 PRK11432, fbpC, ferric transporter ATP-binding sub 5e-10
PRK15134529 PRK15134, PRK15134, microcin C ABC transporter ATP 5e-10
PRK13538204 PRK13538, PRK13538, cytochrome c biogenesis protei 5e-10
PRK13549 506 PRK13549, PRK13549, xylose transporter ATP-binding 5e-10
PRK13643288 PRK13643, cbiO, cobalt transporter ATP-binding sub 6e-10
COG4778235 COG4778, PhnL, ABC-type phosphonate transport syst 6e-10
CHL00131252 CHL00131, ycf16, sulfate ABC transporter protein; 6e-10
PRK10535648 PRK10535, PRK10535, macrolide transporter ATP-bind 7e-10
TIGR02770230 TIGR02770, nickel_nikD, nickel import ATP-binding 7e-10
PRK10419268 PRK10419, nikE, nickel transporter ATP-binding pro 7e-10
TIGR03411242 TIGR03411, urea_trans_UrtD, urea ABC transporter, 7e-10
COG0488530 COG0488, Uup, ATPase components of ABC transporter 8e-10
PRK11300255 PRK11300, livG, leucine/isoleucine/valine transpor 8e-10
PRK11248255 PRK11248, tauB, taurine transporter ATP-binding su 8e-10
cd03215182 cd03215, ABC_Carb_Monos_II, Second domain of the A 9e-10
PRK10584228 PRK10584, PRK10584, putative ABC transporter ATP-b 9e-10
PRK11264250 PRK11264, PRK11264, putative amino-acid ABC transp 1e-09
PRK13651305 PRK13651, PRK13651, cobalt transporter ATP-binding 1e-09
PRK10522547 PRK10522, PRK10522, multidrug transporter membrane 1e-09
TIGR03771223 TIGR03771, anch_rpt_ABC, anchored repeat-type ABC 1e-09
PLN03211 659 PLN03211, PLN03211, ABC transporter G-25; Provisio 1e-09
cd03234226 cd03234, ABCG_White, White pigment protein homolog 2e-09
cd03269210 cd03269, ABC_putative_ATPase, ATP-binding cassette 2e-09
TIGR01257 2272 TIGR01257, rim_protein, retinal-specific rim ABC t 2e-09
PRK10619257 PRK10619, PRK10619, histidine/lysine/arginine/orni 3e-09
COG4136213 COG4136, COG4136, ABC-type uncharacterized transpo 3e-09
TIGR02633 500 TIGR02633, xylG, D-xylose ABC transporter, ATP-bin 3e-09
COG4152300 COG4152, COG4152, ABC-type uncharacterized transpo 3e-09
PRK13548258 PRK13548, hmuV, hemin importer ATP-binding subunit 4e-09
COG4559259 COG4559, COG4559, ABC-type hemin transport system, 4e-09
TIGR01189198 TIGR01189, ccmA, heme ABC exporter, ATP-binding pr 5e-09
PRK15079331 PRK15079, PRK15079, oligopeptide ABC transporter A 5e-09
TIGR03411242 TIGR03411, urea_trans_UrtD, urea ABC transporter, 5e-09
cd03265220 cd03265, ABC_DrrA, Daunorubicin/doxorubicin resist 6e-09
PRK10895241 PRK10895, PRK10895, lipopolysaccharide ABC transpo 7e-09
PRK10771232 PRK10771, thiQ, thiamine transporter ATP-binding s 8e-09
PRK10908222 PRK10908, PRK10908, cell division protein FtsE; Pr 8e-09
COG1129500 COG1129, MglA, ABC-type sugar transport system, AT 9e-09
COG4615546 COG4615, PvdE, ABC-type siderophore export system, 9e-09
COG4138248 COG4138, BtuD, ABC-type cobalamin transport system 1e-08
TIGR02323253 TIGR02323, CP_lyasePhnK, phosphonate C-P lyase sys 1e-08
TIGR012711490 TIGR01271, CFTR_protein, cystic fibrosis transmemb 2e-08
TIGR03269520 TIGR03269, met_CoM_red_A2, methyl coenzyme M reduc 2e-08
TIGR01978243 TIGR01978, sufC, FeS assembly ATPase SufC 2e-08
PRK10895241 PRK10895, PRK10895, lipopolysaccharide ABC transpo 2e-08
COG4107258 COG4107, PhnK, ABC-type phosphonate transport syst 2e-08
PRK09700510 PRK09700, PRK09700, D-allose transporter ATP-bindi 3e-08
PRK10261623 PRK10261, PRK10261, glutathione transporter ATP-bi 3e-08
cd03232192 cd03232, ABCG_PDR_domain2, Second domain of the pl 3e-08
TIGR03522301 TIGR03522, GldA_ABC_ATP, gliding motility-associat 4e-08
PRK15134529 PRK15134, PRK15134, microcin C ABC transporter ATP 4e-08
PRK03695248 PRK03695, PRK03695, vitamin B12-transporter ATPase 5e-08
cd03222177 cd03222, ABC_RNaseL_inhibitor, ATP-binding cassett 6e-08
PRK11629233 PRK11629, lolD, lipoprotein transporter ATP-bindin 7e-08
PRK10522547 PRK10522, PRK10522, multidrug transporter membrane 7e-08
cd03223166 cd03223, ABCD_peroxisomal_ALDP, ATP-binding casset 8e-08
CHL00131252 CHL00131, ycf16, sulfate ABC transporter protein; 9e-08
COG1129500 COG1129, MglA, ABC-type sugar transport system, AT 1e-07
PRK11124242 PRK11124, artP, arginine transporter ATP-binding s 1e-07
TIGR00955617 TIGR00955, 3a01204, The Eye Pigment Precursor Tran 1e-07
PRK10261 623 PRK10261, PRK10261, glutathione transporter ATP-bi 1e-07
PRK11144352 PRK11144, modC, molybdate transporter ATP-binding 1e-07
PRK11144 352 PRK11144, modC, molybdate transporter ATP-binding 2e-07
PRK10418254 PRK10418, nikD, nickel transporter ATP-binding pro 2e-07
PRK11701258 PRK11701, phnK, phosphonate C-P lyase system prote 2e-07
cd03233202 cd03233, ABCG_PDR_domain1, First domain of the ple 2e-07
cd03237246 cd03237, ABC_RNaseL_inhibitor_domain2, The ATP-bin 2e-07
smart00382148 smart00382, AAA, ATPases associated with a variety 2e-07
PRK11614237 PRK11614, livF, leucine/isoleucine/valine transpor 3e-07
PRK10851353 PRK10851, PRK10851, sulfate/thiosulfate transporte 3e-07
PRK10253265 PRK10253, PRK10253, iron-enterobactin transporter 3e-07
PRK10584228 PRK10584, PRK10584, putative ABC transporter ATP-b 3e-07
TIGR02323253 TIGR02323, CP_lyasePhnK, phosphonate C-P lyase sys 3e-07
COG4178604 COG4178, COG4178, ABC-type uncharacterized transpo 4e-07
COG2401593 COG2401, COG2401, ABC-type ATPase fused to a predi 4e-07
PRK10762501 PRK10762, PRK10762, D-ribose transporter ATP bindi 5e-07
PRK09580248 PRK09580, sufC, cysteine desulfurase ATPase compon 5e-07
cd03221144 cd03221, ABCF_EF-3, ATP-binding cassette domain of 5e-07
PLN03211659 PLN03211, PLN03211, ABC transporter G-25; Provisio 6e-07
COG4586325 COG4586, COG4586, ABC-type uncharacterized transpo 7e-07
TIGR02324224 TIGR02324, CP_lyasePhnL, phosphonate C-P lyase sys 8e-07
PRK13543214 PRK13543, PRK13543, cytochrome c biogenesis protei 8e-07
PRK15134529 PRK15134, PRK15134, microcin C ABC transporter ATP 9e-07
COG4152300 COG4152, COG4152, ABC-type uncharacterized transpo 1e-06
cd03223166 cd03223, ABCD_peroxisomal_ALDP, ATP-binding casset 1e-06
PRK11022326 PRK11022, dppD, dipeptide transporter ATP-binding 1e-06
PRK11288501 PRK11288, araG, L-arabinose transporter ATP-bindin 2e-06
cd03267236 cd03267, ABC_NatA_like, ATP-binding cassette domai 2e-06
PLN03073718 PLN03073, PLN03073, ABC transporter F family; Prov 2e-06
cd03271261 cd03271, ABC_UvrA_II, ATP-binding cassette domain 2e-06
COG3845501 COG3845, COG3845, ABC-type uncharacterized transpo 3e-06
cd03271261 cd03271, ABC_UvrA_II, ATP-binding cassette domain 3e-06
PRK10762 501 PRK10762, PRK10762, D-ribose transporter ATP bindi 4e-06
PRK15093330 PRK15093, PRK15093, antimicrobial peptide ABC tran 4e-06
cd03238176 cd03238, ABC_UvrA, ATP-binding cassette domain of 4e-06
TIGR00956 1394 TIGR00956, 3a01205, Pleiotropic Drug Resistance (P 4e-06
COG3845501 COG3845, COG3845, ABC-type uncharacterized transpo 5e-06
TIGR03269520 TIGR03269, met_CoM_red_A2, methyl coenzyme M reduc 5e-06
PRK11000369 PRK11000, PRK11000, maltose/maltodextrin transport 5e-06
TIGR02633500 TIGR02633, xylG, D-xylose ABC transporter, ATP-bin 5e-06
TIGR03415382 TIGR03415, ABC_choXWV_ATP, choline ABC transporter 8e-06
PRK11650 356 PRK11650, ugpC, glycerol-3-phosphate transporter A 8e-06
PRK10982 491 PRK10982, PRK10982, galactose/methyl galaxtoside t 8e-06
PRK11831269 PRK11831, PRK11831, putative ABC transporter ATP-b 1e-05
COG4107258 COG4107, PhnK, ABC-type phosphonate transport syst 1e-05
PRK11701258 PRK11701, phnK, phosphonate C-P lyase system prote 1e-05
TIGR00954659 TIGR00954, 3a01203, Peroxysomal Fatty Acyl CoA Tra 1e-05
PRK13549506 PRK13549, PRK13549, xylose transporter ATP-binding 2e-05
COG4778235 COG4778, PhnL, ABC-type phosphonate transport syst 2e-05
cd03221144 cd03221, ABCF_EF-3, ATP-binding cassette domain of 2e-05
PRK10982491 PRK10982, PRK10982, galactose/methyl galaxtoside t 2e-05
PRK10418254 PRK10418, nikD, nickel transporter ATP-binding pro 3e-05
cd03221144 cd03221, ABCF_EF-3, ATP-binding cassette domain of 3e-05
PRK13547272 PRK13547, hmuV, hemin importer ATP-binding subunit 3e-05
COG1245591 COG1245, COG1245, Predicted ATPase, RNase L inhibi 3e-05
PRK10261623 PRK10261, PRK10261, glutathione transporter ATP-bi 5e-05
PRK13549506 PRK13549, PRK13549, xylose transporter ATP-binding 5e-05
TIGR012572272 TIGR01257, rim_protein, retinal-specific rim ABC t 7e-05
TIGR03771223 TIGR03771, anch_rpt_ABC, anchored repeat-type ABC 9e-05
TIGR02633500 TIGR02633, xylG, D-xylose ABC transporter, ATP-bin 1e-04
TIGR00956 1394 TIGR00956, 3a01205, Pleiotropic Drug Resistance (P 1e-04
PRK10636638 PRK10636, PRK10636, putative ABC transporter ATP-b 1e-04
PRK15056272 PRK15056, PRK15056, manganese/iron transporter ATP 1e-04
cd03227162 cd03227, ABC_Class2, ATP-binding cassette domain o 1e-04
cd03232192 cd03232, ABCG_PDR_domain2, Second domain of the pl 2e-04
PRK03695248 PRK03695, PRK03695, vitamin B12-transporter ATPase 2e-04
PRK10938490 PRK10938, PRK10938, putative molybdenum transport 2e-04
PRK09544251 PRK09544, znuC, high-affinity zinc transporter ATP 2e-04
PRK11288501 PRK11288, araG, L-arabinose transporter ATP-bindin 3e-04
PRK10636638 PRK10636, PRK10636, putative ABC transporter ATP-b 3e-04
PRK13409590 PRK13409, PRK13409, putative ATPase RIL; Provision 3e-04
TIGR03719552 TIGR03719, ABC_ABC_ChvD, ATP-binding cassette prot 3e-04
smart00382148 smart00382, AAA, ATPases associated with a variety 4e-04
COG4170330 COG4170, SapD, ABC-type antimicrobial peptide tran 4e-04
PRK09473330 PRK09473, oppD, oligopeptide transporter ATP-bindi 4e-04
PRK11247257 PRK11247, ssuB, aliphatic sulfonates transport ATP 5e-04
PRK13547272 PRK13547, hmuV, hemin importer ATP-binding subunit 5e-04
cd03233202 cd03233, ABCG_PDR_domain1, First domain of the ple 6e-04
cd03221144 cd03221, ABCF_EF-3, ATP-binding cassette domain of 6e-04
PRK006351809 PRK00635, PRK00635, excinuclease ABC subunit A; Pr 6e-04
TIGR03719 552 TIGR03719, ABC_ABC_ChvD, ATP-binding cassette prot 7e-04
cd03238176 cd03238, ABC_UvrA, ATP-binding cassette domain of 8e-04
PRK15056272 PRK15056, PRK15056, manganese/iron transporter ATP 0.001
PRK10938490 PRK10938, PRK10938, putative molybdenum transport 0.001
PRK11147635 PRK11147, PRK11147, ABC transporter ATPase compone 0.001
PRK10790592 PRK10790, PRK10790, putative multidrug transporter 0.002
PRK13540200 PRK13540, PRK13540, cytochrome c biogenesis protei 0.002
COG4138248 COG4138, BtuD, ABC-type cobalamin transport system 0.002
PRK11650356 PRK11650, ugpC, glycerol-3-phosphate transporter A 0.002
PRK09544251 PRK09544, znuC, high-affinity zinc transporter ATP 0.002
PLN031401470 PLN03140, PLN03140, ABC transporter G family membe 0.002
PRK09700510 PRK09700, PRK09700, D-allose transporter ATP-bindi 0.003
TIGR03719552 TIGR03719, ABC_ABC_ChvD, ATP-binding cassette prot 0.003
TIGR03269520 TIGR03269, met_CoM_red_A2, methyl coenzyme M reduc 0.004
>gnl|CDD|224055 COG1132, MdlB, ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms] Back     alignment and domain information
 Score =  391 bits (1005), Expect = e-122
 Identities = 188/580 (32%), Positives = 312/580 (53%), Gaps = 24/580 (4%)

Query: 715  SFWRLAELSFAEWLYAVLGSIGAAIFGSFNPLLAYVIGLIVTAYYKPEERHHLREEVNKW 774
               RL +    + L  +L  +   +    + LL  +IG I+ A            E+ + 
Sbjct: 3    LLRRLLKYLKYKLL--LLAILLLLLSALLSLLLPLLIGRIIDALLAD------LGELLEL 54

Query: 775  CLIIACMGVVTVVANFLQHFYFGIMGEKMTERVRRMMFSAMLRNEVGWFDEEENSADTLS 834
             L++  + ++  V   LQ +    +G+K+   +RR +F  +LR  + +FD+    +  L 
Sbjct: 55   LLLLLLLALLGGVLRALQSYLGSRLGQKIVADLRRDLFEKLLRLPLSFFDK--AKSGDLI 112

Query: 835  MRLANDATFVRAAFSNRLSIFIQDSAAVIVAVIIGMLLEWRLALVALATLPILSLSAIAQ 894
             RL ND   V    S  L +       +I ++++   L WRLAL+ L  LP+L+L     
Sbjct: 113  SRLTNDVEAVSNLVSTVLVLVFTSILLLIGSLVLLFSLSWRLALILLLILPLLALVLSLL 172

Query: 895  KLWLAGFSRGIQKMHRKASLVLEDAVRNIYTVVAFCAGNKVMELYRLQLKKIFTKSFLHG 954
                   SR +++   + +  L +++  I  + AF A ++ ++ +    +++   +    
Sbjct: 173  ARKSRKLSRRVREALGELNARLLESLSGIRVIKAFGAEDRELKRFEEANEELRRANLRAS 232

Query: 955  MAIGFAFGFSQFLLFACNALLLWYTGKSVRDGYMDLPTALKEYMVFSFATFALVEPFG-- 1012
                        L      L+L   G  V  G + +         F      L+ P    
Sbjct: 233  RLEALLAPLMLLLSSLGTVLVLALGGFLVLSGSLTVGA----LAAFILYLLRLLTPILQL 288

Query: 1013 --LAPYILKRRKSLISVFEIIDRVPKIDPDDSSAVKPPNVYGSIELKNVDFCYPSRPEVL 1070
              +   + +   +   +FE++D  P+++          +  GSIE +NV F YP +    
Sbjct: 289  GEVVSLLQRASAAAERLFELLDEEPEVEDPP---DPLKDTIGSIEFENVSFSYPGKK--P 343

Query: 1071 VLSNFSLKVNGGQTVAVVGVSGSGKSTIISLIERFYDPVAGQVLLDGRDLKLYNLRWLRN 1130
            VL + S  +  G+ VA+VG SGSGKST+I L+ R YDP +G++L+DG D++  +L  LR 
Sbjct: 344  VLKDISFSIEPGEKVAIVGPSGSGKSTLIKLLLRLYDPTSGEILIDGIDIRDISLDSLRK 403

Query: 1131 HLGLVQQEPIIFSTTIRENIIYARHNASEAEVKEAARIANAHHFISSLPHGYDTHVGMRG 1190
             +G+V Q+P++FS TIRENI   R +A++ E++EA ++ANAH FI++LP GYDT VG RG
Sbjct: 404  RIGIVSQDPLLFSGTIRENIALGRPDATDEEIEEALKLANAHEFIANLPDGYDTIVGERG 463

Query: 1191 VDLTPGQKQRIAIARVVLKNAPILLLDEASSSIESESSRVVQEALDTLIMGNKTTILIAH 1250
            V+L+ GQ+QR+AIAR +L+N PIL+LDEA+S++++E+  ++Q+AL  L +  +TT++IAH
Sbjct: 464  VNLSGGQRQRLAIARALLRNPPILILDEATSALDTETEALIQDALKKL-LKGRTTLIIAH 522

Query: 1251 RAAMMRHVDNIVVLNGGRIVEEGTHDSLLAKNGLYVRLMQ 1290
            R + +++ D I+VL+ GRIVE GTH+ LLAK GLY RL Q
Sbjct: 523  RLSTIKNADRIIVLDNGRIVERGTHEELLAKGGLYARLYQ 562


Length = 567

>gnl|CDD|213216 cd03249, ABC_MTABC3_MDL1_MDL2, ATP-binding cassette domain of a mitochondrial protein MTABC3 and related proteins Back     alignment and domain information
>gnl|CDD|224055 COG1132, MdlB, ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|213216 cd03249, ABC_MTABC3_MDL1_MDL2, ATP-binding cassette domain of a mitochondrial protein MTABC3 and related proteins Back     alignment and domain information
>gnl|CDD|131259 TIGR02204, MsbA_rel, ABC transporter, permease/ATP-binding protein Back     alignment and domain information
>gnl|CDD|131259 TIGR02204, MsbA_rel, ABC transporter, permease/ATP-binding protein Back     alignment and domain information
>gnl|CDD|213218 cd03251, ABCC_MsbA, ATP-binding cassette domain of the bacterial lipid flippase and related proteins, subfamily C Back     alignment and domain information
>gnl|CDD|131258 TIGR02203, MsbA_lipidA, lipid A export permease/ATP-binding protein MsbA Back     alignment and domain information
>gnl|CDD|233209 TIGR00958, 3a01208, Conjugate Transporter-2 (CT2) Family protein Back     alignment and domain information
>gnl|CDD|225183 COG2274, SunT, ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|233209 TIGR00958, 3a01208, Conjugate Transporter-2 (CT2) Family protein Back     alignment and domain information
>gnl|CDD|213221 cd03254, ABCC_Glucan_exporter_like, ATP-binding cassette domain of glucan transporter and related proteins, subfamily C Back     alignment and domain information
>gnl|CDD|213218 cd03251, ABCC_MsbA, ATP-binding cassette domain of the bacterial lipid flippase and related proteins, subfamily C Back     alignment and domain information
>gnl|CDD|213220 cd03253, ABCC_ATM1_transporter, ATP-binding cassette domain of iron-sulfur clusters transporter, subfamily C Back     alignment and domain information
>gnl|CDD|213221 cd03254, ABCC_Glucan_exporter_like, ATP-binding cassette domain of glucan transporter and related proteins, subfamily C Back     alignment and domain information
>gnl|CDD|225183 COG2274, SunT, ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|183016 PRK11176, PRK11176, lipid transporter ATP-binding/permease protein; Provisional Back     alignment and domain information
>gnl|CDD|213220 cd03253, ABCC_ATM1_transporter, ATP-binding cassette domain of iron-sulfur clusters transporter, subfamily C Back     alignment and domain information
>gnl|CDD|131258 TIGR02203, MsbA_lipidA, lipid A export permease/ATP-binding protein MsbA Back     alignment and domain information
>gnl|CDD|184214 PRK13657, PRK13657, cyclic beta-1,2-glucan ABC transporter; Provisional Back     alignment and domain information
>gnl|CDD|183016 PRK11176, PRK11176, lipid transporter ATP-binding/permease protein; Provisional Back     alignment and domain information
>gnl|CDD|233596 TIGR01846, type_I_sec_HlyB, type I secretion system ABC transporter, HlyB family Back     alignment and domain information
>gnl|CDD|213219 cd03252, ABCC_Hemolysin, ATP-binding cassette domain of hemolysin B, subfamily C Back     alignment and domain information
>gnl|CDD|184214 PRK13657, PRK13657, cyclic beta-1,2-glucan ABC transporter; Provisional Back     alignment and domain information
>gnl|CDD|227590 COG5265, ATM1, ABC-type transport system involved in Fe-S cluster assembly, permease and ATPase components [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|213215 cd03248, ABCC_TAP, ATP-binding cassette domain of the Transporter Associated with Antigen Processing, subfamily C Back     alignment and domain information
>gnl|CDD|233596 TIGR01846, type_I_sec_HlyB, type I secretion system ABC transporter, HlyB family Back     alignment and domain information
>gnl|CDD|213219 cd03252, ABCC_Hemolysin, ATP-binding cassette domain of hemolysin B, subfamily C Back     alignment and domain information
>gnl|CDD|213195 cd03228, ABCC_MRP_Like, ATP-binding cassette domain of multidrug resistance protein-like transporters Back     alignment and domain information
>gnl|CDD|213215 cd03248, ABCC_TAP, ATP-binding cassette domain of the Transporter Associated with Antigen Processing, subfamily C Back     alignment and domain information
>gnl|CDD|213212 cd03245, ABCC_bacteriocin_exporters, ATP-binding cassette domain of bacteriocin exporters, subfamily C Back     alignment and domain information
>gnl|CDD|227590 COG5265, ATM1, ABC-type transport system involved in Fe-S cluster assembly, permease and ATPase components [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|227320 COG4987, CydC, ABC-type transport system involved in cytochrome bd biosynthesis, fused ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|240339 PTZ00265, PTZ00265, multidrug resistance protein (mdr1); Provisional Back     alignment and domain information
>gnl|CDD|130260 TIGR01192, chvA, glucan exporter ATP-binding protein Back     alignment and domain information
>gnl|CDD|234189 TIGR03375, type_I_sec_LssB, type I secretion system ATPase, LssB family Back     alignment and domain information
>gnl|CDD|236865 PRK11160, PRK11160, cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed Back     alignment and domain information
>gnl|CDD|163508 TIGR03796, NHLM_micro_ABC1, NHLM bacteriocin system ABC transporter, peptidase/ATP-binding protein Back     alignment and domain information
>gnl|CDD|213195 cd03228, ABCC_MRP_Like, ATP-binding cassette domain of multidrug resistance protein-like transporters Back     alignment and domain information
>gnl|CDD|130260 TIGR01192, chvA, glucan exporter ATP-binding protein Back     alignment and domain information
>gnl|CDD|234033 TIGR02857, CydD, thiol reductant ABC exporter, CydD subunit Back     alignment and domain information
>gnl|CDD|227321 COG4988, CydD, ABC-type transport system involved in cytochrome bd biosynthesis, ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|213211 cd03244, ABCC_MRP_domain2, ATP-binding cassette domain 2 of multidrug resistance-associated protein Back     alignment and domain information
>gnl|CDD|213212 cd03245, ABCC_bacteriocin_exporters, ATP-binding cassette domain of bacteriocin exporters, subfamily C Back     alignment and domain information
>gnl|CDD|234189 TIGR03375, type_I_sec_LssB, type I secretion system ATPase, LssB family Back     alignment and domain information
>gnl|CDD|163508 TIGR03796, NHLM_micro_ABC1, NHLM bacteriocin system ABC transporter, peptidase/ATP-binding protein Back     alignment and domain information
>gnl|CDD|227321 COG4988, CydD, ABC-type transport system involved in cytochrome bd biosynthesis, ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|130261 TIGR01193, bacteriocin_ABC, ABC-type bacteriocin transporter Back     alignment and domain information
>gnl|CDD|130261 TIGR01193, bacteriocin_ABC, ABC-type bacteriocin transporter Back     alignment and domain information
>gnl|CDD|234357 TIGR03797, NHLM_micro_ABC2, NHLM bacteriocin system ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|182733 PRK10790, PRK10790, putative multidrug transporter membrane\ATP-binding components; Provisional Back     alignment and domain information
>gnl|CDD|240339 PTZ00265, PTZ00265, multidrug resistance protein (mdr1); Provisional Back     alignment and domain information
>gnl|CDD|182732 PRK10789, PRK10789, putative multidrug transporter membrane\ATP-binding components; Provisional Back     alignment and domain information
>gnl|CDD|236870 PRK11174, PRK11174, cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed Back     alignment and domain information
>gnl|CDD|234033 TIGR02857, CydD, thiol reductant ABC exporter, CydD subunit Back     alignment and domain information
>gnl|CDD|227320 COG4987, CydC, ABC-type transport system involved in cytochrome bd biosynthesis, fused ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|200134 TIGR01842, type_I_sec_PrtD, type I secretion system ABC transporter, PrtD family Back     alignment and domain information
>gnl|CDD|213211 cd03244, ABCC_MRP_domain2, ATP-binding cassette domain 2 of multidrug resistance-associated protein Back     alignment and domain information
>gnl|CDD|236865 PRK11160, PRK11160, cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed Back     alignment and domain information
>gnl|CDD|182733 PRK10790, PRK10790, putative multidrug transporter membrane\ATP-binding components; Provisional Back     alignment and domain information
>gnl|CDD|200134 TIGR01842, type_I_sec_PrtD, type I secretion system ABC transporter, PrtD family Back     alignment and domain information
>gnl|CDD|234357 TIGR03797, NHLM_micro_ABC2, NHLM bacteriocin system ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|182732 PRK10789, PRK10789, putative multidrug transporter membrane\ATP-binding components; Provisional Back     alignment and domain information
>gnl|CDD|240339 PTZ00265, PTZ00265, multidrug resistance protein (mdr1); Provisional Back     alignment and domain information
>gnl|CDD|234041 TIGR02868, CydC, thiol reductant ABC exporter, CydC subunit Back     alignment and domain information
>gnl|CDD|226969 COG4618, ArpD, ABC-type protease/lipase transport system, ATPase and permease components [General function prediction only] Back     alignment and domain information
>gnl|CDD|226969 COG4618, ArpD, ABC-type protease/lipase transport system, ATPase and permease components [General function prediction only] Back     alignment and domain information
>gnl|CDD|236870 PRK11174, PRK11174, cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed Back     alignment and domain information
>gnl|CDD|213269 cd03369, ABCC_NFT1, ATP-binding cassette domain 2 of NFT1, subfamily C Back     alignment and domain information
>gnl|CDD|213214 cd03247, ABCC_cytochrome_bd, ATP-binding cassette domain of CydCD, subfamily C Back     alignment and domain information
>gnl|CDD|213213 cd03246, ABCC_Protease_Secretion, ATP-binding cassette domain of PrtD, subfamily C Back     alignment and domain information
>gnl|CDD|213192 cd03225, ABC_cobalt_CbiO_domain1, First domain of the ATP-binding cassette component of cobalt transport system Back     alignment and domain information
>gnl|CDD|213227 cd03260, ABC_PstB_phosphate_transporter, ATP-binding cassette domain of the phosphate transport system Back     alignment and domain information
>gnl|CDD|213217 cd03250, ABCC_MRP_domain1, ATP-binding cassette domain 1 of multidrug resistance-associated protein, subfamily C Back     alignment and domain information
>gnl|CDD|213269 cd03369, ABCC_NFT1, ATP-binding cassette domain 2 of NFT1, subfamily C Back     alignment and domain information
>gnl|CDD|213227 cd03260, ABC_PstB_phosphate_transporter, ATP-binding cassette domain of the phosphate transport system Back     alignment and domain information
>gnl|CDD|237648 PRK14250, PRK14250, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|224059 COG1136, SalX, ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|216049 pfam00664, ABC_membrane, ABC transporter transmembrane region Back     alignment and domain information
>gnl|CDD|224058 COG1135, AbcC, ABC-type metal ion transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|213214 cd03247, ABCC_cytochrome_bd, ATP-binding cassette domain of CydCD, subfamily C Back     alignment and domain information
>gnl|CDD|224054 COG1131, CcmA, ABC-type multidrug transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|213226 cd03259, ABC_Carb_Solutes_like, ATP-binding cassette domain of the carbohydrate and solute transporters-like Back     alignment and domain information
>gnl|CDD|213192 cd03225, ABC_cobalt_CbiO_domain1, First domain of the ATP-binding cassette component of cobalt transport system Back     alignment and domain information
>gnl|CDD|224054 COG1131, CcmA, ABC-type multidrug transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|188098 TIGR00957, MRP_assoc_pro, multi drug resistance-associated protein (MRP) Back     alignment and domain information
>gnl|CDD|213255 cd03288, ABCC_SUR2, ATP-binding cassette domain 2 of the sulfonylurea receptor SUR Back     alignment and domain information
>gnl|CDD|213228 cd03261, ABC_Org_Solvent_Resistant, ATP-binding cassette transport system involved in resistant to organic solvents Back     alignment and domain information
>gnl|CDD|213213 cd03246, ABCC_Protease_Secretion, ATP-binding cassette domain of PrtD, subfamily C Back     alignment and domain information
>gnl|CDD|224047 COG1122, CbiO, ABC-type cobalt transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|224045 COG1120, FepC, ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|213224 cd03257, ABC_NikE_OppD_transporters, ATP-binding cassette domain of nickel/oligopeptides specific transporters Back     alignment and domain information
>gnl|CDD|234041 TIGR02868, CydC, thiol reductant ABC exporter, CydC subunit Back     alignment and domain information
>gnl|CDD|224047 COG1122, CbiO, ABC-type cobalt transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|213196 cd03229, ABC_Class3, ATP-binding cassette domain of the binding protein-dependent transport systems Back     alignment and domain information
>gnl|CDD|213228 cd03261, ABC_Org_Solvent_Resistant, ATP-binding cassette transport system involved in resistant to organic solvents Back     alignment and domain information
>gnl|CDD|224042 COG1117, PstB, ABC-type phosphate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|213225 cd03258, ABC_MetN_methionine_transporter, ATP-binding cassette domain of methionine transporter Back     alignment and domain information
>gnl|CDD|215595 PLN03130, PLN03130, ABC transporter C family member; Provisional Back     alignment and domain information
>gnl|CDD|237452 PRK13632, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|240339 PTZ00265, PTZ00265, multidrug resistance protein (mdr1); Provisional Back     alignment and domain information
>gnl|CDD|224058 COG1135, AbcC, ABC-type metal ion transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|215595 PLN03130, PLN03130, ABC transporter C family member; Provisional Back     alignment and domain information
>gnl|CDD|215595 PLN03130, PLN03130, ABC transporter C family member; Provisional Back     alignment and domain information
>gnl|CDD|213260 cd03293, ABC_NrtD_SsuB_transporters, ATP-binding cassette domain of the nitrate and sulfonate transporters Back     alignment and domain information
>gnl|CDD|226359 COG3839, MalK, ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|213222 cd03255, ABC_MJ0796_LolCDE_FtsE, ATP-binding cassette domain of the transporters involved in export of lipoprotein and macrolide, and cell division protein Back     alignment and domain information
>gnl|CDD|224048 COG1123, COG1123, ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] Back     alignment and domain information
>gnl|CDD|188098 TIGR00957, MRP_assoc_pro, multi drug resistance-associated protein (MRP) Back     alignment and domain information
>gnl|CDD|213255 cd03288, ABCC_SUR2, ATP-binding cassette domain 2 of the sulfonylurea receptor SUR Back     alignment and domain information
>gnl|CDD|213179 cd00267, ABC_ATPase, ATP-binding cassette transporter nucleotide-binding domain Back     alignment and domain information
>gnl|CDD|215640 PLN03232, PLN03232, ABC transporter C family member; Provisional Back     alignment and domain information
>gnl|CDD|213262 cd03295, ABC_OpuCA_Osmoprotection, ATP-binding cassette domain of the osmoprotectant transporter Back     alignment and domain information
>gnl|CDD|237452 PRK13632, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|213223 cd03256, ABC_PhnC_transporter, ATP-binding cassette domain of the binding protein-dependent phosphonate transport system Back     alignment and domain information
>gnl|CDD|213217 cd03250, ABCC_MRP_domain1, ATP-binding cassette domain 1 of multidrug resistance-associated protein, subfamily C Back     alignment and domain information
>gnl|CDD|224052 COG1127, Ttg2A, ABC-type transport system involved in resistance to organic solvents, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>gnl|CDD|213179 cd00267, ABC_ATPase, ATP-binding cassette transporter nucleotide-binding domain Back     alignment and domain information
>gnl|CDD|224050 COG1125, OpuBA, ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|188353 TIGR03608, L_ocin_972_ABC, putative bacteriocin export ABC transporter, lactococcin 972 group Back     alignment and domain information
>gnl|CDD|216049 pfam00664, ABC_membrane, ABC transporter transmembrane region Back     alignment and domain information
>gnl|CDD|224051 COG1126, GlnQ, ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|213197 cd03230, ABC_DR_subfamily_A, ATP-binding cassette domain of the drug resistance transporter and related proteins, subfamily A Back     alignment and domain information
>gnl|CDD|226164 COG3638, COG3638, ABC-type phosphate/phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|188099 TIGR00972, 3a0107s01c2, phosphate ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|213181 cd03214, ABC_Iron-Siderophores_B12_Hemin, ATP-binding component of iron-siderophores, vitamin B12 and hemin transporters and related proteins Back     alignment and domain information
>gnl|CDD|188098 TIGR00957, MRP_assoc_pro, multi drug resistance-associated protein (MRP) Back     alignment and domain information
>gnl|CDD|213225 cd03258, ABC_MetN_methionine_transporter, ATP-binding cassette domain of methionine transporter Back     alignment and domain information
>gnl|CDD|226361 COG3842, PotA, ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|213196 cd03229, ABC_Class3, ATP-binding cassette domain of the binding protein-dependent transport systems Back     alignment and domain information
>gnl|CDD|213197 cd03230, ABC_DR_subfamily_A, ATP-binding cassette domain of the drug resistance transporter and related proteins, subfamily A Back     alignment and domain information
>gnl|CDD|213229 cd03262, ABC_HisP_GlnQ, ATP-binding cassette domain of the histidine and glutamine transporters Back     alignment and domain information
>gnl|CDD|213226 cd03259, ABC_Carb_Solutes_like, ATP-binding cassette domain of the carbohydrate and solute transporters-like Back     alignment and domain information
>gnl|CDD|224049 COG1124, DppF, ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|213224 cd03257, ABC_NikE_OppD_transporters, ATP-binding cassette domain of nickel/oligopeptides specific transporters Back     alignment and domain information
>gnl|CDD|215640 PLN03232, PLN03232, ABC transporter C family member; Provisional Back     alignment and domain information
>gnl|CDD|213262 cd03295, ABC_OpuCA_Osmoprotection, ATP-binding cassette domain of the osmoprotectant transporter Back     alignment and domain information
>gnl|CDD|226361 COG3842, PotA, ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|131368 TIGR02315, ABC_phnC, phosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|213186 cd03219, ABC_Mj1267_LivG_branched, ATP-binding cassette component of branched chain amino acids transport system Back     alignment and domain information
>gnl|CDD|237457 PRK13647, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|224045 COG1120, FepC, ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|224050 COG1125, OpuBA, ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|184195 PRK13635, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|213186 cd03219, ABC_Mj1267_LivG_branched, ATP-binding cassette component of branched chain amino acids transport system Back     alignment and domain information
>gnl|CDD|213259 cd03292, ABC_FtsE_transporter, ATP-binding cassette domain of the cell division transporter Back     alignment and domain information
>gnl|CDD|237648 PRK14250, PRK14250, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|182692 PRK10744, pstB, phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|224043 COG1118, CysA, ABC-type sulfate/molybdate transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|224059 COG1136, SalX, ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|213222 cd03255, ABC_MJ0796_LolCDE_FtsE, ATP-binding cassette domain of the transporters involved in export of lipoprotein and macrolide, and cell division protein Back     alignment and domain information
>gnl|CDD|224041 COG1116, TauB, ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|240327 PTZ00243, PTZ00243, ABC transporter; Provisional Back     alignment and domain information
>gnl|CDD|226643 COG4175, ProV, ABC-type proline/glycine betaine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|224046 COG1121, ZnuC, ABC-type Mn/Zn transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|236863 PRK11153, metN, DL-methionine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|237455 PRK13637, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|213230 cd03263, ABC_subfamily_A, ATP-binding cassette domain of the lipid transporters, subfamily A Back     alignment and domain information
>gnl|CDD|184207 PRK13648, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|224052 COG1127, Ttg2A, ABC-type transport system involved in resistance to organic solvents, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>gnl|CDD|213260 cd03293, ABC_NrtD_SsuB_transporters, ATP-binding cassette domain of the nitrate and sulfonate transporters Back     alignment and domain information
>gnl|CDD|224048 COG1123, COG1123, ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] Back     alignment and domain information
>gnl|CDD|213259 cd03292, ABC_FtsE_transporter, ATP-binding cassette domain of the cell division transporter Back     alignment and domain information
>gnl|CDD|223521 COG0444, DppD, ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|223488 COG0411, LivG, ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|225438 COG2884, FtsE, Predicted ATPase involved in cell division [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|213261 cd03294, ABC_Pro_Gly_Betaine, ATP-binding cassette domain of the osmoprotectant proline/glycine betaine uptake system Back     alignment and domain information
>gnl|CDD|226359 COG3839, MalK, ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|215640 PLN03232, PLN03232, ABC transporter C family member; Provisional Back     alignment and domain information
>gnl|CDD|188099 TIGR00972, 3a0107s01c2, phosphate ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|213261 cd03294, ABC_Pro_Gly_Betaine, ATP-binding cassette domain of the osmoprotectant proline/glycine betaine uptake system Back     alignment and domain information
>gnl|CDD|213191 cd03224, ABC_TM1139_LivF_branched, ATP-binding cassette domain of branched-chain amino acid transporter Back     alignment and domain information
>gnl|CDD|130254 TIGR01186, proV, glycine betaine/L-proline transport ATP binding subunit Back     alignment and domain information
>gnl|CDD|224042 COG1117, PstB, ABC-type phosphate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|131367 TIGR02314, ABC_MetN, D-methionine ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|213267 cd03300, ABC_PotA_N, ATP-binding cassette domain of the polyamine transporter Back     alignment and domain information
>gnl|CDD|226360 COG3840, ThiQ, ABC-type thiamine transport system, ATPase component [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|213266 cd03299, ABC_ModC_like, ATP-binding cassette domain similar to the molybdate transporter Back     alignment and domain information
>gnl|CDD|130234 TIGR01166, cbiO, cobalt transport protein ATP-binding subunit Back     alignment and domain information
>gnl|CDD|237453 PRK13633, PRK13633, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|226927 COG4555, NatA, ABC-type Na+ transport system, ATPase component [Energy production and conversion / Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|188394 TIGR03864, PQQ_ABC_ATP, ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system Back     alignment and domain information
>gnl|CDD|213202 cd03235, ABC_Metallic_Cations, ATP-binding cassette domain of the metal-type transporters Back     alignment and domain information
>gnl|CDD|224051 COG1126, GlnQ, ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|223488 COG0411, LivG, ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|213180 cd03213, ABCG_EPDR, Eye pigment and drug resistance transporter subfamily G of the ATP-binding cassette superfamily Back     alignment and domain information
>gnl|CDD|236523 PRK09452, potA, putrescine/spermidine ABC transporter ATPase protein; Reviewed Back     alignment and domain information
>gnl|CDD|172200 PRK13652, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|213268 cd03301, ABC_MalK_N, The N-terminal ATPase domain of the maltose transporter, MalK Back     alignment and domain information
>gnl|CDD|215650 pfam00005, ABC_tran, ABC transporter Back     alignment and domain information
>gnl|CDD|226961 COG4598, HisP, ABC-type histidine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|213181 cd03214, ABC_Iron-Siderophores_B12_Hemin, ATP-binding component of iron-siderophores, vitamin B12 and hemin transporters and related proteins Back     alignment and domain information
>gnl|CDD|184207 PRK13648, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|213201 cd03234, ABCG_White, White pigment protein homolog of ABCG transporter subfamily Back     alignment and domain information
>gnl|CDD|213230 cd03263, ABC_subfamily_A, ATP-binding cassette domain of the lipid transporters, subfamily A Back     alignment and domain information
>gnl|CDD|226970 COG4619, COG4619, ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|215595 PLN03130, PLN03130, ABC transporter C family member; Provisional Back     alignment and domain information
>gnl|CDD|184597 PRK14270, PRK14270, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|224041 COG1116, TauB, ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|224053 COG1129, MglA, ABC-type sugar transport system, ATPase component [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|213265 cd03298, ABC_ThiQ_thiamine_transporter, ATP-binding cassette domain of the thiamine transport system Back     alignment and domain information
>gnl|CDD|237457 PRK13647, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|213191 cd03224, ABC_TM1139_LivF_branched, ATP-binding cassette domain of branched-chain amino acid transporter Back     alignment and domain information
>gnl|CDD|188394 TIGR03864, PQQ_ABC_ATP, ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system Back     alignment and domain information
>gnl|CDD|184199 PRK13639, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|182592 PRK10619, PRK10619, histidine/lysine/arginine/ornithine transporter subunit; Provisional Back     alignment and domain information
>gnl|CDD|240327 PTZ00243, PTZ00243, ABC transporter; Provisional Back     alignment and domain information
>gnl|CDD|236863 PRK11153, metN, DL-methionine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|130234 TIGR01166, cbiO, cobalt transport protein ATP-binding subunit Back     alignment and domain information
>gnl|CDD|233335 TIGR01271, CFTR_protein, cystic fibrosis transmembrane conductor regulator (CFTR) Back     alignment and domain information
>gnl|CDD|237649 PRK14254, PRK14254, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|172750 PRK14262, PRK14262, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|130344 TIGR01277, thiQ, thiamine ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|172739 PRK14251, PRK14251, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|131721 TIGR02673, FtsE, cell division ATP-binding protein FtsE Back     alignment and domain information
>gnl|CDD|226164 COG3638, COG3638, ABC-type phosphate/phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|172757 PRK14269, PRK14269, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|172757 PRK14269, PRK14269, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|184209 PRK13650, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|184202 PRK13642, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|225438 COG2884, FtsE, Predicted ATPase involved in cell division [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|213267 cd03300, ABC_PotA_N, ATP-binding cassette domain of the polyamine transporter Back     alignment and domain information
>gnl|CDD|213266 cd03299, ABC_ModC_like, ATP-binding cassette domain similar to the molybdate transporter Back     alignment and domain information
>gnl|CDD|184196 PRK13636, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|172745 PRK14257, PRK14257, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|223487 COG0410, LivF, ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|182528 PRK10535, PRK10535, macrolide transporter ATP-binding /permease protein; Provisional Back     alignment and domain information
>gnl|CDD|184586 PRK14240, PRK14240, phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|224049 COG1124, DppF, ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|226643 COG4175, ProV, ABC-type proline/glycine betaine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|130041 TIGR00968, 3a0106s01, sulfate ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|237645 PRK14235, PRK14235, phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|213258 cd03291, ABCC_CFTR1, ATP-binding cassette domain of the cystic fibrosis transmembrane regulator, subfamily C Back     alignment and domain information
>gnl|CDD|163585 TIGR03873, F420-0_ABC_ATP, proposed F420-0 ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|226905 COG4525, TauB, ABC-type taurine transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|130254 TIGR01186, proV, glycine betaine/L-proline transport ATP binding subunit Back     alignment and domain information
>gnl|CDD|172200 PRK13652, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|213256 cd03289, ABCC_CFTR2, ATP-binding cassette domain 2 of CFTR,subfamily C Back     alignment and domain information
>gnl|CDD|213193 cd03226, ABC_cobalt_CbiO_domain2, Second domain of the ATP-binding cassette component of cobalt transport system Back     alignment and domain information
>gnl|CDD|184582 PRK14236, PRK14236, phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|223521 COG0444, DppD, ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|172734 PRK14246, PRK14246, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|172749 PRK14261, PRK14261, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|226637 COG4167, SapF, ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|240339 PTZ00265, PTZ00265, multidrug resistance protein (mdr1); Provisional Back     alignment and domain information
>gnl|CDD|131721 TIGR02673, FtsE, cell division ATP-binding protein FtsE Back     alignment and domain information
>gnl|CDD|223487 COG0410, LivF, ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|106587 PRK13644, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|237456 PRK13641, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|213257 cd03290, ABCC_SUR1_N, ATP-binding cassette domain of the sulfonylurea receptor, subfamily C Back     alignment and domain information
>gnl|CDD|224048 COG1123, COG1123, ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] Back     alignment and domain information
>gnl|CDD|213193 cd03226, ABC_cobalt_CbiO_domain2, Second domain of the ATP-binding cassette component of cobalt transport system Back     alignment and domain information
>gnl|CDD|172741 PRK14253, PRK14253, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|184208 PRK13649, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|184590 PRK14249, PRK14249, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|213263 cd03296, ABC_CysA_sulfate_importer, ATP-binding cassette domain of the sulfate transporter Back     alignment and domain information
>gnl|CDD|181906 PRK09493, glnQ, glutamine ABC transporter ATP-binding protein; Reviewed Back     alignment and domain information
>gnl|CDD|183063 PRK11264, PRK11264, putative amino-acid ABC transporter ATP-binding protein YecC; Provisional Back     alignment and domain information
>gnl|CDD|213229 cd03262, ABC_HisP_GlnQ, ATP-binding cassette domain of the histidine and glutamine transporters Back     alignment and domain information
>gnl|CDD|182221 PRK10070, PRK10070, glycine betaine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|132027 TIGR02982, heterocyst_DevA, ABC exporter ATP-binding subunit, DevA family Back     alignment and domain information
>gnl|CDD|162242 TIGR01187, potA, spermidine/putrescine ABC transporter ATP-binding subunit Back     alignment and domain information
>gnl|CDD|224043 COG1118, CysA, ABC-type sulfate/molybdate transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|237651 PRK14266, PRK14266, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|213235 cd03268, ABC_BcrA_bacitracin_resist, ATP-binding cassette domain of the bacitracin-resistance transporter Back     alignment and domain information
>gnl|CDD|213183 cd03216, ABC_Carb_Monos_I, First domain of the ATP-binding cassette component of monosaccharide transport system Back     alignment and domain information
>gnl|CDD|184205 PRK13646, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|182221 PRK10070, PRK10070, glycine betaine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|237455 PRK13637, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|172732 PRK14244, PRK14244, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|183044 PRK11231, fecE, iron-dicitrate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|215640 PLN03232, PLN03232, ABC transporter C family member; Provisional Back     alignment and domain information
>gnl|CDD|224053 COG1129, MglA, ABC-type sugar transport system, ATPase component [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|172730 PRK14242, PRK14242, phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|226364 COG3845, COG3845, ABC-type uncharacterized transport systems, ATPase components [General function prediction only] Back     alignment and domain information
>gnl|CDD|185067 PRK15112, PRK15112, antimicrobial peptide ABC system ATP-binding protein SapF; Provisional Back     alignment and domain information
>gnl|CDD|172733 PRK14245, PRK14245, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|224048 COG1123, COG1123, ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] Back     alignment and domain information
>gnl|CDD|213223 cd03256, ABC_PhnC_transporter, ATP-binding cassette domain of the binding protein-dependent phosphonate transport system Back     alignment and domain information
>gnl|CDD|184195 PRK13635, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|240327 PTZ00243, PTZ00243, ABC transporter; Provisional Back     alignment and domain information
>gnl|CDD|226970 COG4619, COG4619, ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|188098 TIGR00957, MRP_assoc_pro, multi drug resistance-associated protein (MRP) Back     alignment and domain information
>gnl|CDD|188353 TIGR03608, L_ocin_972_ABC, putative bacteriocin export ABC transporter, lactococcin 972 group Back     alignment and domain information
>gnl|CDD|184202 PRK13642, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|184582 PRK14236, PRK14236, phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|226641 COG4172, COG4172, ABC-type uncharacterized transport system, duplicated ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|182331 PRK10247, PRK10247, putative ABC transporter ATP-binding protein YbbL; Provisional Back     alignment and domain information
>gnl|CDD|172748 PRK14260, PRK14260, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|213264 cd03297, ABC_ModC_molybdenum_transporter, ATP-binding cassette domain of the molybdenum transport system Back     alignment and domain information
>gnl|CDD|226637 COG4167, SapF, ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|236554 PRK09536, btuD, corrinoid ABC transporter ATPase; Reviewed Back     alignment and domain information
>gnl|CDD|237454 PRK13634, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|233335 TIGR01271, CFTR_protein, cystic fibrosis transmembrane conductor regulator (CFTR) Back     alignment and domain information
>gnl|CDD|213235 cd03268, ABC_BcrA_bacitracin_resist, ATP-binding cassette domain of the bacitracin-resistance transporter Back     alignment and domain information
>gnl|CDD|130262 TIGR01194, cyc_pep_trnsptr, cyclic peptide transporter Back     alignment and domain information
>gnl|CDD|131197 TIGR02142, modC_ABC, molybdenum ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|213202 cd03235, ABC_Metallic_Cations, ATP-binding cassette domain of the metal-type transporters Back     alignment and domain information
>gnl|CDD|237646 PRK14237, PRK14237, phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|131266 TIGR02211, LolD_lipo_ex, lipoprotein releasing system, ATP-binding protein Back     alignment and domain information
>gnl|CDD|130041 TIGR00968, 3a0106s01, sulfate ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|172732 PRK14244, PRK14244, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|226647 COG4181, COG4181, Predicted ABC-type transport system involved in lysophospholipase L1 biosynthesis, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>gnl|CDD|184209 PRK13650, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|226905 COG4525, TauB, ABC-type taurine transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|213263 cd03296, ABC_CysA_sulfate_importer, ATP-binding cassette domain of the sulfate transporter Back     alignment and domain information
>gnl|CDD|182716 PRK10771, thiQ, thiamine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|223473 COG0396, sufC, Cysteine desulfurase activator ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|213233 cd03266, ABC_NatA_sodium_exporter, ATP-binding cassette domain of the Na+ transporter Back     alignment and domain information
>gnl|CDD|172750 PRK14262, PRK14262, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|172759 PRK14271, PRK14271, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|172735 PRK14247, PRK14247, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|172740 PRK14252, PRK14252, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|184585 PRK14239, PRK14239, phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|182692 PRK10744, pstB, phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|237649 PRK14254, PRK14254, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|184196 PRK13636, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|184208 PRK13649, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|172733 PRK14245, PRK14245, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|226635 COG4161, ArtP, ABC-type arginine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|131197 TIGR02142, modC_ABC, molybdenum ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|224044 COG1119, ModF, ABC-type molybdenum transport system, ATPase component/photorepair protein PhrA [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|184586 PRK14240, PRK14240, phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|224044 COG1119, ModF, ABC-type molybdenum transport system, ATPase component/photorepair protein PhrA [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|182561 PRK10575, PRK10575, iron-hydroxamate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|172734 PRK14246, PRK14246, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|226963 COG4604, CeuD, ABC-type enterochelin transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|131367 TIGR02314, ABC_MetN, D-methionine ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|213231 cd03264, ABC_drug_resistance_like, ABC-type multidrug transport system, ATPase component Back     alignment and domain information
>gnl|CDD|237651 PRK14266, PRK14266, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|237421 PRK13539, PRK13539, cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>gnl|CDD|234152 TIGR03265, PhnT2, putative 2-aminoethylphosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|183226 PRK11607, potG, putrescine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|226927 COG4555, NatA, ABC-type Na+ transport system, ATPase component [Energy production and conversion / Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|184199 PRK13639, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|237646 PRK14237, PRK14237, phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|172735 PRK14247, PRK14247, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|172761 PRK14273, PRK14273, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|237652 PRK14275, PRK14275, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|224057 COG1134, TagH, ABC-type polysaccharide/polyol phosphate transport system, ATPase component [Carbohydrate transport and metabolism / Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|184588 PRK14243, PRK14243, phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|184204 PRK13645, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|240327 PTZ00243, PTZ00243, ABC transporter; Provisional Back     alignment and domain information
>gnl|CDD|236523 PRK09452, potA, putrescine/spermidine ABC transporter ATPase protein; Reviewed Back     alignment and domain information
>gnl|CDD|184597 PRK14270, PRK14270, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|226968 COG4615, PvdE, ABC-type siderophore export system, fused ATPase and permease components [Secondary metabolites biosynthesis, transport, and catabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|132050 TIGR03005, ectoine_ehuA, ectoine/hydroxyectoine ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|184590 PRK14249, PRK14249, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|172730 PRK14242, PRK14242, phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|224057 COG1134, TagH, ABC-type polysaccharide/polyol phosphate transport system, ATPase component [Carbohydrate transport and metabolism / Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|237422 PRK13548, hmuV, hemin importer ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|213198 cd03231, ABC_CcmA_heme_exporter, Cytochrome c biogenesis ATP-binding export protein Back     alignment and domain information
>gnl|CDD|184593 PRK14258, PRK14258, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|131816 TIGR02769, nickel_nikE, nickel import ATP-binding protein NikE Back     alignment and domain information
>gnl|CDD|106587 PRK13644, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|131817 TIGR02770, nickel_nikD, nickel import ATP-binding protein NikD Back     alignment and domain information
>gnl|CDD|213184 cd03217, ABC_FeS_Assembly, ABC-type transport system involved in Fe-S cluster assembly, ATPase component Back     alignment and domain information
>gnl|CDD|184594 PRK14264, PRK14264, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|182980 PRK11124, artP, arginine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|163585 TIGR03873, F420-0_ABC_ATP, proposed F420-0 ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|237650 PRK14265, PRK14265, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|234199 TIGR03410, urea_trans_UrtE, urea ABC transporter, ATP-binding protein UrtE Back     alignment and domain information
>gnl|CDD|213264 cd03297, ABC_ModC_molybdenum_transporter, ATP-binding cassette domain of the molybdenum transport system Back     alignment and domain information
>gnl|CDD|184204 PRK13645, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|237650 PRK14265, PRK14265, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|172762 PRK14274, PRK14274, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|226628 COG4148, ModC, ABC-type molybdate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|132302 TIGR03258, PhnT, 2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT Back     alignment and domain information
>gnl|CDD|172756 PRK14268, PRK14268, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|184200 PRK13640, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|226967 COG4608, AppF, ABC-type oligopeptide transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|172743 PRK14255, PRK14255, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|226360 COG3840, ThiQ, ABC-type thiamine transport system, ATPase component [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|215650 pfam00005, ABC_tran, ABC transporter Back     alignment and domain information
>gnl|CDD|172745 PRK14257, PRK14257, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|172741 PRK14253, PRK14253, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|172759 PRK14271, PRK14271, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|224026 COG1101, PhnK, ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|233207 TIGR00955, 3a01204, The Eye Pigment Precursor Transporter (EPP) Family protein Back     alignment and domain information
>gnl|CDD|226929 COG4559, COG4559, ABC-type hemin transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|184587 PRK14241, PRK14241, phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|213187 cd03220, ABC_KpsT_Wzt, ATP-binding cassette component of polysaccharide transport system Back     alignment and domain information
>gnl|CDD|213180 cd03213, ABCG_EPDR, Eye pigment and drug resistance transporter subfamily G of the ATP-binding cassette superfamily Back     alignment and domain information
>gnl|CDD|162242 TIGR01187, potA, spermidine/putrescine ABC transporter ATP-binding subunit Back     alignment and domain information
>gnl|CDD|236554 PRK09536, btuD, corrinoid ABC transporter ATPase; Reviewed Back     alignment and domain information
>gnl|CDD|223473 COG0396, sufC, Cysteine desulfurase activator ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|213185 cd03218, ABC_YhbG, ATP-binding cassette component of YhbG transport system Back     alignment and domain information
>gnl|CDD|213268 cd03301, ABC_MalK_N, The N-terminal ATPase domain of the maltose transporter, MalK Back     alignment and domain information
>gnl|CDD|172761 PRK14273, PRK14273, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|213184 cd03217, ABC_FeS_Assembly, ABC-type transport system involved in Fe-S cluster assembly, ATPase component Back     alignment and domain information
>gnl|CDD|234199 TIGR03410, urea_trans_UrtE, urea ABC transporter, ATP-binding protein UrtE Back     alignment and domain information
>gnl|CDD|172747 PRK14259, PRK14259, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|131266 TIGR02211, LolD_lipo_ex, lipoprotein releasing system, ATP-binding protein Back     alignment and domain information
>gnl|CDD|213258 cd03291, ABCC_CFTR1, ATP-binding cassette domain of the cystic fibrosis transmembrane regulator, subfamily C Back     alignment and domain information
>gnl|CDD|172751 PRK14263, PRK14263, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|233335 TIGR01271, CFTR_protein, cystic fibrosis transmembrane conductor regulator (CFTR) Back     alignment and domain information
>gnl|CDD|172756 PRK14268, PRK14268, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|172744 PRK14256, PRK14256, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|213257 cd03290, ABCC_SUR1_N, ATP-binding cassette domain of the sulfonylurea receptor, subfamily C Back     alignment and domain information
>gnl|CDD|172740 PRK14252, PRK14252, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|237647 PRK14248, PRK14248, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|172748 PRK14260, PRK14260, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|182561 PRK10575, PRK10575, iron-hydroxamate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|184588 PRK14243, PRK14243, phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|226967 COG4608, AppF, ABC-type oligopeptide transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|185336 PRK15439, PRK15439, autoinducer 2 ABC transporter ATP-binding protein LsrA; Provisional Back     alignment and domain information
>gnl|CDD|237419 PRK13536, PRK13536, nodulation factor exporter subunit NodI; Provisional Back     alignment and domain information
>gnl|CDD|237420 PRK13537, PRK13537, nodulation ABC transporter NodI; Provisional Back     alignment and domain information
>gnl|CDD|184596 PRK14267, PRK14267, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|172760 PRK14272, PRK14272, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|224046 COG1121, ZnuC, ABC-type Mn/Zn transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|172749 PRK14261, PRK14261, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|184205 PRK13646, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|226641 COG4172, COG4172, ABC-type uncharacterized transport system, duplicated ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|184585 PRK14239, PRK14239, phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|227019 COG4674, COG4674, Uncharacterized ABC-type transport system, ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|224060 COG1137, YhbG, ABC-type (unclassified) transport system, ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|224060 COG1137, YhbG, ABC-type (unclassified) transport system, ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|163452 TIGR03740, galliderm_ABC, gallidermin-class lantibiotic protection ABC transporter, ATP-binding subunit Back     alignment and domain information
>gnl|CDD|213231 cd03264, ABC_drug_resistance_like, ABC-type multidrug transport system, ATPase component Back     alignment and domain information
>gnl|CDD|130252 TIGR01184, ntrCD, nitrate transport ATP-binding subunits C and D Back     alignment and domain information
>gnl|CDD|226620 COG4136, COG4136, ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|223562 COG0488, Uup, ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] Back     alignment and domain information
>gnl|CDD|183044 PRK11231, fecE, iron-dicitrate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|226641 COG4172, COG4172, ABC-type uncharacterized transport system, duplicated ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|184210 PRK13651, PRK13651, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|237451 PRK13631, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|184203 PRK13643, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|184594 PRK14264, PRK14264, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|130355 TIGR01288, nodI, ATP-binding ABC transporter family nodulation protein NodI Back     alignment and domain information
>gnl|CDD|131368 TIGR02315, ABC_phnC, phosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|182331 PRK10247, PRK10247, putative ABC transporter ATP-binding protein YbbL; Provisional Back     alignment and domain information
>gnl|CDD|237419 PRK13536, PRK13536, nodulation factor exporter subunit NodI; Provisional Back     alignment and domain information
>gnl|CDD|213232 cd03265, ABC_DrrA, Daunorubicin/doxorubicin resistance ATP-binding protein Back     alignment and domain information
>gnl|CDD|237645 PRK14235, PRK14235, phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|181906 PRK09493, glnQ, glutamine ABC transporter ATP-binding protein; Reviewed Back     alignment and domain information
>gnl|CDD|172751 PRK14263, PRK14263, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|184198 PRK13638, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|213187 cd03220, ABC_KpsT_Wzt, ATP-binding cassette component of polysaccharide transport system Back     alignment and domain information
>gnl|CDD|213185 cd03218, ABC_YhbG, ATP-binding cassette component of YhbG transport system Back     alignment and domain information
>gnl|CDD|236898 PRK11308, dppF, dipeptide transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|183226 PRK11607, potG, putrescine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|226628 COG4148, ModC, ABC-type molybdate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|172743 PRK14255, PRK14255, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|236898 PRK11308, dppF, dipeptide transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|132313 TIGR03269, met_CoM_red_A2, methyl coenzyme M reductase system, component A2 Back     alignment and domain information
>gnl|CDD|131377 TIGR02324, CP_lyasePhnL, phosphonate C-P lyase system protein PhnL Back     alignment and domain information
>gnl|CDD|183080 PRK11300, livG, leucine/isoleucine/valine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|226364 COG3845, COG3845, ABC-type uncharacterized transport systems, ATPase components [General function prediction only] Back     alignment and domain information
>gnl|CDD|185067 PRK15112, PRK15112, antimicrobial peptide ABC system ATP-binding protein SapF; Provisional Back     alignment and domain information
>gnl|CDD|226647 COG4181, COG4181, Predicted ABC-type transport system involved in lysophospholipase L1 biosynthesis, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>gnl|CDD|213233 cd03266, ABC_NatA_sodium_exporter, ATP-binding cassette domain of the Na+ transporter Back     alignment and domain information
>gnl|CDD|237652 PRK14275, PRK14275, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|184587 PRK14241, PRK14241, phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|237647 PRK14248, PRK14248, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|233305 TIGR01189, ccmA, heme ABC exporter, ATP-binding protein CcmA Back     alignment and domain information
>gnl|CDD|188317 TIGR03415, ABC_choXWV_ATP, choline ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|184584 PRK14238, PRK14238, phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|213236 cd03269, ABC_putative_ATPase, ATP-binding cassette domain of an uncharacterized transporter Back     alignment and domain information
>gnl|CDD|132050 TIGR03005, ectoine_ehuA, ectoine/hydroxyectoine ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|237420 PRK13537, PRK13537, nodulation ABC transporter NodI; Provisional Back     alignment and domain information
>gnl|CDD|237451 PRK13631, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|183077 PRK11288, araG, L-arabinose transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|226963 COG4604, CeuD, ABC-type enterochelin transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|184593 PRK14258, PRK14258, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|184584 PRK14238, PRK14238, phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|183056 PRK11248, tauB, taurine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|233665 TIGR01978, sufC, FeS assembly ATPase SufC Back     alignment and domain information
>gnl|CDD|172762 PRK14274, PRK14274, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|172744 PRK14256, PRK14256, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|183244 PRK11629, lolD, lipoprotein transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|236689 PRK10419, nikE, nickel transporter ATP-binding protein NikE; Provisional Back     alignment and domain information
>gnl|CDD|183231 PRK11614, livF, leucine/isoleucine/valine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|182778 PRK10851, PRK10851, sulfate/thiosulfate transporter subunit; Provisional Back     alignment and domain information
>gnl|CDD|182893 PRK11000, PRK11000, maltose/maltodextrin transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|237454 PRK13634, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|237453 PRK13633, PRK13633, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|237456 PRK13641, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|132027 TIGR02982, heterocyst_DevA, ABC exporter ATP-binding subunit, DevA family Back     alignment and domain information
>gnl|CDD|224026 COG1101, PhnK, ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|172760 PRK14272, PRK14272, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|223562 COG0488, Uup, ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] Back     alignment and domain information
>gnl|CDD|182036 PRK09700, PRK09700, D-allose transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|182182 PRK09984, PRK09984, phosphonate/organophosphate ester transporter subunit; Provisional Back     alignment and domain information
>gnl|CDD|226617 COG4133, CcmA, ABC-type transport system involved in cytochrome c biogenesis, ATPase component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|236997 PRK11831, PRK11831, putative ABC transporter ATP-binding protein YrbF; Provisional Back     alignment and domain information
>gnl|CDD|213183 cd03216, ABC_Carb_Monos_I, First domain of the ATP-binding cassette component of monosaccharide transport system Back     alignment and domain information
>gnl|CDD|234152 TIGR03265, PhnT2, putative 2-aminoethylphosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|130355 TIGR01288, nodI, ATP-binding ABC transporter family nodulation protein NodI Back     alignment and domain information
>gnl|CDD|182829 PRK10908, PRK10908, cell division protein FtsE; Provisional Back     alignment and domain information
>gnl|CDD|213182 cd03215, ABC_Carb_Monos_II, Second domain of the ATP-binding cassette component of monosaccharide transport system Back     alignment and domain information
>gnl|CDD|130256 TIGR01188, drrA, daunorubicin resistance ABC transporter ATP-binding subunit Back     alignment and domain information
>gnl|CDD|213265 cd03298, ABC_ThiQ_thiamine_transporter, ATP-binding cassette domain of the thiamine transport system Back     alignment and domain information
>gnl|CDD|172739 PRK14251, PRK14251, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|226635 COG4161, ArtP, ABC-type arginine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|184200 PRK13640, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|227019 COG4674, COG4674, Uncharacterized ABC-type transport system, ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|226961 COG4598, HisP, ABC-type histidine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|131816 TIGR02769, nickel_nikE, nickel import ATP-binding protein NikE Back     alignment and domain information
>gnl|CDD|130252 TIGR01184, ntrCD, nitrate transport ATP-binding subunits C and D Back     alignment and domain information
>gnl|CDD|130262 TIGR01194, cyc_pep_trnsptr, cyclic peptide transporter Back     alignment and domain information
>gnl|CDD|183133 PRK11432, fbpC, ferric transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|182336 PRK10253, PRK10253, iron-enterobactin transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|132561 TIGR03522, GldA_ABC_ATP, gliding motility-associated ABC transporter ATP-binding subunit GldA Back     alignment and domain information
>gnl|CDD|130324 TIGR01257, rim_protein, retinal-specific rim ABC transporter Back     alignment and domain information
>gnl|CDD|213234 cd03267, ABC_NatA_like, ATP-binding cassette domain of an uncharacterized transporter similar in sequence to NatA Back     alignment and domain information
>gnl|CDD|213256 cd03289, ABCC_CFTR2, ATP-binding cassette domain 2 of CFTR,subfamily C Back     alignment and domain information
>gnl|CDD|237917 PRK15134, PRK15134, microcin C ABC transporter ATP-binding protein YejF; Provisional Back     alignment and domain information
>gnl|CDD|132302 TIGR03258, PhnT, 2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT Back     alignment and domain information
>gnl|CDD|172747 PRK14259, PRK14259, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|185336 PRK15439, PRK15439, autoinducer 2 ABC transporter ATP-binding protein LsrA; Provisional Back     alignment and domain information
>gnl|CDD|184596 PRK14267, PRK14267, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|223562 COG0488, Uup, ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] Back     alignment and domain information
>gnl|CDD|184198 PRK13638, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|226617 COG4133, CcmA, ABC-type transport system involved in cytochrome c biogenesis, ATPase component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|130256 TIGR01188, drrA, daunorubicin resistance ABC transporter ATP-binding subunit Back     alignment and domain information
>gnl|CDD|184127 PRK13540, PRK13540, cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>gnl|CDD|185037 PRK15079, PRK15079, oligopeptide ABC transporter ATP-binding protein OppF; Provisional Back     alignment and domain information
>gnl|CDD|182342 PRK10261, PRK10261, glutathione transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|183055 PRK11247, ssuB, aliphatic sulfonates transport ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|130344 TIGR01277, thiQ, thiamine ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|226641 COG4172, COG4172, ABC-type uncharacterized transport system, duplicated ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|237421 PRK13539, PRK13539, cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>gnl|CDD|213198 cd03231, ABC_CcmA_heme_exporter, Cytochrome c biogenesis ATP-binding export protein Back     alignment and domain information
>gnl|CDD|163452 TIGR03740, galliderm_ABC, gallidermin-class lantibiotic protection ABC transporter, ATP-binding subunit Back     alignment and domain information
>gnl|CDD|226646 COG4178, COG4178, ABC-type uncharacterized transport system, permease and ATPase components [General function prediction only] Back     alignment and domain information
>gnl|CDD|226952 COG4586, COG4586, ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|183133 PRK11432, fbpC, ferric transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|237917 PRK15134, PRK15134, microcin C ABC transporter ATP-binding protein YejF; Provisional Back     alignment and domain information
>gnl|CDD|184125 PRK13538, PRK13538, cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>gnl|CDD|184134 PRK13549, PRK13549, xylose transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|184203 PRK13643, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|227118 COG4778, PhnL, ABC-type phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|214372 CHL00131, ycf16, sulfate ABC transporter protein; Validated Back     alignment and domain information
>gnl|CDD|182528 PRK10535, PRK10535, macrolide transporter ATP-binding /permease protein; Provisional Back     alignment and domain information
>gnl|CDD|131817 TIGR02770, nickel_nikD, nickel import ATP-binding protein NikD Back     alignment and domain information
>gnl|CDD|236689 PRK10419, nikE, nickel transporter ATP-binding protein NikE; Provisional Back     alignment and domain information
>gnl|CDD|234200 TIGR03411, urea_trans_UrtD, urea ABC transporter, ATP-binding protein UrtD Back     alignment and domain information
>gnl|CDD|223562 COG0488, Uup, ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] Back     alignment and domain information
>gnl|CDD|183080 PRK11300, livG, leucine/isoleucine/valine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|183056 PRK11248, tauB, taurine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|213182 cd03215, ABC_Carb_Monos_II, Second domain of the ATP-binding cassette component of monosaccharide transport system Back     alignment and domain information
>gnl|CDD|182569 PRK10584, PRK10584, putative ABC transporter ATP-binding protein YbbA; Provisional Back     alignment and domain information
>gnl|CDD|183063 PRK11264, PRK11264, putative amino-acid ABC transporter ATP-binding protein YecC; Provisional Back     alignment and domain information
>gnl|CDD|184210 PRK13651, PRK13651, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|236707 PRK10522, PRK10522, multidrug transporter membrane component/ATP-binding component; Provisional Back     alignment and domain information
>gnl|CDD|163483 TIGR03771, anch_rpt_ABC, anchored repeat-type ABC transporter, ATP-binding subunit Back     alignment and domain information
>gnl|CDD|215634 PLN03211, PLN03211, ABC transporter G-25; Provisional Back     alignment and domain information
>gnl|CDD|213201 cd03234, ABCG_White, White pigment protein homolog of ABCG transporter subfamily Back     alignment and domain information
>gnl|CDD|213236 cd03269, ABC_putative_ATPase, ATP-binding cassette domain of an uncharacterized transporter Back     alignment and domain information
>gnl|CDD|130324 TIGR01257, rim_protein, retinal-specific rim ABC transporter Back     alignment and domain information
>gnl|CDD|182592 PRK10619, PRK10619, histidine/lysine/arginine/ornithine transporter subunit; Provisional Back     alignment and domain information
>gnl|CDD|226620 COG4136, COG4136, ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|131681 TIGR02633, xylG, D-xylose ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|226631 COG4152, COG4152, ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|237422 PRK13548, hmuV, hemin importer ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|226929 COG4559, COG4559, ABC-type hemin transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|233305 TIGR01189, ccmA, heme ABC exporter, ATP-binding protein CcmA Back     alignment and domain information
>gnl|CDD|185037 PRK15079, PRK15079, oligopeptide ABC transporter ATP-binding protein OppF; Provisional Back     alignment and domain information
>gnl|CDD|234200 TIGR03411, urea_trans_UrtD, urea ABC transporter, ATP-binding protein UrtD Back     alignment and domain information
>gnl|CDD|213232 cd03265, ABC_DrrA, Daunorubicin/doxorubicin resistance ATP-binding protein Back     alignment and domain information
>gnl|CDD|182817 PRK10895, PRK10895, lipopolysaccharide ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|182716 PRK10771, thiQ, thiamine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|182829 PRK10908, PRK10908, cell division protein FtsE; Provisional Back     alignment and domain information
>gnl|CDD|224053 COG1129, MglA, ABC-type sugar transport system, ATPase component [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|226968 COG4615, PvdE, ABC-type siderophore export system, fused ATPase and permease components [Secondary metabolites biosynthesis, transport, and catabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|226622 COG4138, BtuD, ABC-type cobalamin transport system, ATPase component [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|188208 TIGR02323, CP_lyasePhnK, phosphonate C-P lyase system protein PhnK Back     alignment and domain information
>gnl|CDD|233335 TIGR01271, CFTR_protein, cystic fibrosis transmembrane conductor regulator (CFTR) Back     alignment and domain information
>gnl|CDD|132313 TIGR03269, met_CoM_red_A2, methyl coenzyme M reductase system, component A2 Back     alignment and domain information
>gnl|CDD|233665 TIGR01978, sufC, FeS assembly ATPase SufC Back     alignment and domain information
>gnl|CDD|182817 PRK10895, PRK10895, lipopolysaccharide ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|226592 COG4107, PhnK, ABC-type phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|182036 PRK09700, PRK09700, D-allose transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|182342 PRK10261, PRK10261, glutathione transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|213199 cd03232, ABCG_PDR_domain2, Second domain of the pleiotropic drug resistance-like (PDR) subfamily G of ATP-binding cassette transporters Back     alignment and domain information
>gnl|CDD|132561 TIGR03522, GldA_ABC_ATP, gliding motility-associated ABC transporter ATP-binding subunit GldA Back     alignment and domain information
>gnl|CDD|237917 PRK15134, PRK15134, microcin C ABC transporter ATP-binding protein YejF; Provisional Back     alignment and domain information
>gnl|CDD|235150 PRK03695, PRK03695, vitamin B12-transporter ATPase; Provisional Back     alignment and domain information
>gnl|CDD|213189 cd03222, ABC_RNaseL_inhibitor, ATP-binding cassette domain of RNase L inhibitor Back     alignment and domain information
>gnl|CDD|183244 PRK11629, lolD, lipoprotein transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|236707 PRK10522, PRK10522, multidrug transporter membrane component/ATP-binding component; Provisional Back     alignment and domain information
>gnl|CDD|213190 cd03223, ABCD_peroxisomal_ALDP, ATP-binding cassette domain of peroxisomal transporter, subfamily D Back     alignment and domain information
>gnl|CDD|214372 CHL00131, ycf16, sulfate ABC transporter protein; Validated Back     alignment and domain information
>gnl|CDD|224053 COG1129, MglA, ABC-type sugar transport system, ATPase component [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|182980 PRK11124, artP, arginine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|233207 TIGR00955, 3a01204, The Eye Pigment Precursor Transporter (EPP) Family protein Back     alignment and domain information
>gnl|CDD|182342 PRK10261, PRK10261, glutathione transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|182993 PRK11144, modC, molybdate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|182993 PRK11144, modC, molybdate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|236688 PRK10418, nikD, nickel transporter ATP-binding protein NikD; Provisional Back     alignment and domain information
>gnl|CDD|183280 PRK11701, phnK, phosphonate C-P lyase system protein PhnK; Provisional Back     alignment and domain information
>gnl|CDD|213200 cd03233, ABCG_PDR_domain1, First domain of the pleiotropic drug resistance-like subfamily G of ATP-binding cassette transporters Back     alignment and domain information
>gnl|CDD|213204 cd03237, ABC_RNaseL_inhibitor_domain2, The ATP-binding cassette domain 2 of RNase L inhibitor Back     alignment and domain information
>gnl|CDD|214640 smart00382, AAA, ATPases associated with a variety of cellular activities Back     alignment and domain information
>gnl|CDD|183231 PRK11614, livF, leucine/isoleucine/valine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|182778 PRK10851, PRK10851, sulfate/thiosulfate transporter subunit; Provisional Back     alignment and domain information
>gnl|CDD|182336 PRK10253, PRK10253, iron-enterobactin transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|182569 PRK10584, PRK10584, putative ABC transporter ATP-binding protein YbbA; Provisional Back     alignment and domain information
>gnl|CDD|188208 TIGR02323, CP_lyasePhnK, phosphonate C-P lyase system protein PhnK Back     alignment and domain information
>gnl|CDD|226646 COG4178, COG4178, ABC-type uncharacterized transport system, permease and ATPase components [General function prediction only] Back     alignment and domain information
>gnl|CDD|225265 COG2401, COG2401, ABC-type ATPase fused to a predicted acetyltransferase domain [General function prediction only] Back     alignment and domain information
>gnl|CDD|236755 PRK10762, PRK10762, D-ribose transporter ATP binding protein; Provisional Back     alignment and domain information
>gnl|CDD|181965 PRK09580, sufC, cysteine desulfurase ATPase component; Reviewed Back     alignment and domain information
>gnl|CDD|213188 cd03221, ABCF_EF-3, ATP-binding cassette domain of elongation factor 3, subfamily F Back     alignment and domain information
>gnl|CDD|215634 PLN03211, PLN03211, ABC transporter G-25; Provisional Back     alignment and domain information
>gnl|CDD|226952 COG4586, COG4586, ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|131377 TIGR02324, CP_lyasePhnL, phosphonate C-P lyase system protein PhnL Back     alignment and domain information
>gnl|CDD|184129 PRK13543, PRK13543, cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>gnl|CDD|237917 PRK15134, PRK15134, microcin C ABC transporter ATP-binding protein YejF; Provisional Back     alignment and domain information
>gnl|CDD|226631 COG4152, COG4152, ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|213190 cd03223, ABCD_peroxisomal_ALDP, ATP-binding cassette domain of peroxisomal transporter, subfamily D Back     alignment and domain information
>gnl|CDD|182906 PRK11022, dppD, dipeptide transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|183077 PRK11288, araG, L-arabinose transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|213234 cd03267, ABC_NatA_like, ATP-binding cassette domain of an uncharacterized transporter similar in sequence to NatA Back     alignment and domain information
>gnl|CDD|215558 PLN03073, PLN03073, ABC transporter F family; Provisional Back     alignment and domain information
>gnl|CDD|213238 cd03271, ABC_UvrA_II, ATP-binding cassette domain II of the excision repair protein UvrA Back     alignment and domain information
>gnl|CDD|226364 COG3845, COG3845, ABC-type uncharacterized transport systems, ATPase components [General function prediction only] Back     alignment and domain information
>gnl|CDD|213238 cd03271, ABC_UvrA_II, ATP-binding cassette domain II of the excision repair protein UvrA Back     alignment and domain information
>gnl|CDD|236755 PRK10762, PRK10762, D-ribose transporter ATP binding protein; Provisional Back     alignment and domain information
>gnl|CDD|185049 PRK15093, PRK15093, antimicrobial peptide ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|213205 cd03238, ABC_UvrA, ATP-binding cassette domain of the excision repair protein UvrA Back     alignment and domain information
>gnl|CDD|233208 TIGR00956, 3a01205, Pleiotropic Drug Resistance (PDR) Family protein Back     alignment and domain information
>gnl|CDD|226364 COG3845, COG3845, ABC-type uncharacterized transport systems, ATPase components [General function prediction only] Back     alignment and domain information
>gnl|CDD|132313 TIGR03269, met_CoM_red_A2, methyl coenzyme M reductase system, component A2 Back     alignment and domain information
>gnl|CDD|182893 PRK11000, PRK11000, maltose/maltodextrin transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|131681 TIGR02633, xylG, D-xylose ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|188317 TIGR03415, ABC_choXWV_ATP, choline ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|236947 PRK11650, ugpC, glycerol-3-phosphate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|182880 PRK10982, PRK10982, galactose/methyl galaxtoside transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|236997 PRK11831, PRK11831, putative ABC transporter ATP-binding protein YrbF; Provisional Back     alignment and domain information
>gnl|CDD|226592 COG4107, PhnK, ABC-type phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|183280 PRK11701, phnK, phosphonate C-P lyase system protein PhnK; Provisional Back     alignment and domain information
>gnl|CDD|233206 TIGR00954, 3a01203, Peroxysomal Fatty Acyl CoA Transporter (FAT) Family protei Back     alignment and domain information
>gnl|CDD|184134 PRK13549, PRK13549, xylose transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|227118 COG4778, PhnL, ABC-type phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|213188 cd03221, ABCF_EF-3, ATP-binding cassette domain of elongation factor 3, subfamily F Back     alignment and domain information
>gnl|CDD|182880 PRK10982, PRK10982, galactose/methyl galaxtoside transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|236688 PRK10418, nikD, nickel transporter ATP-binding protein NikD; Provisional Back     alignment and domain information
>gnl|CDD|213188 cd03221, ABCF_EF-3, ATP-binding cassette domain of elongation factor 3, subfamily F Back     alignment and domain information
>gnl|CDD|184132 PRK13547, hmuV, hemin importer ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|224166 COG1245, COG1245, Predicted ATPase, RNase L inhibitor (RLI) homolog [General function prediction only] Back     alignment and domain information
>gnl|CDD|182342 PRK10261, PRK10261, glutathione transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|184134 PRK13549, PRK13549, xylose transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|130324 TIGR01257, rim_protein, retinal-specific rim ABC transporter Back     alignment and domain information
>gnl|CDD|163483 TIGR03771, anch_rpt_ABC, anchored repeat-type ABC transporter, ATP-binding subunit Back     alignment and domain information
>gnl|CDD|131681 TIGR02633, xylG, D-xylose ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|233208 TIGR00956, 3a01205, Pleiotropic Drug Resistance (PDR) Family protein Back     alignment and domain information
>gnl|CDD|236729 PRK10636, PRK10636, putative ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|185016 PRK15056, PRK15056, manganese/iron transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|213194 cd03227, ABC_Class2, ATP-binding cassette domain of non-transporter proteins Back     alignment and domain information
>gnl|CDD|213199 cd03232, ABCG_PDR_domain2, Second domain of the pleiotropic drug resistance-like (PDR) subfamily G of ATP-binding cassette transporters Back     alignment and domain information
>gnl|CDD|235150 PRK03695, PRK03695, vitamin B12-transporter ATPase; Provisional Back     alignment and domain information
>gnl|CDD|182852 PRK10938, PRK10938, putative molybdenum transport ATP-binding protein ModF; Provisional Back     alignment and domain information
>gnl|CDD|181939 PRK09544, znuC, high-affinity zinc transporter ATPase; Reviewed Back     alignment and domain information
>gnl|CDD|183077 PRK11288, araG, L-arabinose transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|236729 PRK10636, PRK10636, putative ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|184037 PRK13409, PRK13409, putative ATPase RIL; Provisional Back     alignment and domain information
>gnl|CDD|163431 TIGR03719, ABC_ABC_ChvD, ATP-binding cassette protein, ChvD family Back     alignment and domain information
>gnl|CDD|214640 smart00382, AAA, ATPases associated with a variety of cellular activities Back     alignment and domain information
>gnl|CDD|226639 COG4170, SapD, ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|181888 PRK09473, oppD, oligopeptide transporter ATP-binding component; Provisional Back     alignment and domain information
>gnl|CDD|183055 PRK11247, ssuB, aliphatic sulfonates transport ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|184132 PRK13547, hmuV, hemin importer ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|213200 cd03233, ABCG_PDR_domain1, First domain of the pleiotropic drug resistance-like subfamily G of ATP-binding cassette transporters Back     alignment and domain information
>gnl|CDD|213188 cd03221, ABCF_EF-3, ATP-binding cassette domain of elongation factor 3, subfamily F Back     alignment and domain information
>gnl|CDD|234806 PRK00635, PRK00635, excinuclease ABC subunit A; Provisional Back     alignment and domain information
>gnl|CDD|163431 TIGR03719, ABC_ABC_ChvD, ATP-binding cassette protein, ChvD family Back     alignment and domain information
>gnl|CDD|213205 cd03238, ABC_UvrA, ATP-binding cassette domain of the excision repair protein UvrA Back     alignment and domain information
>gnl|CDD|185016 PRK15056, PRK15056, manganese/iron transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|182852 PRK10938, PRK10938, putative molybdenum transport ATP-binding protein ModF; Provisional Back     alignment and domain information
>gnl|CDD|236861 PRK11147, PRK11147, ABC transporter ATPase component; Reviewed Back     alignment and domain information
>gnl|CDD|182733 PRK10790, PRK10790, putative multidrug transporter membrane\ATP-binding components; Provisional Back     alignment and domain information
>gnl|CDD|184127 PRK13540, PRK13540, cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>gnl|CDD|226622 COG4138, BtuD, ABC-type cobalamin transport system, ATPase component [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|236947 PRK11650, ugpC, glycerol-3-phosphate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|181939 PRK09544, znuC, high-affinity zinc transporter ATPase; Reviewed Back     alignment and domain information
>gnl|CDD|215599 PLN03140, PLN03140, ABC transporter G family member; Provisional Back     alignment and domain information
>gnl|CDD|182036 PRK09700, PRK09700, D-allose transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|163431 TIGR03719, ABC_ABC_ChvD, ATP-binding cassette protein, ChvD family Back     alignment and domain information
>gnl|CDD|132313 TIGR03269, met_CoM_red_A2, methyl coenzyme M reductase system, component A2 Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 1303
KOG00551228 consensus Multidrug/pheromone exporter, ABC superf 100.0
PTZ002651466 multidrug resistance protein (mdr1); Provisional 100.0
KOG00541381 consensus Multidrug resistance-associated protein/ 100.0
PLN03130 1622 ABC transporter C family member; Provisional 100.0
PLN032321495 ABC transporter C family member; Provisional 100.0
TIGR009571522 MRP_assoc_pro multi drug resistance-associated pro 100.0
PTZ002431560 ABC transporter; Provisional 100.0
TIGR012711490 CFTR_protein cystic fibrosis transmembrane conduct 100.0
KOG0058716 consensus Peptide exporter, ABC superfamily [Intra 100.0
KOG0058716 consensus Peptide exporter, ABC superfamily [Intra 100.0
KOG00551228 consensus Multidrug/pheromone exporter, ABC superf 100.0
COG2274709 SunT ABC-type bacteriocin/lantibiotic exporters, c 100.0
COG2274709 SunT ABC-type bacteriocin/lantibiotic exporters, c 100.0
COG1132567 MdlB ABC-type multidrug transport system, ATPase a 100.0
PRK11174588 cysteine/glutathione ABC transporter membrane/ATP- 100.0
PRK11174588 cysteine/glutathione ABC transporter membrane/ATP- 100.0
COG1132567 MdlB ABC-type multidrug transport system, ATPase a 100.0
TIGR00958711 3a01208 Conjugate Transporter-2 (CT2) Family prote 100.0
TIGR03797686 NHPM_micro_ABC2 NHPM bacteriocin system ABC transp 100.0
PTZ002651466 multidrug resistance protein (mdr1); Provisional 100.0
TIGR00958711 3a01208 Conjugate Transporter-2 (CT2) Family prote 100.0
COG4988559 CydD ABC-type transport system involved in cytochr 100.0
TIGR03797686 NHPM_micro_ABC2 NHPM bacteriocin system ABC transp 100.0
COG4988559 CydD ABC-type transport system involved in cytochr 100.0
TIGR01193708 bacteriocin_ABC ABC-type bacteriocin transporter. 100.0
TIGR03796710 NHPM_micro_ABC1 NHPM bacteriocin system ABC transp 100.0
PRK11160574 cysteine/glutathione ABC transporter membrane/ATP- 100.0
TIGR01193708 bacteriocin_ABC ABC-type bacteriocin transporter. 100.0
PRK11160574 cysteine/glutathione ABC transporter membrane/ATP- 100.0
TIGR03796710 NHPM_micro_ABC1 NHPM bacteriocin system ABC transp 100.0
KOG0057591 consensus Mitochondrial Fe/S cluster exporter, ABC 100.0
PRK11176582 lipid transporter ATP-binding/permease protein; Pr 100.0
KOG0056790 consensus Heavy metal exporter HMT1, ABC superfami 100.0
KOG0056790 consensus Heavy metal exporter HMT1, ABC superfami 100.0
TIGR03375694 type_I_sec_LssB type I secretion system ATPase, Ls 100.0
PRK10790592 putative multidrug transporter membrane\ATP-bindin 100.0
PRK11176582 lipid transporter ATP-binding/permease protein; Pr 100.0
TIGR03375694 type_I_sec_LssB type I secretion system ATPase, Ls 100.0
TIGR01846694 type_I_sec_HlyB type I secretion system ABC transp 100.0
PRK10790592 putative multidrug transporter membrane\ATP-bindin 100.0
TIGR01846694 type_I_sec_HlyB type I secretion system ABC transp 100.0
PRK10789569 putative multidrug transporter membrane\ATP-bindin 100.0
TIGR02203571 MsbA_lipidA lipid A export permease/ATP-binding pr 100.0
COG4987573 CydC ABC-type transport system involved in cytochr 100.0
COG4987573 CydC ABC-type transport system involved in cytochr 100.0
PRK13657588 cyclic beta-1,2-glucan ABC transporter; Provisiona 100.0
KOG0057591 consensus Mitochondrial Fe/S cluster exporter, ABC 100.0
TIGR02203571 MsbA_lipidA lipid A export permease/ATP-binding pr 100.0
TIGR02868529 CydC thiol reductant ABC exporter, CydC subunit. T 100.0
TIGR01192585 chvA glucan exporter ATP-binding protein. This mod 100.0
PRK13657588 cyclic beta-1,2-glucan ABC transporter; Provisiona 100.0
TIGR02868529 CydC thiol reductant ABC exporter, CydC subunit. T 100.0
TIGR02204576 MsbA_rel ABC transporter, permease/ATP-binding pro 100.0
PRK10789569 putative multidrug transporter membrane\ATP-bindin 100.0
TIGR01192585 chvA glucan exporter ATP-binding protein. This mod 100.0
COG5265497 ATM1 ABC-type transport system involved in Fe-S cl 100.0
TIGR02204576 MsbA_rel ABC transporter, permease/ATP-binding pro 100.0
TIGR009571522 MRP_assoc_pro multi drug resistance-associated pro 100.0
COG5265497 ATM1 ABC-type transport system involved in Fe-S cl 100.0
TIGR02857529 CydD thiol reductant ABC exporter, CydD subunit. U 100.0
TIGR02857529 CydD thiol reductant ABC exporter, CydD subunit. U 100.0
PLN031301622 ABC transporter C family member; Provisional 100.0
PTZ002431560 ABC transporter; Provisional 100.0
TIGR01842544 type_I_sec_PrtD type I secretion system ABC transp 100.0
TIGR01842544 type_I_sec_PrtD type I secretion system ABC transp 100.0
PLN032321495 ABC transporter C family member; Provisional 100.0
COG1123539 ATPase components of various ABC-type transport sy 100.0
TIGR012711490 CFTR_protein cystic fibrosis transmembrane conduct 100.0
PRK10261623 glutathione transporter ATP-binding protein; Provi 100.0
TIGR01194555 cyc_pep_trnsptr cyclic peptide transporter. This m 100.0
PRK13549506 xylose transporter ATP-binding subunit; Provisiona 100.0
COG4618580 ArpD ABC-type protease/lipase transport system, AT 100.0
COG4618580 ArpD ABC-type protease/lipase transport system, AT 100.0
TIGR01194555 cyc_pep_trnsptr cyclic peptide transporter. This m 100.0
PRK15134529 microcin C ABC transporter ATP-binding protein Yej 100.0
TIGR01257 2272 rim_protein retinal-specific rim ABC transporter. 100.0
PRK09700510 D-allose transporter ATP-binding protein; Provisio 100.0
TIGR03269520 met_CoM_red_A2 methyl coenzyme M reductase system, 100.0
PRK10762501 D-ribose transporter ATP binding protein; Provisio 100.0
KOG00541381 consensus Multidrug resistance-associated protein/ 100.0
PRK15439510 autoinducer 2 ABC transporter ATP-binding protein 100.0
TIGR02633500 xylG D-xylose ABC transporter, ATP-binding protein 100.0
PRK11288501 araG L-arabinose transporter ATP-binding protein; 100.0
TIGR00956 1394 3a01205 Pleiotropic Drug Resistance (PDR) Family p 100.0
COG4172534 ABC-type uncharacterized transport system, duplica 100.0
PRK10938490 putative molybdenum transport ATP-binding protein 100.0
PRK10982491 galactose/methyl galaxtoside transporter ATP-bindi 100.0
PRK15064530 ABC transporter ATP-binding protein; Provisional 100.0
PRK10522547 multidrug transporter membrane component/ATP-bindi 100.0
PRK10522547 multidrug transporter membrane component/ATP-bindi 100.0
PRK11819556 putative ABC transporter ATP-binding protein; Revi 100.0
TIGR03719552 ABC_ABC_ChvD ATP-binding cassette protein, ChvD fa 100.0
PLN03140 1470 ABC transporter G family member; Provisional 100.0
PRK10636638 putative ABC transporter ATP-binding protein; Prov 100.0
PRK11147635 ABC transporter ATPase component; Reviewed 100.0
TIGR00954659 3a01203 Peroxysomal Fatty Acyl CoA Transporter (FA 100.0
PLN03073718 ABC transporter F family; Provisional 100.0
TIGR00954659 3a01203 Peroxysomal Fatty Acyl CoA Transporter (FA 100.0
PRK13409590 putative ATPase RIL; Provisional 100.0
COG1129500 MglA ABC-type sugar transport system, ATPase compo 100.0
COG0488530 Uup ATPase components of ABC transporters with dup 100.0
COG3845501 ABC-type uncharacterized transport systems, ATPase 100.0
cd03289275 ABCC_CFTR2 The CFTR subfamily domain 2. The cystic 100.0
COG1126240 GlnQ ABC-type polar amino acid transport system, A 100.0
COG1126240 GlnQ ABC-type polar amino acid transport system, A 100.0
cd03289275 ABCC_CFTR2 The CFTR subfamily domain 2. The cystic 100.0
COG1135339 AbcC ABC-type metal ion transport system, ATPase c 100.0
PRK14257329 phosphate ABC transporter ATP-binding protein; Pro 100.0
COG1117253 PstB ABC-type phosphate transport system, ATPase c 100.0
COG1125309 OpuBA ABC-type proline/glycine betaine transport s 100.0
COG1117253 PstB ABC-type phosphate transport system, ATPase c 100.0
COG1135339 AbcC ABC-type metal ion transport system, ATPase c 100.0
COG1125309 OpuBA ABC-type proline/glycine betaine transport s 100.0
cd03252237 ABCC_Hemolysin The ABC-transporter hemolysin B is 100.0
KOG0927614 consensus Predicted transporter (ABC superfamily) 100.0
PRK14257329 phosphate ABC transporter ATP-binding protein; Pro 100.0
cd03288257 ABCC_SUR2 The SUR domain 2. The sulfonylurea recep 100.0
COG4615546 PvdE ABC-type siderophore export system, fused ATP 100.0
cd03252237 ABCC_Hemolysin The ABC-transporter hemolysin B is 100.0
cd03253236 ABCC_ATM1_transporter ATM1 is an ABC transporter t 100.0
cd03249238 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) 100.0
COG1120258 FepC ABC-type cobalamin/Fe3+-siderophores transpor 100.0
cd03254229 ABCC_Glucan_exporter_like Glucan exporter ATP-bind 100.0
cd03251234 ABCC_MsbA MsbA is an essential ABC transporter, cl 100.0
cd03288257 ABCC_SUR2 The SUR domain 2. The sulfonylurea recep 100.0
TIGR02314343 ABC_MetN D-methionine ABC transporter, ATP-binding 100.0
COG3839338 MalK ABC-type sugar transport systems, ATPase comp 100.0
cd03244221 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C. 100.0
KOG0065 1391 consensus Pleiotropic drug resistance proteins (PD 100.0
COG3840231 ThiQ ABC-type thiamine transport system, ATPase co 100.0
cd03253236 ABCC_ATM1_transporter ATM1 is an ABC transporter t 100.0
COG1127263 Ttg2A ABC-type transport system involved in resist 100.0
cd03254229 ABCC_Glucan_exporter_like Glucan exporter ATP-bind 100.0
COG1122235 CbiO ABC-type cobalt transport system, ATPase comp 100.0
COG1116248 TauB ABC-type nitrate/sulfonate/bicarbonate transp 100.0
COG3839338 MalK ABC-type sugar transport systems, ATPase comp 100.0
PRK13631320 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
cd03244221 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C. 100.0
cd03249238 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) 100.0
COG1120258 FepC ABC-type cobalamin/Fe3+-siderophores transpor 100.0
cd03251234 ABCC_MsbA MsbA is an essential ABC transporter, cl 100.0
COG3842352 PotA ABC-type spermidine/putrescine transport syst 100.0
COG3840231 ThiQ ABC-type thiamine transport system, ATPase co 100.0
COG2884223 FtsE Predicted ATPase involved in cell division [C 100.0
COG1124252 DppF ABC-type dipeptide/oligopeptide/nickel transp 100.0
cd03261235 ABC_Org_Solvent_Resistant ABC (ATP-binding cassett 100.0
COG1136226 SalX ABC-type antimicrobial peptide transport syst 100.0
COG1122235 CbiO ABC-type cobalt transport system, ATPase comp 100.0
cd03245220 ABCC_bacteriocin_exporters ABC-type bacteriocin ex 100.0
COG1136226 SalX ABC-type antimicrobial peptide transport syst 100.0
COG1121254 ZnuC ABC-type Mn/Zn transport systems, ATPase comp 100.0
COG4615546 PvdE ABC-type siderophore export system, fused ATP 100.0
COG1116248 TauB ABC-type nitrate/sulfonate/bicarbonate transp 100.0
COG2884223 FtsE Predicted ATPase involved in cell division [C 100.0
COG3638258 ABC-type phosphate/phosphonate transport system, A 100.0
TIGR02314343 ABC_MetN D-methionine ABC transporter, ATP-binding 100.0
PRK13650279 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
COG3638258 ABC-type phosphate/phosphonate transport system, A 100.0
COG1127263 Ttg2A ABC-type transport system involved in resist 100.0
cd03260227 ABC_PstB_phosphate_transporter Phosphate uptake is 100.0
PRK13631320 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
COG4178604 ABC-type uncharacterized transport system, permeas 100.0
cd03245220 ABCC_bacteriocin_exporters ABC-type bacteriocin ex 100.0
KOG0062582 consensus ATPase component of ABC transporters wit 100.0
cd03248226 ABCC_TAP TAP, the Transporter Associated with Anti 100.0
COG4178604 ABC-type uncharacterized transport system, permeas 100.0
COG1121254 ZnuC ABC-type Mn/Zn transport systems, ATPase comp 100.0
COG1124252 DppF ABC-type dipeptide/oligopeptide/nickel transp 100.0
PRK14250241 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK13647274 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
COG3842 352 PotA ABC-type spermidine/putrescine transport syst 100.0
PRK11153343 metN DL-methionine transporter ATP-binding subunit 100.0
PRK13637287 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK13643288 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK11650 356 ugpC glycerol-3-phosphate transporter ATP-binding 100.0
PRK14269246 phosphate ABC transporter ATP-binding protein; Pro 100.0
COG1118345 CysA ABC-type sulfate/molybdate transport systems, 100.0
cd03261235 ABC_Org_Solvent_Resistant ABC (ATP-binding cassett 100.0
PRK11432 351 fbpC ferric transporter ATP-binding subunit; Provi 100.0
TIGR01186 363 proV glycine betaine/L-proline transport ATP bindi 100.0
PRK13635279 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK13642277 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
cd03248226 ABCC_TAP TAP, the Transporter Associated with Anti 100.0
cd03256241 ABC_PhnC_transporter ABC-type phosphate/phosphonat 100.0
PRK09536 402 btuD corrinoid ABC transporter ATPase; Reviewed 100.0
cd03219236 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC trans 100.0
PRK13646286 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
cd03296239 ABC_CysA_sulfate_importer Part of the ABC transpor 100.0
TIGR03265 353 PhnT2 putative 2-aminoethylphosphonate ABC transpo 100.0
PRK13650279 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
TIGR00960216 3a0501s02 Type II (General) Secretory Pathway (IIS 100.0
cd03224222 ABC_TM1139_LivF_branched LivF (TM1139) is part of 100.0
cd03258233 ABC_MetN_methionine_transporter MetN (also known a 100.0
PRK13636283 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK11650356 ugpC glycerol-3-phosphate transporter ATP-binding 100.0
cd03291282 ABCC_CFTR1 The CFTR subfamily domain 1. The cystic 100.0
cd03260227 ABC_PstB_phosphate_transporter Phosphate uptake is 100.0
TIGR02315243 ABC_phnC phosphonate ABC transporter, ATP-binding 100.0
cd03250204 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C. 100.0
PRK13634290 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK10851 353 sulfate/thiosulfate transporter subunit; Provision 100.0
cd03369207 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-ty 100.0
PRK13633280 cobalt transporter ATP-binding subunit; Provisiona 100.0
PRK14273254 phosphate ABC transporter ATP-binding protein; Pro 100.0
cd03259213 ABC_Carb_Solutes_like ABC Carbohydrate and Solute 100.0
TIGR00972247 3a0107s01c2 phosphate ABC transporter, ATP-binding 100.0
cd03291282 ABCC_CFTR1 The CFTR subfamily domain 1. The cystic 100.0
PRK13651305 cobalt transporter ATP-binding subunit; Provisiona 100.0
TIGR03258 362 PhnT 2-aminoethylphosphonate ABC transport system, 100.0
PRK10744260 pstB phosphate transporter ATP-binding protein; Pr 100.0
PRK11432351 fbpC ferric transporter ATP-binding subunit; Provi 100.0
cd03294269 ABC_Pro_Gly_Bertaine This family comprises the gly 100.0
cd03266218 ABC_NatA_sodium_exporter NatA is the ATPase compon 100.0
PRK09452 375 potA putrescine/spermidine ABC transporter ATPase 100.0
cd03263220 ABC_subfamily_A The ABCA subfamily mediates the tr 100.0
PRK13652277 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK14242253 phosphate transporter ATP-binding protein; Provisi 100.0
PRK11629233 lolD lipoprotein transporter ATP-binding subunit; 100.0
cd03226205 ABC_cobalt_CbiO_domain2 Domain II of the ABC compo 100.0
PRK14269246 phosphate ABC transporter ATP-binding protein; Pro 100.0
cd03369207 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-ty 100.0
PRK13632271 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
cd03265220 ABC_DrrA DrrA is the ATP-binding protein component 100.0
TIGR03864236 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, 100.0
PRK13644274 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
cd03268208 ABC_BcrA_bacitracin_resist The BcrA subfamily repr 100.0
PRK11000 369 maltose/maltodextrin transporter ATP-binding prote 100.0
cd03295242 ABC_OpuCA_Osmoprotection OpuCA is a the ATP bindin 100.0
cd03218232 ABC_YhbG The ABC transporters belonging to the Yhb 100.0
PRK13537306 nodulation ABC transporter NodI; Provisional 100.0
TIGR01186363 proV glycine betaine/L-proline transport ATP bindi 100.0
PRK13647274 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK10575265 iron-hydroxamate transporter ATP-binding subunit; 100.0
PRK13637287 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK11231255 fecE iron-dicitrate transporter ATP-binding subuni 100.0
PRK11831269 putative ABC transporter ATP-binding protein YrbF; 100.0
TIGR03265353 PhnT2 putative 2-aminoethylphosphonate ABC transpo 100.0
cd03250204 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C. 100.0
cd03255218 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of 100.0
PRK15079331 oligopeptide ABC transporter ATP-binding protein O 100.0
TIGR03005252 ectoine_ehuA ectoine/hydroxyectoine ABC transporte 100.0
PRK13640282 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK11153343 metN DL-methionine transporter ATP-binding subunit 100.0
PRK09493240 glnQ glutamine ABC transporter ATP-binding protein 100.0
PRK14235267 phosphate transporter ATP-binding protein; Provisi 100.0
PRK13646286 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK14267253 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK11264250 putative amino-acid ABC transporter ATP-binding pr 100.0
PRK13643288 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK14250241 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK13638271 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
cd03264211 ABC_drug_resistance_like ABC-type multidrug transp 100.0
PRK13648269 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK10619257 histidine/lysine/arginine/ornithine transporter su 100.0
PRK11124242 artP arginine transporter ATP-binding subunit; Pro 100.0
TIGR02211221 LolD_lipo_ex lipoprotein releasing system, ATP-bin 100.0
cd03301213 ABC_MalK_N The N-terminal ATPase domain of the mal 100.0
PRK11614237 livF leucine/isoleucine/valine transporter ATP-bin 100.0
cd03219236 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC trans 100.0
PRK13634290 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK13641287 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK14273254 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK14242253 phosphate transporter ATP-binding protein; Provisi 100.0
PRK13645289 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
cd03293220 ABC_NrtD_SsuB_transporters NrtD and SsuB are the A 100.0
TIGR02769265 nickel_nikE nickel import ATP-binding protein NikE 100.0
PRK09452375 potA putrescine/spermidine ABC transporter ATPase 100.0
TIGR03410230 urea_trans_UrtE urea ABC transporter, ATP-binding 100.0
PRK13649280 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK13635279 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK10744260 pstB phosphate transporter ATP-binding protein; Pr 100.0
PRK11247257 ssuB aliphatic sulfonates transport ATP-binding su 100.0
PRK10070 400 glycine betaine transporter ATP-binding subunit; P 100.0
TIGR02673214 FtsE cell division ATP-binding protein FtsE. This 100.0
TIGR00972247 3a0107s01c2 phosphate ABC transporter, ATP-binding 100.0
cd03292214 ABC_FtsE_transporter FtsE is a hydrophilic nucleot 100.0
TIGR00960216 3a0501s02 Type II (General) Secretory Pathway (IIS 100.0
PRK14247250 phosphate ABC transporter ATP-binding protein; Pro 100.0
cd03290218 ABCC_SUR1_N The SUR domain 1. The sulfonylurea rec 100.0
PRK11607 377 potG putrescine transporter ATP-binding subunit; P 100.0
TIGR01288303 nodI ATP-binding ABC transporter family nodulation 100.0
PRK14237267 phosphate transporter ATP-binding protein; Provisi 100.0
PRK10851353 sulfate/thiosulfate transporter subunit; Provision 100.0
PRK13639275 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK13548258 hmuV hemin importer ATP-binding subunit; Provision 100.0
TIGR03258362 PhnT 2-aminoethylphosphonate ABC transport system, 100.0
TIGR00968237 3a0106s01 sulfate ABC transporter, ATP-binding pro 100.0
COG1118345 CysA ABC-type sulfate/molybdate transport systems, 100.0
cd03256241 ABC_PhnC_transporter ABC-type phosphate/phosphonat 100.0
cd03225211 ABC_cobalt_CbiO_domain1 Domain I of the ABC compon 100.0
PRK14236272 phosphate transporter ATP-binding protein; Provisi 100.0
PRK11308327 dppF dipeptide transporter ATP-binding subunit; Pr 100.0
cd03296239 ABC_CysA_sulfate_importer Part of the ABC transpor 100.0
PRK14268258 phosphate ABC transporter ATP-binding protein; Pro 100.0
TIGR03411242 urea_trans_UrtD urea ABC transporter, ATP-binding 100.0
PRK14259269 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK14239252 phosphate transporter ATP-binding protein; Provisi 100.0
cd03235213 ABC_Metallic_Cations ABC component of the metal-ty 100.0
PRK14251251 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK13642277 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK14274259 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK14240250 phosphate transporter ATP-binding protein; Provisi 100.0
TIGR03873256 F420-0_ABC_ATP proposed F420-0 ABC transporter, AT 100.0
TIGR02315243 ABC_phnC phosphonate ABC transporter, ATP-binding 100.0
TIGR03415 382 ABC_choXWV_ATP choline ABC transporter, ATP-bindin 100.0
cd03259213 ABC_Carb_Solutes_like ABC Carbohydrate and Solute 100.0
PRK13651305 cobalt transporter ATP-binding subunit; Provisiona 100.0
cd03263220 ABC_subfamily_A The ABCA subfamily mediates the tr 100.0
PRK09536402 btuD corrinoid ABC transporter ATPase; Reviewed 100.0
PRK14271276 phosphate ABC transporter ATP-binding protein; Pro 100.0
cd03224222 ABC_TM1139_LivF_branched LivF (TM1139) is part of 100.0
PRK14245250 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK10253265 iron-enterobactin transporter ATP-binding protein; 100.0
PRK14249251 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK15112267 antimicrobial peptide ABC system ATP-binding prote 100.0
PRK11300255 livG leucine/isoleucine/valine transporter ATP-bin 100.0
PRK14244251 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK13536340 nodulation factor exporter subunit NodI; Provision 100.0
PRK14248268 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK10908222 cell division protein FtsE; Provisional 100.0
cd03226205 ABC_cobalt_CbiO_domain2 Domain II of the ABC compo 100.0
PRK14262250 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK13636283 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
cd03269210 ABC_putative_ATPase This subfamily is involved in 100.0
PRK14256252 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK10584228 putative ABC transporter ATP-binding protein YbbA; 100.0
cd03258233 ABC_MetN_methionine_transporter MetN (also known a 100.0
TIGR03864236 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, 100.0
PRK11000369 maltose/maltodextrin transporter ATP-binding prote 100.0
cd03255218 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of 100.0
PRK10771232 thiQ thiamine transporter ATP-binding subunit; Pro 100.0
PRK14235267 phosphate transporter ATP-binding protein; Provisi 100.0
cd03298211 ABC_ThiQ_thiamine_transporter ABC-type thiamine tr 100.0
PRK10895241 lipopolysaccharide ABC transporter ATP-binding pro 100.0
PRK13632271 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK11629233 lolD lipoprotein transporter ATP-binding subunit; 100.0
cd03290218 ABCC_SUR1_N The SUR domain 1. The sulfonylurea rec 100.0
cd03300232 ABC_PotA_N PotA is an ABC-type transporter and the 100.0
cd03247178 ABCC_cytochrome_bd The CYD subfamily implicated in 100.0
cd03295242 ABC_OpuCA_Osmoprotection OpuCA is a the ATP bindin 100.0
PRK13644274 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK09473330 oppD oligopeptide transporter ATP-binding componen 100.0
PRK14254285 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK11022326 dppD dipeptide transporter ATP-binding subunit; Pr 100.0
cd03246173 ABCC_Protease_Secretion This family represents the 100.0
PRK14261253 phosphate ABC transporter ATP-binding protein; Pro 100.0
cd03264211 ABC_drug_resistance_like ABC-type multidrug transp 100.0
PRK14238271 phosphate transporter ATP-binding protein; Provisi 100.0
cd03262213 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP- 100.0
PRK10247225 putative ABC transporter ATP-binding protein YbbL; 100.0
PRK14243264 phosphate transporter ATP-binding protein; Provisi 100.0
PRK13652277 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
cd03294269 ABC_Pro_Gly_Bertaine This family comprises the gly 100.0
PRK13633280 cobalt transporter ATP-binding subunit; Provisiona 100.0
PRK14247250 phosphate ABC transporter ATP-binding protein; Pro 100.0
cd03257228 ABC_NikE_OppD_transporters The ABC transporter sub 100.0
cd03268208 ABC_BcrA_bacitracin_resist The BcrA subfamily repr 100.0
PRK14274259 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK14267253 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK14237267 phosphate transporter ATP-binding protein; Provisi 100.0
PRK14259269 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK14270251 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK14240250 phosphate transporter ATP-binding protein; Provisi 100.0
cd03265220 ABC_DrrA DrrA is the ATP-binding protein component 100.0
PRK14253249 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK14260259 phosphate ABC transporter ATP-binding protein; Pro 100.0
cd03299235 ABC_ModC_like Archeal protein closely related to M 100.0
cd03218232 ABC_YhbG The ABC transporters belonging to the Yhb 100.0
PRK11607377 potG putrescine transporter ATP-binding subunit; P 100.0
PRK13640282 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK11144 352 modC molybdate transporter ATP-binding protein; Pr 100.0
PRK10575265 iron-hydroxamate transporter ATP-binding subunit; 100.0
TIGR01978243 sufC FeS assembly ATPase SufC. SufC is part of the 100.0
PRK14258261 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK14236272 phosphate transporter ATP-binding protein; Provisi 100.0
PRK13547272 hmuV hemin importer ATP-binding subunit; Provision 100.0
PRK13537306 nodulation ABC transporter NodI; Provisional 100.0
TIGR03522301 GldA_ABC_ATP gliding motility-associated ABC trans 100.0
TIGR01188302 drrA daunorubicin resistance ABC transporter ATP-b 100.0
PRK09984262 phosphonate/organophosphate ester transporter subu 100.0
PRK14266250 phosphate ABC transporter ATP-binding protein; Pro 100.0
cd03247178 ABCC_cytochrome_bd The CYD subfamily implicated in 100.0
cd03266218 ABC_NatA_sodium_exporter NatA is the ATPase compon 100.0
PRK14249251 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK14239252 phosphate transporter ATP-binding protein; Provisi 100.0
PRK10070400 glycine betaine transporter ATP-binding subunit; P 100.0
PRK14268258 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK14245250 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK15093330 antimicrobial peptide ABC transporter ATP-binding 100.0
PRK13648269 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK14241258 phosphate transporter ATP-binding protein; Provisi 100.0
PRK14248268 phosphate ABC transporter ATP-binding protein; Pro 100.0
TIGR02211221 LolD_lipo_ex lipoprotein releasing system, ATP-bin 100.0
PRK14251251 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK13649280 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK10247225 putative ABC transporter ATP-binding protein YbbL; 100.0
PRK14272252 phosphate ABC transporter ATP-binding protein; Pro 100.0
TIGR01277213 thiQ thiamine ABC transporter, ATP-binding protein 100.0
COG1131293 CcmA ABC-type multidrug transport system, ATPase c 100.0
cd03234226 ABCG_White The White subfamily represents ABC tran 100.0
PRK09493240 glnQ glutamine ABC transporter ATP-binding protein 100.0
PRK15079331 oligopeptide ABC transporter ATP-binding protein O 100.0
PRK11231255 fecE iron-dicitrate transporter ATP-binding subuni 100.0
PRK13641287 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
cd03293220 ABC_NrtD_SsuB_transporters NrtD and SsuB are the A 100.0
PRK14264305 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK14252265 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK14243264 phosphate transporter ATP-binding protein; Provisi 100.0
PRK11831269 putative ABC transporter ATP-binding protein YrbF; 100.0
TIGR02769265 nickel_nikE nickel import ATP-binding protein NikE 100.0
cd03301213 ABC_MalK_N The N-terminal ATPase domain of the mal 100.0
PRK11614237 livF leucine/isoleucine/valine transporter ATP-bin 100.0
TIGR03005252 ectoine_ehuA ectoine/hydroxyectoine ABC transporte 100.0
cd03257228 ABC_NikE_OppD_transporters The ABC transporter sub 100.0
TIGR03411242 urea_trans_UrtD urea ABC transporter, ATP-binding 100.0
PRK10895241 lipopolysaccharide ABC transporter ATP-binding pro 100.0
PRK11701258 phnK phosphonate C-P lyase system protein PhnK; Pr 100.0
PRK13645289 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
TIGR03410230 urea_trans_UrtE urea ABC transporter, ATP-binding 100.0
TIGR02673214 FtsE cell division ATP-binding protein FtsE. This 100.0
PRK14275286 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK11247257 ssuB aliphatic sulfonates transport ATP-binding su 100.0
PRK11264250 putative amino-acid ABC transporter ATP-binding pr 100.0
PRK14263261 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK13548258 hmuV hemin importer ATP-binding subunit; Provision 100.0
cd03225211 ABC_cobalt_CbiO_domain1 Domain I of the ABC compon 100.0
PRK14244251 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK14261253 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK14256252 phosphate ABC transporter ATP-binding protein; Pro 100.0
cd03292214 ABC_FtsE_transporter FtsE is a hydrophilic nucleot 100.0
PRK14238271 phosphate transporter ATP-binding protein; Provisi 100.0
PRK14246257 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK13638271 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
cd03246173 ABCC_Protease_Secretion This family represents the 100.0
PRK14270251 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK14253249 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK10619257 histidine/lysine/arginine/ornithine transporter su 100.0
TIGR01288303 nodI ATP-binding ABC transporter family nodulation 100.0
PRK14255252 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK11124242 artP arginine transporter ATP-binding subunit; Pro 100.0
PRK14271276 phosphate ABC transporter ATP-binding protein; Pro 100.0
COG0410237 LivF ABC-type branched-chain amino acid transport 100.0
PRK14265274 phosphate ABC transporter ATP-binding protein; Pro 100.0
cd03235213 ABC_Metallic_Cations ABC component of the metal-ty 100.0
PRK14262250 phosphate ABC transporter ATP-binding protein; Pro 100.0
COG0410237 LivF ABC-type branched-chain amino acid transport 100.0
TIGR03740223 galliderm_ABC gallidermin-class lantibiotic protec 100.0
PRK13639275 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
TIGR03522301 GldA_ABC_ATP gliding motility-associated ABC trans 100.0
cd03298211 ABC_ThiQ_thiamine_transporter ABC-type thiamine tr 100.0
PRK14254285 phosphate ABC transporter ATP-binding protein; Pro 100.0
COG4175386 ProV ABC-type proline/glycine betaine transport sy 100.0
TIGR02142 354 modC_ABC molybdenum ABC transporter, ATP-binding p 100.0
PRK10908222 cell division protein FtsE; Provisional 100.0
PRK10584228 putative ABC transporter ATP-binding protein YbbA; 100.0
PRK10419268 nikE nickel transporter ATP-binding protein NikE; 100.0
TIGR03873256 F420-0_ABC_ATP proposed F420-0 ABC transporter, AT 100.0
PRK10253265 iron-enterobactin transporter ATP-binding protein; 100.0
PRK11308327 dppF dipeptide transporter ATP-binding subunit; Pr 100.0
PRK14260259 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK14266250 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK11248255 tauB taurine transporter ATP-binding subunit; Prov 100.0
PRK13536340 nodulation factor exporter subunit NodI; Provision 100.0
TIGR02982220 heterocyst_DevA ABC exporter ATP-binding subunit, 100.0
TIGR03415382 ABC_choXWV_ATP choline ABC transporter, ATP-bindin 100.0
PRK10771232 thiQ thiamine transporter ATP-binding subunit; Pro 100.0
PRK11300255 livG leucine/isoleucine/valine transporter ATP-bin 100.0
cd03230173 ABC_DR_subfamily_A This family of ATP-binding prot 100.0
PRK14252265 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK11022326 dppD dipeptide transporter ATP-binding subunit; Pr 100.0
PRK10418254 nikD nickel transporter ATP-binding protein NikD; 100.0
cd03300232 ABC_PotA_N PotA is an ABC-type transporter and the 100.0
PRK14241258 phosphate transporter ATP-binding protein; Provisi 100.0
PRK14263261 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK14275286 phosphate ABC transporter ATP-binding protein; Pro 100.0
cd03262213 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP- 100.0
PRK14265274 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK09984262 phosphonate/organophosphate ester transporter subu 100.0
PRK09473330 oppD oligopeptide transporter ATP-binding componen 100.0
PRK13547272 hmuV hemin importer ATP-binding subunit; Provision 100.0
PRK15112267 antimicrobial peptide ABC system ATP-binding prote 100.0
cd03269210 ABC_putative_ATPase This subfamily is involved in 100.0
TIGR00968237 3a0106s01 sulfate ABC transporter, ATP-binding pro 100.0
PRK11144352 modC molybdate transporter ATP-binding protein; Pr 100.0
PRK14258261 phosphate ABC transporter ATP-binding protein; Pro 100.0
COG4555245 NatA ABC-type Na+ transport system, ATPase compone 100.0
cd03229178 ABC_Class3 This class is comprised of all BPD (Bin 100.0
cd03233202 ABC_PDR_domain1 The pleiotropic drug resistance (P 100.0
PRK14264305 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK00349943 uvrA excinuclease ABC subunit A; Reviewed 100.0
TIGR01978243 sufC FeS assembly ATPase SufC. SufC is part of the 100.0
PRK14272252 phosphate ABC transporter ATP-binding protein; Pro 100.0
TIGR01277213 thiQ thiamine ABC transporter, ATP-binding protein 100.0
PRK14246257 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK14255252 phosphate ABC transporter ATP-binding protein; Pro 100.0
COG4555245 NatA ABC-type Na+ transport system, ATPase compone 100.0
cd03297214 ABC_ModC_molybdenum_transporter ModC is an ABC-typ 100.0
cd03234226 ABCG_White The White subfamily represents ABC tran 100.0
cd03232192 ABC_PDR_domain2 The pleiotropic drug resistance-li 100.0
COG4175 386 ProV ABC-type proline/glycine betaine transport sy 100.0
>KOG0055 consensus Multidrug/pheromone exporter, ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
Probab=100.00  E-value=7e-211  Score=1929.10  Aligned_cols=1156  Identities=51%  Similarity=0.850  Sum_probs=1060.2

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhCChhhHhccCCchhHHHHHHhhHHHHHHHHHH
Q 000751           28 WLSELALYIVYIAGGVFAAGWIEVSCWILTGERQTAVIRSRYVQVLLNQDMSFFDTYGNNGDIVSQVLSDVLLIQSALSE  107 (1303)
Q Consensus        28 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~lr~~~~~~l~~~~~~~~~~~~~~G~l~sr~~~Dv~~i~~~~~~  107 (1303)
                      -+..+++++++++++.++..|++..+|.+.++|+..++|.++++.+++++++|||.+ .+|++.+++++|++.+++++++
T Consensus        69 ~~~~~~l~~~~lg~~~~~~~~~q~~c~~~~geRq~~riR~~yl~~iLrQdi~~fD~~-~~g~~~~~l~~d~~~I~d~~ge  147 (1228)
T KOG0055|consen   69 EVSKVALYFVYLGVGVFISGFIQVSCWMRTGERQTARIRSKYLKAILRQDIGWFDTN-STGELVTRLSDDIELIQDAIGE  147 (1228)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhCccceeecc-cccceEEEecCcHHHHHHHHHH
Confidence            456788999999999999999999999999999999999999999999999999996 7799999999999999999999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhHHHHHHhc
Q 000751          108 KVGNYIHNMATFFSGLAIAFVNCWQIALITLCTGPFIVAAGGISNIFLHRLAENIQDAYAEAASIAEQAVSYIRTLYAFT  187 (1303)
Q Consensus       108 ~~~~~~~~~~~~~~~~~~~~~~~~~l~l~~l~~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~e~l~gi~~ik~~~  187 (1303)
                      ++..+++.+.+++.++++.|+..|+|+++++...|++++...++.+.+.+...+.+++++++.++++|++.++|||.+|+
T Consensus       148 Kvg~~i~~~~~fi~g~ii~F~~~W~Ltlv~l~~~Pli~~~g~~~a~~~~~~t~ke~~~ya~Ag~iaEe~i~~iRTV~af~  227 (1228)
T KOG0055|consen  148 KVGNFIQLLATFIAGFVIGFYYGWKLTLVMLSFIPLIAIAGGLLARFLSKLTEKEQEAYAKAGSIAEEVISSIRTVYAFN  227 (1228)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhhhhhhhc
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             hhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhCCccHHHHHHHHHHHHHHHHHHHHH
Q 000751          188 NETLAKYSYATSLQATLRYGILISLVQGLGLGFTYGLAICSCALQLWVGRFLVTHNKAHGGEIVTALFAVILSGLGLNQA  267 (1303)
Q Consensus       188 ~e~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~v~~g~~~~g~l~~~~~~~~~~~~~l~~~  267 (1303)
                      .|+.+.++|.+.++...+...+...+.++..++..++.++++++.+|+|+.++.++..++|+++++++.++.....+.+.
T Consensus       228 gq~~e~~ry~~~L~~~~k~gi~~g~~~G~~~G~~~~~~~~~~a~~~WyG~~li~~~~~~~g~v~~v~~~vl~g~~sLgqa  307 (1228)
T KOG0055|consen  228 GEKKEIERYSKALENALKFGIKKGLFKGLGLGFTFFLLFASYALAFWYGSTLILNGGYNGGDVITVFFSVLIGGMSLGQA  307 (1228)
T ss_pred             CcHHHHHHHHHHHHHHHHHHHHHHHHHHHHhHHHHHHHHHHHHHHHHHHHHHHhcCCCCCceEEEEEeehhhhhhhhhcc
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHhccCCCCCCCC--CCCCCCCCccEEEEEEEEEcCCCCCCCcccceeEEeeCCCEEEEECC
Q 000751          268 ATNFYSFDQGRIAAYRLYEMISRSSSTTNYD--GNTLPSVHGNIEFRNVYFSYLSRPEIPILSGFYLTVPAKKAVALVGR  345 (1303)
Q Consensus       268 ~~~~~~~~~~~~a~~ri~~~l~~~~~~~~~~--~~~~~~~~~~i~~~~v~f~y~~~~~~~~l~~i~l~i~~g~~~~ivG~  345 (1303)
                      .+.+..+..+++|+.+|++.++..++.....  +......+++|+|+||+|+||++++.++|+|+||+|++|+++|||||
T Consensus       308 ~p~l~~f~~a~~aa~~I~~~i~~~~~i~~~~~~~~~~~~~~g~ief~nV~FsYPsRpdv~Il~g~sl~i~~G~~valVG~  387 (1228)
T KOG0055|consen  308 SPHLSAFAKARAAAYRIFETIDRKPSIDPYSKGGRVLSSIKGEIEFRNVCFSYPSRPDVKILKGVSLKIPSGQTVALVGP  387 (1228)
T ss_pred             ccchHHHhccccchHHHHHHhcCCCCCCcccccCCcccccccceEEEEEEecCCCCCcchhhCCeEEEeCCCCEEEEECC
Confidence            9999999999999999999999876543321  22233467899999999999999989999999999999999999999


Q ss_pred             CCCcHHHHHHHHhccCCCCCcEEEECCeecCCCCHHHHhcceEEEecccccccHhHHHHHhcCC-CCCHHHHHHHHHHhc
Q 000751          346 NGSGKSSIIPLMERFYDPTLGEVLLDGENIKNLKLEWLRSQIGLVTQEPALLSLSIRDNIAYGR-DATLDQIEEAAKIAH  424 (1303)
Q Consensus       346 sGsGKSTl~~ll~~~~~~~~G~i~~~g~~~~~~~~~~~~~~i~~v~Q~~~l~~~ti~~ni~~~~-~~~~~~~~~~~~~~~  424 (1303)
                      |||||||+++||.|||+|++|+|++||.|+++++.+|+|++||+|+|+|.||++||+|||+||+ +++++++.+|++.++
T Consensus       388 SGsGKST~i~LL~RfydP~~G~V~idG~di~~~~~~~lr~~iglV~QePvlF~~tI~eNI~~G~~dat~~~i~~a~k~an  467 (1228)
T KOG0055|consen  388 SGSGKSTLIQLLARFYDPTSGEVLIDGEDIRNLNLKWLRSQIGLVSQEPVLFATTIRENIRYGKPDATREEIEEAAKAAN  467 (1228)
T ss_pred             CCCCHHHHHHHHHHhcCCCCceEEEcCccchhcchHHHHhhcCeeeechhhhcccHHHHHhcCCCcccHHHHHHHHHHcc
Confidence            9999999999999999999999999999999999999999999999999999999999999999 999999999999999


Q ss_pred             chHHHHhcccccCccccCCCCCCChHHHHHHHHHHhhccCCCEEEEeCCCCCCCHHHHHHHHHHHHHhcCCCeEEEEecC
Q 000751          425 AHTFISSLEKGYETQVGRAGLALTEEQKIKLSIARAVLLNPSILLLDEVTGGLDFEAERAVQEALDLLMLGRSTIIIARR  504 (1303)
Q Consensus       425 ~~~~i~~l~~g~~t~vg~~g~~LSgGqkqrialARal~~~~~ililDe~ts~lD~~~~~~i~~~l~~~~~~~t~i~ith~  504 (1303)
                      +++||..||+||||.+||+|..|||||||||||||||++||+||||||||||||+++|+.++++|++..+|||+|+||||
T Consensus       468 a~~fi~~lp~g~~T~vge~g~qLSGGQKQRIAIARalv~~P~ILLLDEaTSaLD~~se~~Vq~ALd~~~~grTTivVaHR  547 (1228)
T KOG0055|consen  468 AHDFILKLPDGYDTLVGERGVQLSGGQKQRIAIARALVRNPKILLLDEATSALDAESERVVQEALDKASKGRTTIVVAHR  547 (1228)
T ss_pred             HHHHHHhhHHhhcccccCCCCCCChHHHHHHHHHHHHHhCCCEEEecCcccccCHHHHHHHHHHHHHhhcCCeEEEEeee
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CccccccCEEEEEeCceEeeccChHHHhhcChhHHHHHHHHHhccCCCCCCccCcccccccccccCccCCCCCCCCCCcc
Q 000751          505 LSLIRNADYIAVMDEGRLFEMGTHDELLATGDLYAELLKCEEAAKLPRRMPVRNYKETSTFQIEKDSSASHSFQEPSSPK  584 (1303)
Q Consensus       505 ~~~~~~~d~i~~l~~G~i~~~g~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  584 (1303)
                      |+++++||+|+||++|+|+|.|+|+||++.+|.|.++++.|+....++..+  +.++.   .....    .+. ..+.  
T Consensus       548 LStIrnaD~I~v~~~G~IvE~G~h~ELi~~~G~Y~~lv~~Q~~~~~~~~~~--~~~~~---~~~~~----~s~-~~s~--  615 (1228)
T KOG0055|consen  548 LSTIRNADKIAVMEEGKIVEQGTHDELIALGGIYSSLVRLQELEKAAEDEE--EEESL---KEERS----RSL-KSSS--  615 (1228)
T ss_pred             hhhhhccCEEEEEECCEEEEecCHHHHHhccchHHHHHHHHhhhhhhhccc--cccch---hhhhh----hcc-cccc--
Confidence            999999999999999999999999999999999999999987654321100  00000   00000    000 0000  


Q ss_pred             cCCCCccccccccCCCCCCCCCCCCCCCCCCchhhhhhcCCCCCccCCCccccccccccccCCCCCccccccccccCCCC
Q 000751          585 MLKSPSLQRVGIYRPTDGAFDSQESPKVLSPPSEKMLENGMPMDAADKEPSIRRQDSFEMRLPELPKIDVHSSNRQTSNG  664 (1303)
Q Consensus       585 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  664 (1303)
                                                     .                ..                           +..
T Consensus       616 -------------------------------~----------------~~---------------------------~~~  621 (1228)
T KOG0055|consen  616 -------------------------------S----------------SP---------------------------SLS  621 (1228)
T ss_pred             -------------------------------c----------------cc---------------------------ccc
Confidence                                           0                00                           000


Q ss_pred             CCCCCCCCCCCCCCCcccccccccccCCCCCCCCCCcchhhhhhhccCcchHHHHhhhhHHHHHHHHHHHHHHHHHHHHH
Q 000751          665 SDPESPISPLLTSDPKNERSHSQTFSRPHSHSDDFPTKVREEESKHQKAPSFWRLAELSFAEWLYAVLGSIGAAIFGSFN  744 (1303)
Q Consensus       665 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  744 (1303)
                      +..  ..+....             .++.......+  .    .......++++++++++++|+++++|.+++++.|+..
T Consensus       622 ~~~--~~~~~~~-------------~~~~~e~~~~~--~----~~~~~~~s~~~i~k~~~pe~~~l~lG~i~a~i~G~~~  680 (1228)
T KOG0055|consen  622 RGS--NRSNLLS-------------VKPEGEDPEEP--V----SEEDEKVSFWRIFKLNKPEWPYLLLGSLGAAIRGATY  680 (1228)
T ss_pred             CCc--ccccccc-------------ccccccccccc--c----ccccccccHHHHHHhccchhHHHHHHHHHHHHhhhhH
Confidence            000  0000000             00000000000  0    0111457899999999999999999999999999999


Q ss_pred             HHHHHHHHHHHHHhcCCcchhhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhCCccccc
Q 000751          745 PLLAYVIGLIVTAYYKPEERHHLREEVNKWCLIIACMGVVTVVANFLQHFYFGIMGEKMTERVRRMMFSAMLRNEVGWFD  824 (1303)
Q Consensus       745 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~lr~~l~~~il~~~~~ffd  824 (1303)
                      |++++.++.++..++..+.+ ........|++++++++++..++.+++++++.+++++++.|+|.++|+++++++++|||
T Consensus       681 P~fa~~~s~~~~~f~~~~~~-~~~~~~~~~al~f~~l~~~~~i~~~~q~~~f~~~ge~Lt~R~R~~~F~~ll~qd~~wFD  759 (1228)
T KOG0055|consen  681 PLFAYVFSQVLEAFYPPDDD-ELKREVRAWALIFLGLGIVSGITNFLQHYFFGIAGEKLTKRLRSMMFRALLRQEVGWFD  759 (1228)
T ss_pred             HHHHHHHHHHHHHHhCCChH-HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcCCCcccC
Confidence            99999999999998865422 33334445999999999999999999999999999999999999999999999999999


Q ss_pred             cccCChhhHHHHHHhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q 000751          825 EEENSADTLSMRLANDATFVRAAFSNRLSIFIQDSAAVIVAVIIGMLLEWRLALVALATLPILSLSAIAQKLWLAGFSRG  904 (1303)
Q Consensus       825 ~~~~~~g~l~~rl~~D~~~i~~~~~~~l~~~i~~~~~~i~~~~~~~~~~~~l~l~~l~~~p~~~~~~~~~~~~~~~~~~~  904 (1303)
                      +++|+ |.|.+|+.+|...++..+...+..+++++..++++++++|+++|+++++++++.|++++..+.+.+++..+.++
T Consensus       760 ~~~ns-g~l~~RLa~Da~~vr~~v~~rl~~vv~~~~~~~~~iiiaf~~~W~lalv~la~~Pll~~~~~~~~~~~~~~~~~  838 (1228)
T KOG0055|consen  760 DPENS-GALSSRLATDASNVRAAVGDRLSLVVQNIAAVIIGIIIAFIYGWRLALVVLATFPLLILSGYLQKKFLKGFSKD  838 (1228)
T ss_pred             CCccc-hHHHHHHhcchHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhhHH
Confidence            99999 99999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHHHHHHhhHHHHHHhcchHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhHHhh
Q 000751          905 IQKMHRKASLVLEDAVRNIYTVVAFCAGNKVMELYRLQLKKIFTKSFLHGMAIGFAFGFSQFLLFACNALLLWYTGKSVR  984 (1303)
Q Consensus       905 ~~~~~~~~~~~~~e~l~gi~tI~a~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~  984 (1303)
                      .++...+++....|+++|++||++|+.|+++.+.|.+.+++..+...+++.+.++.+++++++.++++++.+|+|++++.
T Consensus       839 ~~~~~~ea~~iA~eai~NIrTV~al~~e~~~~~~y~~~l~~p~~~~~~~~~i~gl~f~~sqs~~~~~~A~~f~~G~~Li~  918 (1228)
T KOG0055|consen  839 DKKAYEEASKIAIEAVSNIRTVAALCAEEKFMELYKEELEKPRKSSFKRGLISGLGFGFSQSLLFFVYALSFWYGARLIS  918 (1228)
T ss_pred             HHHHHHHHHHHHHHHHHhHHHHHHHhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhHHHHh
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             cCccCHHHHHHHHHHHHHHHHHHHHHHhhHHHHHHHHHHHHHHHHHHhcCCCCCCCCCCCCCCCCCcccEEEEeeEEECC
Q 000751          985 DGYMDLPTALKEYMVFSFATFALVEPFGLAPYILKRRKSLISVFEIIDRVPKIDPDDSSAVKPPNVYGSIELKNVDFCYP 1064 (1303)
Q Consensus       985 ~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~~~~~~~~~~~~~~~~~~~~~~g~I~~~~Vsf~Y~ 1064 (1303)
                      .|.+++.+.+.+++++.+....+.+...+.|++.++..++.+++++++++|+.+++.+.+...+...|+|+|+||+|+||
T Consensus       919 ~g~~~~~~~~~vf~~l~~ta~~~~~~~s~~Pd~~ka~~Aa~~iF~i~dr~~~i~~~~~~~~~~~~~~G~I~~~~V~F~YP  998 (1228)
T KOG0055|consen  919 NGEMTFEDVFRVFMALSFTAMALGQASSYAPDISKAKIAAGSIFEILDRKPTIDPDSTSGGKLPNVKGDIEFRNVSFAYP  998 (1228)
T ss_pred             cCCcCHHHHHHHHHHHHHHHHHHHHHHhhCcHHHHHHHHHHHHHHHhcCCCCCCCCCCCCCccccceeEEEEeeeEeeCC
Confidence            99999999999999999999999999999999999999999999999999887766544444566789999999999999


Q ss_pred             CCCCcceeeeeeEEeeCCCEEEEEcCCCCChHHHHHHHhccccCCccEEEECCeeCCCCCHHHhhcceEEEccCCccCcc
Q 000751         1065 SRPEVLVLSNFSLKVNGGQTVAVVGVSGSGKSTIISLIERFYDPVAGQVLLDGRDLKLYNLRWLRNHLGLVQQEPIIFST 1144 (1303)
Q Consensus      1065 ~~~~~~vL~~isl~I~~Ge~vaIVG~sGSGKSTL~~lL~rl~~~~~G~I~idG~di~~~~~~~lR~~i~~VpQdp~LF~g 1144 (1303)
                      ++|+.+||+|+||+|++||++|+||||||||||++.+|.|||||.+|.|.|||+||+++++++||++|++|+|||.||++
T Consensus       999 sRP~~~Il~~l~l~i~~GqTvALVG~SGsGKSTvI~LLeRfYdp~~G~V~IDg~dik~lnl~~LR~~i~lVsQEP~LF~~ 1078 (1228)
T KOG0055|consen  999 TRPDVPVLNNLSLSIRAGQTVALVGPSGSGKSTVISLLERFYDPDAGKVKIDGVDIKDLNLKWLRKQIGLVSQEPVLFNG 1078 (1228)
T ss_pred             CCCCchhhcCCcEEecCCCEEEEECCCCCCHHHHHHHHHHhcCCCCCeEEECCcccccCCHHHHHHhcceeccCchhhcc
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             cHHHHHHcCCCCCCHHHHHHHHHHhchHHHHHhCCCCcccccCCCCCCCChHHHHHHHHHHHHhcCCCEEEEeCCCCCCC
Q 000751         1145 TIRENIIYARHNASEAEVKEAARIANAHHFISSLPHGYDTHVGMRGVDLTPGQKQRIAIARVVLKNAPILLLDEASSSIE 1224 (1303)
Q Consensus      1145 TIreNl~~g~~~~~~~ei~~al~~a~l~~~I~~lp~Gldt~vge~G~~LSgGQrQRlaLARAllr~p~ILlLDEaTSaLD 1224 (1303)
                      ||||||.||...++++|+.+|++.|++|+||.+||+||||.|||+|.+||||||||||||||++|||+||||||||||||
T Consensus      1079 TIrENI~YG~~~vs~~eIi~Aak~ANaH~FI~sLP~GyDT~vGerG~QLSGGQKQRIAIARAilRnPkILLLDEATSALD 1158 (1228)
T KOG0055|consen 1079 TIRENIAYGSEEVSEEEIIEAAKLANAHNFISSLPQGYDTRVGERGVQLSGGQKQRIAIARAILRNPKILLLDEATSALD 1158 (1228)
T ss_pred             cHHHHHhccCCCCCHHHHHHHHHHhhhHHHHhcCcCcccCccCcccCcCCchHHHHHHHHHHHHcCCCeeeeeccchhhh
Confidence            99999999965689999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHHHhhcCCcEEEEEecCchhHhhcCEEEEEeCCEEEEecChHHHhhcCchhHHHHhhhhh
Q 000751         1225 SESSRVVQEALDTLIMGNKTTILIAHRAAMMRHVDNIVVLNGGRIVEEGTHDSLLAKNGLYVRLMQPHYG 1294 (1303)
Q Consensus      1225 ~~te~~I~~~l~~~~~~~~TvI~IaHrl~ti~~~D~Iivl~~G~Ive~Gt~~eLl~~~g~y~~l~~~~~~ 1294 (1303)
                      .++|+.||++|++... +||+|+|||||+||++||.|+|+++|+|+|+|||+||++++|.|++|++.|..
T Consensus      1159 seSErvVQeALd~a~~-gRT~IvIAHRLSTIqnaD~I~Vi~~G~VvE~GtH~~L~~~~G~Y~~Lv~~q~~ 1227 (1228)
T KOG0055|consen 1159 SESERVVQEALDRAME-GRTTIVIAHRLSTIQNADVIAVLKNGKVVEQGTHDELLAKRGIYFRLVQLQSS 1227 (1228)
T ss_pred             hhhHHHHHHHHHHhhc-CCcEEEEecchhhhhcCCEEEEEECCEEEecccHHHHHhCCCchHHHhhhccC
Confidence            9999999999999876 69999999999999999999999999999999999999999999999998753



>PTZ00265 multidrug resistance protein (mdr1); Provisional Back     alignment and domain information
>KOG0054 consensus Multidrug resistance-associated protein/mitoxantrone resistance protein, ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PLN03130 ABC transporter C family member; Provisional Back     alignment and domain information
>PLN03232 ABC transporter C family member; Provisional Back     alignment and domain information
>TIGR00957 MRP_assoc_pro multi drug resistance-associated protein (MRP) Back     alignment and domain information
>PTZ00243 ABC transporter; Provisional Back     alignment and domain information
>TIGR01271 CFTR_protein cystic fibrosis transmembrane conductor regulator (CFTR) Back     alignment and domain information
>KOG0058 consensus Peptide exporter, ABC superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0058 consensus Peptide exporter, ABC superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0055 consensus Multidrug/pheromone exporter, ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>COG2274 SunT ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain [Defense mechanisms] Back     alignment and domain information
>COG2274 SunT ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain [Defense mechanisms] Back     alignment and domain information
>COG1132 MdlB ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms] Back     alignment and domain information
>PRK11174 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed Back     alignment and domain information
>PRK11174 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed Back     alignment and domain information
>COG1132 MdlB ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms] Back     alignment and domain information
>TIGR00958 3a01208 Conjugate Transporter-2 (CT2) Family protein Back     alignment and domain information
>TIGR03797 NHPM_micro_ABC2 NHPM bacteriocin system ABC transporter, ATP-binding protein Back     alignment and domain information
>PTZ00265 multidrug resistance protein (mdr1); Provisional Back     alignment and domain information
>TIGR00958 3a01208 Conjugate Transporter-2 (CT2) Family protein Back     alignment and domain information
>COG4988 CydD ABC-type transport system involved in cytochrome bd biosynthesis, ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03797 NHPM_micro_ABC2 NHPM bacteriocin system ABC transporter, ATP-binding protein Back     alignment and domain information
>COG4988 CydD ABC-type transport system involved in cytochrome bd biosynthesis, ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR01193 bacteriocin_ABC ABC-type bacteriocin transporter Back     alignment and domain information
>TIGR03796 NHPM_micro_ABC1 NHPM bacteriocin system ABC transporter, peptidase/ATP-binding protein Back     alignment and domain information
>PRK11160 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed Back     alignment and domain information
>TIGR01193 bacteriocin_ABC ABC-type bacteriocin transporter Back     alignment and domain information
>PRK11160 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed Back     alignment and domain information
>TIGR03796 NHPM_micro_ABC1 NHPM bacteriocin system ABC transporter, peptidase/ATP-binding protein Back     alignment and domain information
>KOG0057 consensus Mitochondrial Fe/S cluster exporter, ABC superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK11176 lipid transporter ATP-binding/permease protein; Provisional Back     alignment and domain information
>KOG0056 consensus Heavy metal exporter HMT1, ABC superfamily [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG0056 consensus Heavy metal exporter HMT1, ABC superfamily [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR03375 type_I_sec_LssB type I secretion system ATPase, LssB family Back     alignment and domain information
>PRK10790 putative multidrug transporter membrane\ATP-binding components; Provisional Back     alignment and domain information
>PRK11176 lipid transporter ATP-binding/permease protein; Provisional Back     alignment and domain information
>TIGR03375 type_I_sec_LssB type I secretion system ATPase, LssB family Back     alignment and domain information
>TIGR01846 type_I_sec_HlyB type I secretion system ABC transporter, HlyB family Back     alignment and domain information
>PRK10790 putative multidrug transporter membrane\ATP-binding components; Provisional Back     alignment and domain information
>TIGR01846 type_I_sec_HlyB type I secretion system ABC transporter, HlyB family Back     alignment and domain information
>PRK10789 putative multidrug transporter membrane\ATP-binding components; Provisional Back     alignment and domain information
>TIGR02203 MsbA_lipidA lipid A export permease/ATP-binding protein MsbA Back     alignment and domain information
>COG4987 CydC ABC-type transport system involved in cytochrome bd biosynthesis, fused ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG4987 CydC ABC-type transport system involved in cytochrome bd biosynthesis, fused ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK13657 cyclic beta-1,2-glucan ABC transporter; Provisional Back     alignment and domain information
>KOG0057 consensus Mitochondrial Fe/S cluster exporter, ABC superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>TIGR02203 MsbA_lipidA lipid A export permease/ATP-binding protein MsbA Back     alignment and domain information
>TIGR02868 CydC thiol reductant ABC exporter, CydC subunit Back     alignment and domain information
>TIGR01192 chvA glucan exporter ATP-binding protein Back     alignment and domain information
>PRK13657 cyclic beta-1,2-glucan ABC transporter; Provisional Back     alignment and domain information
>TIGR02868 CydC thiol reductant ABC exporter, CydC subunit Back     alignment and domain information
>TIGR02204 MsbA_rel ABC transporter, permease/ATP-binding protein Back     alignment and domain information
>PRK10789 putative multidrug transporter membrane\ATP-binding components; Provisional Back     alignment and domain information
>TIGR01192 chvA glucan exporter ATP-binding protein Back     alignment and domain information
>COG5265 ATM1 ABC-type transport system involved in Fe-S cluster assembly, permease and ATPase components [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02204 MsbA_rel ABC transporter, permease/ATP-binding protein Back     alignment and domain information
>TIGR00957 MRP_assoc_pro multi drug resistance-associated protein (MRP) Back     alignment and domain information
>COG5265 ATM1 ABC-type transport system involved in Fe-S cluster assembly, permease and ATPase components [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02857 CydD thiol reductant ABC exporter, CydD subunit Back     alignment and domain information
>TIGR02857 CydD thiol reductant ABC exporter, CydD subunit Back     alignment and domain information
>PLN03130 ABC transporter C family member; Provisional Back     alignment and domain information
>PTZ00243 ABC transporter; Provisional Back     alignment and domain information
>TIGR01842 type_I_sec_PrtD type I secretion system ABC transporter, PrtD family Back     alignment and domain information
>TIGR01842 type_I_sec_PrtD type I secretion system ABC transporter, PrtD family Back     alignment and domain information
>PLN03232 ABC transporter C family member; Provisional Back     alignment and domain information
>COG1123 ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] Back     alignment and domain information
>TIGR01271 CFTR_protein cystic fibrosis transmembrane conductor regulator (CFTR) Back     alignment and domain information
>PRK10261 glutathione transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR01194 cyc_pep_trnsptr cyclic peptide transporter Back     alignment and domain information
>PRK13549 xylose transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG4618 ArpD ABC-type protease/lipase transport system, ATPase and permease components [General function prediction only] Back     alignment and domain information
>COG4618 ArpD ABC-type protease/lipase transport system, ATPase and permease components [General function prediction only] Back     alignment and domain information
>TIGR01194 cyc_pep_trnsptr cyclic peptide transporter Back     alignment and domain information
>PRK15134 microcin C ABC transporter ATP-binding protein YejF; Provisional Back     alignment and domain information
>TIGR01257 rim_protein retinal-specific rim ABC transporter Back     alignment and domain information
>PRK09700 D-allose transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR03269 met_CoM_red_A2 methyl coenzyme M reductase system, component A2 Back     alignment and domain information
>PRK10762 D-ribose transporter ATP binding protein; Provisional Back     alignment and domain information
>KOG0054 consensus Multidrug resistance-associated protein/mitoxantrone resistance protein, ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK15439 autoinducer 2 ABC transporter ATP-binding protein LsrA; Provisional Back     alignment and domain information
>TIGR02633 xylG D-xylose ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK11288 araG L-arabinose transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR00956 3a01205 Pleiotropic Drug Resistance (PDR) Family protein Back     alignment and domain information
>COG4172 ABC-type uncharacterized transport system, duplicated ATPase component [General function prediction only] Back     alignment and domain information
>PRK10938 putative molybdenum transport ATP-binding protein ModF; Provisional Back     alignment and domain information
>PRK10982 galactose/methyl galaxtoside transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK15064 ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10522 multidrug transporter membrane component/ATP-binding component; Provisional Back     alignment and domain information
>PRK10522 multidrug transporter membrane component/ATP-binding component; Provisional Back     alignment and domain information
>PRK11819 putative ABC transporter ATP-binding protein; Reviewed Back     alignment and domain information
>TIGR03719 ABC_ABC_ChvD ATP-binding cassette protein, ChvD family Back     alignment and domain information
>PLN03140 ABC transporter G family member; Provisional Back     alignment and domain information
>PRK10636 putative ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11147 ABC transporter ATPase component; Reviewed Back     alignment and domain information
>TIGR00954 3a01203 Peroxysomal Fatty Acyl CoA Transporter (FAT) Family protei Back     alignment and domain information
>PLN03073 ABC transporter F family; Provisional Back     alignment and domain information
>TIGR00954 3a01203 Peroxysomal Fatty Acyl CoA Transporter (FAT) Family protei Back     alignment and domain information
>PRK13409 putative ATPase RIL; Provisional Back     alignment and domain information
>COG1129 MglA ABC-type sugar transport system, ATPase component [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG0488 Uup ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] Back     alignment and domain information
>COG3845 ABC-type uncharacterized transport systems, ATPase components [General function prediction only] Back     alignment and domain information
>cd03289 ABCC_CFTR2 The CFTR subfamily domain 2 Back     alignment and domain information
>COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>cd03289 ABCC_CFTR2 The CFTR subfamily domain 2 Back     alignment and domain information
>COG1135 AbcC ABC-type metal ion transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK14257 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG1117 PstB ABC-type phosphate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG1125 OpuBA ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>COG1117 PstB ABC-type phosphate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG1135 AbcC ABC-type metal ion transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG1125 OpuBA ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>cd03252 ABCC_Hemolysin The ABC-transporter hemolysin B is a central component of the secretion machinery that translocates the toxin, hemolysin A, in a Sec-independent fashion across both membranes of E Back     alignment and domain information
>KOG0927 consensus Predicted transporter (ABC superfamily) [General function prediction only] Back     alignment and domain information
>PRK14257 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03288 ABCC_SUR2 The SUR domain 2 Back     alignment and domain information
>COG4615 PvdE ABC-type siderophore export system, fused ATPase and permease components [Secondary metabolites biosynthesis, transport, and catabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>cd03252 ABCC_Hemolysin The ABC-transporter hemolysin B is a central component of the secretion machinery that translocates the toxin, hemolysin A, in a Sec-independent fashion across both membranes of E Back     alignment and domain information
>cd03253 ABCC_ATM1_transporter ATM1 is an ABC transporter that is expressed in the mitochondria Back     alignment and domain information
>cd03249 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) is a mitochondrial ATP-binding cassette protein involved in iron homeostasis and one of four ABC transporters expressed in the mitochondrial inner membrane, the other three being MDL1(ABC7), MDL2, and ATM1 Back     alignment and domain information
>COG1120 FepC ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>cd03254 ABCC_Glucan_exporter_like Glucan exporter ATP-binding protein Back     alignment and domain information
>cd03251 ABCC_MsbA MsbA is an essential ABC transporter, closely related to eukaryotic MDR proteins Back     alignment and domain information
>cd03288 ABCC_SUR2 The SUR domain 2 Back     alignment and domain information
>TIGR02314 ABC_MetN D-methionine ABC transporter, ATP-binding protein Back     alignment and domain information
>COG3839 MalK ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd03244 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C Back     alignment and domain information
>KOG0065 consensus Pleiotropic drug resistance proteins (PDR1-15), ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>COG3840 ThiQ ABC-type thiamine transport system, ATPase component [Coenzyme metabolism] Back     alignment and domain information
>cd03253 ABCC_ATM1_transporter ATM1 is an ABC transporter that is expressed in the mitochondria Back     alignment and domain information
>COG1127 Ttg2A ABC-type transport system involved in resistance to organic solvents, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>cd03254 ABCC_Glucan_exporter_like Glucan exporter ATP-binding protein Back     alignment and domain information
>COG1122 CbiO ABC-type cobalt transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG1116 TauB ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG3839 MalK ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK13631 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03244 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C Back     alignment and domain information
>cd03249 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) is a mitochondrial ATP-binding cassette protein involved in iron homeostasis and one of four ABC transporters expressed in the mitochondrial inner membrane, the other three being MDL1(ABC7), MDL2, and ATM1 Back     alignment and domain information
>COG1120 FepC ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>cd03251 ABCC_MsbA MsbA is an essential ABC transporter, closely related to eukaryotic MDR proteins Back     alignment and domain information
>COG3842 PotA ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>COG3840 ThiQ ABC-type thiamine transport system, ATPase component [Coenzyme metabolism] Back     alignment and domain information
>COG2884 FtsE Predicted ATPase involved in cell division [Cell division and chromosome partitioning] Back     alignment and domain information
>COG1124 DppF ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>cd03261 ABC_Org_Solvent_Resistant ABC (ATP-binding cassette) transport system involved in resistant to organic solvents; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>COG1136 SalX ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>COG1122 CbiO ABC-type cobalt transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd03245 ABCC_bacteriocin_exporters ABC-type bacteriocin exporters Back     alignment and domain information
>COG1136 SalX ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>COG1121 ZnuC ABC-type Mn/Zn transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG4615 PvdE ABC-type siderophore export system, fused ATPase and permease components [Secondary metabolites biosynthesis, transport, and catabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>COG1116 TauB ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG2884 FtsE Predicted ATPase involved in cell division [Cell division and chromosome partitioning] Back     alignment and domain information
>COG3638 ABC-type phosphate/phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR02314 ABC_MetN D-methionine ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK13650 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG3638 ABC-type phosphate/phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG1127 Ttg2A ABC-type transport system involved in resistance to organic solvents, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>cd03260 ABC_PstB_phosphate_transporter Phosphate uptake is of fundamental importance in the cell physiology of bacteria because phosphate is required as a nutrient Back     alignment and domain information
>PRK13631 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG4178 ABC-type uncharacterized transport system, permease and ATPase components [General function prediction only] Back     alignment and domain information
>cd03245 ABCC_bacteriocin_exporters ABC-type bacteriocin exporters Back     alignment and domain information
>KOG0062 consensus ATPase component of ABC transporters with duplicated ATPase domains/Translation elongation factor EF-3b [Amino acid transport and metabolism; Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd03248 ABCC_TAP TAP, the Transporter Associated with Antigen Processing; TAP is essential for peptide delivery from the cytosol into the lumen of the endoplasmic reticulum (ER), where these peptides are loaded on major histocompatibility complex (MHC) I molecules Back     alignment and domain information
>COG4178 ABC-type uncharacterized transport system, permease and ATPase components [General function prediction only] Back     alignment and domain information
>COG1121 ZnuC ABC-type Mn/Zn transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG1124 DppF ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK14250 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13647 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG3842 PotA ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>PRK11153 metN DL-methionine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13637 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13643 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11650 ugpC glycerol-3-phosphate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14269 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG1118 CysA ABC-type sulfate/molybdate transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd03261 ABC_Org_Solvent_Resistant ABC (ATP-binding cassette) transport system involved in resistant to organic solvents; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>PRK11432 fbpC ferric transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR01186 proV glycine betaine/L-proline transport ATP binding subunit Back     alignment and domain information
>PRK13635 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13642 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03248 ABCC_TAP TAP, the Transporter Associated with Antigen Processing; TAP is essential for peptide delivery from the cytosol into the lumen of the endoplasmic reticulum (ER), where these peptides are loaded on major histocompatibility complex (MHC) I molecules Back     alignment and domain information
>cd03256 ABC_PhnC_transporter ABC-type phosphate/phosphonate transport system Back     alignment and domain information
>PRK09536 btuD corrinoid ABC transporter ATPase; Reviewed Back     alignment and domain information
>cd03219 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC transporter subfamily is involved in the transport of the hydrophobic amino acids leucine, isoleucine and valine Back     alignment and domain information
>PRK13646 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03296 ABC_CysA_sulfate_importer Part of the ABC transporter complex cysAWTP involved in sulfate import Back     alignment and domain information
>TIGR03265 PhnT2 putative 2-aminoethylphosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK13650 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR00960 3a0501s02 Type II (General) Secretory Pathway (IISP) Family protein Back     alignment and domain information
>cd03224 ABC_TM1139_LivF_branched LivF (TM1139) is part of the LIV-I bacterial ABC-type two-component transport system that imports neutral, branched-chain amino acids Back     alignment and domain information
>cd03258 ABC_MetN_methionine_transporter MetN (also known as YusC) is an ABC-type transporter encoded by metN of the metNPQ operon in Bacillus subtilis that is involved in methionine transport Back     alignment and domain information
>PRK13636 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11650 ugpC glycerol-3-phosphate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03291 ABCC_CFTR1 The CFTR subfamily domain 1 Back     alignment and domain information
>cd03260 ABC_PstB_phosphate_transporter Phosphate uptake is of fundamental importance in the cell physiology of bacteria because phosphate is required as a nutrient Back     alignment and domain information
>TIGR02315 ABC_phnC phosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>cd03250 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C Back     alignment and domain information
>PRK13634 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK10851 sulfate/thiosulfate transporter subunit; Provisional Back     alignment and domain information
>cd03369 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-type transporter 1) Back     alignment and domain information
>PRK13633 cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14273 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03259 ABC_Carb_Solutes_like ABC Carbohydrate and Solute Transporters-like subgroup Back     alignment and domain information
>TIGR00972 3a0107s01c2 phosphate ABC transporter, ATP-binding protein Back     alignment and domain information
>cd03291 ABCC_CFTR1 The CFTR subfamily domain 1 Back     alignment and domain information
>PRK13651 cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR03258 PhnT 2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT Back     alignment and domain information
>PRK10744 pstB phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11432 fbpC ferric transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03294 ABC_Pro_Gly_Bertaine This family comprises the glycine betaine/L-proline ATP binding subunit in bacteria and its equivalents in archaea Back     alignment and domain information
>cd03266 ABC_NatA_sodium_exporter NatA is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled proton or K+ uptake Back     alignment and domain information
>PRK09452 potA putrescine/spermidine ABC transporter ATPase protein; Reviewed Back     alignment and domain information
>cd03263 ABC_subfamily_A The ABCA subfamily mediates the transport of a variety of lipid compounds Back     alignment and domain information
>PRK13652 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14242 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11629 lolD lipoprotein transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03226 ABC_cobalt_CbiO_domain2 Domain II of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota Back     alignment and domain information
>PRK14269 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03369 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-type transporter 1) Back     alignment and domain information
>PRK13632 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03265 ABC_DrrA DrrA is the ATP-binding protein component of a bacterial exporter complex that confers resistance to the antibiotics daunorubicin and doxorubicin Back     alignment and domain information
>TIGR03864 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system Back     alignment and domain information
>PRK13644 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03268 ABC_BcrA_bacitracin_resist The BcrA subfamily represents ABC transporters involved in peptide antibiotic resistance Back     alignment and domain information
>PRK11000 maltose/maltodextrin transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03295 ABC_OpuCA_Osmoprotection OpuCA is a the ATP binding component of a bacterial solute transporter that serves a protective role to cells growing in a hyperosmolar environment Back     alignment and domain information
>cd03218 ABC_YhbG The ABC transporters belonging to the YhbG family are similar to members of the Mj1267_LivG family, which is involved in the transport of branched-chain amino acids Back     alignment and domain information
>PRK13537 nodulation ABC transporter NodI; Provisional Back     alignment and domain information
>TIGR01186 proV glycine betaine/L-proline transport ATP binding subunit Back     alignment and domain information
>PRK13647 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK10575 iron-hydroxamate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13637 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11231 fecE iron-dicitrate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11831 putative ABC transporter ATP-binding protein YrbF; Provisional Back     alignment and domain information
>TIGR03265 PhnT2 putative 2-aminoethylphosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>cd03250 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C Back     alignment and domain information
>cd03255 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of liporoteins from the cytoplasmic membrane (LolCDE) Back     alignment and domain information
>PRK15079 oligopeptide ABC transporter ATP-binding protein OppF; Provisional Back     alignment and domain information
>TIGR03005 ectoine_ehuA ectoine/hydroxyectoine ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK13640 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11153 metN DL-methionine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK09493 glnQ glutamine ABC transporter ATP-binding protein; Reviewed Back     alignment and domain information
>PRK14235 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13646 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14267 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11264 putative amino-acid ABC transporter ATP-binding protein YecC; Provisional Back     alignment and domain information
>PRK13643 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14250 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13638 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03264 ABC_drug_resistance_like ABC-type multidrug transport system, ATPase component Back     alignment and domain information
>PRK13648 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK10619 histidine/lysine/arginine/ornithine transporter subunit; Provisional Back     alignment and domain information
>PRK11124 artP arginine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR02211 LolD_lipo_ex lipoprotein releasing system, ATP-binding protein Back     alignment and domain information
>cd03301 ABC_MalK_N The N-terminal ATPase domain of the maltose transporter, MalK Back     alignment and domain information
>PRK11614 livF leucine/isoleucine/valine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03219 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC transporter subfamily is involved in the transport of the hydrophobic amino acids leucine, isoleucine and valine Back     alignment and domain information
>PRK13634 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13641 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14273 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14242 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13645 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03293 ABC_NrtD_SsuB_transporters NrtD and SsuB are the ATP-binding subunits of the bacterial ABC-type nitrate and sulfonate transport systems, respectively Back     alignment and domain information
>TIGR02769 nickel_nikE nickel import ATP-binding protein NikE Back     alignment and domain information
>PRK09452 potA putrescine/spermidine ABC transporter ATPase protein; Reviewed Back     alignment and domain information
>TIGR03410 urea_trans_UrtE urea ABC transporter, ATP-binding protein UrtE Back     alignment and domain information
>PRK13649 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13635 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK10744 pstB phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11247 ssuB aliphatic sulfonates transport ATP-binding subunit; Provisional Back     alignment and domain information
>PRK10070 glycine betaine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR02673 FtsE cell division ATP-binding protein FtsE Back     alignment and domain information
>TIGR00972 3a0107s01c2 phosphate ABC transporter, ATP-binding protein Back     alignment and domain information
>cd03292 ABC_FtsE_transporter FtsE is a hydrophilic nucleotide-binding protein that binds FtsX to form a heterodimeric ATP-binding cassette (ABC)-type transporter that associates with the bacterial inner membrane Back     alignment and domain information
>TIGR00960 3a0501s02 Type II (General) Secretory Pathway (IISP) Family protein Back     alignment and domain information
>PRK14247 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03290 ABCC_SUR1_N The SUR domain 1 Back     alignment and domain information
>PRK11607 potG putrescine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR01288 nodI ATP-binding ABC transporter family nodulation protein NodI Back     alignment and domain information
>PRK14237 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10851 sulfate/thiosulfate transporter subunit; Provisional Back     alignment and domain information
>PRK13639 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13548 hmuV hemin importer ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR03258 PhnT 2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT Back     alignment and domain information
>TIGR00968 3a0106s01 sulfate ABC transporter, ATP-binding protein Back     alignment and domain information
>COG1118 CysA ABC-type sulfate/molybdate transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd03256 ABC_PhnC_transporter ABC-type phosphate/phosphonate transport system Back     alignment and domain information
>cd03225 ABC_cobalt_CbiO_domain1 Domain I of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota Back     alignment and domain information
>PRK14236 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11308 dppF dipeptide transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03296 ABC_CysA_sulfate_importer Part of the ABC transporter complex cysAWTP involved in sulfate import Back     alignment and domain information
>PRK14268 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR03411 urea_trans_UrtD urea ABC transporter, ATP-binding protein UrtD Back     alignment and domain information
>PRK14259 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14239 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03235 ABC_Metallic_Cations ABC component of the metal-type transporters Back     alignment and domain information
>PRK14251 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13642 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14274 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14240 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR03873 F420-0_ABC_ATP proposed F420-0 ABC transporter, ATP-binding protein Back     alignment and domain information
>TIGR02315 ABC_phnC phosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>TIGR03415 ABC_choXWV_ATP choline ABC transporter, ATP-binding protein Back     alignment and domain information
>cd03259 ABC_Carb_Solutes_like ABC Carbohydrate and Solute Transporters-like subgroup Back     alignment and domain information
>PRK13651 cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03263 ABC_subfamily_A The ABCA subfamily mediates the transport of a variety of lipid compounds Back     alignment and domain information
>PRK09536 btuD corrinoid ABC transporter ATPase; Reviewed Back     alignment and domain information
>PRK14271 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03224 ABC_TM1139_LivF_branched LivF (TM1139) is part of the LIV-I bacterial ABC-type two-component transport system that imports neutral, branched-chain amino acids Back     alignment and domain information
>PRK14245 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10253 iron-enterobactin transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14249 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK15112 antimicrobial peptide ABC system ATP-binding protein SapF; Provisional Back     alignment and domain information
>PRK11300 livG leucine/isoleucine/valine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14244 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13536 nodulation factor exporter subunit NodI; Provisional Back     alignment and domain information
>PRK14248 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10908 cell division protein FtsE; Provisional Back     alignment and domain information
>cd03226 ABC_cobalt_CbiO_domain2 Domain II of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota Back     alignment and domain information
>PRK14262 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13636 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03269 ABC_putative_ATPase This subfamily is involved in drug resistance, nodulation, lipid transport, and bacteriocin and lantibiotic immunity Back     alignment and domain information
>PRK14256 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10584 putative ABC transporter ATP-binding protein YbbA; Provisional Back     alignment and domain information
>cd03258 ABC_MetN_methionine_transporter MetN (also known as YusC) is an ABC-type transporter encoded by metN of the metNPQ operon in Bacillus subtilis that is involved in methionine transport Back     alignment and domain information
>TIGR03864 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system Back     alignment and domain information
>PRK11000 maltose/maltodextrin transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03255 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of liporoteins from the cytoplasmic membrane (LolCDE) Back     alignment and domain information
>PRK10771 thiQ thiamine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14235 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03298 ABC_ThiQ_thiamine_transporter ABC-type thiamine tranport system; part of the binding-protein-dependent transport system tbpA-thiPQ for thiamine and TPP Back     alignment and domain information
>PRK10895 lipopolysaccharide ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13632 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11629 lolD lipoprotein transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03290 ABCC_SUR1_N The SUR domain 1 Back     alignment and domain information
>cd03300 ABC_PotA_N PotA is an ABC-type transporter and the ATPase component of the spermidine/putrescine-preferential uptake system consisting of PotA, -B, -C, and -D Back     alignment and domain information
>cd03247 ABCC_cytochrome_bd The CYD subfamily implicated in cytochrome bd biogenesis Back     alignment and domain information
>cd03295 ABC_OpuCA_Osmoprotection OpuCA is a the ATP binding component of a bacterial solute transporter that serves a protective role to cells growing in a hyperosmolar environment Back     alignment and domain information
>PRK13644 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK09473 oppD oligopeptide transporter ATP-binding component; Provisional Back     alignment and domain information
>PRK14254 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11022 dppD dipeptide transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03246 ABCC_Protease_Secretion This family represents the ABC component of the protease secretion system PrtD, a 60-kDa integral membrane protein sharing 37% identity with HlyB, the ABC component of the alpha-hemolysin secretion pathway, in the C-terminal domain Back     alignment and domain information
>PRK14261 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03264 ABC_drug_resistance_like ABC-type multidrug transport system, ATPase component Back     alignment and domain information
>PRK14238 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03262 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP-binding components of the bacterial periplasmic histidine and glutamine permeases, repectively Back     alignment and domain information
>PRK10247 putative ABC transporter ATP-binding protein YbbL; Provisional Back     alignment and domain information
>PRK14243 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13652 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03294 ABC_Pro_Gly_Bertaine This family comprises the glycine betaine/L-proline ATP binding subunit in bacteria and its equivalents in archaea Back     alignment and domain information
>PRK13633 cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14247 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03257 ABC_NikE_OppD_transporters The ABC transporter subfamily specific for the transport of dipeptides, oligopeptides (OppD), and nickel (NikDE) Back     alignment and domain information
>cd03268 ABC_BcrA_bacitracin_resist The BcrA subfamily represents ABC transporters involved in peptide antibiotic resistance Back     alignment and domain information
>PRK14274 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14267 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14237 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14259 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14270 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14240 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03265 ABC_DrrA DrrA is the ATP-binding protein component of a bacterial exporter complex that confers resistance to the antibiotics daunorubicin and doxorubicin Back     alignment and domain information
>PRK14253 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14260 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03299 ABC_ModC_like Archeal protein closely related to ModC Back     alignment and domain information
>cd03218 ABC_YhbG The ABC transporters belonging to the YhbG family are similar to members of the Mj1267_LivG family, which is involved in the transport of branched-chain amino acids Back     alignment and domain information
>PRK11607 potG putrescine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13640 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11144 modC molybdate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10575 iron-hydroxamate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR01978 sufC FeS assembly ATPase SufC Back     alignment and domain information
>PRK14258 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14236 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13547 hmuV hemin importer ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13537 nodulation ABC transporter NodI; Provisional Back     alignment and domain information
>TIGR03522 GldA_ABC_ATP gliding motility-associated ABC transporter ATP-binding subunit GldA Back     alignment and domain information
>TIGR01188 drrA daunorubicin resistance ABC transporter ATP-binding subunit Back     alignment and domain information
>PRK09984 phosphonate/organophosphate ester transporter subunit; Provisional Back     alignment and domain information
>PRK14266 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03247 ABCC_cytochrome_bd The CYD subfamily implicated in cytochrome bd biogenesis Back     alignment and domain information
>cd03266 ABC_NatA_sodium_exporter NatA is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled proton or K+ uptake Back     alignment and domain information
>PRK14249 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14239 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10070 glycine betaine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14268 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14245 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK15093 antimicrobial peptide ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13648 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14241 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14248 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR02211 LolD_lipo_ex lipoprotein releasing system, ATP-binding protein Back     alignment and domain information
>PRK14251 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13649 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK10247 putative ABC transporter ATP-binding protein YbbL; Provisional Back     alignment and domain information
>PRK14272 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR01277 thiQ thiamine ABC transporter, ATP-binding protein Back     alignment and domain information
>COG1131 CcmA ABC-type multidrug transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>cd03234 ABCG_White The White subfamily represents ABC transporters homologous to the Drosophila white gene, which acts as a dimeric importer for eye pigment precursors Back     alignment and domain information
>PRK09493 glnQ glutamine ABC transporter ATP-binding protein; Reviewed Back     alignment and domain information
>PRK15079 oligopeptide ABC transporter ATP-binding protein OppF; Provisional Back     alignment and domain information
>PRK11231 fecE iron-dicitrate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13641 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03293 ABC_NrtD_SsuB_transporters NrtD and SsuB are the ATP-binding subunits of the bacterial ABC-type nitrate and sulfonate transport systems, respectively Back     alignment and domain information
>PRK14264 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14252 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14243 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11831 putative ABC transporter ATP-binding protein YrbF; Provisional Back     alignment and domain information
>TIGR02769 nickel_nikE nickel import ATP-binding protein NikE Back     alignment and domain information
>cd03301 ABC_MalK_N The N-terminal ATPase domain of the maltose transporter, MalK Back     alignment and domain information
>PRK11614 livF leucine/isoleucine/valine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR03005 ectoine_ehuA ectoine/hydroxyectoine ABC transporter, ATP-binding protein Back     alignment and domain information
>cd03257 ABC_NikE_OppD_transporters The ABC transporter subfamily specific for the transport of dipeptides, oligopeptides (OppD), and nickel (NikDE) Back     alignment and domain information
>TIGR03411 urea_trans_UrtD urea ABC transporter, ATP-binding protein UrtD Back     alignment and domain information
>PRK10895 lipopolysaccharide ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11701 phnK phosphonate C-P lyase system protein PhnK; Provisional Back     alignment and domain information
>PRK13645 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR03410 urea_trans_UrtE urea ABC transporter, ATP-binding protein UrtE Back     alignment and domain information
>TIGR02673 FtsE cell division ATP-binding protein FtsE Back     alignment and domain information
>PRK14275 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11247 ssuB aliphatic sulfonates transport ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11264 putative amino-acid ABC transporter ATP-binding protein YecC; Provisional Back     alignment and domain information
>PRK14263 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13548 hmuV hemin importer ATP-binding subunit; Provisional Back     alignment and domain information
>cd03225 ABC_cobalt_CbiO_domain1 Domain I of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota Back     alignment and domain information
>PRK14244 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14261 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14256 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03292 ABC_FtsE_transporter FtsE is a hydrophilic nucleotide-binding protein that binds FtsX to form a heterodimeric ATP-binding cassette (ABC)-type transporter that associates with the bacterial inner membrane Back     alignment and domain information
>PRK14238 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14246 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13638 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03246 ABCC_Protease_Secretion This family represents the ABC component of the protease secretion system PrtD, a 60-kDa integral membrane protein sharing 37% identity with HlyB, the ABC component of the alpha-hemolysin secretion pathway, in the C-terminal domain Back     alignment and domain information
>PRK14270 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14253 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10619 histidine/lysine/arginine/ornithine transporter subunit; Provisional Back     alignment and domain information
>TIGR01288 nodI ATP-binding ABC transporter family nodulation protein NodI Back     alignment and domain information
>PRK14255 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11124 artP arginine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14271 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG0410 LivF ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>PRK14265 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03235 ABC_Metallic_Cations ABC component of the metal-type transporters Back     alignment and domain information
>PRK14262 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG0410 LivF ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR03740 galliderm_ABC gallidermin-class lantibiotic protection ABC transporter, ATP-binding subunit Back     alignment and domain information
>PRK13639 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR03522 GldA_ABC_ATP gliding motility-associated ABC transporter ATP-binding subunit GldA Back     alignment and domain information
>cd03298 ABC_ThiQ_thiamine_transporter ABC-type thiamine tranport system; part of the binding-protein-dependent transport system tbpA-thiPQ for thiamine and TPP Back     alignment and domain information
>PRK14254 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG4175 ProV ABC-type proline/glycine betaine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR02142 modC_ABC molybdenum ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK10908 cell division protein FtsE; Provisional Back     alignment and domain information
>PRK10584 putative ABC transporter ATP-binding protein YbbA; Provisional Back     alignment and domain information
>PRK10419 nikE nickel transporter ATP-binding protein NikE; Provisional Back     alignment and domain information
>TIGR03873 F420-0_ABC_ATP proposed F420-0 ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK10253 iron-enterobactin transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11308 dppF dipeptide transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14260 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14266 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11248 tauB taurine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13536 nodulation factor exporter subunit NodI; Provisional Back     alignment and domain information
>TIGR02982 heterocyst_DevA ABC exporter ATP-binding subunit, DevA family Back     alignment and domain information
>TIGR03415 ABC_choXWV_ATP choline ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK10771 thiQ thiamine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11300 livG leucine/isoleucine/valine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03230 ABC_DR_subfamily_A This family of ATP-binding proteins belongs to a multisubunit transporter involved in drug resistance (BcrA and DrrA), nodulation, lipid transport, and lantibiotic immunity Back     alignment and domain information
>PRK14252 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11022 dppD dipeptide transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK10418 nikD nickel transporter ATP-binding protein NikD; Provisional Back     alignment and domain information
>cd03300 ABC_PotA_N PotA is an ABC-type transporter and the ATPase component of the spermidine/putrescine-preferential uptake system consisting of PotA, -B, -C, and -D Back     alignment and domain information
>PRK14241 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14263 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14275 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03262 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP-binding components of the bacterial periplasmic histidine and glutamine permeases, repectively Back     alignment and domain information
>PRK14265 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK09984 phosphonate/organophosphate ester transporter subunit; Provisional Back     alignment and domain information
>PRK09473 oppD oligopeptide transporter ATP-binding component; Provisional Back     alignment and domain information
>PRK13547 hmuV hemin importer ATP-binding subunit; Provisional Back     alignment and domain information
>PRK15112 antimicrobial peptide ABC system ATP-binding protein SapF; Provisional Back     alignment and domain information
>cd03269 ABC_putative_ATPase This subfamily is involved in drug resistance, nodulation, lipid transport, and bacteriocin and lantibiotic immunity Back     alignment and domain information
>TIGR00968 3a0106s01 sulfate ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK11144 modC molybdate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14258 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG4555 NatA ABC-type Na+ transport system, ATPase component [Energy production and conversion / Inorganic ion transport and metabolism] Back     alignment and domain information
>cd03229 ABC_Class3 This class is comprised of all BPD (Binding Protein Dependent) systems that are largely represented in archaea and eubacteria and are primarily involved in scavenging solutes from the environment Back     alignment and domain information
>cd03233 ABC_PDR_domain1 The pleiotropic drug resistance (PDR) family of ATP-binding cassette (ABC) transporters Back     alignment and domain information
>PRK14264 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK00349 uvrA excinuclease ABC subunit A; Reviewed Back     alignment and domain information
>TIGR01978 sufC FeS assembly ATPase SufC Back     alignment and domain information
>PRK14272 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR01277 thiQ thiamine ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK14246 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14255 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG4555 NatA ABC-type Na+ transport system, ATPase component [Energy production and conversion / Inorganic ion transport and metabolism] Back     alignment and domain information
>cd03297 ABC_ModC_molybdenum_transporter ModC is an ABC-type transporter and the ATPase component of a molybdate transport system that also includes the periplasmic binding protein ModA and the membrane protein ModB Back     alignment and domain information
>cd03234 ABCG_White The White subfamily represents ABC transporters homologous to the Drosophila white gene, which acts as a dimeric importer for eye pigment precursors Back     alignment and domain information
>cd03232 ABC_PDR_domain2 The pleiotropic drug resistance-like (PDR) family of ATP-binding cassette (ABC) transporters Back     alignment and domain information
>COG4175 ProV ABC-type proline/glycine betaine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1303
4f4c_A1321 The Crystal Structure Of The Multi-Drug Transporter 1e-151
4f4c_A 1321 The Crystal Structure Of The Multi-Drug Transporter 2e-73
3g60_A1284 Structure Of P-Glycoprotein Reveals A Molecular Bas 1e-102
3g5u_A1284 Structure Of P-Glycoprotein Reveals A Molecular Bas 1e-102
4ayt_A595 Structure Of The Human Mitochondrial Abc Transporte 6e-74
4ayt_A595 Structure Of The Human Mitochondrial Abc Transporte 2e-66
4ayw_A619 Structure Of The Human Mitochondrial Abc Transporte 1e-73
4ayw_A619 Structure Of The Human Mitochondrial Abc Transporte 7e-66
3b5w_A582 Crystal Structure Of Eschericia Coli Msba Length = 1e-58
3b5w_A582 Crystal Structure Of Eschericia Coli Msba Length = 5e-55
3b5y_A582 Crystal Structure Of Msba From Salmonella Typhimuri 2e-58
3b5y_A582 Crystal Structure Of Msba From Salmonella Typhimuri 3e-56
3qf4_B598 Crystal Structure Of A Heterodimeric Abc Transporte 1e-57
3qf4_B598 Crystal Structure Of A Heterodimeric Abc Transporte 1e-49
3b5x_A582 Crystal Structure Of Msba From Vibrio Cholerae Leng 1e-54
3b5x_A582 Crystal Structure Of Msba From Vibrio Cholerae Leng 3e-46
2hyd_A578 Multidrug Abc Transporter Sav1866 Length = 578 3e-54
2hyd_A578 Multidrug Abc Transporter Sav1866 Length = 578 3e-53
2pmk_A243 Crystal Structures Of An Isolated Abc-Atpase In Com 9e-49
2pmk_A243 Crystal Structures Of An Isolated Abc-Atpase In Com 4e-35
3b5j_A243 Crystal Structures Of The S504a Mutant Of An Isolat 2e-48
3b5j_A243 Crystal Structures Of The S504a Mutant Of An Isolat 5e-35
1mt0_A241 Atp-Binding Domain Of Haemolysin B From Escherichia 4e-48
1mt0_A241 Atp-Binding Domain Of Haemolysin B From Escherichia 3e-35
2ff7_A247 The Abc-Atpase Of The Abc-Transporter Hlyb In The A 4e-48
2ff7_A247 The Abc-Atpase Of The Abc-Transporter Hlyb In The A 3e-35
1xef_A241 Crystal Structure Of The AtpMG2+ BOUND COMPOSITE DI 7e-48
1xef_A241 Crystal Structure Of The AtpMG2+ BOUND COMPOSITE DI 4e-34
2ffa_A247 Crystal Structure Of Abc-Atpase H662a Of The Abc-Tr 7e-48
2ffa_A247 Crystal Structure Of Abc-Atpase H662a Of The Abc-Tr 4e-34
2ffb_A247 The Crystal Structure Of The Hlyb-Nbd E631q Mutant 9e-48
2ffb_A247 The Crystal Structure Of The Hlyb-Nbd E631q Mutant 3e-35
3nh6_A306 Nucleotide Binding Domain Of Human Abcb6 (Apo Struc 2e-46
3nh6_A306 Nucleotide Binding Domain Of Human Abcb6 (Apo Struc 2e-38
3qf4_A587 Crystal Structure Of A Heterodimeric Abc Transporte 2e-45
3qf4_A587 Crystal Structure Of A Heterodimeric Abc Transporte 7e-41
1mv5_A243 Crystal Structure Of Lmra Atp-Binding Domain Length 4e-45
1mv5_A243 Crystal Structure Of Lmra Atp-Binding Domain Length 9e-32
1jj7_A260 Crystal Structure Of The C-Terminal Atpase Domain O 2e-41
1jj7_A260 Crystal Structure Of The C-Terminal Atpase Domain O 3e-35
2ixf_A271 Crystal Structure Of The Atpase Domain Of Tap1 With 5e-41
2ixf_A271 Crystal Structure Of The Atpase Domain Of Tap1 With 8e-33
2ixe_A271 Crystal Structure Of The Atpase Domain Of Tap1 With 7e-41
2ixe_A271 Crystal Structure Of The Atpase Domain Of Tap1 With 7e-32
2ixg_A271 Crystal Structure Of The Atpase Domain Of Tap1 With 1e-40
2ixg_A271 Crystal Structure Of The Atpase Domain Of Tap1 With 1e-31
2ghi_A260 Crystal Structure Of Plasmodium Yoelii Multidrug Re 4e-40
2ghi_A260 Crystal Structure Of Plasmodium Yoelii Multidrug Re 2e-35
2cbz_A237 Structure Of The Human Multidrug Resistance Protein 3e-19
2cbz_A237 Structure Of The Human Multidrug Resistance Protein 1e-15
1q3h_A286 Mouse Cftr Nbd1 With Amp.Pnp Length = 286 2e-14
1q3h_A286 Mouse Cftr Nbd1 With Amp.Pnp Length = 286 5e-10
1r0z_A286 Phosphorylated Cystic Fibrosis Transmembrane Conduc 2e-14
1r0z_A286 Phosphorylated Cystic Fibrosis Transmembrane Conduc 5e-10
3dhw_C343 Crystal Structure Of Methionine Importer Metni Leng 4e-14
3dhw_C343 Crystal Structure Of Methionine Importer Metni Leng 7e-06
1xf9_A283 Structure Of Nbd1 From Murine Cftr- F508s Mutant Le 7e-14
1xf9_A283 Structure Of Nbd1 From Murine Cftr- F508s Mutant Le 2e-09
1xfa_A283 Structure Of Nbd1 From Murine Cftr- F508r Mutant Le 7e-14
1xfa_A283 Structure Of Nbd1 From Murine Cftr- F508r Mutant Le 2e-09
3tui_C366 Inward Facing Conformations Of The Metni Methionine 1e-13
3tui_C366 Inward Facing Conformations Of The Metni Methionine 7e-06
3tuj_C366 Inward Facing Conformations Of The Metni Methionine 7e-13
3tuj_C366 Inward Facing Conformations Of The Metni Methionine 2e-05
2bbo_A291 Human Nbd1 With Phe508 Length = 291 7e-13
2bbo_A291 Human Nbd1 With Phe508 Length = 291 3e-08
3si7_A285 The Crystal Structure Of The Nbd1 Domain Of The Mou 1e-12
3si7_A285 The Crystal Structure Of The Nbd1 Domain Of The Mou 7e-10
2it1_A362 Structure Of Ph0203 Protein From Pyrococcus Horikos 3e-12
2it1_A 362 Structure Of Ph0203 Protein From Pyrococcus Horikos 1e-05
1xmi_A291 Crystal Structure Of Human F508a Nbd1 Domain With A 1e-11
1xmi_A291 Crystal Structure Of Human F508a Nbd1 Domain With A 2e-08
1z47_A355 Structure Of The Atpase Subunit Cysa Of The Putativ 1e-11
1z47_A355 Structure Of The Atpase Subunit Cysa Of The Putativ 3e-04
2bbt_A290 Human Deltaf508 Nbd1 With Two Solublizing Mutations 2e-11
2bbt_A290 Human Deltaf508 Nbd1 With Two Solublizing Mutations 4e-09
3gfo_A275 Structure Of Cbio1 From Clostridium Perfringens: Pa 2e-11
3gfo_A275 Structure Of Cbio1 From Clostridium Perfringens: Pa 2e-05
2pzg_A241 Minimal Human Cftr First Nucleotide Binding Domain 2e-11
2pzg_A241 Minimal Human Cftr First Nucleotide Binding Domain 7e-09
2pze_A229 Minimal Human Cftr First Nucleotide Binding Domain 2e-11
2pze_A229 Minimal Human Cftr First Nucleotide Binding Domain 9e-09
3d31_A348 Modbc From Methanosarcina Acetivorans Length = 348 3e-11
3d31_A 348 Modbc From Methanosarcina Acetivorans Length = 348 8e-08
1xmj_A290 Crystal Structure Of Human Deltaf508 Human Nbd1 Dom 4e-11
1xmj_A290 Crystal Structure Of Human Deltaf508 Human Nbd1 Dom 3e-08
4hlu_A268 Structure Of The Ecfa-a' Heterodimer Bound To Adp L 5e-11
4hlu_A268 Structure Of The Ecfa-a' Heterodimer Bound To Adp L 2e-07
2bbs_A290 Human Deltaf508 Nbd1 With Three Solubilizing Mutati 6e-11
2bbs_A290 Human Deltaf508 Nbd1 With Three Solubilizing Mutati 5e-09
2yz2_A266 Crystal Structure Of The Abc Transporter In The Cob 8e-11
2yz2_A266 Crystal Structure Of The Abc Transporter In The Cob 7e-07
3gd7_A390 Crystal Structure Of Human Nbd2 Complexed With N6- 1e-10
3gd7_A 390 Crystal Structure Of Human Nbd2 Complexed With N6- 6e-07
2yyz_A359 Crystal Structure Of Sugar Abc Transporter, Atp-Bin 2e-10
2yyz_A 359 Crystal Structure Of Sugar Abc Transporter, Atp-Bin 4e-04
2onk_A240 Abc Transporter Modbc In Complex With Its Binding P 3e-10
3c41_J242 Abc Protein Artp In Complex With Amp-PnpMG2+ Length 4e-10
3c41_J242 Abc Protein Artp In Complex With Amp-PnpMG2+ Length 4e-06
2olj_A263 Abc Protein Artp In Complex With AdpMG2+ Length = 2 4e-10
2olj_A263 Abc Protein Artp In Complex With AdpMG2+ Length = 2 6e-06
3fvq_A359 Crystal Structure Of The Nucleotide Binding Domain 6e-10
2pzf_A228 Minimal Human Cftr First Nucleotide Binding Domain 1e-09
2pzf_A228 Minimal Human Cftr First Nucleotide Binding Domain 1e-08
1f3o_A235 Crystal Structure Of Mj0796 Atp-Binding Cassette Le 5e-08
1f3o_A235 Crystal Structure Of Mj0796 Atp-Binding Cassette Le 2e-04
1vpl_A256 Crystal Structure Of Abc Transporter Atp-binding Pr 1e-07
1vci_A373 Crystal Structure Of The Atp-binding Cassette Of Mu 2e-07
1v43_A372 Crystal Structure Of Atpase Subunit Of Abc Sugar Tr 2e-07
1l2t_A235 Dimeric Structure Of Mj0796, A Bacterial Abc Transp 2e-07
1l2t_A235 Dimeric Structure Of Mj0796, A Bacterial Abc Transp 4e-04
4hlu_D268 Structure Of The Ecfa-a' Heterodimer Bound To Adp L 4e-07
4hlu_D268 Structure Of The Ecfa-a' Heterodimer Bound To Adp L 1e-05
1q12_A381 Crystal Structure Of The Atp-bound E. Coli Malk Len 8e-07
1q1b_A381 Crystal Structure Of E. Coli Malk In The Nucleotide 9e-07
1b0u_A262 Atp-Binding Subunit Of The Histidine Permease From 1e-06
4g1u_C266 X-Ray Structure Of The Bacterial Heme Transporter H 1e-06
2r6g_A381 The Crystal Structure Of The E. Coli Maltose Transp 2e-06
2d2e_A250 Crystal Structure Of Atypical Cytoplasmic Abc-Atpas 3e-06
3tif_A235 Dimeric Structure Of A Post-Hydrolysis State Of The 3e-06
3tif_A235 Dimeric Structure Of A Post-Hydrolysis State Of The 7e-04
1oxx_K353 Crystal Structure Of Glcv, The Abc-Atpase Of The Gl 1e-05
1oxs_C353 Crystal Structure Of Glcv, The Abc-Atpase Of The Gl 1e-05
1g29_1372 Malk Length = 372 2e-05
1ji0_A240 Crystal Structure Analysis Of The Abc Transporter F 3e-05
2pcj_A224 Crystal Structure Of Abc Transporter (Aq_297) From 3e-05
2pcj_A224 Crystal Structure Of Abc Transporter (Aq_297) From 4e-04
1g6h_A257 Crystal Structure Of The Adp Conformation Of Mj1267 3e-05
1g9x_A257 Characterization Of The Twinning Structure Of Mj126 3e-05
2d62_A375 Crystal Structure Of Multiple Sugar Binding Transpo 4e-05
1gaj_A257 Crystal Structure Of A Nucleotide-Free Atp-Binding 7e-05
2d3w_A248 Crystal Structure Of Escherichia Coli Sufc, An Atpa 8e-05
2zu0_C267 Crystal Structure Of Sufc-Sufd Complex Involved In 8e-05
4fwi_B334 Crystal Structure Of The Nucleotide-binding Domain 1e-04
>pdb|4F4C|A Chain A, The Crystal Structure Of The Multi-Drug Transporter Length = 1321 Back     alignment and structure

Iteration: 1

Score = 533 bits (1372), Expect = e-151, Method: Compositional matrix adjust. Identities = 372/1271 (29%), Positives = 602/1271 (47%), Gaps = 122/1271 (9%) Query: 42 GVFAAGWIEVSCWILTGERQTAVIRSRYVQVLLNQDMSFFDTYGNNGDIVSQVLSDVLLI 101 G++AAG I V+C++ E+ +R +V+ +L Q++S+FDT ++G + +++ ++ + Sbjct: 148 GMWAAGQITVTCYLYVAEQMNNRLRREFVKSILRQEISWFDT-NHSGTLATKLFDNLERV 206 Query: 102 QSALSEKVGNYIHNMATFFSGLAIAFVNCWQIALITLCTGPFIVAAGGISNIFLHRLAEN 161 + +K+G ++ F +G +AF + WQ+ L+ L P G + A Sbjct: 207 KEGTGDKIGMAFQYLSQFITGFIVAFTHSWQLTLVMLAVTPIQALCGFAIAKSMSTFAIR 266 Query: 162 XXXXXXXXXXXXXXXVSYIRTLYAFTNETLAKYSYATSLQATLRYGILISLVQGLGLGFT 221 +S IRT+ + Y+T+++ + G+L L G+ G Sbjct: 267 ETLRYAKAGKVVEETISSIRTVVSLNGLRYELERYSTAVEEAKKAGVLKGLFLGISFGAM 326 Query: 222 YGLAICSCALQLWVGRFLVTHNKAHGGEIVTALFAVILSGLGLNQAATNFYSFDQGRIAA 281 S AL ++G V + G+++T +V++ + L A + AA Sbjct: 327 QASNFISFALAFYIGVGWVHDGSLNFGDMLTTFSSVMMGSMALGLAGPQLAVLGTAQGAA 386 Query: 282 YRLYEMISRSS--STTNYDGNTLPSVHGNIEFRNVYFSYLSRPEIPILSGFYLTVPAKKA 339 +YE++ R +++ G + G+I NV+F+Y SRP++PIL G L V A + Sbjct: 387 SGIYEVLDRKPVIDSSSKAGRKDMKIKGDITVENVHFTYPSRPDVPILRGMNLRVNAGQT 446 Query: 340 VALVGRNGSGKSSIIPLMERFYDPTLGEVLLDGENIKNLKLEWLRSQIGLVTQEPALLSL 399 VALVG +G GKS+II L+ R+YD G++ +DG +++++ LE+LR + +V+QEPAL + Sbjct: 447 VALVGSSGCGKSTIISLLLRYYDVLKGKITIDGVDVRDINLEFLRKNVAVVSQEPALFNC 506 Query: 400 SIRDNIAYGRDA-TLDQIEEAAKIAHAHTFISSLEKGYETQVGRAGLALTEEQKIKLSIA 458 +I +NI+ G++ T +++ A K+A+A FI +L GY T VG G L+ QK +++IA Sbjct: 507 TIEENISLGKEGITREEMVAACKMANAEKFIKTLPNGYNTLVGDRGTQLSGGQKQRIAIA 566 Query: 459 RAVLLNPSILLLDEVTGGLDFEAERAVQEALDLLMLGRSTIIIARRLSLIRNADYIAVMD 518 RA++ NP ILLLDE T LD E+E VQ+ALD GR+TIIIA RLS IRNAD I Sbjct: 567 RALVRNPKILLLDEATSALDAESEGIVQQALDKAAKGRTTIIIAHRLSTIRNADLIISCK 626 Query: 519 EGRLFEMGTHDELLATGDLYAELLKCEEAAKLPRRMPVRNYKETSTFQIEKDSSASHSFQ 578 G++ E+G H L+A LY +L+ + TF DS+A F Sbjct: 627 NGQVVEVGDHRALMAQQGLYYDLVTAQ------------------TFTDAVDSAAEGKFS 668 Query: 579 EXXXXXXXXXXXXQRVGIYRPTDGAFDSQESPKVLSPPSEKMLENGMPMDAADKEPSIRR 638 EN + ++ E + R Sbjct: 669 R------------------------------------------ENSVARQTSEHE-GLSR 685 Query: 639 QDSFEMRLPELPKIDVHSSNRQTSNGSDPESPISPLLTSDPKNERSHSQTFSRPHSHSDD 698 Q S EM D+ + R ++ GS P+ D K ER SR Sbjct: 686 QAS-EMD-------DIMNRVRSSTIGSITNGPV-----IDEKEERIGKDALSR------- 725 Query: 699 FPTKVREEESKHQKAPSF---WRLAELSFAEWLYAVLGSIGAAIFGSFNPLLAYVIGLIV 755 K EE+ QK F + + + ++ +IG I+ +++ + + Sbjct: 726 --LKQELEENNAQKTNLFEILYHARPHALSLFIGMSTATIGGFIYPTYSVFFTSFMNVFA 783 Query: 756 TAYYKPEERHHLREEVNKWCLIIACMGVVTVVANFLQHFYFGIMGEKMTERVRRMMFSAM 815 + H W L+ + + +FL F+ GI E +T +R +F + Sbjct: 784 GNPADFLSQGHF------WALMFLVLAAAQGICSFLMTFFMGIASESLTRDLRNKLFRNV 837 Query: 816 LRNEVGWFDEEENSADTLSMRLANDATFVRAAFSNRLSIFIQDSAAVIVAVIIGMLLEWR 875 L +G+FD +N++ +S RLA D +R A R S I +++ + + W+ Sbjct: 838 LSQHIGFFDSPQNASGKISTRLATDVPNLRTAIDFRFSTVITTLVSMVAGIGLAFFYGWQ 897 Query: 876 LALVALATLPILSLSAIAQKLWLAGFSRGIQKMHRKASLVLEDAVRNIYTVVAFCAGNKV 935 +AL+ +A LPI++ + G + + + +A+ N+ TV A + Sbjct: 898 MALLIIAILPIVAFGQYLRGRRFTGKNVKSASEFADSGKIAIEAIENVRTVQALAREDTF 957 Query: 936 MELYRLQL----KKIFTKSFLHGMAIGFAFGFSQFLLFACN---ALLLWYTGKSVRDGYM 988 E + +L K+ ++F+ G++ G A +LL C L L T Sbjct: 958 YENFCEKLDIPHKEAIKEAFIQGLSYGCASSV-LYLLNTCAYRMGLALIIT--------- 1007 Query: 989 DLPT-----ALKEYMVFSFATFALVEPFGLAPYILKRRKSLISVFEIIDRVPKIDPDDSS 1043 D PT L+ + +T L P K + +F ++ ++ KID S Sbjct: 1008 DPPTMQPMRVLRVMYAITISTSTLGFATSYFPEYAKATFAGGIIFGMLRKISKID-SLSL 1066 Query: 1044 AVKPPNVYGSIELKNVDFCYPSRPEVLVLSNFSLKVNXXXXXXXXXXXXXXXXXXXXLIE 1103 A + +YG + KNV F YP RPE+ +L S V L+E Sbjct: 1067 AGEKKKLYGKVIFKNVRFAYPERPEIEILKGLSFSVEPGQTLALVGPSGCGKSTVVALLE 1126 Query: 1104 RFYDPVAGQVLLDGRDLKLYNLRWLRNHLGLVQQEPIIFSTTIRENIIYARHNAS--EAE 1161 RFYD + G++ +DG ++K N R+ + +V QEP +F +I ENIIY +S A+ Sbjct: 1127 RFYDTLGGEIFIDGSEIKTLNPEHTRSQIAIVSQEPTLFDCSIAENIIYGLDPSSVTMAQ 1186 Query: 1162 VKEAARIANAHHFISSLPHGYDTHVGMRGVDLTPGQKQRIAIARVVLKNAPILLLDXXXX 1221 V+EAAR+AN H+FI+ LP G++T VG RG L+ GQKQRIAIAR +++N ILLLD Sbjct: 1187 VEEAARLANIHNFIAELPEGFETRVGDRGTQLSGGQKQRIAIARALVRNPKILLLDEATS 1246 Query: 1222 XXXXXXXRVVQEALDTLIMGNKTTILIAHRAAMMRHVDNIVVLNGGRIVEEGTHDSLLAK 1281 +VVQEALD G +T I+IAHR + + D I V++ G I+E+GTH L+++ Sbjct: 1247 ALDTESEKVVQEALDRAREG-RTCIVIAHRLNTVMNADCIAVVSNGTIIEKGTHTQLMSE 1305 Query: 1282 NGLYVRLMQPH 1292 G Y +L Q Sbjct: 1306 KGAYYKLTQKQ 1316
>pdb|4F4C|A Chain A, The Crystal Structure Of The Multi-Drug Transporter Length = 1321 Back     alignment and structure
>pdb|3G60|A Chain A, Structure Of P-Glycoprotein Reveals A Molecular Basis For Poly-Specific Drug Binding Length = 1284 Back     alignment and structure
>pdb|3G5U|A Chain A, Structure Of P-Glycoprotein Reveals A Molecular Basis For Poly-Specific Drug Binding Length = 1284 Back     alignment and structure
>pdb|4AYT|A Chain A, Structure Of The Human Mitochondrial Abc Transporter, Abcb10 Length = 595 Back     alignment and structure
>pdb|4AYT|A Chain A, Structure Of The Human Mitochondrial Abc Transporter, Abcb10 Length = 595 Back     alignment and structure
>pdb|4AYW|A Chain A, Structure Of The Human Mitochondrial Abc Transporter, Abcb10 (plate Form) Length = 619 Back     alignment and structure
>pdb|4AYW|A Chain A, Structure Of The Human Mitochondrial Abc Transporter, Abcb10 (plate Form) Length = 619 Back     alignment and structure
>pdb|3B5W|A Chain A, Crystal Structure Of Eschericia Coli Msba Length = 582 Back     alignment and structure
>pdb|3B5W|A Chain A, Crystal Structure Of Eschericia Coli Msba Length = 582 Back     alignment and structure
>pdb|3B5Y|A Chain A, Crystal Structure Of Msba From Salmonella Typhimurium With Amppnp Length = 582 Back     alignment and structure
>pdb|3B5Y|A Chain A, Crystal Structure Of Msba From Salmonella Typhimurium With Amppnp Length = 582 Back     alignment and structure
>pdb|3QF4|B Chain B, Crystal Structure Of A Heterodimeric Abc Transporter In Its Inward- Facing Conformation Length = 598 Back     alignment and structure
>pdb|3QF4|B Chain B, Crystal Structure Of A Heterodimeric Abc Transporter In Its Inward- Facing Conformation Length = 598 Back     alignment and structure
>pdb|3B5X|A Chain A, Crystal Structure Of Msba From Vibrio Cholerae Length = 582 Back     alignment and structure
>pdb|3B5X|A Chain A, Crystal Structure Of Msba From Vibrio Cholerae Length = 582 Back     alignment and structure
>pdb|2HYD|A Chain A, Multidrug Abc Transporter Sav1866 Length = 578 Back     alignment and structure
>pdb|2HYD|A Chain A, Multidrug Abc Transporter Sav1866 Length = 578 Back     alignment and structure
>pdb|2PMK|A Chain A, Crystal Structures Of An Isolated Abc-Atpase In Complex With Tnp-Adp Length = 243 Back     alignment and structure
>pdb|2PMK|A Chain A, Crystal Structures Of An Isolated Abc-Atpase In Complex With Tnp-Adp Length = 243 Back     alignment and structure
>pdb|3B5J|A Chain A, Crystal Structures Of The S504a Mutant Of An Isolated Abc-atpase In Complex With Tnp-adp Length = 243 Back     alignment and structure
>pdb|3B5J|A Chain A, Crystal Structures Of The S504a Mutant Of An Isolated Abc-atpase In Complex With Tnp-adp Length = 243 Back     alignment and structure
>pdb|1MT0|A Chain A, Atp-Binding Domain Of Haemolysin B From Escherichia Coli Length = 241 Back     alignment and structure
>pdb|1MT0|A Chain A, Atp-Binding Domain Of Haemolysin B From Escherichia Coli Length = 241 Back     alignment and structure
>pdb|2FF7|A Chain A, The Abc-Atpase Of The Abc-Transporter Hlyb In The Adp Bound State Length = 247 Back     alignment and structure
>pdb|2FF7|A Chain A, The Abc-Atpase Of The Abc-Transporter Hlyb In The Adp Bound State Length = 247 Back     alignment and structure
>pdb|1XEF|A Chain A, Crystal Structure Of The AtpMG2+ BOUND COMPOSITE DIMER OF HLYB-Nbd Length = 241 Back     alignment and structure
>pdb|1XEF|A Chain A, Crystal Structure Of The AtpMG2+ BOUND COMPOSITE DIMER OF HLYB-Nbd Length = 241 Back     alignment and structure
>pdb|2FFA|A Chain A, Crystal Structure Of Abc-Atpase H662a Of The Abc-Transporter Hlyb In Complex With Adp Length = 247 Back     alignment and structure
>pdb|2FFA|A Chain A, Crystal Structure Of Abc-Atpase H662a Of The Abc-Transporter Hlyb In Complex With Adp Length = 247 Back     alignment and structure
>pdb|2FFB|A Chain A, The Crystal Structure Of The Hlyb-Nbd E631q Mutant In Complex With Adp Length = 247 Back     alignment and structure
>pdb|2FFB|A Chain A, The Crystal Structure Of The Hlyb-Nbd E631q Mutant In Complex With Adp Length = 247 Back     alignment and structure
>pdb|3NH6|A Chain A, Nucleotide Binding Domain Of Human Abcb6 (Apo Structure) Length = 306 Back     alignment and structure
>pdb|3NH6|A Chain A, Nucleotide Binding Domain Of Human Abcb6 (Apo Structure) Length = 306 Back     alignment and structure
>pdb|3QF4|A Chain A, Crystal Structure Of A Heterodimeric Abc Transporter In Its Inward- Facing Conformation Length = 587 Back     alignment and structure
>pdb|3QF4|A Chain A, Crystal Structure Of A Heterodimeric Abc Transporter In Its Inward- Facing Conformation Length = 587 Back     alignment and structure
>pdb|1MV5|A Chain A, Crystal Structure Of Lmra Atp-Binding Domain Length = 243 Back     alignment and structure
>pdb|1MV5|A Chain A, Crystal Structure Of Lmra Atp-Binding Domain Length = 243 Back     alignment and structure
>pdb|1JJ7|A Chain A, Crystal Structure Of The C-Terminal Atpase Domain Of Human Tap1 Length = 260 Back     alignment and structure
>pdb|1JJ7|A Chain A, Crystal Structure Of The C-Terminal Atpase Domain Of Human Tap1 Length = 260 Back     alignment and structure
>pdb|2IXF|A Chain A, Crystal Structure Of The Atpase Domain Of Tap1 With Atp (D645q, Q678h Mutant) Length = 271 Back     alignment and structure
>pdb|2IXF|A Chain A, Crystal Structure Of The Atpase Domain Of Tap1 With Atp (D645q, Q678h Mutant) Length = 271 Back     alignment and structure
>pdb|2IXE|A Chain A, Crystal Structure Of The Atpase Domain Of Tap1 With Atp (d645n Mutant) Length = 271 Back     alignment and structure
>pdb|2IXE|A Chain A, Crystal Structure Of The Atpase Domain Of Tap1 With Atp (d645n Mutant) Length = 271 Back     alignment and structure
>pdb|2IXG|A Chain A, Crystal Structure Of The Atpase Domain Of Tap1 With Atp (S621a, G622v, D645n Mutant) Length = 271 Back     alignment and structure
>pdb|2IXG|A Chain A, Crystal Structure Of The Atpase Domain Of Tap1 With Atp (S621a, G622v, D645n Mutant) Length = 271 Back     alignment and structure
>pdb|2GHI|A Chain A, Crystal Structure Of Plasmodium Yoelii Multidrug Resistance Protein 2 Length = 260 Back     alignment and structure
>pdb|2GHI|A Chain A, Crystal Structure Of Plasmodium Yoelii Multidrug Resistance Protein 2 Length = 260 Back     alignment and structure
>pdb|2CBZ|A Chain A, Structure Of The Human Multidrug Resistance Protein 1 Nucleotide Binding Domain 1 Length = 237 Back     alignment and structure
>pdb|2CBZ|A Chain A, Structure Of The Human Multidrug Resistance Protein 1 Nucleotide Binding Domain 1 Length = 237 Back     alignment and structure
>pdb|1Q3H|A Chain A, Mouse Cftr Nbd1 With Amp.Pnp Length = 286 Back     alignment and structure
>pdb|1Q3H|A Chain A, Mouse Cftr Nbd1 With Amp.Pnp Length = 286 Back     alignment and structure
>pdb|1R0Z|A Chain A, Phosphorylated Cystic Fibrosis Transmembrane Conductance Regulator (Cftr) Nucleotide-Binding Domain One (Nbd1) With Atp Length = 286 Back     alignment and structure
>pdb|1R0Z|A Chain A, Phosphorylated Cystic Fibrosis Transmembrane Conductance Regulator (Cftr) Nucleotide-Binding Domain One (Nbd1) With Atp Length = 286 Back     alignment and structure
>pdb|3DHW|C Chain C, Crystal Structure Of Methionine Importer Metni Length = 343 Back     alignment and structure
>pdb|3DHW|C Chain C, Crystal Structure Of Methionine Importer Metni Length = 343 Back     alignment and structure
>pdb|1XF9|A Chain A, Structure Of Nbd1 From Murine Cftr- F508s Mutant Length = 283 Back     alignment and structure
>pdb|1XF9|A Chain A, Structure Of Nbd1 From Murine Cftr- F508s Mutant Length = 283 Back     alignment and structure
>pdb|1XFA|A Chain A, Structure Of Nbd1 From Murine Cftr- F508r Mutant Length = 283 Back     alignment and structure
>pdb|1XFA|A Chain A, Structure Of Nbd1 From Murine Cftr- F508r Mutant Length = 283 Back     alignment and structure
>pdb|3TUI|C Chain C, Inward Facing Conformations Of The Metni Methionine Abc Transporter: Cy5 Native Crystal Form Length = 366 Back     alignment and structure
>pdb|3TUI|C Chain C, Inward Facing Conformations Of The Metni Methionine Abc Transporter: Cy5 Native Crystal Form Length = 366 Back     alignment and structure
>pdb|3TUJ|C Chain C, Inward Facing Conformations Of The Metni Methionine Abc Transporter: Dm Crystal Form Length = 366 Back     alignment and structure
>pdb|3TUJ|C Chain C, Inward Facing Conformations Of The Metni Methionine Abc Transporter: Dm Crystal Form Length = 366 Back     alignment and structure
>pdb|2BBO|A Chain A, Human Nbd1 With Phe508 Length = 291 Back     alignment and structure
>pdb|2BBO|A Chain A, Human Nbd1 With Phe508 Length = 291 Back     alignment and structure
>pdb|3SI7|A Chain A, The Crystal Structure Of The Nbd1 Domain Of The Mouse Cftr Protein, Deltaf508 Mutant Length = 285 Back     alignment and structure
>pdb|3SI7|A Chain A, The Crystal Structure Of The Nbd1 Domain Of The Mouse Cftr Protein, Deltaf508 Mutant Length = 285 Back     alignment and structure
>pdb|2IT1|A Chain A, Structure Of Ph0203 Protein From Pyrococcus Horikoshii Length = 362 Back     alignment and structure
>pdb|2IT1|A Chain A, Structure Of Ph0203 Protein From Pyrococcus Horikoshii Length = 362 Back     alignment and structure
>pdb|1XMI|A Chain A, Crystal Structure Of Human F508a Nbd1 Domain With Atp Length = 291 Back     alignment and structure
>pdb|1XMI|A Chain A, Crystal Structure Of Human F508a Nbd1 Domain With Atp Length = 291 Back     alignment and structure
>pdb|1Z47|A Chain A, Structure Of The Atpase Subunit Cysa Of The Putative Sulfate Atp-Binding Cassette (Abc) Transporter From Alicyclobacillus Acidocaldarius Length = 355 Back     alignment and structure
>pdb|1Z47|A Chain A, Structure Of The Atpase Subunit Cysa Of The Putative Sulfate Atp-Binding Cassette (Abc) Transporter From Alicyclobacillus Acidocaldarius Length = 355 Back     alignment and structure
>pdb|2BBT|A Chain A, Human Deltaf508 Nbd1 With Two Solublizing Mutations. Length = 290 Back     alignment and structure
>pdb|2BBT|A Chain A, Human Deltaf508 Nbd1 With Two Solublizing Mutations. Length = 290 Back     alignment and structure
>pdb|3GFO|A Chain A, Structure Of Cbio1 From Clostridium Perfringens: Part Of The Abc Transporter Complex Cbionq Length = 275 Back     alignment and structure
>pdb|3GFO|A Chain A, Structure Of Cbio1 From Clostridium Perfringens: Part Of The Abc Transporter Complex Cbionq Length = 275 Back     alignment and structure
>pdb|2PZG|A Chain A, Minimal Human Cftr First Nucleotide Binding Domain As A Monomer Length = 241 Back     alignment and structure
>pdb|2PZG|A Chain A, Minimal Human Cftr First Nucleotide Binding Domain As A Monomer Length = 241 Back     alignment and structure
>pdb|2PZE|A Chain A, Minimal Human Cftr First Nucleotide Binding Domain As A Head-To-Tail Dimer Length = 229 Back     alignment and structure
>pdb|2PZE|A Chain A, Minimal Human Cftr First Nucleotide Binding Domain As A Head-To-Tail Dimer Length = 229 Back     alignment and structure
>pdb|3D31|A Chain A, Modbc From Methanosarcina Acetivorans Length = 348 Back     alignment and structure
>pdb|3D31|A Chain A, Modbc From Methanosarcina Acetivorans Length = 348 Back     alignment and structure
>pdb|1XMJ|A Chain A, Crystal Structure Of Human Deltaf508 Human Nbd1 Domain With Atp Length = 290 Back     alignment and structure
>pdb|1XMJ|A Chain A, Crystal Structure Of Human Deltaf508 Human Nbd1 Domain With Atp Length = 290 Back     alignment and structure
>pdb|4HLU|A Chain A, Structure Of The Ecfa-a' Heterodimer Bound To Adp Length = 268 Back     alignment and structure
>pdb|4HLU|A Chain A, Structure Of The Ecfa-a' Heterodimer Bound To Adp Length = 268 Back     alignment and structure
>pdb|2BBS|A Chain A, Human Deltaf508 Nbd1 With Three Solubilizing Mutations Length = 290 Back     alignment and structure
>pdb|2BBS|A Chain A, Human Deltaf508 Nbd1 With Three Solubilizing Mutations Length = 290 Back     alignment and structure
>pdb|2YZ2|A Chain A, Crystal Structure Of The Abc Transporter In The Cobalt Transport System Length = 266 Back     alignment and structure
>pdb|2YZ2|A Chain A, Crystal Structure Of The Abc Transporter In The Cobalt Transport System Length = 266 Back     alignment and structure
>pdb|3GD7|A Chain A, Crystal Structure Of Human Nbd2 Complexed With N6- Phenylethyl-Atp (P-Atp) Length = 390 Back     alignment and structure
>pdb|3GD7|A Chain A, Crystal Structure Of Human Nbd2 Complexed With N6- Phenylethyl-Atp (P-Atp) Length = 390 Back     alignment and structure
>pdb|2YYZ|A Chain A, Crystal Structure Of Sugar Abc Transporter, Atp-Binding Protein Length = 359 Back     alignment and structure
>pdb|2YYZ|A Chain A, Crystal Structure Of Sugar Abc Transporter, Atp-Binding Protein Length = 359 Back     alignment and structure
>pdb|2ONK|A Chain A, Abc Transporter Modbc In Complex With Its Binding Protein Moda Length = 240 Back     alignment and structure
>pdb|3C41|J Chain J, Abc Protein Artp In Complex With Amp-PnpMG2+ Length = 242 Back     alignment and structure
>pdb|3C41|J Chain J, Abc Protein Artp In Complex With Amp-PnpMG2+ Length = 242 Back     alignment and structure
>pdb|2OLJ|A Chain A, Abc Protein Artp In Complex With AdpMG2+ Length = 263 Back     alignment and structure
>pdb|2OLJ|A Chain A, Abc Protein Artp In Complex With AdpMG2+ Length = 263 Back     alignment and structure
>pdb|3FVQ|A Chain A, Crystal Structure Of The Nucleotide Binding Domain Fbpc Complexed With Atp Length = 359 Back     alignment and structure
>pdb|2PZF|A Chain A, Minimal Human Cftr First Nucleotide Binding Domain As A Head-To-Tail Dimer With Delta F508 Length = 228 Back     alignment and structure
>pdb|2PZF|A Chain A, Minimal Human Cftr First Nucleotide Binding Domain As A Head-To-Tail Dimer With Delta F508 Length = 228 Back     alignment and structure
>pdb|1F3O|A Chain A, Crystal Structure Of Mj0796 Atp-Binding Cassette Length = 235 Back     alignment and structure
>pdb|1F3O|A Chain A, Crystal Structure Of Mj0796 Atp-Binding Cassette Length = 235 Back     alignment and structure
>pdb|1VPL|A Chain A, Crystal Structure Of Abc Transporter Atp-binding Protein (tm0544) From Thermotoga Maritima At 2.10 A Resolution Length = 256 Back     alignment and structure
>pdb|1VCI|A Chain A, Crystal Structure Of The Atp-binding Cassette Of Multisugar Transporter From Pyrococcus Horikoshii Ot3 Complexed With Atp Length = 373 Back     alignment and structure
>pdb|1V43|A Chain A, Crystal Structure Of Atpase Subunit Of Abc Sugar Transporter Length = 372 Back     alignment and structure
>pdb|1L2T|A Chain A, Dimeric Structure Of Mj0796, A Bacterial Abc Transporter Cassette Length = 235 Back     alignment and structure
>pdb|1L2T|A Chain A, Dimeric Structure Of Mj0796, A Bacterial Abc Transporter Cassette Length = 235 Back     alignment and structure
>pdb|4HLU|D Chain D, Structure Of The Ecfa-a' Heterodimer Bound To Adp Length = 268 Back     alignment and structure
>pdb|4HLU|D Chain D, Structure Of The Ecfa-a' Heterodimer Bound To Adp Length = 268 Back     alignment and structure
>pdb|1Q12|A Chain A, Crystal Structure Of The Atp-bound E. Coli Malk Length = 381 Back     alignment and structure
>pdb|1Q1B|A Chain A, Crystal Structure Of E. Coli Malk In The Nucleotide-Free Form Length = 381 Back     alignment and structure
>pdb|1B0U|A Chain A, Atp-Binding Subunit Of The Histidine Permease From Salmonella Typhimurium Length = 262 Back     alignment and structure
>pdb|4G1U|C Chain C, X-Ray Structure Of The Bacterial Heme Transporter Hmuuv From Yersinia Pestis Length = 266 Back     alignment and structure
>pdb|2R6G|A Chain A, The Crystal Structure Of The E. Coli Maltose Transporter Length = 381 Back     alignment and structure
>pdb|2D2E|A Chain A, Crystal Structure Of Atypical Cytoplasmic Abc-Atpase Sufc From Thermus Thermophilus Hb8 Length = 250 Back     alignment and structure
>pdb|3TIF|A Chain A, Dimeric Structure Of A Post-Hydrolysis State Of The Atp-Binding Cassette Mj0796 Bound To Adp And Pi Length = 235 Back     alignment and structure
>pdb|3TIF|A Chain A, Dimeric Structure Of A Post-Hydrolysis State Of The Atp-Binding Cassette Mj0796 Bound To Adp And Pi Length = 235 Back     alignment and structure
>pdb|1OXX|K Chain K, Crystal Structure Of Glcv, The Abc-Atpase Of The Glucose Abc Transporter From Sulfolobus Solfataricus Length = 353 Back     alignment and structure
>pdb|1OXS|C Chain C, Crystal Structure Of Glcv, The Abc-Atpase Of The Glucose Abc Transporter From Sulfolobus Solfataricus Length = 353 Back     alignment and structure
>pdb|1G29|1 Chain 1, Malk Length = 372 Back     alignment and structure
>pdb|1JI0|A Chain A, Crystal Structure Analysis Of The Abc Transporter From Thermotoga Maritima Length = 240 Back     alignment and structure
>pdb|2PCJ|A Chain A, Crystal Structure Of Abc Transporter (Aq_297) From Aquifex Aeolicus Vf5 Length = 224 Back     alignment and structure
>pdb|2PCJ|A Chain A, Crystal Structure Of Abc Transporter (Aq_297) From Aquifex Aeolicus Vf5 Length = 224 Back     alignment and structure
>pdb|1G6H|A Chain A, Crystal Structure Of The Adp Conformation Of Mj1267, An Atp- Binding Cassette Of An Abc Transporter Length = 257 Back     alignment and structure
>pdb|1G9X|A Chain A, Characterization Of The Twinning Structure Of Mj1267, An Atp-Binding Cassette Of An Abc Transporter Length = 257 Back     alignment and structure
>pdb|2D62|A Chain A, Crystal Structure Of Multiple Sugar Binding Transport Atp- Binding Protein Length = 375 Back     alignment and structure
>pdb|1GAJ|A Chain A, Crystal Structure Of A Nucleotide-Free Atp-Binding Cassette From An Abc Transporter Length = 257 Back     alignment and structure
>pdb|2D3W|A Chain A, Crystal Structure Of Escherichia Coli Sufc, An Atpase Compenent Of The Suf Iron-Sulfur Cluster Assembly Machinery Length = 248 Back     alignment and structure
>pdb|2ZU0|C Chain C, Crystal Structure Of Sufc-Sufd Complex Involved In The Iron- Sulfur Cluster Biosynthesis Length = 267 Back     alignment and structure
>pdb|4FWI|B Chain B, Crystal Structure Of The Nucleotide-binding Domain Of A Dipeptide Abc Transporter Length = 334 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1303
3g5u_A1284 MCG1178, multidrug resistance protein 1A; P-glycop 0.0
3g5u_A1284 MCG1178, multidrug resistance protein 1A; P-glycop 0.0
3g5u_A 1284 MCG1178, multidrug resistance protein 1A; P-glycop 0.0
3g5u_A1284 MCG1178, multidrug resistance protein 1A; P-glycop 1e-179
2yl4_A595 ATP-binding cassette SUB-family B member 10, mitoc 0.0
2yl4_A595 ATP-binding cassette SUB-family B member 10, mitoc 0.0
3b60_A582 Lipid A export ATP-binding/permease protein MSBA; 1e-156
3b60_A582 Lipid A export ATP-binding/permease protein MSBA; 1e-134
3b5x_A582 Lipid A export ATP-binding/permease protein MSBA; 1e-154
3b5x_A582 Lipid A export ATP-binding/permease protein MSBA; 1e-131
4a82_A578 Cystic fibrosis transmembrane conductance regulat; 1e-146
4a82_A578 Cystic fibrosis transmembrane conductance regulat; 1e-124
2ixe_A271 Antigen peptide transporter 1; ABC ATPase, hydrola 1e-138
2ixe_A271 Antigen peptide transporter 1; ABC ATPase, hydrola 1e-119
1mv5_A243 LMRA, multidrug resistance ABC transporter ATP-bin 1e-123
1mv5_A243 LMRA, multidrug resistance ABC transporter ATP-bin 1e-110
2ff7_A247 Alpha-hemolysin translocation ATP-binding protein 1e-123
2ff7_A247 Alpha-hemolysin translocation ATP-binding protein 1e-112
2ghi_A260 Transport protein; multidrug resistance protein, M 1e-118
2ghi_A260 Transport protein; multidrug resistance protein, M 1e-106
3qf4_B598 Uncharacterized ABC transporter ATP-binding prote 1e-117
3qf4_B598 Uncharacterized ABC transporter ATP-binding prote 2e-99
3nh6_A306 ATP-binding cassette SUB-family B member 6, mitoc; 1e-109
3nh6_A306 ATP-binding cassette SUB-family B member 6, mitoc; 7e-98
3qf4_A587 ABC transporter, ATP-binding protein; multidrug tr 2e-98
3qf4_A587 ABC transporter, ATP-binding protein; multidrug tr 1e-79
3gd7_A 390 Fusion complex of cystic fibrosis transmembrane co 1e-50
3gd7_A390 Fusion complex of cystic fibrosis transmembrane co 8e-45
2pze_A229 Cystic fibrosis transmembrane conductance regulat; 2e-44
2pze_A229 Cystic fibrosis transmembrane conductance regulat; 5e-31
2cbz_A237 Multidrug resistance-associated protein 1; ABC pro 9e-44
2cbz_A237 Multidrug resistance-associated protein 1; ABC pro 8e-29
2bbs_A290 Cystic fibrosis transmembrane conductance regulato 3e-43
2bbs_A290 Cystic fibrosis transmembrane conductance regulato 2e-26
3gfo_A275 Cobalt import ATP-binding protein CBIO 1; structur 1e-36
3gfo_A275 Cobalt import ATP-binding protein CBIO 1; structur 5e-28
2yz2_A266 Putative ABC transporter ATP-binding protein TM_0; 2e-35
2yz2_A266 Putative ABC transporter ATP-binding protein TM_0; 1e-27
2pjz_A263 Hypothetical protein ST1066; ATP binding protein, 3e-31
2pjz_A263 Hypothetical protein ST1066; ATP binding protein, 3e-26
2ihy_A279 ABC transporter, ATP-binding protein; ATPase, ABC 2e-30
2ihy_A279 ABC transporter, ATP-binding protein; ATPase, ABC 2e-27
3j16_B608 RLI1P; ribosome recycling, translation, eukarya, r 6e-27
3j16_B 608 RLI1P; ribosome recycling, translation, eukarya, r 7e-24
3j16_B608 RLI1P; ribosome recycling, translation, eukarya, r 2e-15
3j16_B608 RLI1P; ribosome recycling, translation, eukarya, r 1e-10
2pcj_A224 ABC transporter, lipoprotein-releasing system ATP- 4e-26
2pcj_A224 ABC transporter, lipoprotein-releasing system ATP- 3e-13
3tui_C366 Methionine import ATP-binding protein METN; ABC-tr 5e-26
3tui_C366 Methionine import ATP-binding protein METN; ABC-tr 1e-21
3tif_A235 Uncharacterized ABC transporter ATP-binding prote; 6e-26
3tif_A235 Uncharacterized ABC transporter ATP-binding prote; 3e-15
3ozx_A538 RNAse L inhibitor; ATP binding cassette protein, h 4e-25
3ozx_A 538 RNAse L inhibitor; ATP binding cassette protein, h 7e-18
3ozx_A538 RNAse L inhibitor; ATP binding cassette protein, h 3e-14
3ozx_A538 RNAse L inhibitor; ATP binding cassette protein, h 3e-13
2qi9_C249 Vitamin B12 import ATP-binding protein BTUD; inner 8e-24
2qi9_C249 Vitamin B12 import ATP-binding protein BTUD; inner 1e-19
2olj_A263 Amino acid ABC transporter; ABC domain, ATPase, hy 1e-23
2olj_A263 Amino acid ABC transporter; ABC domain, ATPase, hy 1e-15
3bk7_A607 ABC transporter ATP-binding protein; ABC ATPase, i 5e-23
3bk7_A 607 ABC transporter ATP-binding protein; ABC ATPase, i 5e-19
3bk7_A607 ABC transporter ATP-binding protein; ABC ATPase, i 9e-13
3bk7_A607 ABC transporter ATP-binding protein; ABC ATPase, i 3e-11
1yqt_A538 RNAse L inhibitor; ATP-binding cassette, ribosome 6e-22
1yqt_A 538 RNAse L inhibitor; ATP-binding cassette, ribosome 2e-19
1yqt_A538 RNAse L inhibitor; ATP-binding cassette, ribosome 1e-13
1yqt_A538 RNAse L inhibitor; ATP-binding cassette, ribosome 3e-12
1b0u_A262 Histidine permease; ABC transporter, transport pro 7e-22
1b0u_A262 Histidine permease; ABC transporter, transport pro 3e-13
1vpl_A256 ABC transporter, ATP-binding protein; TM0544, stru 8e-22
1vpl_A256 ABC transporter, ATP-binding protein; TM0544, stru 7e-20
1sgw_A214 Putative ABC transporter; structural genomics, P p 1e-21
1sgw_A214 Putative ABC transporter; structural genomics, P p 1e-21
2nq2_C253 Hypothetical ABC transporter ATP-binding protein H 1e-20
2nq2_C253 Hypothetical ABC transporter ATP-binding protein H 2e-15
2onk_A240 Molybdate/tungstate ABC transporter, ATP-binding p 2e-18
2onk_A240 Molybdate/tungstate ABC transporter, ATP-binding p 1e-17
1g6h_A257 High-affinity branched-chain amino acid transport 5e-18
1g6h_A257 High-affinity branched-chain amino acid transport 1e-17
1oxx_K353 GLCV, glucose, ABC transporter, ATP binding protei 1e-17
1oxx_K353 GLCV, glucose, ABC transporter, ATP binding protei 5e-10
1z47_A355 CYSA, putative ABC-transporter ATP-binding protein 2e-17
1z47_A355 CYSA, putative ABC-transporter ATP-binding protein 3e-16
3fvq_A 359 Fe(3+) IONS import ATP-binding protein FBPC; nucle 1e-16
3fvq_A359 Fe(3+) IONS import ATP-binding protein FBPC; nucle 3e-14
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-15
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-10
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 8e-07
1vt4_I1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-04
3d31_A 348 Sulfate/molybdate ABC transporter, ATP-binding pro 1e-14
3d31_A348 Sulfate/molybdate ABC transporter, ATP-binding pro 3e-13
1ji0_A240 ABC transporter; ATP binding protein, structural g 8e-14
1ji0_A240 ABC transporter; ATP binding protein, structural g 2e-13
2it1_A 362 362AA long hypothetical maltose/maltodextrin trans 8e-13
2it1_A362 362AA long hypothetical maltose/maltodextrin trans 1e-05
2yyz_A 359 Sugar ABC transporter, ATP-binding protein; sugar 7e-11
2yyz_A359 Sugar ABC transporter, ATP-binding protein; sugar 7e-04
1v43_A 372 Sugar-binding transport ATP-binding protein; ATPas 2e-10
1g29_1 372 MALK, maltose transport protein MALK; ATPase, acti 6e-10
2iw3_A 986 Elongation factor 3A; acetylation, ATP-binding, pr 8e-09
2iw3_A986 Elongation factor 3A; acetylation, ATP-binding, pr 5e-08
2iw3_A986 Elongation factor 3A; acetylation, ATP-binding, pr 1e-05
2iw3_A986 Elongation factor 3A; acetylation, ATP-binding, pr 4e-05
2iw3_A986 Elongation factor 3A; acetylation, ATP-binding, pr 1e-04
2iw3_A986 Elongation factor 3A; acetylation, ATP-binding, pr 8e-04
3qkt_A339 DNA double-strand break repair RAD50 ATPase; RECA- 9e-08
3qkt_A339 DNA double-strand break repair RAD50 ATPase; RECA- 6e-06
3rlf_A 381 Maltose/maltodextrin import ATP-binding protein M; 8e-07
2zu0_C267 Probable ATP-dependent transporter SUFC; iron-sulf 6e-06
2d2e_A250 SUFC protein; ABC-ATPase, SUF protein, 310-helix, 8e-06
2d2e_A250 SUFC protein; ABC-ATPase, SUF protein, 310-helix, 9e-05
1f2t_B148 RAD50 ABC-ATPase; DNA double-strand break repair, 1e-05
>3g5u_A MCG1178, multidrug resistance protein 1A; P-glycoprotein, PGP, cyclic peptide, membrane protein; 3.80A {Mus musculus} PDB: 3g61_A* 3g60_A* Length = 1284 Back     alignment and structure
 Score =  766 bits (1980), Expect = 0.0
 Identities = 224/652 (34%), Positives = 347/652 (53%), Gaps = 5/652 (0%)

Query: 645  RLPELPKIDVHSSNRQTSNGSDPESPISPL--LTSDPKNERSHSQTFSRPHSHSDDFPTK 702
            +L               +  S  E     +    S     R  S   S    H  D    
Sbjct: 620  KLVMTQTAGNEIELGNEACKSKDEIDNLDMSSKDSGSSLIRRRSTRKSICGPHDQDRKLS 679

Query: 703  VREEESKHQKAPSFWRLAELSFAEWLYAVLGSIGAAIFGSFNPLLAYVIGLIVTAYYKPE 762
             +E   +     SFWR+ +L+  EW Y V+G   A I G   P  + +   +V  +    
Sbjct: 680  TKEALDEDVPPASFWRILKLNSTEWPYFVVGIFCAIINGGLQPAFSVIFSKVVGVFTNGG 739

Query: 763  ERHHLREEVNKWCLIIACMGVVTVVANFLQHFYFGIMGEKMTERVRRMMFSAMLRNEVGW 822
                 R+  N + L+   +G+++ +  FLQ F FG  GE +T+R+R M+F +MLR +V W
Sbjct: 740  PPETQRQNSNLFSLLFLILGIISFITFFLQGFTFGKAGEILTKRLRYMVFKSMLRQDVSW 799

Query: 823  FDEEENSADTLSMRLANDATFVRAAFSNRLSIFIQDSAAVIVAVIIGMLLEWRLALVALA 882
            FD+ +N+   L+ RLANDA  V+ A  +RL++  Q+ A +   +II ++  W+L L+ LA
Sbjct: 800  FDDPKNTTGALTTRLANDAAQVKGATGSRLAVIFQNIANLGTGIIISLIYGWQLTLLLLA 859

Query: 883  TLPILSLSAIAQKLWLAGFSRGIQKMHRKASLVLEDAVRNIYTVVAFCAGNKVMELYRLQ 942
             +PI++++ + +   L+G +   +K    +  +  +A+ N  TVV+     K   +Y   
Sbjct: 860  IVPIIAIAGVVEMKMLSGQALKDKKELEGSGKIATEAIENFRTVVSLTREQKFETMYAQS 919

Query: 943  LKKIFTKSFLHGMAIGFAFGFSQFLLFACNALLLWYTGKSVRDGYMDLPTALKEYMVFSF 1002
            L+  +  +       G  F F+Q +++   A    +    V    M     L  +    F
Sbjct: 920  LQIPYRNAMKKAHVFGITFSFTQAMMYFSYAAAFRFGAYLVTQQLMTFENVLLVFSAIVF 979

Query: 1003 ATFALVEPFGLAPYILKRRKSLISVFEIIDRVPKIDPDDSSAVKPPNVYGSIELKNVDFC 1062
               A+ +    AP   K   S   +  II++ P+ID   +  +KP  + G+++   V F 
Sbjct: 980  GAMAVGQVSSFAPDYAKATVSASHIIRIIEKTPEIDSYSTQGLKPNMLEGNVQFSGVVFN 1039

Query: 1063 YPSRPEVLVLSNFSLKVNGGQTVAVVGVSGSGKSTIISLIERFYDPVAGQVLLDGRDLKL 1122
            YP+RP + VL   SL+V  GQT+A+VG SG GKST++ L+ERFYDP+AG V LDG+++K 
Sbjct: 1040 YPTRPSIPVLQGLSLEVKKGQTLALVGSSGCGKSTVVQLLERFYDPMAGSVFLDGKEIKQ 1099

Query: 1123 YNLRWLRNHLGLVQQEPIIFSTTIRENIIYAR--HNASEAEVKEAARIANAHHFISSLPH 1180
             N++WLR  LG+V QEPI+F  +I ENI Y       S  E+  AA+ AN H FI SLP 
Sbjct: 1100 LNVQWLRAQLGIVSQEPILFDCSIAENIAYGDNSRVVSYEEIVRAAKEANIHQFIDSLPD 1159

Query: 1181 GYDTHVGMRGVDLTPGQKQRIAIARVVLKNAPILLLDEASSSIESESSRVVQEALDTLIM 1240
             Y+T VG +G  L+ GQKQRIAIAR +++   ILLLDEA+S++++ES +VVQEALD    
Sbjct: 1160 KYNTRVGDKGTQLSGGQKQRIAIARALVRQPHILLLDEATSALDTESEKVVQEALDKA-R 1218

Query: 1241 GNKTTILIAHRAAMMRHVDNIVVLNGGRIVEEGTHDSLLAKNGLYVRLMQPH 1292
              +T I+IAHR + +++ D IVV+  G++ E GTH  LLA+ G+Y  ++   
Sbjct: 1219 EGRTCIVIAHRLSTIQNADLIVVIQNGKVKEHGTHQQLLAQKGIYFSMVSVQ 1270


>3g5u_A MCG1178, multidrug resistance protein 1A; P-glycoprotein, PGP, cyclic peptide, membrane protein; 3.80A {Mus musculus} PDB: 3g61_A* 3g60_A* Length = 1284 Back     alignment and structure
>3g5u_A MCG1178, multidrug resistance protein 1A; P-glycoprotein, PGP, cyclic peptide, membrane protein; 3.80A {Mus musculus} PDB: 3g61_A* 3g60_A* Length = 1284 Back     alignment and structure
>3g5u_A MCG1178, multidrug resistance protein 1A; P-glycoprotein, PGP, cyclic peptide, membrane protein; 3.80A {Mus musculus} PDB: 3g61_A* 3g60_A* Length = 1284 Back     alignment and structure
>3b60_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; HET: ANP; 3.70A {Salmonella typhimurium} SCOP: c.37.1.12 f.37.1.1 PDB: 3b5y_A* 3b5z_A* 3b5w_A Length = 582 Back     alignment and structure
>3b60_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; HET: ANP; 3.70A {Salmonella typhimurium} SCOP: c.37.1.12 f.37.1.1 PDB: 3b5y_A* 3b5z_A* 3b5w_A Length = 582 Back     alignment and structure
>3b5x_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; 5.50A {Vibrio cholerae} Length = 582 Back     alignment and structure
>3b5x_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; 5.50A {Vibrio cholerae} Length = 582 Back     alignment and structure
>4a82_A Cystic fibrosis transmembrane conductance regulat; CFTR, ION channel, transport protein, casse protein; 2.00A {Homo sapiens} PDB: 2onj_A* 2hyd_A Length = 578 Back     alignment and structure
>4a82_A Cystic fibrosis transmembrane conductance regulat; CFTR, ION channel, transport protein, casse protein; 2.00A {Homo sapiens} PDB: 2onj_A* 2hyd_A Length = 578 Back     alignment and structure
>2ixe_A Antigen peptide transporter 1; ABC ATPase, hydrolase; HET: ATP; 2.0A {Rattus norvegicus} PDB: 2ixg_A* 2ixf_A* 1jj7_A* Length = 271 Back     alignment and structure
>2ixe_A Antigen peptide transporter 1; ABC ATPase, hydrolase; HET: ATP; 2.0A {Rattus norvegicus} PDB: 2ixg_A* 2ixf_A* 1jj7_A* Length = 271 Back     alignment and structure
>1mv5_A LMRA, multidrug resistance ABC transporter ATP-binding and permease protein; asymmetric dimer, tetramer, P-glycoprotein; HET: ATP ADP; 3.10A {Lactococcus lactis} SCOP: c.37.1.12 Length = 243 Back     alignment and structure
>1mv5_A LMRA, multidrug resistance ABC transporter ATP-binding and permease protein; asymmetric dimer, tetramer, P-glycoprotein; HET: ATP ADP; 3.10A {Lactococcus lactis} SCOP: c.37.1.12 Length = 243 Back     alignment and structure
>2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A* Length = 247 Back     alignment and structure
>2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A* Length = 247 Back     alignment and structure
>2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str} Length = 260 Back     alignment and structure
>2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str} Length = 260 Back     alignment and structure
>3qf4_B Uncharacterized ABC transporter ATP-binding prote TM_0288; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} Length = 598 Back     alignment and structure
>3qf4_B Uncharacterized ABC transporter ATP-binding prote TM_0288; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} Length = 598 Back     alignment and structure
>3nh6_A ATP-binding cassette SUB-family B member 6, mitoc; ABC-transporter, ABCB6, nucleotide binding domain, heme BIOS transport protein; 2.00A {Homo sapiens} PDB: 3nh9_A* 3nha_A* 3nhb_A* Length = 306 Back     alignment and structure
>3nh6_A ATP-binding cassette SUB-family B member 6, mitoc; ABC-transporter, ABCB6, nucleotide binding domain, heme BIOS transport protein; 2.00A {Homo sapiens} PDB: 3nh9_A* 3nha_A* 3nhb_A* Length = 306 Back     alignment and structure
>3qf4_A ABC transporter, ATP-binding protein; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} Length = 587 Back     alignment and structure
>3qf4_A ABC transporter, ATP-binding protein; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} Length = 587 Back     alignment and structure
>3gd7_A Fusion complex of cystic fibrosis transmembrane conductance regulator, residues 1193-1427...; CFTR, ABC transporter, nucleotide binding domain, NBD; HET: B44; 2.70A {Homo sapiens} Length = 390 Back     alignment and structure
>3gd7_A Fusion complex of cystic fibrosis transmembrane conductance regulator, residues 1193-1427...; CFTR, ABC transporter, nucleotide binding domain, NBD; HET: B44; 2.70A {Homo sapiens} Length = 390 Back     alignment and structure
>2pze_A Cystic fibrosis transmembrane conductance regulat; NBD, ABC transporter, CFTR, hydrolase; HET: ATP; 1.70A {Homo sapiens} PDB: 2pzg_A* 2pzf_A* 1ckx_A 1cky_A 1ckw_A 1ckz_A Length = 229 Back     alignment and structure
>2pze_A Cystic fibrosis transmembrane conductance regulat; NBD, ABC transporter, CFTR, hydrolase; HET: ATP; 1.70A {Homo sapiens} PDB: 2pzg_A* 2pzf_A* 1ckx_A 1cky_A 1ckw_A 1ckz_A Length = 229 Back     alignment and structure
>2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens} Length = 237 Back     alignment and structure
>2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens} Length = 237 Back     alignment and structure
>2bbs_A Cystic fibrosis transmembrane conductance regulator; ATP binding cassette, transport protein; HET: ATP; 2.05A {Homo sapiens} PDB: 2bbt_A* 1xmi_A* 1xmj_A* 2bbo_A* 3si7_A* 1r0w_A 1q3h_A 1r0x_A* 1r0y_A* 1r0z_A* 1r10_A* 1xf9_A* 1xfa_A* Length = 290 Back     alignment and structure
>2bbs_A Cystic fibrosis transmembrane conductance regulator; ATP binding cassette, transport protein; HET: ATP; 2.05A {Homo sapiens} PDB: 2bbt_A* 1xmi_A* 1xmj_A* 2bbo_A* 3si7_A* 1r0w_A 1q3h_A 1r0x_A* 1r0y_A* 1r0z_A* 1r10_A* 1xf9_A* 1xfa_A* Length = 290 Back     alignment and structure
>3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124} Length = 275 Back     alignment and structure
>3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124} Length = 275 Back     alignment and structure
>2yz2_A Putative ABC transporter ATP-binding protein TM_0; cobalt transport, TM02 hydrolase, inner membrane, membrane, nucleotide-binding; 2.30A {Thermotoga maritima} Length = 266 Back     alignment and structure
>2yz2_A Putative ABC transporter ATP-binding protein TM_0; cobalt transport, TM02 hydrolase, inner membrane, membrane, nucleotide-binding; 2.30A {Thermotoga maritima} Length = 266 Back     alignment and structure
>2pjz_A Hypothetical protein ST1066; ATP binding protein, structural genomics, NPPSFA; 1.90A {Sulfolobus tokodaii} Length = 263 Back     alignment and structure
>2pjz_A Hypothetical protein ST1066; ATP binding protein, structural genomics, NPPSFA; 1.90A {Sulfolobus tokodaii} Length = 263 Back     alignment and structure
>2ihy_A ABC transporter, ATP-binding protein; ATPase, ABC cassette, hydrolase; HET: MSE; 1.90A {Staphylococcus aureus} Length = 279 Back     alignment and structure
>2ihy_A ABC transporter, ATP-binding protein; ATPase, ABC cassette, hydrolase; HET: MSE; 1.90A {Staphylococcus aureus} Length = 279 Back     alignment and structure
>3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; NMR {Saccharomyces cerevisiae} Length = 608 Back     alignment and structure
>3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; NMR {Saccharomyces cerevisiae} Length = 608 Back     alignment and structure
>3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; NMR {Saccharomyces cerevisiae} Length = 608 Back     alignment and structure
>3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; NMR {Saccharomyces cerevisiae} Length = 608 Back     alignment and structure
>2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein; structural genomics; 1.70A {Aquifex aeolicus} PDB: 2pcl_A Length = 224 Back     alignment and structure
>2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein; structural genomics; 1.70A {Aquifex aeolicus} PDB: 2pcl_A Length = 224 Back     alignment and structure
>3tui_C Methionine import ATP-binding protein METN; ABC-transporter, type I ABC type importer, methionine uptake transporter, membrane protein; HET: ADP; 2.90A {Escherichia coli} PDB: 3tuj_C 3tuz_C* 3dhw_C Length = 366 Back     alignment and structure
>3tui_C Methionine import ATP-binding protein METN; ABC-transporter, type I ABC type importer, methionine uptake transporter, membrane protein; HET: ADP; 2.90A {Escherichia coli} PDB: 3tuj_C 3tuz_C* 3dhw_C Length = 366 Back     alignment and structure
>3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A* Length = 235 Back     alignment and structure
>3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A* Length = 235 Back     alignment and structure
>3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} Length = 538 Back     alignment and structure
>3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} Length = 538 Back     alignment and structure
>3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} Length = 538 Back     alignment and structure
>3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} Length = 538 Back     alignment and structure
>2qi9_C Vitamin B12 import ATP-binding protein BTUD; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_C* 4dbl_C Length = 249 Back     alignment and structure
>2qi9_C Vitamin B12 import ATP-binding protein BTUD; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_C* 4dbl_C Length = 249 Back     alignment and structure
>2olj_A Amino acid ABC transporter; ABC domain, ATPase, hydrolase; HET: ADP; 2.05A {Geobacillus stearothermophilus} PDB: 2olk_A* 2ouk_A 2q0h_A* 3c4j_A* 3c41_J* Length = 263 Back     alignment and structure
>2olj_A Amino acid ABC transporter; ABC domain, ATPase, hydrolase; HET: ADP; 2.05A {Geobacillus stearothermophilus} PDB: 2olk_A* 2ouk_A 2q0h_A* 3c4j_A* 3c41_J* Length = 263 Back     alignment and structure
>3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* Length = 607 Back     alignment and structure
>3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* Length = 607 Back     alignment and structure
>3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* Length = 607 Back     alignment and structure
>3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* Length = 607 Back     alignment and structure
>1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} Length = 538 Back     alignment and structure
>1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} Length = 538 Back     alignment and structure
>1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} Length = 538 Back     alignment and structure
>1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} Length = 538 Back     alignment and structure
>1b0u_A Histidine permease; ABC transporter, transport protein; HET: ATP; 1.50A {Salmonella typhimurium} SCOP: c.37.1.12 Length = 262 Back     alignment and structure
>1b0u_A Histidine permease; ABC transporter, transport protein; HET: ATP; 1.50A {Salmonella typhimurium} SCOP: c.37.1.12 Length = 262 Back     alignment and structure
>1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12 Length = 256 Back     alignment and structure
>1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12 Length = 256 Back     alignment and structure
>1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12 Length = 214 Back     alignment and structure
>1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12 Length = 214 Back     alignment and structure
>2nq2_C Hypothetical ABC transporter ATP-binding protein HI1470; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae} Length = 253 Back     alignment and structure
>2nq2_C Hypothetical ABC transporter ATP-binding protein HI1470; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae} Length = 253 Back     alignment and structure
>2onk_A Molybdate/tungstate ABC transporter, ATP-binding protein; membrane protein; 3.10A {Archaeoglobus fulgidus} SCOP: c.37.1.12 Length = 240 Back     alignment and structure
>2onk_A Molybdate/tungstate ABC transporter, ATP-binding protein; membrane protein; 3.10A {Archaeoglobus fulgidus} SCOP: c.37.1.12 Length = 240 Back     alignment and structure
>1g6h_A High-affinity branched-chain amino acid transport ATP-binding protein; beta-core domain; HET: ADP; 1.60A {Methanocaldococcus jannaschii} SCOP: c.37.1.12 PDB: 1gaj_A 1g9x_A* Length = 257 Back     alignment and structure
>1g6h_A High-affinity branched-chain amino acid transport ATP-binding protein; beta-core domain; HET: ADP; 1.60A {Methanocaldococcus jannaschii} SCOP: c.37.1.12 PDB: 1gaj_A 1g9x_A* Length = 257 Back     alignment and structure
>1oxx_K GLCV, glucose, ABC transporter, ATP binding protein; ABC-ATPase, ATP-binding cassette, ATPase, transport protein; 1.45A {Sulfolobus solfataricus} SCOP: b.40.6.3 c.37.1.12 PDB: 1oxs_C 1oxt_A 1oxu_A* 1oxv_A* Length = 353 Back     alignment and structure
>1oxx_K GLCV, glucose, ABC transporter, ATP binding protein; ABC-ATPase, ATP-binding cassette, ATPase, transport protein; 1.45A {Sulfolobus solfataricus} SCOP: b.40.6.3 c.37.1.12 PDB: 1oxs_C 1oxt_A 1oxu_A* 1oxv_A* Length = 353 Back     alignment and structure
>1z47_A CYSA, putative ABC-transporter ATP-binding protein; alpha/beta motif, beta sandwich, ligand binding protein; 1.90A {Alicyclobacillus acidocaldarius} Length = 355 Back     alignment and structure
>1z47_A CYSA, putative ABC-transporter ATP-binding protein; alpha/beta motif, beta sandwich, ligand binding protein; 1.90A {Alicyclobacillus acidocaldarius} Length = 355 Back     alignment and structure
>3fvq_A Fe(3+) IONS import ATP-binding protein FBPC; nucleotide binding domain, ABC motor domain, ferric iron transport, cell inner membrane; HET: ATP; 1.90A {Neisseria gonorrhoeae} Length = 359 Back     alignment and structure
>3fvq_A Fe(3+) IONS import ATP-binding protein FBPC; nucleotide binding domain, ABC motor domain, ferric iron transport, cell inner membrane; HET: ATP; 1.90A {Neisseria gonorrhoeae} Length = 359 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3d31_A Sulfate/molybdate ABC transporter, ATP-binding protein; ATP-binding, nucleotide-binding, membrane, transmembrane, transport protein; 3.00A {Methanosarcina acetivorans} SCOP: b.40.6.3 c.37.1.12 Length = 348 Back     alignment and structure
>3d31_A Sulfate/molybdate ABC transporter, ATP-binding protein; ATP-binding, nucleotide-binding, membrane, transmembrane, transport protein; 3.00A {Methanosarcina acetivorans} SCOP: b.40.6.3 c.37.1.12 Length = 348 Back     alignment and structure
>1ji0_A ABC transporter; ATP binding protein, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: ATP; 2.00A {Thermotoga maritima} SCOP: c.37.1.12 Length = 240 Back     alignment and structure
>1ji0_A ABC transporter; ATP binding protein, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: ATP; 2.00A {Thermotoga maritima} SCOP: c.37.1.12 Length = 240 Back     alignment and structure
>2it1_A 362AA long hypothetical maltose/maltodextrin transport ATP-binding protein; structural genomics, NPPSFA; 1.94A {Pyrococcus horikoshii} Length = 362 Back     alignment and structure
>2it1_A 362AA long hypothetical maltose/maltodextrin transport ATP-binding protein; structural genomics, NPPSFA; 1.94A {Pyrococcus horikoshii} Length = 362 Back     alignment and structure
>2yyz_A Sugar ABC transporter, ATP-binding protein; sugar transport, alpha and beta proteins (A/B) TM0421, structural genomics, NPPSFA; 2.11A {Thermotoga maritima} Length = 359 Back     alignment and structure
>2yyz_A Sugar ABC transporter, ATP-binding protein; sugar transport, alpha and beta proteins (A/B) TM0421, structural genomics, NPPSFA; 2.11A {Thermotoga maritima} Length = 359 Back     alignment and structure
>1v43_A Sugar-binding transport ATP-binding protein; ATPase, active transport, sugar uptake and regulation, transport protein; 2.20A {Pyrococcus horikoshii} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 1vci_A* Length = 372 Back     alignment and structure
>1g29_1 MALK, maltose transport protein MALK; ATPase, active transport, maltose uptake and regulation, sugar binding protein; 1.90A {Thermococcus litoralis} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 2d62_A Length = 372 Back     alignment and structure
>2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A Length = 986 Back     alignment and structure
>2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A Length = 986 Back     alignment and structure
>2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A Length = 986 Back     alignment and structure
>2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A Length = 986 Back     alignment and structure
>2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A Length = 986 Back     alignment and structure
>2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A Length = 986 Back     alignment and structure
>3qkt_A DNA double-strand break repair RAD50 ATPase; RECA-like fold, coiled-coils, ATP binding, DNA bindi MRE11, replication; HET: DNA ANP; 1.90A {Pyrococcus furiosus} PDB: 3qku_A* 1ii8_A 3qks_B* 3qkr_B* 1ii8_B Length = 339 Back     alignment and structure
>3qkt_A DNA double-strand break repair RAD50 ATPase; RECA-like fold, coiled-coils, ATP binding, DNA bindi MRE11, replication; HET: DNA ANP; 1.90A {Pyrococcus furiosus} PDB: 3qku_A* 1ii8_A 3qks_B* 3qkr_B* 1ii8_B Length = 339 Back     alignment and structure
>3rlf_A Maltose/maltodextrin import ATP-binding protein M; integral membrane protein, ATPase, ABC transporter, membrane transmembrane; HET: UMQ MAL PGV ANP; 2.20A {Escherichia coli} PDB: 1q1e_A 1q12_A* 2awo_A* 3fh6_A 3puv_A* 3puw_A* 3pux_A* 3puy_A* 3puz_A* 3pv0_A* 2awn_A* 2r6g_A* 1q1b_A Length = 381 Back     alignment and structure
>2zu0_C Probable ATP-dependent transporter SUFC; iron-sulfur cluster, ABC-ATPase, ATP-binding, cytoplasm, nucleotide-binding; HET: MES; 2.20A {Escherichia coli} PDB: 2d3w_A Length = 267 Back     alignment and structure
>2d2e_A SUFC protein; ABC-ATPase, SUF protein, 310-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics, binding; 1.70A {Thermus thermophilus} PDB: 2d2f_A* Length = 250 Back     alignment and structure
>2d2e_A SUFC protein; ABC-ATPase, SUF protein, 310-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics, binding; 1.70A {Thermus thermophilus} PDB: 2d2f_A* Length = 250 Back     alignment and structure
>1f2t_B RAD50 ABC-ATPase; DNA double-strand break repair, replication; 1.60A {Pyrococcus furiosus} SCOP: c.37.1.12 PDB: 1f2u_B* 1us8_B* Length = 148 Back     alignment and structure

Structure Templates Detected by HHsearch ?

No hit with probability above 80.00


Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 1303
d2hyda1255 c.37.1.12 (A:324-578) Putative multidrug export AT 9e-91
d2hyda1255 c.37.1.12 (A:324-578) Putative multidrug export AT 4e-81
d3b60a1253 c.37.1.12 (A:329-581) Multidrug resistance ABC tra 5e-85
d3b60a1253 c.37.1.12 (A:329-581) Multidrug resistance ABC tra 1e-76
d1jj7a_251 c.37.1.12 (A:) Peptide transporter Tap1, C-termina 6e-84
d1jj7a_251 c.37.1.12 (A:) Peptide transporter Tap1, C-termina 3e-75
d2pmka1241 c.37.1.12 (A:467-707) Haemolysin B ATP-binding pro 5e-76
d2pmka1241 c.37.1.12 (A:467-707) Haemolysin B ATP-binding pro 1e-67
d1mv5a_242 c.37.1.12 (A:) Multidrug resistance ABC transporte 2e-74
d1mv5a_242 c.37.1.12 (A:) Multidrug resistance ABC transporte 2e-68
d1r0wa_281 c.37.1.12 (A:) Cystic fibrosis transmembrane condu 1e-68
d1r0wa_281 c.37.1.12 (A:) Cystic fibrosis transmembrane condu 2e-62
d1l2ta_230 c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jann 1e-45
d1l2ta_230 c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jann 7e-40
d1l7vc_231 c.37.1.12 (C:) ABC transporter involved in vitamin 1e-44
d1l7vc_231 c.37.1.12 (C:) ABC transporter involved in vitamin 7e-34
d1b0ua_258 c.37.1.12 (A:) ATP-binding subunit of the histidin 6e-39
d1b0ua_258 c.37.1.12 (A:) ATP-binding subunit of the histidin 2e-31
d1v43a3239 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N 1e-38
d1v43a3239 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N 2e-32
d3dhwc1240 c.37.1.12 (C:1-240) Methionine import ATP-binding 5e-38
d3dhwc1240 c.37.1.12 (C:1-240) Methionine import ATP-binding 2e-32
d1vpla_238 c.37.1.12 (A:) Putative ABC transporter TM0544 {Th 2e-34
d1vpla_238 c.37.1.12 (A:) Putative ABC transporter TM0544 {Th 2e-30
d1g6ha_254 c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jann 3e-34
d1g6ha_254 c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jann 8e-27
d2awna2232 c.37.1.12 (A:4-235) Maltose transport protein MalK 1e-32
d2awna2232 c.37.1.12 (A:4-235) Maltose transport protein MalK 1e-25
d1ji0a_240 c.37.1.12 (A:) Branched chain aminoacid ABC transp 5e-32
d1ji0a_240 c.37.1.12 (A:) Branched chain aminoacid ABC transp 5e-25
d1g2912240 c.37.1.12 (1:1-240) Maltose transport protein MalK 8e-32
d1g2912240 c.37.1.12 (1:1-240) Maltose transport protein MalK 4e-24
d3d31a2229 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transpor 1e-31
d3d31a2229 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transpor 1e-22
d2onka1240 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP 2e-31
d2onka1240 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP 1e-21
d1sgwa_200 c.37.1.12 (A:) Putative ABC transporter PF0895 {Py 3e-31
d1sgwa_200 c.37.1.12 (A:) Putative ABC transporter PF0895 {Py 2e-27
d1oxxk2242 c.37.1.12 (K:1-242) Glucose transport protein GlcV 3e-30
d1oxxk2242 c.37.1.12 (K:1-242) Glucose transport protein GlcV 7e-23
d1ye8a1178 c.37.1.11 (A:1-178) Hypothetical kinase-like prote 9e-20
d1ye8a1178 c.37.1.11 (A:1-178) Hypothetical kinase-like prote 4e-17
g1ii8.1369 c.37.1.12 (A:,B:) Rad50 {Archaeon Pyrococcus furio 3e-09
g1ii8.1369 c.37.1.12 (A:,B:) Rad50 {Archaeon Pyrococcus furio 4e-08
g1f2t.1292 c.37.1.12 (A:,B:) Rad50 {Archaeon Pyrococcus furio 5e-09
g1f2t.1292 c.37.1.12 (A:,B:) Rad50 {Archaeon Pyrococcus furio 5e-08
g1f2t.1292 c.37.1.12 (A:,B:) Rad50 {Archaeon Pyrococcus furio 0.003
d3b60a2319 f.37.1.1 (A:10-328) Multidrug resistance ABC trans 1e-08
d2hyda2323 f.37.1.1 (A:1-323) Putative multidrug export ATP-b 4e-07
d2i3ba1189 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 7e-07
d2i3ba1189 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 7e-04
d1w1wa_427 c.37.1.12 (A:) Smc head domain {Baker's yeast (Sac 0.002
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Length = 255 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: ABC transporter ATPase domain-like
domain: Putative multidrug export ATP-binding/permease protein SAV1866
species: Staphylococcus aureus [TaxId: 1280]
 Score =  291 bits (747), Expect = 9e-91
 Identities = 123/251 (49%), Positives = 172/251 (68%), Gaps = 2/251 (0%)

Query: 1040 DDSSAVKPPNVYGSIELKNVDFCYPSRPEVLVLSNFSLKVNGGQTVAVVGVSGSGKSTII 1099
            +   A       G I++ +V F Y    E  +L + +L +  G+TVA VG+SG GKST+I
Sbjct: 3    NGVGAQPIEIKQGRIDIDHVSFQYNDN-EAPILKDINLSIEKGETVAFVGMSGGGKSTLI 61

Query: 1100 SLIERFYDPVAGQVLLDGRDLKLYNLRWLRNHLGLVQQEPIIFSTTIRENIIYARHNASE 1159
            +LI RFYD  +GQ+L+DG ++K +    LRN +GLVQQ+ I+FS T++ENI+  R  A++
Sbjct: 62   NLIPRFYDVTSGQILIDGHNIKDFLTGSLRNQIGLVQQDNILFSDTVKENILLGRPTATD 121

Query: 1160 AEVKEAARIANAHHFISSLPHGYDTHVGMRGVDLTPGQKQRIAIARVVLKNAPILLLDEA 1219
             EV EAA++ANAH FI +LP GYDT VG RGV L+ GQKQR++IAR+ L N PIL+LDEA
Sbjct: 122  EEVVEAAKMANAHDFIMNLPQGYDTEVGERGVKLSGGQKQRLSIARIFLNNPPILILDEA 181

Query: 1220 SSSIESESSRVVQEALDTLIMGNKTTILIAHRAAMMRHVDNIVVLNGGRIVEEGTHDSLL 1279
            +S+++ ES  ++QEALD L   ++TT+++AHR + + H D IVV+  G IVE GTH  L+
Sbjct: 182  TSALDLESESIIQEALDVL-SKDRTTLIVAHRLSTITHADKIVVIENGHIVETGTHRELI 240

Query: 1280 AKNGLYVRLMQ 1290
            AK G Y  L  
Sbjct: 241  AKQGAYEHLYS 251


>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Length = 255 Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Length = 253 Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Length = 253 Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Length = 251 Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Length = 251 Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Length = 241 Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Length = 241 Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Length = 242 Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Length = 242 Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 281 Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 281 Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 230 Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 230 Back     information, alignment and structure
>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} Length = 231 Back     information, alignment and structure
>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} Length = 231 Back     information, alignment and structure
>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Length = 258 Back     information, alignment and structure
>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Length = 258 Back     information, alignment and structure
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Length = 239 Back     information, alignment and structure
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Length = 239 Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Length = 240 Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Length = 240 Back     information, alignment and structure
>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Length = 238 Back     information, alignment and structure
>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Length = 238 Back     information, alignment and structure
>d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 254 Back     information, alignment and structure
>d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 254 Back     information, alignment and structure
>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 232 Back     information, alignment and structure
>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 232 Back     information, alignment and structure
>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Length = 240 Back     information, alignment and structure
>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Length = 240 Back     information, alignment and structure
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Length = 240 Back     information, alignment and structure
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Length = 240 Back     information, alignment and structure
>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Length = 229 Back     information, alignment and structure
>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Length = 229 Back     information, alignment and structure
>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Length = 240 Back     information, alignment and structure
>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Length = 240 Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Length = 200 Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Length = 200 Back     information, alignment and structure
>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Length = 242 Back     information, alignment and structure
>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Length = 242 Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Length = 178 Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Length = 178 Back     information, alignment and structure
>d3b60a2 f.37.1.1 (A:10-328) Multidrug resistance ABC transporter MsbA, N-terminal domain {Salmonella typhimurium [TaxId: 90371]} Length = 319 Back     information, alignment and structure
>d2hyda2 f.37.1.1 (A:1-323) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Length = 323 Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Length = 189 Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Length = 189 Back     information, alignment and structure
>d1w1wa_ c.37.1.12 (A:) Smc head domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 427 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query1303
d2hyda1255 Putative multidrug export ATP-binding/permease pro 100.0
d2pmka1241 Haemolysin B ATP-binding protein {Escherichia coli 100.0
d3b60a1253 Multidrug resistance ABC transporter MsbA, C-termi 100.0
d1jj7a_251 Peptide transporter Tap1, C-terminal ABC domain {H 100.0
d1mv5a_242 Multidrug resistance ABC transporter LmrA, C-termi 100.0
d2hyda1255 Putative multidrug export ATP-binding/permease pro 100.0
d3b60a1253 Multidrug resistance ABC transporter MsbA, C-termi 100.0
d2pmka1241 Haemolysin B ATP-binding protein {Escherichia coli 100.0
d1jj7a_251 Peptide transporter Tap1, C-terminal ABC domain {H 100.0
d1mv5a_242 Multidrug resistance ABC transporter LmrA, C-termi 100.0
d1r0wa_281 Cystic fibrosis transmembrane conductance regulato 100.0
d1r0wa_281 Cystic fibrosis transmembrane conductance regulato 100.0
d1v43a3239 Hypothetical protein PH0022, N-terminal domain {Py 100.0
d1oxxk2242 Glucose transport protein GlcV, N-terminal domain 100.0
d2awna2232 Maltose transport protein MalK, N-terminal domain 100.0
d3d31a2229 Sulfate/molybdate ABC transporter, ATP-binding pro 100.0
d3dhwc1240 Methionine import ATP-binding protein MetN {Escher 100.0
d1g2912240 Maltose transport protein MalK, N-terminal domain 100.0
d1l2ta_230 MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 100.0
d1b0ua_258 ATP-binding subunit of the histidine permease {Sal 100.0
d1ji0a_240 Branched chain aminoacid ABC transporter {Thermoto 100.0
d1g6ha_254 MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 100.0
d1vpla_238 Putative ABC transporter TM0544 {Thermotoga mariti 100.0
d3d31a2229 Sulfate/molybdate ABC transporter, ATP-binding pro 100.0
d1v43a3239 Hypothetical protein PH0022, N-terminal domain {Py 100.0
d2awna2232 Maltose transport protein MalK, N-terminal domain 100.0
d1oxxk2242 Glucose transport protein GlcV, N-terminal domain 100.0
d1g2912240 Maltose transport protein MalK, N-terminal domain 100.0
d2onka1240 Molybdate/tungstate import ATP-binding protein Wtp 100.0
d3dhwc1240 Methionine import ATP-binding protein MetN {Escher 100.0
d1l2ta_230 MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 100.0
d1b0ua_258 ATP-binding subunit of the histidine permease {Sal 100.0
d1g6ha_254 MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 100.0
d1ji0a_240 Branched chain aminoacid ABC transporter {Thermoto 100.0
d1vpla_238 Putative ABC transporter TM0544 {Thermotoga mariti 100.0
d2onka1240 Molybdate/tungstate import ATP-binding protein Wtp 100.0
d1l7vc_231 ABC transporter involved in vitamin B12 uptake, Bt 100.0
d1l7vc_231 ABC transporter involved in vitamin B12 uptake, Bt 100.0
d1sgwa_200 Putative ABC transporter PF0895 {Pyrococcus furios 100.0
d1sgwa_200 Putative ABC transporter PF0895 {Pyrococcus furios 100.0
d3b60a2319 Multidrug resistance ABC transporter MsbA, N-termi 99.95
d3b60a2319 Multidrug resistance ABC transporter MsbA, N-termi 99.95
d2hyda2323 Putative multidrug export ATP-binding/permease pro 99.95
d2hyda2323 Putative multidrug export ATP-binding/permease pro 99.94
g1f2t.1292 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 99.77
g1f2t.1292 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 99.69
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 99.54
g1ii8.1369 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 99.49
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 99.41
d1w1wa_427 Smc head domain {Baker's yeast (Saccharomyces cere 99.32
d1w1wa_427 Smc head domain {Baker's yeast (Saccharomyces cere 99.13
d1e69a_308 Smc head domain {Thermotoga maritima [TaxId: 2336] 99.11
d1e69a_308 Smc head domain {Thermotoga maritima [TaxId: 2336] 99.04
g1xew.1329 Smc head domain {Pyrococcus furiosus [TaxId: 2261] 98.85
g1ii8.1369 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 98.8
g1xew.1329 Smc head domain {Pyrococcus furiosus [TaxId: 2261] 98.7
d1ewqa2224 DNA repair protein MutS, the C-terminal domain {Th 96.99
d1cr2a_277 Gene 4 protein (g4p, DNA primase), helicase domain 96.85
d1wb9a2234 DNA repair protein MutS, the C-terminal domain {Es 96.79
d1g6oa_323 Hexameric traffic ATPase, HP0525 {Helicobacter pyl 96.73
d1cr2a_277 Gene 4 protein (g4p, DNA primase), helicase domain 96.69
d1nlfa_274 Hexameric replicative helicase repA {Escherichia c 96.65
d1u0la2225 Probable GTPase EngC (YjeQ), C-terminal domain {Th 96.41
d1nlfa_274 Hexameric replicative helicase repA {Escherichia c 96.3
d1tf7a2242 Circadian clock protein KaiC {Synechococcus sp. st 96.27
d1tf7a2242 Circadian clock protein KaiC {Synechococcus sp. st 96.19
d1r7ra3265 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 96.16
d1lv7a_256 AAA domain of cell division protein FtsH {Escheric 96.12
d1r7ra3265 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 96.06
d1u0la2225 Probable GTPase EngC (YjeQ), C-terminal domain {Th 96.04
d2i3ba1189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 95.96
d1znwa1182 Guanylate kinase {Mycobacterium tuberculosis [TaxI 95.93
d1znwa1182 Guanylate kinase {Mycobacterium tuberculosis [TaxI 95.91
d1zp6a1176 Hypothetical protein Atu3015 {Agrobacterium tumefa 95.81
d1g6oa_323 Hexameric traffic ATPase, HP0525 {Helicobacter pyl 95.75
d1np6a_170 Molybdopterin-guanine dinucleotide biosynthesis pr 95.68
d1ewqa2224 DNA repair protein MutS, the C-terminal domain {Th 95.67
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 95.64
d1lv7a_256 AAA domain of cell division protein FtsH {Escheric 95.57
d1sq5a_308 Pantothenate kinase PanK {Escherichia coli [TaxId: 95.49
d1t9ha2231 Probable GTPase EngC (YjeQ), C-terminal domain {Ba 95.47
d1zp6a1176 Hypothetical protein Atu3015 {Agrobacterium tumefa 95.46
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 95.45
d1m8pa3183 ATP sulfurylase C-terminal domain {Fungus (Penicil 95.45
d2dy1a2267 Elongation factor G (EF-G), N-terminal (G) domain 95.43
d1mkya2186 Probable GTPase Der, N-terminal and middle domains 95.34
d1sq5a_308 Pantothenate kinase PanK {Escherichia coli [TaxId: 95.34
d1s96a_205 Guanylate kinase {Escherichia coli [TaxId: 562]} 95.28
d1s96a_205 Guanylate kinase {Escherichia coli [TaxId: 562]} 95.28
d1rz3a_198 Hypothetical protein rbstp0775 {Bacillus stearothe 95.17
d1xjca_165 Molybdopterin-guanine dinucleotide biosynthesis pr 95.08
d1m8pa3183 ATP sulfurylase C-terminal domain {Fungus (Penicil 95.04
d1np6a_170 Molybdopterin-guanine dinucleotide biosynthesis pr 95.01
d1t9ha2231 Probable GTPase EngC (YjeQ), C-terminal domain {Ba 94.99
d1y63a_174 Probable kinase LmjF30.1890 {Leishmania major [Tax 94.98
d1ixza_247 AAA domain of cell division protein FtsH {Thermus 94.95
d1yj5a2172 5' polynucleotide kinase-3' phosphatase, C-termina 94.94
d1p9ra_401 Extracellular secretion NTPase EpsE {Vibrio choler 94.91
d1yj5a2172 5' polynucleotide kinase-3' phosphatase, C-termina 94.86
d1sxje2252 Replication factor C5 {Baker's yeast (Saccharomyce 94.83
d1uj2a_213 Uridine-cytidine kinase 2 {Human (Homo sapiens) [T 94.82
d1qhxa_178 Chloramphenicol phosphotransferase {Streptomyces v 94.82
d2i3ba1189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 94.75
d1y63a_174 Probable kinase LmjF30.1890 {Leishmania major [Tax 94.69
d1svia_195 Probable GTPase EngB {Bacillus subtilis [TaxId: 14 94.68
d1qhxa_178 Chloramphenicol phosphotransferase {Streptomyces v 94.66
d1lw7a2192 Transcriptional regulator NadR, ribosylnicotinamid 94.55
d1tq4a_400 Interferon-inducible GTPase {Mouse (Mus musculus) 94.52
d1knqa_171 Gluconate kinase {Escherichia coli [TaxId: 562]} 94.51
d1m7ga_208 Adenosine-5'phosphosulfate kinase (APS kinase) {Fu 94.48
d1knqa_171 Gluconate kinase {Escherichia coli [TaxId: 562]} 94.48
d1rz3a_198 Hypothetical protein rbstp0775 {Bacillus stearothe 94.41
d1lw7a2192 Transcriptional regulator NadR, ribosylnicotinamid 94.38
d1kgda_178 Guanylate kinase-like domain of Cask {Human (Homo 94.27
d1wb9a2234 DNA repair protein MutS, the C-terminal domain {Es 94.26
d1khta_190 Adenylate kinase {Archaeon Methanococcus voltae [T 94.24
d2bdta1176 Hypothetical protein BH3686 {Bacillus halodurans [ 94.19
d1h65a_257 Chloroplast protein translocon GTPase Toc34 {Garde 94.15
d1x6va3195 Adenosine-5'phosphosulfate kinase (APS kinase) {Hu 94.08
d2bdta1176 Hypothetical protein BH3686 {Bacillus halodurans [ 94.08
d1uj2a_213 Uridine-cytidine kinase 2 {Human (Homo sapiens) [T 94.06
d1x6va3195 Adenosine-5'phosphosulfate kinase (APS kinase) {Hu 93.96
d1kgda_178 Guanylate kinase-like domain of Cask {Human (Homo 93.92
d1sxje2252 Replication factor C5 {Baker's yeast (Saccharomyce 93.83
d1gkya_186 Guanylate kinase {Baker's yeast (Saccharomyces cer 93.78
d1xjca_165 Molybdopterin-guanine dinucleotide biosynthesis pr 93.77
d1khta_190 Adenylate kinase {Archaeon Methanococcus voltae [T 93.77
d1ak2a1190 Adenylate kinase {Cow (Bos taurus), mitochondrial 93.74
d2cxxa1184 GTP-binding protein engB {Pyrococcus horikoshii [T 93.74
d1rkba_173 Adenylate kinase {Human (Homo sapiens), isoenzyme 93.71
d1yrba1244 ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss 93.52
d1ak2a1190 Adenylate kinase {Cow (Bos taurus), mitochondrial 93.51
d1kaga_169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 93.51
d1kaga_169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 93.48
d1mkya2186 Probable GTPase Der, N-terminal and middle domains 93.47
d1qf9a_194 UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 93.45
d1p5zb_241 Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 93.43
d1rkba_173 Adenylate kinase {Human (Homo sapiens), isoenzyme 93.4
d1gkya_186 Guanylate kinase {Baker's yeast (Saccharomyces cer 93.4
d2gj8a1161 Probable tRNA modification GTPase TrmE (MnmE), G d 93.39
d1lnza2185 Obg GTP-binding protein middle domain {Bacillus su 93.37
d1lvga_190 Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 93.34
d1wf3a1178 GTPase Era, N-terminal domain {Thermus thermophilu 93.33
d1mkya1171 Probable GTPase Der, N-terminal and middle domains 93.29
d1qf9a_194 UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 93.26
d1ukza_196 Uridylate kinase {Baker's yeast (Saccharomyces cer 93.18
d1p9ra_401 Extracellular secretion NTPase EpsE {Vibrio choler 93.11
d1vmaa2213 GTPase domain of the signal recognition particle r 93.11
d2p67a1327 LAO/AO transport system kinase ArgK {Escherichia c 93.02
d1uf9a_191 Dephospho-CoA kinase {Thermus thermophilus [TaxId: 93.01
d1yrba1244 ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss 92.98
d1egaa1179 GTPase Era, N-terminal domain {Escherichia coli [T 92.92
d1svia_195 Probable GTPase EngB {Bacillus subtilis [TaxId: 14 92.71
d1udxa2180 Obg GTP-binding protein middle domain {Thermus the 92.7
d2vp4a1197 Deoxyribonucleoside kinase {Fruit fly (Drosophila 92.7
d1bifa1213 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata 92.67
d1nrjb_209 Signal recognition particle receptor beta-subunit 92.67
d3adka_194 Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} 92.67
d1jjva_205 Dephospho-CoA kinase {Haemophilus influenzae [TaxI 92.66
d1lvga_190 Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 92.66
d1j8yf2211 GTPase domain of the signal sequence recognition p 92.66
d1n0wa_242 DNA repair protein Rad51, catalytic domain {Human 92.63
d2erxa1171 di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 92.61
d1f6ba_186 SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 92.6
d1nn5a_209 Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 92.54
d1puia_188 Probable GTPase EngB {Escherichia coli [TaxId: 562 92.51
d1n0wa_242 DNA repair protein Rad51, catalytic domain {Human 92.5
d1ukza_196 Uridylate kinase {Baker's yeast (Saccharomyces cer 92.46
d1q3ta_223 CMP kinase {Streptococcus pneumoniae [TaxId: 1313] 92.43
d1knxa2177 HPr kinase HprK C-terminal domain {Mycoplasma pneu 92.28
d1e6ca_170 Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax 92.11
d1a7ja_288 Phosphoribulokinase {Rhodobacter sphaeroides [TaxI 92.06
d1upta_169 ADP-ribosylation factor {Human (Homo sapiens), ARL 92.06
d1p5zb_241 Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 92.05
d1gvnb_273 Plasmid maintenance system epsilon/zeta, toxin zet 92.05
d1okkd2207 GTPase domain of the signal recognition particle r 92.02
d1m7ga_208 Adenosine-5'phosphosulfate kinase (APS kinase) {Fu 91.96
d1q3ta_223 CMP kinase {Streptococcus pneumoniae [TaxId: 1313] 91.85
d1ixza_247 AAA domain of cell division protein FtsH {Thermus 91.85
d3adka_194 Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} 91.83
d2vp4a1197 Deoxyribonucleoside kinase {Fruit fly (Drosophila 91.82
d1uf9a_191 Dephospho-CoA kinase {Thermus thermophilus [TaxId: 91.82
d1r8sa_160 ADP-ribosylation factor {Human (Homo sapiens), ARF 91.81
d1odfa_286 Hypothetical protein Ygr205W {Baker's yeast (Sacch 91.78
d1tmka_214 Thymidylate kinase {Baker's yeast (Saccharomyces c 91.73
d1xtqa1167 GTP-binding protein RheB {Human (Homo sapiens) [Ta 91.71
d1teva_194 UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] 91.71
d1wb1a4179 Elongation factor SelB, N-terminal domain {Methano 91.62
d1viaa_161 Shikimate kinase (AroK) {Campylobacter jejuni [Tax 91.62
d1bifa1213 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata 91.57
d4tmka_210 Thymidylate kinase {Escherichia coli [TaxId: 562]} 91.49
d2qtvb1166 SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta 91.49
d1tq4a_400 Interferon-inducible GTPase {Mouse (Mus musculus) 91.47
d1jjva_205 Dephospho-CoA kinase {Haemophilus influenzae [TaxI 91.47
d1e6ca_170 Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax 91.46
d1zina1182 Adenylate kinase {Bacillus stearothermophilus [Tax 91.46
d1ksha_165 ADP-ribosylation factor {Mouse (Mus musculus), ARL 91.45
d1h65a_257 Chloroplast protein translocon GTPase Toc34 {Garde 91.44
d1viaa_161 Shikimate kinase (AroK) {Campylobacter jejuni [Tax 91.35
d1s3ga1182 Adenylate kinase {Bacillus globisporus [TaxId: 145 91.33
d1g41a_443 HslU {Haemophilus influenzae [TaxId: 727]} 91.25
d1mkya1171 Probable GTPase Der, N-terminal and middle domains 91.22
d1zaka1189 Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} 91.21
d2qy9a2211 GTPase domain of the signal recognition particle r 91.17
d1teva_194 UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] 91.16
d2erxa1171 di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 91.1
d1nksa_194 Adenylate kinase {Archaeon Sulfolobus acidocaldari 90.96
d1wf3a1178 GTPase Era, N-terminal domain {Thermus thermophilu 90.92
d1vhta_208 Dephospho-CoA kinase {Escherichia coli [TaxId: 562 90.9
d2fh5b1207 Signal recognition particle receptor beta-subunit 90.9
d1nrjb_209 Signal recognition particle receptor beta-subunit 90.81
d1ckea_225 CMP kinase {Escherichia coli [TaxId: 562]} 90.81
d1szpa2251 DNA repair protein Rad51, catalytic domain {Baker' 90.79
d1nn5a_209 Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 90.78
d2cxxa1184 GTP-binding protein engB {Pyrococcus horikoshii [T 90.78
d1ofha_309 HslU {Haemophilus influenzae [TaxId: 727]} 90.75
d1qhla_222 Cell division protein MukB {Escherichia coli [TaxI 90.75
d2atva1168 Ras-like estrogen-regulated growth inhibitor, RERG 90.74
d1zaka1189 Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} 90.73
d1ofha_309 HslU {Haemophilus influenzae [TaxId: 727]} 90.67
d1zina1182 Adenylate kinase {Bacillus stearothermophilus [Tax 90.65
d4tmka_210 Thymidylate kinase {Escherichia coli [TaxId: 562]} 90.64
d2qy9a2211 GTPase domain of the signal recognition particle r 90.62
d1szpa2251 DNA repair protein Rad51, catalytic domain {Baker' 90.6
d1nksa_194 Adenylate kinase {Archaeon Sulfolobus acidocaldari 90.54
d2iyva1165 Shikimate kinase (AroK) {Mycobacterium tuberculosi 90.51
d1qhla_222 Cell division protein MukB {Escherichia coli [TaxI 90.49
d1in4a2238 Holliday junction helicase RuvB {Thermotoga mariti 90.46
d1s3ga1182 Adenylate kinase {Bacillus globisporus [TaxId: 145 90.42
d1sxja2253 Replication factor C1 {Baker's yeast (Saccharomyce 90.4
d1u8za_168 Ras-related protein RalA {Cotton-top tamarin (Sagu 90.38
d1gvnb_273 Plasmid maintenance system epsilon/zeta, toxin zet 90.32
d1ky3a_175 Rab-related protein ypt7p {Baker's yeast (Saccharo 90.26
d1a7ja_288 Phosphoribulokinase {Rhodobacter sphaeroides [TaxI 90.16
d2p67a1327 LAO/AO transport system kinase ArgK {Escherichia c 90.15
d1lnza2185 Obg GTP-binding protein middle domain {Bacillus su 90.15
d2iyva1165 Shikimate kinase (AroK) {Mycobacterium tuberculosi 90.12
d1vmaa2213 GTPase domain of the signal recognition particle r 90.11
d1zj6a1177 ADP-ribosylation factor {Human (Homo sapiens), ARL 90.1
d2gj8a1161 Probable tRNA modification GTPase TrmE (MnmE), G d 90.04
d1e4va1179 Adenylate kinase {Escherichia coli [TaxId: 562]} 90.04
d1tmka_214 Thymidylate kinase {Baker's yeast (Saccharomyces c 90.03
d2erya1171 r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 90.02
d1v5wa_258 Meiotic recombination protein DMC1/LIM15 homolog { 89.95
d2ak3a1189 Adenylate kinase {Cow (Bos taurus), mitochondrial 89.94
d2cdna1181 Adenylate kinase {Mycobacterium tuberculosis [TaxI 89.93
d1e4va1179 Adenylate kinase {Escherichia coli [TaxId: 562]} 89.89
d1kkma_176 HPr kinase HprK C-terminal domain {Lactobacillus c 89.86
d1odfa_286 Hypothetical protein Ygr205W {Baker's yeast (Sacch 89.84
d1l8qa2213 Chromosomal replication initiation factor DnaA {Aq 89.83
d1r8sa_160 ADP-ribosylation factor {Human (Homo sapiens), ARF 89.8
d1ckea_225 CMP kinase {Escherichia coli [TaxId: 562]} 89.76
d1egaa1179 GTPase Era, N-terminal domain {Escherichia coli [T 89.75
d1upta_169 ADP-ribosylation factor {Human (Homo sapiens), ARL 89.7
d1pzna2254 DNA repair protein Rad51, catalytic domain {Archae 89.69
d1ksha_165 ADP-ribosylation factor {Mouse (Mus musculus), ARL 89.69
d2bv3a2276 Elongation factor G (EF-G), N-terminal (G) domain 89.65
d1ek0a_170 Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [T 89.51
d1xtqa1167 GTP-binding protein RheB {Human (Homo sapiens) [Ta 89.51
d1vhta_208 Dephospho-CoA kinase {Escherichia coli [TaxId: 562 89.47
d1xpua3289 Transcription termination factor Rho, ATPase domai 89.41
d2fnaa2283 Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ 89.37
d1g7sa4227 Initiation factor IF2/eIF5b, N-terminal (G) domain 89.31
d1knxa2177 HPr kinase HprK C-terminal domain {Mycoplasma pneu 89.3
d1xzpa2160 TrmE GTPase domain {Thermotoga maritima [TaxId: 23 89.27
d3raba_169 Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} 89.18
d2akab1299 Dynamin G domain {Rat (Rattus norvegicus) [TaxId: 89.17
d1tf7a1242 Circadian clock protein KaiC {Synechococcus sp. st 89.14
d1fzqa_176 ADP-ribosylation factor {Mouse (Mus musculus), ARL 89.09
d2qtvb1166 SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta 89.08
d1f6ba_186 SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 89.03
d1udxa2180 Obg GTP-binding protein middle domain {Thermus the 89.02
d1deka_241 Deoxynucleoside monophosphate kinase {Bacteriophag 88.98
d2i1qa2258 DNA repair protein Rad51, catalytic domain {Archae 88.95
d1l8qa2213 Chromosomal replication initiation factor DnaA {Aq 88.93
d1ko7a2169 HPr kinase HprK C-terminal domain {Staphylococcus 88.91
d1v5wa_258 Meiotic recombination protein DMC1/LIM15 homolog { 88.9
d1jwyb_306 Dynamin G domain {Dictyostelium discoideum [TaxId: 88.88
d1u94a1263 RecA protein, ATPase-domain {Escherichia coli [Tax 88.87
d1kaoa_167 Rap2a {Human (Homo sapiens) [TaxId: 9606]} 88.86
d1tf7a1242 Circadian clock protein KaiC {Synechococcus sp. st 88.83
d2qm8a1323 Metallochaperone MeaB {Methylobacterium extorquens 88.8
d2cdna1181 Adenylate kinase {Mycobacterium tuberculosis [TaxI 88.76
d1wmsa_174 Rab9a {Human (Homo sapiens) [TaxId: 9606]} 88.63
d1akya1180 Adenylate kinase {Baker's yeast (Saccharomyces cer 88.61
d1ky3a_175 Rab-related protein ypt7p {Baker's yeast (Saccharo 88.57
d1pzna2254 DNA repair protein Rad51, catalytic domain {Archae 88.51
d2f7sa1186 Rab27b {Human (Homo sapiens) [TaxId: 9606]} 88.48
d1fnna2276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 88.44
d2bmja1175 Centaurin gamma 1, G domain {Human (Homo sapiens) 88.42
d1fnna2276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 88.42
d2i1qa2258 DNA repair protein Rad51, catalytic domain {Archae 88.27
d1j8yf2211 GTPase domain of the signal sequence recognition p 88.27
d2erya1171 r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 88.22
d1vg8a_184 Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} 88.12
d1sxja2253 Replication factor C1 {Baker's yeast (Saccharomyce 88.06
d2f9la1175 Rab11b {Human (Homo sapiens) [TaxId: 9606]} 88.02
d1p6xa_333 Thymidine kinase {Equine herpesvirus type 4 [TaxId 87.99
d1kkma_176 HPr kinase HprK C-terminal domain {Lactobacillus c 87.99
d1gsia_208 Thymidylate kinase {Mycobacterium tuberculosis [Ta 87.98
d1u94a1263 RecA protein, ATPase-domain {Escherichia coli [Tax 87.97
d1yzqa1164 Rab6 {Human (Homo sapiens) [TaxId: 9606]} 87.96
d2fnaa2283 Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ 87.95
d1ixsb2239 Holliday junction helicase RuvB {Thermus thermophi 87.93
d1in4a2238 Holliday junction helicase RuvB {Thermotoga mariti 87.89
d2fh5b1207 Signal recognition particle receptor beta-subunit 87.81
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 87.81
d1z2aa1164 Rab23 {Mouse (Mus musculus) [TaxId: 10090]} 87.75
d1z0ja1167 Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} 87.68
d2dy1a2267 Elongation factor G (EF-G), N-terminal (G) domain 87.64
d2gjsa1168 Rad {Human (Homo sapiens) [TaxId: 9606]} 87.64
d2ak3a1189 Adenylate kinase {Cow (Bos taurus), mitochondrial 87.63
d1ctqa_166 cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 87.59
d1z2aa1164 Rab23 {Mouse (Mus musculus) [TaxId: 10090]} 87.59
d1zd9a1164 ADP-ribosylation factor {Human (Homo sapiens), ARL 87.52
d1wxqa1319 GTP-binding protein PH0525 {Pyrococcus horikoshii 87.45
d1xpua3289 Transcription termination factor Rho, ATPase domai 87.41
d2g3ya1172 GTP-binding protein GEM {Human (Homo sapiens) [Tax 87.28
d1x1ra1169 Ras-related protein M-Ras (XRas) {Mouse (Mus muscu 87.23
d1wmsa_174 Rab9a {Human (Homo sapiens) [TaxId: 9606]} 87.23
d1ls1a2207 GTPase domain of the signal sequence recognition p 87.2
d1e32a2258 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 87.11
d2qm8a1323 Metallochaperone MeaB {Methylobacterium extorquens 87.1
d2atva1168 Ras-like estrogen-regulated growth inhibitor, RERG 87.08
d1moza_182 ADP-ribosylation factor {Baker's yeast (Saccharomy 87.06
d1f5na2277 Interferon-induced guanylate-binding protein 1 (GB 87.04
d1deka_241 Deoxynucleoside monophosphate kinase {Bacteriophag 87.04
d1htwa_158 Hypothetical protein HI0065 {Haemophilus influenza 87.02
d1wb1a4179 Elongation factor SelB, N-terminal domain {Methano 87.0
d1gsia_208 Thymidylate kinase {Mycobacterium tuberculosis [Ta 86.96
d2a5ja1173 Rab2b {Human (Homo sapiens) [TaxId: 9606]} 86.93
d1sxjd2237 Replication factor C2 {Baker's yeast (Saccharomyce 86.87
d1ek0a_170 Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [T 86.86
d1okkd2207 GTPase domain of the signal recognition particle r 86.82
d1puia_188 Probable GTPase EngB {Escherichia coli [TaxId: 562 86.75
d1g16a_166 Rab-related protein Sec4 {Baker's yeast (Saccharom 86.74
d1htwa_158 Hypothetical protein HI0065 {Haemophilus influenza 86.73
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 86.72
d1kk1a3195 Initiation factor eIF2 gamma subunit, N-terminal ( 86.72
d1zj6a1177 ADP-ribosylation factor {Human (Homo sapiens), ARL 86.69
d2ew1a1171 Rab30 {Human (Homo sapiens) [TaxId: 9606]} 86.66
d1mh1a_183 Rac {Human (Homo sapiens) [TaxId: 9606]} 86.64
d1kaoa_167 Rap2a {Human (Homo sapiens) [TaxId: 9606]} 86.61
d1jala1278 YchF GTP-binding protein N-terminal domain {Haemop 86.6
d1u8za_168 Ras-related protein RalA {Cotton-top tamarin (Sagu 86.47
d1svma_362 Papillomavirus large T antigen helicase domain {Si 86.45
d1njfa_239 delta prime subunit of DNA polymerase III, N-domai 86.39
d1akya1180 Adenylate kinase {Baker's yeast (Saccharomyces cer 86.36
d1m7ba_179 RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} 86.28
d1azta2221 Transducin (alpha subunit) {Cow (Bos taurus) [TaxI 86.28
d1sxjd2237 Replication factor C2 {Baker's yeast (Saccharomyce 86.11
d1yzqa1164 Rab6 {Human (Homo sapiens) [TaxId: 9606]} 85.99
d3raba_169 Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} 85.99
d1ko7a2169 HPr kinase HprK C-terminal domain {Staphylococcus 85.97
d1g7sa4227 Initiation factor IF2/eIF5b, N-terminal (G) domain 85.95
d1mo6a1269 RecA protein, ATPase-domain {Mycobacterium tubercu 85.9
d1vg8a_184 Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} 85.58
d2bcgy1194 GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisi 85.55
d1d2na_246 Hexamerization domain of N-ethylmalemide-sensitive 85.5
d1z0ja1167 Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} 85.42
d1z08a1167 Rab21 {Human (Homo sapiens) [TaxId: 9606]} 85.39
d2jdid3276 Central domain of beta subunit of F1 ATP synthase 85.36
d1x1ra1169 Ras-related protein M-Ras (XRas) {Mouse (Mus muscu 85.36
d1kmqa_177 RhoA {Human (Homo sapiens) [TaxId: 9606]} 85.33
d1ni3a1296 YchF GTP-binding protein N-terminal domain {Fissio 85.32
d1e9ra_433 Bacterial conjugative coupling protein TrwB {Esche 85.24
d1z06a1165 Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} 85.24
d1z0fa1166 Rab14 {Human (Homo sapiens) [TaxId: 9606]} 85.18
d1i2ma_170 Ran {Human (Homo sapiens) [TaxId: 9606]} 85.16
d2ocpa1241 Deoxyguanosine kinase {Human (Homo sapiens) [TaxId 85.14
d2bmea1174 Rab4a {Human (Homo sapiens) [TaxId: 9606]} 84.98
d2f7sa1186 Rab27b {Human (Homo sapiens) [TaxId: 9606]} 84.94
d1m7ba_179 RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} 84.88
d2fn4a1173 r-Ras {Human (Homo sapiens) [TaxId: 9606]} 84.86
d1x3sa1177 Rab18 {Human (Homo sapiens) [TaxId: 9606]} 84.84
d2bv3a2276 Elongation factor G (EF-G), N-terminal (G) domain 84.84
d2f9la1175 Rab11b {Human (Homo sapiens) [TaxId: 9606]} 84.8
d1zcba2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 84.79
d1zd9a1164 ADP-ribosylation factor {Human (Homo sapiens), ARL 84.77
d1ctqa_166 cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 84.59
d1sxjb2224 Replication factor C4 {Baker's yeast (Saccharomyce 84.56
d2g3ya1172 GTP-binding protein GEM {Human (Homo sapiens) [Tax 84.5
d2jdid3276 Central domain of beta subunit of F1 ATP synthase 84.47
d1z08a1167 Rab21 {Human (Homo sapiens) [TaxId: 9606]} 84.41
d1fzqa_176 ADP-ribosylation factor {Mouse (Mus musculus), ARL 84.38
d2fu5c1173 Rab8a {Mouse (Mus musculus) [TaxId: 10090]} 84.35
d1mo6a1269 RecA protein, ATPase-domain {Mycobacterium tubercu 84.24
d1r6bx3315 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 84.2
d1xp8a1268 RecA protein, ATPase-domain {Deinococcus radiodura 84.18
d1d2na_246 Hexamerization domain of N-ethylmalemide-sensitive 84.15
d1r2qa_170 Rab5a {Human (Homo sapiens) [TaxId: 9606]} 84.13
d2gjsa1168 Rad {Human (Homo sapiens) [TaxId: 9606]} 84.07
d1osna_331 Thymidine kinase {Varicella-zoster virus [TaxId: 1 84.06
d1e32a2258 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 83.95
d2atxa1185 RhoQ {Human (Homo sapiens) [TaxId: 9606]} 83.93
d2g6ba1170 Rab26 {Human (Homo sapiens) [TaxId: 9606]} 83.92
d2ocpa1241 Deoxyguanosine kinase {Human (Homo sapiens) [TaxId 83.9
d2a5ja1173 Rab2b {Human (Homo sapiens) [TaxId: 9606]} 83.88
d1xzpa2160 TrmE GTPase domain {Thermotoga maritima [TaxId: 23 83.83
d1xp8a1268 RecA protein, ATPase-domain {Deinococcus radiodura 83.57
d1svsa1195 Transducin (alpha subunit) {Rat (Rattus norvegicus 83.52
d1ixsb2239 Holliday junction helicase RuvB {Thermus thermophi 83.3
d1e0sa_173 ADP-ribosylation factor {Human (Homo sapiens), ARF 83.28
d1ls1a2207 GTPase domain of the signal sequence recognition p 83.28
d2ew1a1171 Rab30 {Human (Homo sapiens) [TaxId: 9606]} 83.27
d1svma_362 Papillomavirus large T antigen helicase domain {Si 83.27
d2g6ba1170 Rab26 {Human (Homo sapiens) [TaxId: 9606]} 83.07
d1jwyb_306 Dynamin G domain {Dictyostelium discoideum [TaxId: 82.79
d1g8pa_333 ATPase subunit of magnesium chelatase, BchI {Rhodo 82.76
d1azta2221 Transducin (alpha subunit) {Cow (Bos taurus) [TaxI 82.62
d1sxjc2227 Replication factor C3 {Baker's yeast (Saccharomyce 82.6
d2bmja1175 Centaurin gamma 1, G domain {Human (Homo sapiens) 82.5
d2ngra_191 CDC42 {Human (Homo sapiens) [TaxId: 9606]} 82.44
d2c78a3204 Elongation factor Tu (EF-Tu), N-terminal (G) domai 82.4
d2qn6a3205 Initiation factor eIF2 gamma subunit, N-terminal ( 82.39
d1mh1a_183 Rac {Human (Homo sapiens) [TaxId: 9606]} 82.37
d2akab1299 Dynamin G domain {Rat (Rattus norvegicus) [TaxId: 82.34
d1zcba2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 82.15
d1z0fa1166 Rab14 {Human (Homo sapiens) [TaxId: 9606]} 82.12
d1g16a_166 Rab-related protein Sec4 {Baker's yeast (Saccharom 82.11
d1x3sa1177 Rab18 {Human (Homo sapiens) [TaxId: 9606]} 82.0
d1r6bx3315 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 81.94
d2bcgy1194 GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisi 81.94
d1sxjb2224 Replication factor C4 {Baker's yeast (Saccharomyce 81.89
d1c1ya_167 Rap1A {Human (Homo sapiens) [TaxId: 9606]} 81.83
d1z06a1165 Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} 81.74
d1r2qa_170 Rab5a {Human (Homo sapiens) [TaxId: 9606]} 81.64
d1um8a_364 ClpX {Helicobacter pylori [TaxId: 210]} 81.48
d1f5na2277 Interferon-induced guanylate-binding protein 1 (GB 81.4
d1kmqa_177 RhoA {Human (Homo sapiens) [TaxId: 9606]} 81.2
d1fx0a3276 Central domain of alpha subunit of F1 ATP synthase 81.09
d1kk1a3195 Initiation factor eIF2 gamma subunit, N-terminal ( 80.89
d1sxjc2227 Replication factor C3 {Baker's yeast (Saccharomyce 80.88
d2fn4a1173 r-Ras {Human (Homo sapiens) [TaxId: 9606]} 80.64
d1u0ja_267 Rep 40 protein helicase domain {Adeno-associated v 80.61
d1svsa1195 Transducin (alpha subunit) {Rat (Rattus norvegicus 80.59
d2bmea1174 Rab4a {Human (Homo sapiens) [TaxId: 9606]} 80.26
d1e2ka_329 Thymidine kinase {Herpes simplex virus type 1, dif 80.08
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: ABC transporter ATPase domain-like
domain: Putative multidrug export ATP-binding/permease protein SAV1866
species: Staphylococcus aureus [TaxId: 1280]
Probab=100.00  E-value=0  Score=521.71  Aligned_cols=242  Identities=50%  Similarity=0.826  Sum_probs=233.6

Q ss_pred             CCCCEEEEEEEEECCCCCCCCEEEEEEEEEECCCEEEEECCCCCCHHHHHHHHHCCCCCCCCEEEECCEECCCCCHHHHH
Q ss_conf             76628997558987999985201101588638979999827999868899987056658865899999607999978764
Q 000751         1050 VYGSIELKNVDFCYPSRPEVLVLSNFSLKVNGGQTVAVVGVSGSGKSTIISLIERFYDPVAGQVLLDGRDLKLYNLRWLR 1129 (1303)
Q Consensus      1050 ~~g~I~~~nVsf~Y~~~~~~~vL~~isl~I~~Ge~vaIVG~SGSGKSTLl~lL~rl~~p~~G~I~idG~di~~~~~~~lR 1129 (1303)
                      ..|.|+|+||+|+|+++. .++|+|+||+|++||++||||+||||||||+++|+|+|+|++|+|.+||.|+++++.+++|
T Consensus        13 ~~g~I~~~nvsf~Y~~~~-~~vL~~isl~i~~Ge~vaivG~sGsGKSTLl~ll~gl~~p~~G~I~i~g~~i~~~~~~~lr   91 (255)
T d2hyda1          13 KQGRIDIDHVSFQYNDNE-APILKDINLSIEKGETVAFVGMSGGGKSTLINLIPRFYDVTSGQILIDGHNIKDFLTGSLR   91 (255)
T ss_dssp             CSCCEEEEEEEECSCSSS-CCSEEEEEEEECTTCEEEEECSTTSSHHHHHTTTTTSSCCSEEEEEETTEEGGGSCHHHHH
T ss_pred             CCCEEEEEEEEEEECCCC-CCCEECEEEEECCCCEEEEECCCCCCHHHHHHHHHHCCCCCCCCCCCCCEECCCCCHHHHH
T ss_conf             788799998899959999-7606443899839989999889998099999999712786300015399875307888863


Q ss_pred             CCEEEECCCCCCCCCCHHHHHHCCCCCCCHHHHHHHHHHHCHHHHHHHCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHC
Q ss_conf             13688836786672128999971888999999999999952699998199986642378888889589999999999703
Q 000751         1130 NHLGLVQQEPIIFSTTIRENIIYARHNASEAEVKEAARIANAHHFISSLPHGYDTHVGMRGVDLTPGQKQRIAIARVVLK 1209 (1303)
Q Consensus      1130 ~~i~~V~Q~p~Lf~gTIreNI~~g~~~~~~~ei~~al~~a~l~~~I~~lp~Gldt~vge~G~~LSGGQkQRiaLARAll~ 1209 (1303)
                      ++++||||+|++|++||+|||.+|.++.++++++++++.+++++++..+|+|++|.++++|.+||||||||+|||||+++
T Consensus        92 ~~i~~v~Q~~~lf~~Ti~eNi~~g~~~~~~~~~~~al~~~~l~~~i~~lp~gl~t~i~~~g~~LSgGq~QRi~iARal~~  171 (255)
T d2hyda1          92 NQIGLVQQDNILFSDTVKENILLGRPTATDEEVVEAAKMANAHDFIMNLPQGYDTEVGERGVKLSGGQKQRLSIARIFLN  171 (255)
T ss_dssp             HTEEEECSSCCCCSSBHHHHHGGGCSSCCHHHHHHHHHHTTCHHHHHTSTTGGGCBCCGGGTTSCHHHHHHHHHHHHHHH
T ss_pred             HEEEEEECCCCCCCCCHHHHHHCCCCCCCHHHHHHHHHHHCCHHHHHHCCCCCCCHHCCCCCCCCHHHHHHHHHHHHHHC
T ss_conf             41456510156899879999851586799999999999969799997362420103338889849999999999999855


Q ss_pred             CCCEEEEECCCCCCCHHHHHHHHHHHHHHHCCCCEEEEEECCCHHHHHCCEEEEEECCEEEEECCHHHHHHCCCHHHHHH
Q ss_conf             99999984778999989899999999984419929999833901674059899996989988349578964070669987
Q 000751         1210 NAPILLLDEASSSIESESSRVVQEALDTLIMGNKTTILIAHRAAMMRHVDNIVVLNGGRIVEEGTHDSLLAKNGLYVRLM 1289 (1303)
Q Consensus      1210 ~p~ILlLDEaTSaLD~~te~~I~~~l~~~~~~~~TvI~IaHrl~ti~~aD~Iivl~~G~Ive~Gt~~eLl~~~g~y~~l~ 1289 (1303)
                      +|+|||||||||+||++++..|.+.|..+.. ++|+|+||||++.++.||+|++|++|+|++.|+|+||+++++.|++||
T Consensus       172 ~p~ililDEpts~LD~~t~~~i~~~l~~l~~-~~TvI~itH~~~~~~~~D~ii~l~~G~iv~~G~~~eLl~~~~~y~~l~  250 (255)
T d2hyda1         172 NPPILILDEATSALDLESESIIQEALDVLSK-DRTTLIVAHRLSTITHADKIVVIENGHIVETGTHRELIAKQGAYEHLY  250 (255)
T ss_dssp             CCSEEEEESTTTTCCHHHHHHHHHHHHHHTT-TSEEEEECSSGGGTTTCSEEEEEETTEEEEEECHHHHHHTTSHHHHHH
T ss_pred             CCCEEEEECCCCCCCHHHHHHHHHHHHHHHC-CCEEEEEECCHHHHHHCCEEEEEECCEEEEECCHHHHHHCCCHHHHHH
T ss_conf             9989998376544797799999999998753-888999968999998599999998999999889999986884999999


Q ss_pred             HHHH
Q ss_conf             4552
Q 000751         1290 QPHY 1293 (1303)
Q Consensus      1290 ~~q~ 1293 (1303)
                      +.|.
T Consensus       251 ~~Q~  254 (255)
T d2hyda1         251 SIQN  254 (255)
T ss_dssp             TTTT
T ss_pred             HHCC
T ss_conf             9747



>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Back     information, alignment and structure
>d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Back     information, alignment and structure
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Back     information, alignment and structure
>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Back     information, alignment and structure
>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d3b60a2 f.37.1.1 (A:10-328) Multidrug resistance ABC transporter MsbA, N-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d3b60a2 f.37.1.1 (A:10-328) Multidrug resistance ABC transporter MsbA, N-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2hyda2 f.37.1.1 (A:1-323) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2hyda2 f.37.1.1 (A:1-323) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1w1wa_ c.37.1.12 (A:) Smc head domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1w1wa_ c.37.1.12 (A:) Smc head domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1e69a_ c.37.1.12 (A:) Smc head domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1e69a_ c.37.1.12 (A:) Smc head domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ewqa2 c.37.1.12 (A:542-765) DNA repair protein MutS, the C-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} Back     information, alignment and structure
>d1wb9a2 c.37.1.12 (A:567-800) DNA repair protein MutS, the C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} Back     information, alignment and structure
>d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ewqa2 c.37.1.12 (A:542-765) DNA repair protein MutS, the C-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d2dy1a2 c.37.1.8 (A:8-274) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus, EF-G-2 [TaxId: 274]} Back     information, alignment and structure
>d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1tq4a_ c.37.1.8 (A:) Interferon-inducible GTPase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wb9a2 c.37.1.12 (A:567-800) DNA repair protein MutS, the C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} Back     information, alignment and structure
>d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1p5zb_ c.37.1.1 (B:) Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1jjva_ c.37.1.1 (A:) Dephospho-CoA kinase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1knxa2 c.91.1.2 (A:133-309) HPr kinase HprK C-terminal domain {Mycoplasma pneumoniae [TaxId: 2104]} Back     information, alignment and structure
>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} Back     information, alignment and structure
>d1p5zb_ c.37.1.1 (B:) Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} Back     information, alignment and structure
>d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1tmka_ c.37.1.1 (A:) Thymidylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wb1a4 c.37.1.8 (A:1-179) Elongation factor SelB, N-terminal domain {Methanococcus maripaludis [TaxId: 39152]} Back     information, alignment and structure
>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1tq4a_ c.37.1.8 (A:) Interferon-inducible GTPase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jjva_ c.37.1.1 (A:) Dephospho-CoA kinase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} Back     information, alignment and structure
>d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1vhta_ c.37.1.1 (A:) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1qhla_ c.37.1.12 (A:) Cell division protein MukB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1qhla_ c.37.1.12 (A:) Cell division protein MukB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} Back     information, alignment and structure
>d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tmka_ c.37.1.1 (A:) Thymidylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kkma_ c.91.1.2 (A:) HPr kinase HprK C-terminal domain {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} Back     information, alignment and structure
>d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} Back     information, alignment and structure
>d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} Back     information, alignment and structure
>d2bv3a2 c.37.1.8 (A:7-282) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vhta_ c.37.1.1 (A:) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xpua3 c.37.1.11 (A:129-417) Transcription termination factor Rho, ATPase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1g7sa4 c.37.1.8 (A:1-227) Initiation factor IF2/eIF5b, N-terminal (G) domain {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1knxa2 c.91.1.2 (A:133-309) HPr kinase HprK C-terminal domain {Mycoplasma pneumoniae [TaxId: 2104]} Back     information, alignment and structure
>d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2akab1 c.37.1.8 (B:6-304) Dynamin G domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} Back     information, alignment and structure
>d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1deka_ c.37.1.1 (A:) Deoxynucleoside monophosphate kinase {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1ko7a2 c.91.1.2 (A:130-298) HPr kinase HprK C-terminal domain {Staphylococcus xylosus [TaxId: 1288]} Back     information, alignment and structure
>d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jwyb_ c.37.1.8 (B:) Dynamin G domain {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d2bmja1 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p6xa_ c.37.1.1 (A:) Thymidine kinase {Equine herpesvirus type 4 [TaxId: 10331]} Back     information, alignment and structure
>d1kkma_ c.91.1.2 (A:) HPr kinase HprK C-terminal domain {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dy1a2 c.37.1.8 (A:8-274) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus, EF-G-2 [TaxId: 274]} Back     information, alignment and structure
>d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} Back     information, alignment and structure
>d1wxqa1 c.37.1.8 (A:1-319) GTP-binding protein PH0525 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1xpua3 c.37.1.11 (A:129-417) Transcription termination factor Rho, ATPase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} Back     information, alignment and structure
>d1f5na2 c.37.1.8 (A:7-283) Interferon-induced guanylate-binding protein 1 (GBP1), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1deka_ c.37.1.1 (A:) Deoxynucleoside monophosphate kinase {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1htwa_ c.37.1.18 (A:) Hypothetical protein HI0065 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1wb1a4 c.37.1.8 (A:1-179) Elongation factor SelB, N-terminal domain {Methanococcus maripaludis [TaxId: 39152]} Back     information, alignment and structure
>d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1htwa_ c.37.1.18 (A:) Hypothetical protein HI0065 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1kk1a3 c.37.1.8 (A:6-200) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Archaeon Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} Back     information, alignment and structure
>d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jala1 c.37.1.8 (A:1-278) YchF GTP-binding protein N-terminal domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} Back     information, alignment and structure
>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1azta2 c.37.1.8 (A:35-65,A:202-391) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ko7a2 c.91.1.2 (A:130-298) HPr kinase HprK C-terminal domain {Staphylococcus xylosus [TaxId: 1288]} Back     information, alignment and structure
>d1g7sa4 c.37.1.8 (A:1-227) Initiation factor IF2/eIF5b, N-terminal (G) domain {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2jdid3 c.37.1.11 (D:82-357) Central domain of beta subunit of F1 ATP synthase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ni3a1 c.37.1.8 (A:11-306) YchF GTP-binding protein N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1e9ra_ c.37.1.11 (A:) Bacterial conjugative coupling protein TrwB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i2ma_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ocpa1 c.37.1.1 (A:37-277) Deoxyguanosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bv3a2 c.37.1.8 (A:7-282) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} Back     information, alignment and structure
>d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2jdid3 c.37.1.11 (D:82-357) Central domain of beta subunit of F1 ATP synthase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} Back     information, alignment and structure
>d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1osna_ c.37.1.1 (A:) Thymidine kinase {Varicella-zoster virus [TaxId: 10335]} Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ocpa1 c.37.1.1 (A:37-277) Deoxyguanosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1svsa1 c.37.1.8 (A:32-60,A:182-347) Transducin (alpha subunit) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Back     information, alignment and structure
>d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jwyb_ c.37.1.8 (B:) Dynamin G domain {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} Back     information, alignment and structure
>d1azta2 c.37.1.8 (A:35-65,A:202-391) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2bmja1 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c78a3 c.37.1.8 (A:9-212) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2qn6a3 c.37.1.8 (A:2-206) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2akab1 c.37.1.8 (B:6-304) Dynamin G domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1f5na2 c.37.1.8 (A:7-283) Interferon-induced guanylate-binding protein 1 (GBP1), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fx0a3 c.37.1.11 (A:97-372) Central domain of alpha subunit of F1 ATP synthase {Spinach (Spinacia oleracea), chloroplast [TaxId: 3562]} Back     information, alignment and structure
>d1kk1a3 c.37.1.8 (A:6-200) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Archaeon Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u0ja_ c.37.1.20 (A:) Rep 40 protein helicase domain {Adeno-associated virus 2, AAV2 [TaxId: 10804]} Back     information, alignment and structure
>d1svsa1 c.37.1.8 (A:32-60,A:182-347) Transducin (alpha subunit) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e2ka_ c.37.1.1 (A:) Thymidine kinase {Herpes simplex virus type 1, different strains [TaxId: 10298]} Back     information, alignment and structure