Citrus Sinensis ID: 000874
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 1243 | ||||||
| 224127917 | 1470 | tir-nbs-lrr resistance protein [Populus | 0.888 | 0.751 | 0.397 | 0.0 | |
| 451798990 | 1335 | TMV resistance protein N-like protein 7 | 0.829 | 0.772 | 0.401 | 0.0 | |
| 255537139 | 1137 | leucine-rich repeat-containing protein, | 0.880 | 0.963 | 0.381 | 0.0 | |
| 255563202 | 1158 | leucine-rich repeat containing protein, | 0.869 | 0.933 | 0.375 | 0.0 | |
| 359486075 | 1291 | PREDICTED: TMV resistance protein N-like | 0.884 | 0.852 | 0.380 | 0.0 | |
| 359493487 | 1162 | PREDICTED: TMV resistance protein N-like | 0.799 | 0.855 | 0.405 | 0.0 | |
| 359493483 | 1274 | PREDICTED: TMV resistance protein N-like | 0.802 | 0.783 | 0.403 | 0.0 | |
| 296090597 | 1201 | unnamed protein product [Vitis vinifera] | 0.863 | 0.893 | 0.396 | 0.0 | |
| 224145016 | 1254 | tir-nbs-lrr resistance protein [Populus | 0.850 | 0.842 | 0.383 | 0.0 | |
| 359493273 | 1233 | PREDICTED: TMV resistance protein N-like | 0.887 | 0.894 | 0.383 | 0.0 |
| >gi|224127917|ref|XP_002329209.1| tir-nbs-lrr resistance protein [Populus trichocarpa] gi|222870990|gb|EEF08121.1| tir-nbs-lrr resistance protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
Score = 748 bits (1932), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 492/1237 (39%), Positives = 686/1237 (55%), Gaps = 133/1237 (10%)
Query: 1 MASSSSC----NYDVFLSFRGVDTRASFTCHLYDSLFERKKIRTFIDDEELRQGDAISPV 56
M SSS+ YDVFLSFRG DTR +F HL D+L RK+I+TFIDD+ L +G+ I+
Sbjct: 1 MVSSSAVAQKWKYDVFLSFRGKDTRDNFVSHLRDALC-RKQIKTFIDDK-LERGEEITGA 58
Query: 57 LLNAIQGSKISLIIFSKDYASSKWCLNELVKILECKNTNGQIVIPVFYNVSPSDVRHQTG 116
LL I+ S+IS+IIFS++YASS WC++ELVKILECK GQIV+PVFY+V PSDV QTG
Sbjct: 59 LLRTIEESRISVIIFSRNYASSPWCVDELVKILECKKAYGQIVLPVFYHVDPSDVDQQTG 118
Query: 117 IFGDGFDKLEQQFKEKPEIVQKWRYALRETSHLAGHESTKFRHDAQLVNKIVEDILKKLE 176
FG+ F +LE+ FK+K + V +WR L ++++G +S R ++ LV +IV ILKKL
Sbjct: 119 SFGNAFAELERNFKQKMDKVPRWRADLTSAANISGWDSQVTRPESSLVEQIVHHILKKLN 178
Query: 177 KITVSTDSSNGLVGLNSRIEQIKPFLCMDLSDTVQIVGIWGMGGIGKTTLATAIFNQFSS 236
S+ GLVG++SR+EQI+ LC L + VGIWGMGG GKTT+A IFN+ +
Sbjct: 179 --YASSSDLKGLVGMDSRMEQIEASLCTKLPEFC-FVGIWGMGGTGKTTIAGEIFNKIAR 235
Query: 237 EFEGRCFMSDVRRNSETGGGLEHLQKQMLSTILSEK-LEVAGPNIPQ-FTKERVRRMKVL 294
E+EG F+++VR SE GGL ++ ++ S I E+ L + P I F K+R+ R K+L
Sbjct: 236 EYEGHYFLANVRE-SEKNGGLFRIRDELFSKITEEENLHIRTPRIGHPFIKDRICRKKIL 294
Query: 295 IVLDDVNKVGQLEGLIGGLDQYGPGSRIVVTTRDKGVLEKFGVEEEKIYGVNGLEFDEAF 354
IV DDVN V Q+E L+GG + +GPGSRI++T+RDK VL+K+ +KI+ V GL EA
Sbjct: 295 IVFDDVNDVDQIEMLLGGCESFGPGSRIILTSRDKQVLKKYA---DKIFEVEGLNHREAL 351
Query: 355 ELFCNFAFEENHCPEDLNWHSRRVVWYATSNPLVLKVLGSSLCLKRKSHWENVLDDLNRI 414
LF AF++N P + S R + YA NPL LKVLGSSL + WE+ L+ + ++
Sbjct: 352 HLFSLHAFKDNQPPYNYMELSVRAINYAKGNPLALKVLGSSLFGRTTKEWESALNKVEKL 411
Query: 415 CESEIHDIYDILKISFNELIPREKSMFLDIACFFEGEDKDILMRILDD---SESYALGVL 471
++H + L+IS+ L EKS+FLDIACFF G D + RILD VL
Sbjct: 412 TRQKVHSV---LRISYEALDSEEKSIFLDIACFFRGHRVDFVKRILDGCGFKTDIGFSVL 468
Query: 472 IDKSLITISHNCLQMHDLLQEMGRQIVRQESQKEPGKRSRLWDPKEIRRVLKHNKGTDAI 531
ID+ LI IS + ++MHDLLQEM +VR+ES E G +SRLW PK++ +VL +N GT +
Sbjct: 469 IDRCLIKISDDKVEMHDLLQEMAHDVVRKESLDELGGQSRLWSPKDVYQVLTNNLGTGKV 528
Query: 532 EGIFMDLSKIEGINLDSRAFTNMSNLRMLKFYVPKFLGMIIEEKLEDSKVQLPDGIDYLP 591
EGIF+D+SKI I L S A M LR+LK Y E +V LP G++ L
Sbjct: 529 EGIFLDVSKIREIELSSTALGRMYKLRLLKIYN--------SEAGVKCRVHLPHGLESLS 580
Query: 592 KNLRYLHWYKYPLRTLPSNFKPKNIVELSLRFSKVEQIWEGKKKAFKLKSIDLSHSEHLI 651
+ LRYLHW YPL +LPSNF+P+N+VE++L SKV ++W G + LK ++LS+ EH+
Sbjct: 581 EELRYLHWDGYPLTSLPSNFRPQNLVEINLSCSKVNRLWRGDQNLVNLKDVNLSNCEHIT 640
Query: 652 RIPDLSEIPNLERIYLSNCTNLVHVPASIQNFKYL------------------------- 686
+PDLS+ NLER+ L CT+LV VP+SIQ+ L
Sbjct: 641 FLPDLSKARNLERLNLQFCTSLVKVPSSIQHLDRLVDLDLRGCERLVNLPSRINSSCLET 700
Query: 687 ----------KFPQISGKITRLYLSQSAIEEVPSSIECLTDLVELDLRDCKRLKRISTRF 736
K P+ + K+T L L+++A+EE+P SI L+ LV L+L++CK L +
Sbjct: 701 LNLSGCANLKKCPETARKLTYLNLNETAVEELPQSIGELSGLVALNLKNCKLLVNLPENM 760
Query: 737 CKLKSLVKLCLDDCLNLERFPEILEEMEHLKRIYLERTAITELPSSFENLLGLEFLTVSG 796
L SL+ + + C ++ R P+ + +L YL TAI ELPSS +L L +L +SG
Sbjct: 761 YLLTSLLLVDISGCSSISRLPDFSRNIRYL---YLNGTAIEELPSSIGDLRKLIYLNLSG 817
Query: 797 CSKLDKLPDNIGNLKSLDFIAAVGSAISQLPSSVADSNVLRMLFFCRCRRLLSLP----- 851
CS + + P N+K L G+AI ++PSS+ L L C++ LP
Sbjct: 818 CSSITEFPKVSNNIKEL---YLDGTAIREIPSSIDCLFELVELHLRNCKQFEILPSSICT 874
Query: 852 -----RLLLSG-------------LSSLKFLYISDCAVTEIPQDIACLSSLTTLNLSG-- 891
RL LSG + L++LY+ + +T++P I L L L +
Sbjct: 875 LRKLERLNLSGCLQFRDFPEVLEPMVCLRYLYLEETRITKLPSPIGNLKGLACLEVGNCK 934
Query: 892 --NNFE-----SLPASIKQLSQLSSLYLKDCKMLQSLPELPLCLKYLDLRDCNTLRSLPE 944
N+ E L L L L L C + +P+ CL L++ D + +
Sbjct: 935 YLNDIECFVDLQLSERWVDLDYLRKLNLDGCH-ISVVPDSLGCLSSLEVLDLSG-NNFST 992
Query: 945 LPLC------LESLKARNCKGLQSLPEIPSCLQELDASVLEKLSKHSPDRSIKWRYKTST 998
+PL L+ L RNCK L+SLPE+P L +LDA E L+ S K +
Sbjct: 993 IPLSINKLSELQYLGLRNCKRLESLPELPPRLSKLDADNCESLNYLGSSSSTV--VKGNI 1050
Query: 999 IYFEFTNCLELNGKANNKILADSRLRIQHLAIASLRLGYEKTNEEKLSEVDGPI-IVLPG 1057
F FTNCL L N+IL A+ RL Y K + ++G LPG
Sbjct: 1051 FEFIFTNCLSLC--RINQILP--------YALKKFRL-YTKRLHQLTDVLEGACSFFLPG 1099
Query: 1058 SEIPDWFSNQSSGSSICIQLPPHSFCRNLIGFALCAVLDFKQLHCDCLSDFYVSCQLDLE 1117
P W S+QS GS++ QL H +GF+LCAV+ F V C
Sbjct: 1100 GVSPQWLSHQSWGSTVTCQLSSHWANSKFLGFSLCAVIAFHSFG----HSLQVKCTYHF- 1154
Query: 1118 IKTLSKTKHVDLGFYLP--YFKYSIDSDHVILGFKPC 1152
+ DL YL Y + IDS+H+++GF PC
Sbjct: 1155 --SNEHGDSHDLYCYLHGWYDEKRIDSEHILVGFDPC 1189
|
Source: Populus trichocarpa Species: Populus trichocarpa Genus: Populus Family: Salicaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|451798990|gb|AGF69193.1| TMV resistance protein N-like protein 7 [Vitis labrusca] | Back alignment and taxonomy information |
|---|
| >gi|255537139|ref|XP_002509636.1| leucine-rich repeat-containing protein, putative [Ricinus communis] gi|223549535|gb|EEF51023.1| leucine-rich repeat-containing protein, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|255563202|ref|XP_002522604.1| leucine-rich repeat containing protein, putative [Ricinus communis] gi|223538080|gb|EEF39691.1| leucine-rich repeat containing protein, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|359486075|ref|XP_002273047.2| PREDICTED: TMV resistance protein N-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|359493487|ref|XP_003634612.1| PREDICTED: TMV resistance protein N-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|359493483|ref|XP_003634610.1| PREDICTED: TMV resistance protein N-like, partial [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|296090597|emb|CBI40966.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|224145016|ref|XP_002325496.1| tir-nbs-lrr resistance protein [Populus trichocarpa] gi|222862371|gb|EEE99877.1| tir-nbs-lrr resistance protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|359493273|ref|XP_002272034.2| PREDICTED: TMV resistance protein N-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 1243 | ||||||
| TAIR|locus:2118106 | 1219 | AT4G12010 [Arabidopsis thalian | 0.728 | 0.743 | 0.357 | 1.4e-163 | |
| UNIPROTKB|Q40392 | 1144 | N "TMV resistance protein N" [ | 0.436 | 0.473 | 0.432 | 7e-149 | |
| TAIR|locus:2155189 | 980 | AT5G49140 [Arabidopsis thalian | 0.633 | 0.804 | 0.383 | 3e-144 | |
| TAIR|locus:2160487 | 1085 | AT5G41550 [Arabidopsis thalian | 0.536 | 0.614 | 0.390 | 1.9e-142 | |
| TAIR|locus:2175991 | 1294 | AT5G17680 [Arabidopsis thalian | 0.646 | 0.621 | 0.364 | 1.9e-140 | |
| TAIR|locus:2153072 | 1229 | AT5G51630 [Arabidopsis thalian | 0.633 | 0.641 | 0.371 | 7.2e-137 | |
| TAIR|locus:2053405 | 1215 | AT2G14080 [Arabidopsis thalian | 0.646 | 0.661 | 0.372 | 5e-136 | |
| TAIR|locus:2147992 | 1189 | AT5G11250 [Arabidopsis thalian | 0.643 | 0.672 | 0.360 | 1.7e-135 | |
| TAIR|locus:2039405 | 1109 | AT2G16870 [Arabidopsis thalian | 0.626 | 0.702 | 0.374 | 1.7e-135 | |
| TAIR|locus:2163426 | 1187 | TAO1 "target of AVRB operation | 0.649 | 0.679 | 0.365 | 4.8e-131 |
| TAIR|locus:2118106 AT4G12010 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 1374 (488.7 bits), Expect = 1.4e-163, Sum P(2) = 1.4e-163
Identities = 344/962 (35%), Positives = 529/962 (54%)
Query: 2 ASSSSCNYDVFLSFRGVDTRASFTCHLYDSLFERKKIRTFIDDEELRQGDAISPVLLNAI 61
+S SS +DVFLSFRG DTR +FT HL +L + I +FIDD LR+GD ++ L + I
Sbjct: 4 SSPSSAEFDVFLSFRGFDTRNNFTGHLQKAL-RLRGIDSFIDDR-LRRGDNLT-ALFDRI 60
Query: 62 QGSKISLIIFSKDYASSKWCLNELVKILECKNTNGQIVIPVFYNVSPSDVRHQTGIFGDG 121
+ SKI++I+FS +YA+S WCL ELVKILEC+N+N Q+V+P+FY V SDV Q F
Sbjct: 61 EKSKIAIIVFSTNYANSAWCLRELVKILECRNSNQQLVVPIFYKVDKSDVEKQRNSFAVP 120
Query: 122 FDKLEQQFKE-KPEIVQKWRYALRETSHLAGHESTKFR-HDAQLVNKIVEDILKKLEKIT 179
F E F PE + W+ AL S++ G+ + +A+LV++I D KKL +
Sbjct: 121 FKLPELTFPGVTPEEISSWKAALASASNILGYVVKEISTSEAKLVDEIAVDTFKKLNDLA 180
Query: 180 VSTDSSNGLVGLNSRIEQIKPFLCMDLSDTVQIVGIWGMGGIGKTTLATAIFNQFSSEFE 239
S + GLVG+ SR++ ++ L + DTV I+GI GM GIGKTTLA ++ + +F+
Sbjct: 181 PS--GNEGLVGIESRLKNLEKLLSWEDLDTVHIIGIVGMVGIGKTTLADCLYGRMRGQFD 238
Query: 240 GRCFMSDVRRNSETGGGLEHLQKQMLSTILSEK-LEVAGP-NIPQFTKERVRRMKVLIVL 297
G CF++++R NS G LE L +++ ST+L+++ LE+ P N + + R++ ++LIVL
Sbjct: 239 GSCFLTNIRENSGRSG-LESLLQKLFSTVLNDRDLEIGAPGNAHERFERRLKSKRLLIVL 297
Query: 298 DDVNKVGQLEGLIGGLDQYGPGSRIVVTTRDKGVLEKFGVEEEKIYGVNGLEFDEAFELF 357
DDVN Q+ L+G Y GSRI++TTRD ++E ++ K Y + L EA +LF
Sbjct: 298 DDVNDEKQIRYLMGHCKWYQGGSRIIITTRDSKLIET--IKGRK-YVLPKLNDREALKLF 354
Query: 358 CNFAFEENHCPEDLNWHSRRVVWYATSNPLVLKVLGSSLCLKRKSHWENVLDDLNRICES 417
AF + ++ + V+ YA +PL LKVLGS LC + +WE LD L +S
Sbjct: 355 SLNAFSNSFPLKEFEGLTNMVLDYAKGHPLALKVLGSDLCERDDLYWEAKLDRL----KS 410
Query: 418 EIH-DIYDILKISFNELIPREKSMFLDIACFFEGEDKDILMRILDDSESYALGV---LID 473
H DIY++L+ S+ EL +K++FLDIACFF E+ D + +L+ GV L+D
Sbjct: 411 RSHGDIYEVLETSYEELTTEQKNVFLDIACFFRSENVDYVTSLLNSHGVDVSGVVKDLVD 470
Query: 474 KSLITISHNCLQMHDLLQEMGRQI-VRQES--------QKEPGKRS----RLWDPKEIRR 520
K LIT+S N ++MHD+LQ M ++I ++ E+ G + RLWD ++I
Sbjct: 471 KCLITLSDNRIEMHDMLQTMAKEISLKVETIGIRDCRWLSRHGNQCQWHIRLWDSEDICD 530
Query: 521 VLKHNKGTDAIEGIFMDLSKIEGINLDSRAFTNMSNLRMLKFYVPKFLGMIIEEKLEDSK 580
+L GTD I GIF+D SK+ + L ++AF M NL+ LK Y E + K
Sbjct: 531 LLTEGLGTDKIRGIFLDTSKLRAMRLSAKAFQGMYNLKYLKIY-DSHCSRGCEAEF---K 586
Query: 581 VQLPDGIDYLPKNLRYLHWYKYPLRTLPSNFKPKNIVELSLRFSKVEQIWEGKKKAFKLK 640
+ L G+ +LP L YLHW+ YPL+++P +F PKN+V+L L S++E+IW+ +K LK
Sbjct: 587 LHLRRGLSFLPNELTYLHWHGYPLQSIPLDFDPKNLVDLKLPHSQLEEIWDDEKDVGMLK 646
Query: 641 SIDLSHSEHLIRIPDLSEIPNLERIYLSNCTNLVHVPASIQNFKYLKFPQISGKITRLYL 700
+DLSHS +L + L+ NLER+ L CT+L +P++I + K+ L L
Sbjct: 647 WVDLSHSINLRQCLGLANAHNLERLNLEGCTSLKKLPSTINCLE---------KLIYLNL 697
Query: 701 SQ-SAIEEVPSSIECLTDLVELDLRDCKRLKRISTRFCKLKSLVKLCLDDCLNLERFPEI 759
+++ +P I+ + L L L C LK+ F + V++ L D ++ PE
Sbjct: 698 RDCTSLRSLPKGIKTQS-LQTLILSGCSSLKK----FPLISENVEVLLLDGTVIKSLPES 752
Query: 760 LEEMEHLKRIYLERTA-ITELPSSFENLLGLEFLTVSGCSKLDKLPDNIGNLKSLDFIAA 818
++ L + L+ + L S L L+ L +SGCS+L+ P+ +++SL+ +
Sbjct: 753 IQTFRRLALLNLKNCKKLKHLSSDLYKLKCLQELILSGCSQLEVFPEIKEDMESLEILLM 812
Query: 819 VGSAISQLPSSVADSNVXXXXXXXXXXXXXXXXXXX--XXXXXXXXXXYISDCAVTEIPQ 876
++I+++P + SN+ Y+S C++ ++P
Sbjct: 813 DDTSITEMPKMMHLSNIKTFSLCGTSSHVSVSMFFMPPTLGCSRLTDLYLSRCSLYKLPD 872
Query: 877 DIACXXXXXXXXXXXXXFESLPASIKXXXXXXXXYLKDCKMLQSLPELPLCLKYLDLRDC 936
+I E+LP S LK CKML+SLP LP L+YLD +C
Sbjct: 873 NIGGLSSLQSLCLSGNNIENLPESFNQLNNLKWFDLKFCKMLKSLPVLPQNLQYLDAHEC 932
Query: 937 NT 938
+
Sbjct: 933 ES 934
|
|
| UNIPROTKB|Q40392 N "TMV resistance protein N" [Nicotiana glutinosa (taxid:35889)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2155189 AT5G49140 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2160487 AT5G41550 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2175991 AT5G17680 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2153072 AT5G51630 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2053405 AT2G14080 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2147992 AT5G11250 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2039405 AT2G16870 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2163426 TAO1 "target of AVRB operation1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| eugene3.01250003 | tir-nbs-lrr resistance protein (1470 aa) | |||||||
(Populus trichocarpa) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 1243 | |||
| PLN03210 | 1153 | PLN03210, PLN03210, Resistant to P | 1e-172 | |
| pfam00931 | 285 | pfam00931, NB-ARC, NB-ARC domain | 1e-42 | |
| pfam01582 | 135 | pfam01582, TIR, TIR domain | 5e-38 | |
| smart00255 | 140 | smart00255, TIR, Toll - interleukin 1 - resistance | 7e-35 | |
| PLN03194 | 187 | PLN03194, PLN03194, putative disease resistance pr | 7e-16 | |
| COG4886 | 394 | COG4886, COG4886, Leucine-rich repeat (LRR) protei | 2e-09 | |
| PLN00113 | 968 | PLN00113, PLN00113, leucine-rich repeat receptor-l | 4e-08 | |
| PRK15387 | 788 | PRK15387, PRK15387, E3 ubiquitin-protein ligase Ss | 8e-08 | |
| PLN00113 | 968 | PLN00113, PLN00113, leucine-rich repeat receptor-l | 2e-07 | |
| PRK15387 | 788 | PRK15387, PRK15387, E3 ubiquitin-protein ligase Ss | 8e-07 | |
| pfam13676 | 102 | pfam13676, TIR_2, TIR domain | 3e-06 | |
| pfam13855 | 60 | pfam13855, LRR_8, Leucine rich repeat | 4e-06 | |
| PLN00113 | 968 | PLN00113, PLN00113, leucine-rich repeat receptor-l | 6e-06 | |
| COG4886 | 394 | COG4886, COG4886, Leucine-rich repeat (LRR) protei | 1e-05 | |
| pfam13855 | 60 | pfam13855, LRR_8, Leucine rich repeat | 2e-05 | |
| PRK15370 | 754 | PRK15370, PRK15370, E3 ubiquitin-protein ligase Sl | 7e-05 | |
| PRK15386 | 426 | PRK15386, PRK15386, type III secretion protein Gog | 9e-05 | |
| PRK15387 | 788 | PRK15387, PRK15387, E3 ubiquitin-protein ligase Ss | 1e-04 | |
| COG3903 | 414 | COG3903, COG3903, Predicted ATPase [General functi | 2e-04 | |
| pfam12799 | 43 | pfam12799, LRR_4, Leucine Rich repeats (2 copies) | 4e-04 | |
| pfam13191 | 154 | pfam13191, AAA_16, AAA ATPase domain | 0.003 | |
| PLN03150 | 623 | PLN03150, PLN03150, hypothetical protein; Provisio | 0.003 | |
| pfam05729 | 165 | pfam05729, NACHT, NACHT domain | 0.004 |
| >gnl|CDD|215633 PLN03210, PLN03210, Resistant to P | Back alignment and domain information |
|---|
Score = 541 bits (1396), Expect = e-172
Identities = 383/1146 (33%), Positives = 591/1146 (51%), Gaps = 163/1146 (14%)
Query: 2 ASSSSCN--YDVFLSFRGVDTRASFTCHLYDSLFERKKIRTFIDDEELRQGDAISPVLLN 59
+SSSS N YDVF SF G D R +F H L +RK I F D E+ + ++ P L
Sbjct: 4 SSSSSRNWVYDVFPSFSGEDVRITFLSHFLKEL-DRKLIIAF-KDNEIERSQSLDPELKQ 61
Query: 60 AIQGSKISLIIFSKDYASSKWCLNELVKILECKNTNGQIVIPVFYNVSPSDVRHQTGIFG 119
AI+ S+I++++FSK+YASS WCLNEL++I+ CK GQ+VIPVFY + PS VR QTG FG
Sbjct: 62 AIRDSRIAVVVFSKNYASSSWCLNELLEIVRCKEELGQLVIPVFYGLDPSHVRKQTGDFG 121
Query: 120 DGFDKLEQQFKEKPEIVQKWRYALRETSHLAGHESTKFRHDAQLVNKIVEDILKKLEKIT 179
+ F+K Q E + +W+ AL + +++ G+ S + ++A+++ +I D+L KL +T
Sbjct: 122 EAFEKTCQNKTE--DEKIQWKQALTDVANILGYHSQNWPNEAKMIEEIANDVLGKL-NLT 178
Query: 180 VSTDSSNGLVGLNSRIEQIKPFLCMDLSDTVQIVGIWGMGGIGKTTLATAIFNQFSSEFE 239
S D + VG+ I ++ L ++ S+ V++VGIWG GIGKTT+A A+F++ S +F+
Sbjct: 179 PSNDFED-FVGIEDHIAKMSSLLHLE-SEEVRMVGIWGSSGIGKTTIARALFSRLSRQFQ 236
Query: 240 G-----RCFMSDVRRNSETGGGLE-----HLQKQMLSTILSEKLEVAGPNIPQF----TK 285
R F+S + + HLQ+ LS IL +K +I + +
Sbjct: 237 SSVFIDRAFISKSMEIYSSANPDDYNMKLHLQRAFLSEILDKK------DIKIYHLGAME 290
Query: 286 ERVRRMKVLIVLDDVNKVGQLEGLIGGLDQYGPGSRIVVTTRDKGVLEKFGVEEEKIYGV 345
ER++ KVLI +DD++ L+ L G +G GSRI+V T+DK L G++ IY V
Sbjct: 291 ERLKHRKVLIFIDDLDDQDVLDALAGQTQWFGSGSRIIVITKDKHFLRAHGIDH--IYEV 348
Query: 346 NGLEFDEAFELFCNFAFEENHCPEDLNWHSRRVVWYATSNPLVLKVLGSSLCLKRKSHWE 405
+ A E+FC AF++N P+ + V A + PL L VLGS L + K W
Sbjct: 349 CLPSNELALEMFCRSAFKKNSPPDGFMELASEVALRAGNLPLGLNVLGSYLRGRDKEDW- 407
Query: 406 NVLDDLNRICESEIHDIYDILKISFNELIPR-EKSMFLDIACFFEGEDKDILMRILDDSE 464
+D L R+ I L++S++ L + +K++F IAC F GE + + +L +S+
Sbjct: 408 --MDMLPRLRNGLDGKIEKTLRVSYDGLNNKKDKAIFRHIACLFNGEKVNDIKLLLANSD 465
Query: 465 ---SYALGVLIDKSLITISHNCLQMHDLLQEMGRQIVRQESQKEPGKRSRLWDPKEIRRV 521
+ L L+DKSLI + + ++MH LLQEMG++IVR +S EPG+R L D K+I V
Sbjct: 466 LDVNIGLKNLVDKSLIHVREDIVEMHSLLQEMGKEIVRAQSN-EPGEREFLVDAKDICDV 524
Query: 522 LKHNKGTDAIEGIFMDLSKIEGINLDSRAFTNMSNLRMLKFYVPKFLGMIIEEKLEDSKV 581
L+ N GT + GI +D+ +I+ +++ AF M NL LKFY K+ ++ ++ +
Sbjct: 525 LEDNTGTKKVLGITLDIDEIDELHIHENAFKGMRNLLFLKFYTKKW------DQKKEVRW 578
Query: 582 QLPDGIDYLPKNLRYLHWYKYPLRTLPSNFKPKNIVELSLRFSKVEQIWEGKKKAFKLKS 641
LP+G DYLP LR L W KYPLR +PSNF+P+N+V+L ++ SK+E++W+G L++
Sbjct: 579 HLPEGFDYLPPKLRLLRWDKYPLRCMPSNFRPENLVKLQMQGSKLEKLWDGVHSLTGLRN 638
Query: 642 IDLSHSEHLIRIPDLSEIPNLERIYLSNCTNLVHVPASIQNFKYLKFPQISGKITRLYLS 701
IDL S++L IPDLS NLE + LS+C++LV
Sbjct: 639 IDLRGSKNLKEIPDLSMATNLETLKLSDCSSLV--------------------------- 671
Query: 702 QSAIEEVPSSIECLTDLVELDLRDCKRLKRISTRFCKLKSLVKLCLDDCLNLERFPEILE 761
E+PSSI+ L L +LD+ C+ L+ + T LKSL +L L C L+ FP+I
Sbjct: 672 -----ELPSSIQYLNKLEDLDMSRCENLEILPTGI-NLKSLYRLNLSGCSRLKSFPDIST 725
Query: 762 EMEHLKRIYLERTAITELPSS--FENLLGLEFLTVSGCSKLDKLPDNIGNLKSLD----- 814
+ L L+ TAI E PS+ ENL L + K +KL + + L L
Sbjct: 726 NISWL---DLDETAIEEFPSNLRLENLDELILCEM----KSEKLWERVQPLTPLMTMLSP 778
Query: 815 -----FIAAVGSAISQLPSSVADSNVLRMLFFCRCRRLLSLPRLLLSGLSSLKFLYISDC 869
F++ + S + +LPSS+ + + L L C L +LP + L SL+ L +S C
Sbjct: 779 SLTRLFLSDIPSLV-ELPSSIQNLHKLEHLEIENCINLETLPTGI--NLESLESLDLSGC 835
Query: 870 AVTEIPQDIACLSSLTTLNLSGNNFESLPASIKQLSQLSSLYLKDCKMLQSLPELPLCLK 929
+ DI+ ++++ LNLS E +P I++ S LS L + C LQ + LK
Sbjct: 836 SRLRTFPDIS--TNISDLNLSRTGIEEVPWWIEKFSNLSFLDMNGCNNLQRVSLNISKLK 893
Query: 930 YLDLRDCNTLRSLPELPLCLESLKARNCKGLQSLPEIPSCLQELDASVLEKLSKHSPDRS 989
+L+ D + +L E S PS + A + + P
Sbjct: 894 HLETVDFSDCGALTEA----------------SWNGSPSEV----AMATDNIHSKLP--- 930
Query: 990 IKWRYKTSTIYFEFTNCLELNGKANNKILADSRLRIQHLAIASLRLGYEKTNEEKLSEVD 1049
ST+ F NC L+ +A +L +
Sbjct: 931 -------STVCINFINCFNLDQEA---LL--------------------------QQQSI 954
Query: 1050 GPIIVLPGSEIPDWFSNQSSGSS-ICIQLPPHSFCRNLIGFALCAVLDFKQLHCDCLS-D 1107
++L G E+P +F+++++G+S I L S C+ F CAV+D + +S D
Sbjct: 955 FKQLILSGEEVPSYFTHRTTGASLTNIPLLHISPCQPFFRFRACAVVDSESFFIISVSFD 1014
Query: 1108 FYVSCQ 1113
V C+
Sbjct: 1015 IQVCCR 1020
|
syringae 6; Provisional. Length = 1153 |
| >gnl|CDD|216202 pfam00931, NB-ARC, NB-ARC domain | Back alignment and domain information |
|---|
| >gnl|CDD|216585 pfam01582, TIR, TIR domain | Back alignment and domain information |
|---|
| >gnl|CDD|214587 smart00255, TIR, Toll - interleukin 1 - resistance | Back alignment and domain information |
|---|
| >gnl|CDD|215626 PLN03194, PLN03194, putative disease resistance protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|185285 PRK15387, PRK15387, E3 ubiquitin-protein ligase SspH2; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|185285 PRK15387, PRK15387, E3 ubiquitin-protein ligase SspH2; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|222311 pfam13676, TIR_2, TIR domain | Back alignment and domain information |
|---|
| >gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat | Back alignment and domain information |
|---|
| >gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat | Back alignment and domain information |
|---|
| >gnl|CDD|185268 PRK15370, PRK15370, E3 ubiquitin-protein ligase SlrP; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237954 PRK15386, PRK15386, type III secretion protein GogB; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|185285 PRK15387, PRK15387, E3 ubiquitin-protein ligase SspH2; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|226418 COG3903, COG3903, Predicted ATPase [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|205079 pfam12799, LRR_4, Leucine Rich repeats (2 copies) | Back alignment and domain information |
|---|
| >gnl|CDD|221970 pfam13191, AAA_16, AAA ATPase domain | Back alignment and domain information |
|---|
| >gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|218719 pfam05729, NACHT, NACHT domain | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 1243 | |||
| PLN03210 | 1153 | Resistant to P. syringae 6; Provisional | 100.0 | |
| KOG4658 | 889 | consensus Apoptotic ATPase [Signal transduction me | 100.0 | |
| PLN03194 | 187 | putative disease resistance protein; Provisional | 100.0 | |
| PLN00113 | 968 | leucine-rich repeat receptor-like protein kinase; | 100.0 | |
| PLN00113 | 968 | leucine-rich repeat receptor-like protein kinase; | 100.0 | |
| PF00931 | 287 | NB-ARC: NB-ARC domain; InterPro: IPR002182 This is | 100.0 | |
| KOG0444 | 1255 | consensus Cytoskeletal regulator Flightless-I (con | 99.96 | |
| KOG4194 | 873 | consensus Membrane glycoprotein LIG-1 [Signal tran | 99.95 | |
| KOG0444 | 1255 | consensus Cytoskeletal regulator Flightless-I (con | 99.95 | |
| KOG4194 | 873 | consensus Membrane glycoprotein LIG-1 [Signal tran | 99.95 | |
| KOG0472 | 565 | consensus Leucine-rich repeat protein [Function un | 99.94 | |
| KOG0472 | 565 | consensus Leucine-rich repeat protein [Function un | 99.93 | |
| KOG0618 | 1081 | consensus Serine/threonine phosphatase 2C containi | 99.91 | |
| PLN03210 | 1153 | Resistant to P. syringae 6; Provisional | 99.9 | |
| KOG0618 | 1081 | consensus Serine/threonine phosphatase 2C containi | 99.89 | |
| PF01582 | 141 | TIR: TIR domain; InterPro: IPR000157 In Drosophila | 99.81 | |
| PRK15387 | 788 | E3 ubiquitin-protein ligase SspH2; Provisional | 99.78 | |
| PRK15387 | 788 | E3 ubiquitin-protein ligase SspH2; Provisional | 99.77 | |
| smart00255 | 140 | TIR Toll - interleukin 1 - resistance. | 99.73 | |
| KOG4237 | 498 | consensus Extracellular matrix protein slit, conta | 99.71 | |
| PRK15370 | 754 | E3 ubiquitin-protein ligase SlrP; Provisional | 99.7 | |
| PRK15370 | 754 | E3 ubiquitin-protein ligase SlrP; Provisional | 99.69 | |
| KOG4237 | 498 | consensus Extracellular matrix protein slit, conta | 99.6 | |
| KOG0617 | 264 | consensus Ras suppressor protein (contains leucine | 99.54 | |
| KOG0617 | 264 | consensus Ras suppressor protein (contains leucine | 99.5 | |
| cd00116 | 319 | LRR_RI Leucine-rich repeats (LRRs), ribonuclease i | 99.48 | |
| cd00116 | 319 | LRR_RI Leucine-rich repeats (LRRs), ribonuclease i | 99.41 | |
| PF13676 | 102 | TIR_2: TIR domain; PDB: 3H16_B 3UB4_A 2Y92_A 3UB3_ | 99.32 | |
| PRK04841 | 903 | transcriptional regulator MalT; Provisional | 99.22 | |
| KOG4658 | 889 | consensus Apoptotic ATPase [Signal transduction me | 99.11 | |
| KOG0532 | 722 | consensus Leucine-rich repeat (LRR) protein, conta | 98.99 | |
| PRK00411 | 394 | cdc6 cell division control protein 6; Reviewed | 98.98 | |
| KOG3207 | 505 | consensus Beta-tubulin folding cofactor E [Posttra | 98.95 | |
| KOG0532 | 722 | consensus Leucine-rich repeat (LRR) protein, conta | 98.93 | |
| PF05729 | 166 | NACHT: NACHT domain | 98.92 | |
| COG4886 | 394 | Leucine-rich repeat (LRR) protein [Function unknow | 98.91 | |
| TIGR00635 | 305 | ruvB Holliday junction DNA helicase, RuvB subunit. | 98.91 | |
| PF01637 | 234 | Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 | 98.91 | |
| TIGR03015 | 269 | pepcterm_ATPase putative secretion ATPase, PEP-CTE | 98.88 | |
| KOG1259 | 490 | consensus Nischarin, modulator of integrin alpha5 | 98.86 | |
| TIGR02928 | 365 | orc1/cdc6 family replication initiation protein. M | 98.86 | |
| COG4886 | 394 | Leucine-rich repeat (LRR) protein [Function unknow | 98.86 | |
| PRK00080 | 328 | ruvB Holliday junction DNA helicase RuvB; Reviewed | 98.85 | |
| KOG3207 | 505 | consensus Beta-tubulin folding cofactor E [Posttra | 98.81 | |
| KOG1259 | 490 | consensus Nischarin, modulator of integrin alpha5 | 98.79 | |
| COG3899 | 849 | Predicted ATPase [General function prediction only | 98.77 | |
| PF14580 | 175 | LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ | 98.71 | |
| COG2909 | 894 | MalT ATP-dependent transcriptional regulator [Tran | 98.68 | |
| PF14580 | 175 | LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ | 98.68 | |
| KOG1909 | 382 | consensus Ran GTPase-activating protein [RNA proce | 98.66 | |
| COG2256 | 436 | MGS1 ATPase related to the helicase subunit of the | 98.64 | |
| KOG1909 | 382 | consensus Ran GTPase-activating protein [RNA proce | 98.64 | |
| PRK06893 | 229 | DNA replication initiation factor; Validated | 98.6 | |
| PRK13342 | 413 | recombination factor protein RarA; Reviewed | 98.51 | |
| PRK15386 | 426 | type III secretion protein GogB; Provisional | 98.5 | |
| PRK15386 | 426 | type III secretion protein GogB; Provisional | 98.45 | |
| PTZ00112 | 1164 | origin recognition complex 1 protein; Provisional | 98.38 | |
| PLN03150 | 623 | hypothetical protein; Provisional | 98.3 | |
| TIGR03420 | 226 | DnaA_homol_Hda DnaA regulatory inactivator Hda. Me | 98.3 | |
| PF13173 | 128 | AAA_14: AAA domain | 98.29 | |
| COG3903 | 414 | Predicted ATPase [General function prediction only | 98.28 | |
| KOG0531 | 414 | consensus Protein phosphatase 1, regulatory subuni | 98.27 | |
| PLN03150 | 623 | hypothetical protein; Provisional | 98.26 | |
| KOG3678 | 832 | consensus SARM protein (with sterile alpha and arm | 98.24 | |
| KOG0531 | 414 | consensus Protein phosphatase 1, regulatory subuni | 98.23 | |
| TIGR01242 | 364 | 26Sp45 26S proteasome subunit P45 family. Many pro | 98.19 | |
| KOG2120 | 419 | consensus SCF ubiquitin ligase, Skp2 component [Po | 98.19 | |
| KOG4341 | 483 | consensus F-box protein containing LRR [General fu | 98.18 | |
| PRK12402 | 337 | replication factor C small subunit 2; Reviewed | 98.18 | |
| PF13855 | 61 | LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF | 98.17 | |
| PRK14949 | 944 | DNA polymerase III subunits gamma and tau; Provisi | 98.14 | |
| cd00009 | 151 | AAA The AAA+ (ATPases Associated with a wide varie | 98.14 | |
| PRK14963 | 504 | DNA polymerase III subunits gamma and tau; Provisi | 98.13 | |
| PRK14961 | 363 | DNA polymerase III subunits gamma and tau; Provisi | 98.13 | |
| KOG2120 | 419 | consensus SCF ubiquitin ligase, Skp2 component [Po | 98.12 | |
| PRK07003 | 830 | DNA polymerase III subunits gamma and tau; Validat | 98.12 | |
| PTZ00202 | 550 | tuzin; Provisional | 98.12 | |
| PRK14960 | 702 | DNA polymerase III subunits gamma and tau; Provisi | 98.11 | |
| PRK05564 | 313 | DNA polymerase III subunit delta'; Validated | 98.1 | |
| PF13191 | 185 | AAA_16: AAA ATPase domain; PDB: 2V1U_A. | 98.09 | |
| PLN03025 | 319 | replication factor C subunit; Provisional | 98.08 | |
| PF13401 | 131 | AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S | 98.08 | |
| PRK08727 | 233 | hypothetical protein; Validated | 98.07 | |
| TIGR02903 | 615 | spore_lon_C ATP-dependent protease, Lon family. Me | 98.07 | |
| PRK13341 | 725 | recombination factor protein RarA/unknown domain f | 98.07 | |
| PRK07471 | 365 | DNA polymerase III subunit delta'; Validated | 98.06 | |
| PRK12323 | 700 | DNA polymerase III subunits gamma and tau; Provisi | 98.04 | |
| PRK14957 | 546 | DNA polymerase III subunits gamma and tau; Provisi | 98.04 | |
| PRK04195 | 482 | replication factor C large subunit; Provisional | 98.0 | |
| PRK14962 | 472 | DNA polymerase III subunits gamma and tau; Provisi | 97.99 | |
| KOG2028 | 554 | consensus ATPase related to the helicase subunit o | 97.99 | |
| PRK00440 | 319 | rfc replication factor C small subunit; Reviewed | 97.98 | |
| PRK08691 | 709 | DNA polymerase III subunits gamma and tau; Validat | 97.98 | |
| PRK14087 | 450 | dnaA chromosomal replication initiation protein; P | 97.97 | |
| PRK09087 | 226 | hypothetical protein; Validated | 97.96 | |
| PRK07940 | 394 | DNA polymerase III subunit delta'; Validated | 97.96 | |
| PF13855 | 61 | LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF | 97.95 | |
| TIGR00678 | 188 | holB DNA polymerase III, delta' subunit. At positi | 97.95 | |
| KOG1859 | 1096 | consensus Leucine-rich repeat proteins [General fu | 97.94 | |
| PRK08084 | 235 | DNA replication initiation factor; Provisional | 97.94 | |
| PRK06645 | 507 | DNA polymerase III subunits gamma and tau; Validat | 97.93 | |
| PF05496 | 233 | RuvB_N: Holliday junction DNA helicase ruvB N-term | 97.93 | |
| KOG4341 | 483 | consensus F-box protein containing LRR [General fu | 97.92 | |
| PRK14956 | 484 | DNA polymerase III subunits gamma and tau; Provisi | 97.92 | |
| TIGR02397 | 355 | dnaX_nterm DNA polymerase III, subunit gamma and t | 97.9 | |
| KOG2982 | 418 | consensus Uncharacterized conserved protein [Funct | 97.89 | |
| PRK07994 | 647 | DNA polymerase III subunits gamma and tau; Validat | 97.89 | |
| PRK03992 | 389 | proteasome-activating nucleotidase; Provisional | 97.88 | |
| COG1474 | 366 | CDC6 Cdc6-related protein, AAA superfamily ATPase | 97.87 | |
| PF00308 | 219 | Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013 | 97.87 | |
| PRK09112 | 351 | DNA polymerase III subunit delta'; Validated | 97.87 | |
| KOG1859 | 1096 | consensus Leucine-rich repeat proteins [General fu | 97.87 | |
| PRK08903 | 227 | DnaA regulatory inactivator Hda; Validated | 97.86 | |
| KOG2982 | 418 | consensus Uncharacterized conserved protein [Funct | 97.83 | |
| PRK14964 | 491 | DNA polymerase III subunits gamma and tau; Provisi | 97.83 | |
| PRK14955 | 397 | DNA polymerase III subunits gamma and tau; Provisi | 97.83 | |
| PRK05642 | 234 | DNA replication initiation factor; Validated | 97.82 | |
| PRK14951 | 618 | DNA polymerase III subunits gamma and tau; Provisi | 97.82 | |
| PRK14970 | 367 | DNA polymerase III subunits gamma and tau; Provisi | 97.82 | |
| PRK09376 | 416 | rho transcription termination factor Rho; Provisio | 97.81 | |
| PRK14958 | 509 | DNA polymerase III subunits gamma and tau; Provisi | 97.78 | |
| PRK14969 | 527 | DNA polymerase III subunits gamma and tau; Provisi | 97.77 | |
| PHA02544 | 316 | 44 clamp loader, small subunit; Provisional | 97.75 | |
| PF14516 | 331 | AAA_35: AAA-like domain | 97.75 | |
| TIGR02639 | 731 | ClpA ATP-dependent Clp protease ATP-binding subuni | 97.74 | |
| PRK05896 | 605 | DNA polymerase III subunits gamma and tau; Validat | 97.74 | |
| PF12799 | 44 | LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ | 97.7 | |
| PRK06305 | 451 | DNA polymerase III subunits gamma and tau; Validat | 97.69 | |
| PRK14959 | 624 | DNA polymerase III subunits gamma and tau; Provisi | 97.68 | |
| PRK00149 | 450 | dnaA chromosomal replication initiation protein; R | 97.67 | |
| TIGR00362 | 405 | DnaA chromosomal replication initiator protein Dna | 97.67 | |
| PRK07764 | 824 | DNA polymerase III subunits gamma and tau; Validat | 97.66 | |
| PRK14954 | 620 | DNA polymerase III subunits gamma and tau; Provisi | 97.66 | |
| PTZ00361 | 438 | 26 proteosome regulatory subunit 4-like protein; P | 97.66 | |
| KOG2543 | 438 | consensus Origin recognition complex, subunit 5 [R | 97.65 | |
| PRK07133 | 725 | DNA polymerase III subunits gamma and tau; Validat | 97.62 | |
| cd01128 | 249 | rho_factor Transcription termination factor rho is | 97.6 | |
| PRK09111 | 598 | DNA polymerase III subunits gamma and tau; Validat | 97.59 | |
| TIGR02881 | 261 | spore_V_K stage V sporulation protein K. Members o | 97.58 | |
| TIGR03689 | 512 | pup_AAA proteasome ATPase. In the Actinobacteria, | 97.58 | |
| PRK14952 | 584 | DNA polymerase III subunits gamma and tau; Provisi | 97.58 | |
| PRK14950 | 585 | DNA polymerase III subunits gamma and tau; Provisi | 97.56 | |
| PRK14088 | 440 | dnaA chromosomal replication initiation protein; P | 97.53 | |
| PTZ00454 | 398 | 26S protease regulatory subunit 6B-like protein; P | 97.53 | |
| TIGR03345 | 852 | VI_ClpV1 type VI secretion ATPase, ClpV1 family. M | 97.52 | |
| KOG2227 | 529 | consensus Pre-initiation complex, subunit CDC6, AA | 97.51 | |
| PRK14953 | 486 | DNA polymerase III subunits gamma and tau; Provisi | 97.51 | |
| PRK08451 | 535 | DNA polymerase III subunits gamma and tau; Validat | 97.49 | |
| CHL00095 | 821 | clpC Clp protease ATP binding subunit | 97.48 | |
| PRK12422 | 445 | chromosomal replication initiation protein; Provis | 97.46 | |
| KOG3665 | 699 | consensus ZYG-1-like serine/threonine protein kina | 97.45 | |
| TIGR00767 | 415 | rho transcription termination factor Rho. Members | 97.4 | |
| PRK10865 | 857 | protein disaggregation chaperone; Provisional | 97.39 | |
| PRK06620 | 214 | hypothetical protein; Validated | 97.39 | |
| PRK06647 | 563 | DNA polymerase III subunits gamma and tau; Validat | 97.38 | |
| TIGR02880 | 284 | cbbX_cfxQ probable Rubsico expression protein CbbX | 97.36 | |
| COG5238 | 388 | RNA1 Ran GTPase-activating protein (RanGAP) involv | 97.35 | |
| KOG4579 | 177 | consensus Leucine-rich repeat (LRR) protein associ | 97.34 | |
| PRK14948 | 620 | DNA polymerase III subunits gamma and tau; Provisi | 97.34 | |
| CHL00181 | 287 | cbbX CbbX; Provisional | 97.33 | |
| PRK11034 | 758 | clpA ATP-dependent Clp protease ATP-binding subuni | 97.32 | |
| KOG0989 | 346 | consensus Replication factor C, subunit RFC4 [Repl | 97.3 | |
| TIGR03346 | 852 | chaperone_ClpB ATP-dependent chaperone ClpB. Membe | 97.3 | |
| PRK14971 | 614 | DNA polymerase III subunits gamma and tau; Provisi | 97.3 | |
| CHL00195 | 489 | ycf46 Ycf46; Provisional | 97.28 | |
| PRK14086 | 617 | dnaA chromosomal replication initiation protein; P | 97.26 | |
| PRK07952 | 244 | DNA replication protein DnaC; Validated | 97.26 | |
| PF12799 | 44 | LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ | 97.26 | |
| KOG1644 | 233 | consensus U2-associated snRNP A' protein [RNA proc | 97.25 | |
| PRK05707 | 328 | DNA polymerase III subunit delta'; Validated | 97.23 | |
| PF00004 | 132 | AAA: ATPase family associated with various cellula | 97.22 | |
| PRK08116 | 268 | hypothetical protein; Validated | 97.21 | |
| COG0593 | 408 | DnaA ATPase involved in DNA replication initiation | 97.17 | |
| CHL00176 | 638 | ftsH cell division protein; Validated | 97.16 | |
| PRK14965 | 576 | DNA polymerase III subunits gamma and tau; Provisi | 97.14 | |
| PRK05563 | 559 | DNA polymerase III subunits gamma and tau; Validat | 97.14 | |
| PF08937 | 130 | DUF1863: MTH538 TIR-like domain (DUF1863); InterPr | 97.14 | |
| COG1373 | 398 | Predicted ATPase (AAA+ superfamily) [General funct | 97.1 | |
| PRK10536 | 262 | hypothetical protein; Provisional | 97.09 | |
| PRK12377 | 248 | putative replication protein; Provisional | 97.06 | |
| KOG3665 | 699 | consensus ZYG-1-like serine/threonine protein kina | 97.03 | |
| COG1222 | 406 | RPT1 ATP-dependent 26S proteasome regulatory subun | 97.03 | |
| TIGR00602 | 637 | rad24 checkpoint protein rad24. This family is bas | 97.0 | |
| KOG0991 | 333 | consensus Replication factor C, subunit RFC2 [Repl | 97.0 | |
| COG5238 | 388 | RNA1 Ran GTPase-activating protein (RanGAP) involv | 97.0 | |
| PF05673 | 249 | DUF815: Protein of unknown function (DUF815); Inte | 96.98 | |
| TIGR01241 | 495 | FtsH_fam ATP-dependent metalloprotease FtsH. HflB( | 96.97 | |
| PRK07399 | 314 | DNA polymerase III subunit delta'; Validated | 96.97 | |
| KOG4579 | 177 | consensus Leucine-rich repeat (LRR) protein associ | 96.95 | |
| cd01133 | 274 | F1-ATPase_beta F1 ATP synthase beta subunit, nucle | 96.92 | |
| smart00382 | 148 | AAA ATPases associated with a variety of cellular | 96.91 | |
| PRK09183 | 259 | transposase/IS protein; Provisional | 96.91 | |
| PRK06526 | 254 | transposase; Provisional | 96.9 | |
| KOG1644 | 233 | consensus U2-associated snRNP A' protein [RNA proc | 96.85 | |
| PRK08181 | 269 | transposase; Validated | 96.84 | |
| TIGR01243 | 733 | CDC48 AAA family ATPase, CDC48 subfamily. This sub | 96.83 | |
| PRK10865 | 857 | protein disaggregation chaperone; Provisional | 96.77 | |
| PF05621 | 302 | TniB: Bacterial TniB protein; InterPro: IPR008868 | 96.74 | |
| PLN00020 | 413 | ribulose bisphosphate carboxylase/oxygenase activa | 96.72 | |
| PF01695 | 178 | IstB_IS21: IstB-like ATP binding protein; InterPro | 96.72 | |
| PRK11331 | 459 | 5-methylcytosine-specific restriction enzyme subun | 96.7 | |
| PRK08058 | 329 | DNA polymerase III subunit delta'; Validated | 96.7 | |
| TIGR02639 | 731 | ClpA ATP-dependent Clp protease ATP-binding subuni | 96.69 | |
| PRK00771 | 437 | signal recognition particle protein Srp54; Provisi | 96.68 | |
| COG2255 | 332 | RuvB Holliday junction resolvasome, helicase subun | 96.65 | |
| PRK06871 | 325 | DNA polymerase III subunit delta'; Validated | 96.64 | |
| PRK07261 | 171 | topology modulation protein; Provisional | 96.64 | |
| TIGR01243 | 733 | CDC48 AAA family ATPase, CDC48 subfamily. This sub | 96.6 | |
| PRK08118 | 167 | topology modulation protein; Reviewed | 96.59 | |
| TIGR03346 | 852 | chaperone_ClpB ATP-dependent chaperone ClpB. Membe | 96.58 | |
| TIGR00763 | 775 | lon ATP-dependent protease La. This protein is ind | 96.57 | |
| KOG0735 | 952 | consensus AAA+-type ATPase [Posttranslational modi | 96.56 | |
| PRK08769 | 319 | DNA polymerase III subunit delta'; Validated | 96.52 | |
| KOG1947 | 482 | consensus Leucine rich repeat proteins, some prote | 96.52 | |
| PRK06921 | 266 | hypothetical protein; Provisional | 96.49 | |
| KOG2739 | 260 | consensus Leucine-rich acidic nuclear protein [Cel | 96.47 | |
| COG3267 | 269 | ExeA Type II secretory pathway, component ExeA (pr | 96.46 | |
| TIGR02640 | 262 | gas_vesic_GvpN gas vesicle protein GvpN. Members o | 96.46 | |
| COG0466 | 782 | Lon ATP-dependent Lon protease, bacterial type [Po | 96.43 | |
| KOG0741 | 744 | consensus AAA+-type ATPase [Posttranslational modi | 96.42 | |
| TIGR03345 | 852 | VI_ClpV1 type VI secretion ATPase, ClpV1 family. M | 96.41 | |
| PF04665 | 241 | Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 | 96.4 | |
| cd01131 | 198 | PilT Pilus retraction ATPase PilT. PilT is a nucle | 96.37 | |
| PRK10867 | 433 | signal recognition particle protein; Provisional | 96.34 | |
| COG1484 | 254 | DnaC DNA replication protein [DNA replication, rec | 96.34 | |
| PRK10787 | 784 | DNA-binding ATP-dependent protease La; Provisional | 96.32 | |
| TIGR00959 | 428 | ffh signal recognition particle protein. This mode | 96.3 | |
| PRK06090 | 319 | DNA polymerase III subunit delta'; Validated | 96.29 | |
| COG0542 | 786 | clpA ATP-binding subunits of Clp protease and DnaK | 96.29 | |
| PRK07993 | 334 | DNA polymerase III subunit delta'; Validated | 96.28 | |
| PF13207 | 121 | AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6 | 96.27 | |
| PRK06835 | 329 | DNA replication protein DnaC; Validated | 96.25 | |
| PF02562 | 205 | PhoH: PhoH-like protein; InterPro: IPR003714 PhoH | 96.24 | |
| PF07728 | 139 | AAA_5: AAA domain (dynein-related subfamily); Inte | 96.23 | |
| PRK14974 | 336 | cell division protein FtsY; Provisional | 96.21 | |
| KOG0733 | 802 | consensus Nuclear AAA ATPase (VCP subfamily) [Post | 96.17 | |
| COG1618 | 179 | Predicted nucleotide kinase [Nucleotide transport | 96.16 | |
| KOG0744 | 423 | consensus AAA+-type ATPase [Posttranslational modi | 96.15 | |
| TIGR01425 | 429 | SRP54_euk signal recognition particle protein SRP5 | 96.15 | |
| PRK12608 | 380 | transcription termination factor Rho; Provisional | 96.13 | |
| TIGR02902 | 531 | spore_lonB ATP-dependent protease LonB. Members of | 96.11 | |
| PRK06696 | 223 | uridine kinase; Validated | 96.1 | |
| KOG0730 | 693 | consensus AAA+-type ATPase [Posttranslational modi | 96.1 | |
| CHL00095 | 821 | clpC Clp protease ATP binding subunit | 96.05 | |
| PRK11889 | 436 | flhF flagellar biosynthesis regulator FlhF; Provis | 96.04 | |
| KOG2739 | 260 | consensus Leucine-rich acidic nuclear protein [Cel | 95.96 | |
| KOG2228 | 408 | consensus Origin recognition complex, subunit 4 [R | 95.94 | |
| PRK11034 | 758 | clpA ATP-dependent Clp protease ATP-binding subuni | 95.94 | |
| smart00763 | 361 | AAA_PrkA PrkA AAA domain. This is a family of PrkA | 95.91 | |
| PF13177 | 162 | DNA_pol3_delta2: DNA polymerase III, delta subunit | 95.79 | |
| PRK08939 | 306 | primosomal protein DnaI; Reviewed | 95.76 | |
| PRK06964 | 342 | DNA polymerase III subunit delta'; Validated | 95.7 | |
| TIGR00064 | 272 | ftsY signal recognition particle-docking protein F | 95.66 | |
| PRK10733 | 644 | hflB ATP-dependent metalloprotease; Reviewed | 95.66 | |
| cd01120 | 165 | RecA-like_NTPases RecA-like NTPases. This family i | 95.65 | |
| PRK07667 | 193 | uridine kinase; Provisional | 95.6 | |
| PRK04132 | 846 | replication factor C small subunit; Provisional | 95.59 | |
| KOG1947 | 482 | consensus Leucine rich repeat proteins, some prote | 95.55 | |
| COG0542 | 786 | clpA ATP-binding subunits of Clp protease and DnaK | 95.54 | |
| KOG2123 | 388 | consensus Uncharacterized conserved protein [Funct | 95.52 | |
| COG2812 | 515 | DnaX DNA polymerase III, gamma/tau subunits [DNA r | 95.43 | |
| COG1223 | 368 | Predicted ATPase (AAA+ superfamily) [General funct | 95.4 | |
| PF10443 | 431 | RNA12: RNA12 protein; InterPro: IPR018850 Mitochon | 95.32 | |
| PRK05541 | 176 | adenylylsulfate kinase; Provisional | 95.31 | |
| PF13604 | 196 | AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL | 95.3 | |
| PRK04296 | 190 | thymidine kinase; Provisional | 95.29 | |
| PF08357 | 150 | SEFIR: SEFIR domain; InterPro: IPR013568 This doma | 95.24 | |
| KOG0729 | 435 | consensus 26S proteasome regulatory complex, ATPas | 95.2 | |
| PRK14722 | 374 | flhF flagellar biosynthesis regulator FlhF; Provis | 95.19 | |
| KOG2004 | 906 | consensus Mitochondrial ATP-dependent protease PIM | 95.16 | |
| PF13238 | 129 | AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB | 95.14 | |
| COG0470 | 325 | HolB ATPase involved in DNA replication [DNA repli | 95.12 | |
| PF01583 | 156 | APS_kinase: Adenylylsulphate kinase; InterPro: IPR | 95.1 | |
| KOG1514 | 767 | consensus Origin recognition complex, subunit 1, a | 95.09 | |
| PF00448 | 196 | SRP54: SRP54-type protein, GTPase domain; InterPro | 95.08 | |
| PRK08699 | 325 | DNA polymerase III subunit delta'; Validated | 95.07 | |
| PRK09361 | 225 | radB DNA repair and recombination protein RadB; Pr | 95.06 | |
| PF00485 | 194 | PRK: Phosphoribulokinase / Uridine kinase family; | 95.06 | |
| TIGR01420 | 343 | pilT_fam pilus retraction protein PilT. This model | 95.05 | |
| cd01121 | 372 | Sms Sms (bacterial radA) DNA repair protein. This | 95.05 | |
| cd01858 | 157 | NGP_1 NGP-1. Autoantigen NGP-1 (Nucleolar G-protei | 95.02 | |
| cd00561 | 159 | CobA_CobO_BtuR ATP:corrinoid adenosyltransferase B | 95.01 | |
| KOG0738 | 491 | consensus AAA+-type ATPase [Posttranslational modi | 95.0 | |
| PRK05703 | 424 | flhF flagellar biosynthesis regulator FlhF; Valida | 95.0 | |
| PRK12724 | 432 | flagellar biosynthesis regulator FlhF; Provisional | 94.97 | |
| COG0572 | 218 | Udk Uridine kinase [Nucleotide transport and metab | 94.95 | |
| PRK15429 | 686 | formate hydrogenlyase transcriptional activator Fh | 94.9 | |
| cd01394 | 218 | radB RadB. The archaeal protein radB shares simila | 94.89 | |
| KOG0652 | 424 | consensus 26S proteasome regulatory complex, ATPas | 94.89 | |
| PRK10416 | 318 | signal recognition particle-docking protein FtsY; | 94.87 | |
| COG1875 | 436 | NYN ribonuclease and ATPase of PhoH family domains | 94.86 | |
| TIGR01817 | 534 | nifA Nif-specific regulatory protein. This model r | 94.85 | |
| TIGR02237 | 209 | recomb_radB DNA repair and recombination protein R | 94.74 | |
| PRK12727 | 559 | flagellar biosynthesis regulator FlhF; Provisional | 94.72 | |
| PF07726 | 131 | AAA_3: ATPase family associated with various cellu | 94.69 | |
| PRK11608 | 326 | pspF phage shock protein operon transcriptional ac | 94.69 | |
| PTZ00301 | 210 | uridine kinase; Provisional | 94.68 | |
| PF13306 | 129 | LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ | 94.67 | |
| KOG2123 | 388 | consensus Uncharacterized conserved protein [Funct | 94.66 | |
| PF03215 | 519 | Rad17: Rad17 cell cycle checkpoint protein | 94.66 | |
| cd03221 | 144 | ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is | 94.65 | |
| KOG0731 | 774 | consensus AAA+-type ATPase containing the peptidas | 94.59 | |
| COG4608 | 268 | AppF ABC-type oligopeptide transport system, ATPas | 94.53 | |
| COG0464 | 494 | SpoVK ATPases of the AAA+ class [Posttranslational | 94.49 | |
| PRK06067 | 234 | flagellar accessory protein FlaH; Validated | 94.45 | |
| KOG0733 | 802 | consensus Nuclear AAA ATPase (VCP subfamily) [Post | 94.45 | |
| PRK15455 | 644 | PrkA family serine protein kinase; Provisional | 94.44 | |
| PRK05480 | 209 | uridine/cytidine kinase; Provisional | 94.44 | |
| cd03223 | 166 | ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cass | 94.44 | |
| COG2607 | 287 | Predicted ATPase (AAA+ superfamily) [General funct | 94.4 | |
| COG2884 | 223 | FtsE Predicted ATPase involved in cell division [C | 94.4 | |
| PRK04040 | 188 | adenylate kinase; Provisional | 94.39 | |
| PF14532 | 138 | Sigma54_activ_2: Sigma-54 interaction domain; PDB: | 94.39 | |
| PRK03839 | 180 | putative kinase; Provisional | 94.38 | |
| cd02019 | 69 | NK Nucleoside/nucleotide kinase (NK) is a protein | 94.38 | |
| PRK08233 | 182 | hypothetical protein; Provisional | 94.38 | |
| cd01129 | 264 | PulE-GspE PulE/GspE The type II secretory pathway | 94.35 | |
| KOG1969 | 877 | consensus DNA replication checkpoint protein CHL12 | 94.34 | |
| cd03222 | 177 | ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibi | 94.26 | |
| TIGR02974 | 329 | phageshock_pspF psp operon transcriptional activat | 94.25 | |
| PRK05022 | 509 | anaerobic nitric oxide reductase transcription reg | 94.25 | |
| PRK06762 | 166 | hypothetical protein; Provisional | 94.25 | |
| PRK00625 | 173 | shikimate kinase; Provisional | 94.23 | |
| TIGR00235 | 207 | udk uridine kinase. Model contains a number of lon | 94.2 | |
| cd01393 | 226 | recA_like RecA is a bacterial enzyme which has rol | 94.17 | |
| PRK12723 | 388 | flagellar biosynthesis regulator FlhF; Provisional | 94.13 | |
| cd00983 | 325 | recA RecA is a bacterial enzyme which has roles in | 94.11 | |
| KOG0728 | 404 | consensus 26S proteasome regulatory complex, ATPas | 94.1 | |
| cd03214 | 180 | ABC_Iron-Siderophores_B12_Hemin ABC transporters, | 94.07 | |
| PF08433 | 270 | KTI12: Chromatin associated protein KTI12 ; InterP | 94.04 | |
| PRK12726 | 407 | flagellar biosynthesis regulator FlhF; Provisional | 93.97 | |
| PRK06547 | 172 | hypothetical protein; Provisional | 93.92 | |
| KOG0651 | 388 | consensus 26S proteasome regulatory complex, ATPas | 93.92 | |
| PRK13531 | 498 | regulatory ATPase RavA; Provisional | 93.91 | |
| KOG0743 | 457 | consensus AAA+-type ATPase [Posttranslational modi | 93.91 | |
| PF13671 | 143 | AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1 | 93.91 | |
| PF00910 | 107 | RNA_helicase: RNA helicase; InterPro: IPR000605 He | 93.9 | |
| PTZ00088 | 229 | adenylate kinase 1; Provisional | 93.89 | |
| cd01135 | 276 | V_A-ATPase_B V/A-type ATP synthase (non-catalytic) | 93.88 | |
| cd03238 | 176 | ABC_UvrA The excision repair protein UvrA; Nucleot | 93.82 | |
| TIGR00416 | 454 | sms DNA repair protein RadA. The gene protuct code | 93.79 | |
| TIGR01360 | 188 | aden_kin_iso1 adenylate kinase, isozyme 1 subfamil | 93.75 | |
| PRK12597 | 461 | F0F1 ATP synthase subunit beta; Provisional | 93.73 | |
| PHA00729 | 226 | NTP-binding motif containing protein | 93.7 | |
| PRK06995 | 484 | flhF flagellar biosynthesis regulator FlhF; Valida | 93.66 | |
| PRK00131 | 175 | aroK shikimate kinase; Reviewed | 93.66 | |
| cd03115 | 173 | SRP The signal recognition particle (SRP) mediates | 93.65 | |
| PRK06217 | 183 | hypothetical protein; Validated | 93.65 | |
| PRK09280 | 463 | F0F1 ATP synthase subunit beta; Validated | 93.64 | |
| TIGR03499 | 282 | FlhF flagellar biosynthetic protein FlhF. | 93.63 | |
| KOG2035 | 351 | consensus Replication factor C, subunit RFC3 [Cell | 93.63 | |
| cd00544 | 169 | CobU Adenosylcobinamide kinase / adenosylcobinamid | 93.6 | |
| COG1121 | 254 | ZnuC ABC-type Mn/Zn transport systems, ATPase comp | 93.6 | |
| PRK14723 | 767 | flhF flagellar biosynthesis regulator FlhF; Provis | 93.6 | |
| COG1428 | 216 | Deoxynucleoside kinases [Nucleotide transport and | 93.56 | |
| PRK09354 | 349 | recA recombinase A; Provisional | 93.56 | |
| KOG1051 | 898 | consensus Chaperone HSP104 and related ATP-depende | 93.53 | |
| PRK13947 | 171 | shikimate kinase; Provisional | 93.5 | |
| TIGR02012 | 321 | tigrfam_recA protein RecA. This model describes or | 93.47 | |
| PF13306 | 129 | LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ | 93.47 | |
| cd02028 | 179 | UMPK_like Uridine monophosphate kinase_like (UMPK_ | 93.46 | |
| PRK08356 | 195 | hypothetical protein; Provisional | 93.43 | |
| PRK11823 | 446 | DNA repair protein RadA; Provisional | 93.43 | |
| PRK12678 | 672 | transcription termination factor Rho; Provisional | 93.34 | |
| PRK00889 | 175 | adenylylsulfate kinase; Provisional | 93.33 | |
| PRK05439 | 311 | pantothenate kinase; Provisional | 93.32 | |
| PRK09270 | 229 | nucleoside triphosphate hydrolase domain-containin | 93.31 | |
| PF03205 | 140 | MobB: Molybdopterin guanine dinucleotide synthesis | 93.29 | |
| PRK10923 | 469 | glnG nitrogen regulation protein NR(I); Provisiona | 93.26 | |
| PF00006 | 215 | ATP-synt_ab: ATP synthase alpha/beta family, nucle | 93.25 | |
| KOG0726 | 440 | consensus 26S proteasome regulatory complex, ATPas | 93.23 | |
| KOG0734 | 752 | consensus AAA+-type ATPase containing the peptidas | 93.2 | |
| PRK03846 | 198 | adenylylsulfate kinase; Provisional | 93.18 | |
| PF00437 | 270 | T2SE: Type II/IV secretion system protein; InterPr | 93.16 | |
| PRK05973 | 237 | replicative DNA helicase; Provisional | 93.11 | |
| PF00560 | 22 | LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le | 93.1 | |
| TIGR00554 | 290 | panK_bact pantothenate kinase, bacterial type. Sho | 93.09 | |
| TIGR01039 | 461 | atpD ATP synthase, F1 beta subunit. The sequences | 93.08 | |
| KOG1532 | 366 | consensus GTPase XAB1, interacts with DNA repair p | 93.07 | |
| PF10236 | 309 | DAP3: Mitochondrial ribosomal death-associated pro | 93.07 | |
| COG3640 | 255 | CooC CO dehydrogenase maturation factor [Cell divi | 93.04 | |
| cd00227 | 175 | CPT Chloramphenicol (Cm) phosphotransferase (CPT). | 93.02 | |
| TIGR03877 | 237 | thermo_KaiC_1 KaiC domain protein, Ph0284 family. | 93.01 | |
| cd02024 | 187 | NRK1 Nicotinamide riboside kinase (NRK) is an enzy | 92.95 | |
| cd01857 | 141 | HSR1_MMR1 HSR1/MMR1. Human HSR1, is localized to t | 92.92 | |
| COG0055 | 468 | AtpD F0F1-type ATP synthase, beta subunit [Energy | 92.92 | |
| PRK10820 | 520 | DNA-binding transcriptional regulator TyrR; Provis | 92.91 | |
| cd03240 | 204 | ABC_Rad50 The catalytic domains of Rad50 are simil | 92.9 | |
| TIGR01359 | 183 | UMP_CMP_kin_fam UMP-CMP kinase family. This subfam | 92.89 | |
| cd02025 | 220 | PanK Pantothenate kinase (PanK) catalyzes the phos | 92.88 | |
| COG1102 | 179 | Cmk Cytidylate kinase [Nucleotide transport and me | 92.82 | |
| cd03216 | 163 | ABC_Carb_Monos_I This family represents the domain | 92.8 | |
| PF00406 | 151 | ADK: Adenylate kinase; InterPro: IPR000850 Adenyla | 92.76 | |
| cd02023 | 198 | UMPK Uridine monophosphate kinase (UMPK, EC 2.7.1. | 92.72 | |
| cd03228 | 171 | ABCC_MRP_Like The MRP (Mutidrug Resistance Protein | 92.7 | |
| PRK10463 | 290 | hydrogenase nickel incorporation protein HypB; Pro | 92.7 | |
| COG1066 | 456 | Sms Predicted ATP-dependent serine protease [Postt | 92.7 | |
| COG0003 | 322 | ArsA Predicted ATPase involved in chromosome parti | 92.69 | |
| PRK13949 | 169 | shikimate kinase; Provisional | 92.66 | |
| KOG1970 | 634 | consensus Checkpoint RAD17-RFC complex, RAD17/RAD2 | 92.66 | |
| COG0488 | 530 | Uup ATPase components of ABC transporters with dup | 92.61 | |
| PRK10751 | 173 | molybdopterin-guanine dinucleotide biosynthesis pr | 92.6 | |
| PRK13948 | 182 | shikimate kinase; Provisional | 92.51 | |
| TIGR02858 | 270 | spore_III_AA stage III sporulation protein AA. Mem | 92.51 | |
| cd01122 | 271 | GP4d_helicase GP4d_helicase is a homohexameric 5'- | 92.45 | |
| TIGR00390 | 441 | hslU ATP-dependent protease HslVU, ATPase subunit. | 92.45 | |
| PF03308 | 266 | ArgK: ArgK protein; InterPro: IPR005129 Bacterial | 92.43 | |
| TIGR00150 | 133 | HI0065_YjeE ATPase, YjeE family. Members of this f | 92.42 | |
| cd00071 | 137 | GMPK Guanosine monophosphate kinase (GMPK, EC 2.7. | 92.39 | |
| cd02020 | 147 | CMPK Cytidine monophosphate kinase (CMPK) catalyze | 92.38 | |
| PHA02244 | 383 | ATPase-like protein | 92.33 | |
| PRK06002 | 450 | fliI flagellum-specific ATP synthase; Validated | 92.3 | |
| PRK13946 | 184 | shikimate kinase; Provisional | 92.29 | |
| PRK11388 | 638 | DNA-binding transcriptional regulator DhaR; Provis | 92.27 | |
| cd01130 | 186 | VirB11-like_ATPase Type IV secretory pathway compo | 92.27 | |
| COG2401 | 593 | ABC-type ATPase fused to a predicted acetyltransfe | 92.24 | |
| PF03266 | 168 | NTPase_1: NTPase; InterPro: IPR004948 This entry r | 92.24 | |
| TIGR02322 | 179 | phosphon_PhnN phosphonate metabolism protein/1,5-b | 92.24 | |
| cd00464 | 154 | SK Shikimate kinase (SK) is the fifth enzyme in th | 92.23 | |
| PRK08972 | 444 | fliI flagellum-specific ATP synthase; Validated | 92.22 | |
| TIGR00708 | 173 | cobA cob(I)alamin adenosyltransferase. Alternate n | 92.21 | |
| KOG3928 | 461 | consensus Mitochondrial ribosome small subunit com | 92.17 | |
| cd02021 | 150 | GntK Gluconate kinase (GntK) catalyzes the phospho | 92.14 | |
| cd01132 | 274 | F1_ATPase_alpha F1 ATP synthase alpha, central dom | 92.12 | |
| PRK14493 | 274 | putative bifunctional molybdopterin-guanine dinucl | 92.07 | |
| COG0703 | 172 | AroK Shikimate kinase [Amino acid transport and me | 92.06 | |
| cd03283 | 199 | ABC_MutS-like MutS-like homolog in eukaryotes. The | 92.03 | |
| TIGR02788 | 308 | VirB11 P-type DNA transfer ATPase VirB11. The VirB | 92.01 | |
| TIGR02655 | 484 | circ_KaiC circadian clock protein KaiC. Members of | 91.99 | |
| COG0465 | 596 | HflB ATP-dependent Zn proteases [Posttranslational | 91.95 | |
| PF06068 | 398 | TIP49: TIP49 C-terminus; InterPro: IPR010339 This | 91.95 | |
| PLN02796 | 347 | D-glycerate 3-kinase | 91.91 | |
| PRK05201 | 443 | hslU ATP-dependent protease ATP-binding subunit Hs | 91.86 | |
| PRK08149 | 428 | ATP synthase SpaL; Validated | 91.85 | |
| PRK13768 | 253 | GTPase; Provisional | 91.85 | |
| PRK13975 | 196 | thymidylate kinase; Provisional | 91.83 | |
| PLN03046 | 460 | D-glycerate 3-kinase; Provisional | 91.83 | |
| COG1936 | 180 | Predicted nucleotide kinase (related to CMP and AM | 91.82 | |
| PF00154 | 322 | RecA: recA bacterial DNA recombination protein; In | 91.81 | |
| PF12775 | 272 | AAA_7: P-loop containing dynein motor region D3; P | 91.8 | |
| PRK05057 | 172 | aroK shikimate kinase I; Reviewed | 91.79 | |
| TIGR00176 | 155 | mobB molybdopterin-guanine dinucleotide biosynthes | 91.78 | |
| PF00625 | 183 | Guanylate_kin: Guanylate kinase; InterPro: IPR0081 | 91.77 | |
| PF00560 | 22 | LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le | 91.75 | |
| PRK14530 | 215 | adenylate kinase; Provisional | 91.74 | |
| PRK12339 | 197 | 2-phosphoglycerate kinase; Provisional | 91.7 | |
| cd00267 | 157 | ABC_ATPase ABC (ATP-binding cassette) transporter | 91.69 | |
| TIGR03878 | 259 | thermo_KaiC_2 KaiC domain protein, AF_0795 family. | 91.66 | |
| TIGR02524 | 358 | dot_icm_DotB Dot/Icm secretion system ATPase DotB. | 91.61 | |
| TIGR02782 | 299 | TrbB_P P-type conjugative transfer ATPase TrbB. Th | 91.61 | |
| KOG0727 | 408 | consensus 26S proteasome regulatory complex, ATPas | 91.53 | |
| PRK15453 | 290 | phosphoribulokinase; Provisional | 91.52 | |
| COG3854 | 308 | SpoIIIAA ncharacterized protein conserved in bacte | 91.49 | |
| COG0468 | 279 | RecA RecA/RadA recombinase [DNA replication, recom | 91.45 | |
| PRK14529 | 223 | adenylate kinase; Provisional | 91.44 | |
| COG0563 | 178 | Adk Adenylate kinase and related kinases [Nucleoti | 91.4 | |
| COG2019 | 189 | AdkA Archaeal adenylate kinase [Nucleotide transpo | 91.38 | |
| COG0529 | 197 | CysC Adenylylsulfate kinase and related kinases [I | 91.37 | |
| TIGR03574 | 249 | selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal. Mem | 91.35 | |
| PRK14526 | 211 | adenylate kinase; Provisional | 91.33 | |
| CHL00059 | 485 | atpA ATP synthase CF1 alpha subunit | 91.31 | |
| TIGR03600 | 421 | phage_DnaB phage replicative helicase, DnaB family | 91.27 | |
| TIGR01287 | 275 | nifH nitrogenase iron protein. This model describe | 91.27 | |
| COG1224 | 450 | TIP49 DNA helicase TIP49, TBP-interacting protein | 91.26 | |
| cd02034 | 116 | CooC The accessory protein CooC, which contains a | 91.26 | |
| CHL00060 | 494 | atpB ATP synthase CF1 beta subunit | 91.23 | |
| PF03029 | 238 | ATP_bind_1: Conserved hypothetical ATP binding pro | 91.23 | |
| COG0194 | 191 | Gmk Guanylate kinase [Nucleotide transport and met | 91.22 | |
| TIGR03324 | 497 | alt_F1F0_F1_al alternate F1F0 ATPase, F1 subunit a | 91.21 | |
| TIGR03263 | 180 | guanyl_kin guanylate kinase. Members of this famil | 91.18 | |
| PF13504 | 17 | LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO | 91.16 | |
| cd04121 | 189 | Rab40 Rab40 subfamily. This subfamily contains Rab | 91.1 | |
| COG0396 | 251 | sufC Cysteine desulfurase activator ATPase [Posttr | 91.07 | |
| cd01983 | 99 | Fer4_NifH The Fer4_NifH superfamily contains a var | 91.02 | |
| PTZ00494 | 664 | tuzin-like protein; Provisional | 91.01 | |
| PLN02200 | 234 | adenylate kinase family protein | 91.0 | |
| COG1763 | 161 | MobB Molybdopterin-guanine dinucleotide biosynthes | 91.0 | |
| COG1124 | 252 | DppF ABC-type dipeptide/oligopeptide/nickel transp | 90.99 | |
| cd01136 | 326 | ATPase_flagellum-secretory_path_III Flagellum-spec | 90.98 | |
| PRK14738 | 206 | gmk guanylate kinase; Provisional | 90.96 | |
| COG0378 | 202 | HypB Ni2+-binding GTPase involved in regulation of | 90.95 | |
| PRK03731 | 171 | aroL shikimate kinase II; Reviewed | 90.94 | |
| cd02027 | 149 | APSK Adenosine 5'-phosphosulfate kinase (APSK) cat | 90.93 | |
| COG0467 | 260 | RAD55 RecA-superfamily ATPases implicated in signa | 90.91 | |
| KOG0066 | 807 | consensus eIF2-interacting protein ABC50 (ABC supe | 90.9 | |
| PRK04182 | 180 | cytidylate kinase; Provisional | 90.89 | |
| PLN02318 | 656 | phosphoribulokinase/uridine kinase | 90.89 | |
| PF02374 | 305 | ArsA_ATPase: Anion-transporting ATPase; PDB: 2WOO_ | 90.88 | |
| cd03281 | 213 | ABC_MSH5_euk MutS5 homolog in eukaryotes. The MutS | 90.88 | |
| cd03116 | 159 | MobB Molybdenum is an essential trace element in t | 90.87 | |
| TIGR01069 | 771 | mutS2 MutS2 family protein. Function of MutS2 is u | 90.85 | |
| TIGR01313 | 163 | therm_gnt_kin carbohydrate kinase, thermoresistant | 90.82 | |
| PRK09435 | 332 | membrane ATPase/protein kinase; Provisional | 90.8 | |
| PRK15115 | 444 | response regulator GlrR; Provisional | 90.79 | |
| cd01125 | 239 | repA Hexameric Replicative Helicase RepA. RepA is | 90.76 | |
| PRK08927 | 442 | fliI flagellum-specific ATP synthase; Validated | 90.76 | |
| KOG0780 | 483 | consensus Signal recognition particle, subunit Srp | 90.73 | |
| PRK07132 | 299 | DNA polymerase III subunit delta'; Validated | 90.72 | |
| TIGR03305 | 449 | alt_F1F0_F1_bet alternate F1F0 ATPase, F1 subunit | 90.72 | |
| COG4088 | 261 | Predicted nucleotide kinase [Nucleotide transport | 90.71 |
| >PLN03210 Resistant to P | Back alignment and domain information |
|---|
Probab=100.00 E-value=1.9e-147 Score=1449.20 Aligned_cols=1097 Identities=33% Similarity=0.552 Sum_probs=890.4
Q ss_pred CCCCccEEEccccccccCchHHHHHHHHhhcCCceeeecCccccCCCcchHHHHHHhhhcceeEEeeccCcccchhhHHH
Q 000874 5 SSCNYDVFLSFRGVDTRASFTCHLYDSLFERKKIRTFIDDEELRQGDAISPVLLNAIQGSKISLIIFSKDYASSKWCLNE 84 (1243)
Q Consensus 5 ~~~~~dvF~sf~g~d~r~~f~~~L~~~L~~~~gi~~f~d~~~~~~g~~~~~~l~~ai~~s~~~i~v~s~~y~~s~wcl~e 84 (1243)
+.|+||||+||||+|||++|++|||+|| .++||++|+|++ +++|+.|+++|++||++|+|+|||||++||+|+|||||
T Consensus 9 ~~~~~~vf~sfrg~d~r~~f~~hl~~~l-~~~~i~~f~d~~-~~~g~~~~~~l~~~i~~s~~~ivv~s~~ya~s~wcl~e 86 (1153)
T PLN03210 9 RNWVYDVFPSFSGEDVRITFLSHFLKEL-DRKLIIAFKDNE-IERSQSLDPELKQAIRDSRIAVVVFSKNYASSSWCLNE 86 (1153)
T ss_pred CCCCCcEEeeCCCcccccCHHHHHHHHH-HHCCCeEEccCC-ccCCCcccHHHHHHHHhCeEEEEEecCCcccchHHHHH
Confidence 5799999999999999999999999999 999999999885 99999999999999999999999999999999999999
Q ss_pred HHHHHHhHhcCCCEEEeEEEEeCcchhccccCchhhHHHHHHHhhccChHHHHHHHHHHHHhhhhcCCCccc-CcchHHH
Q 000874 85 LVKILECKNTNGQIVIPVFYNVSPSDVRHQTGIFGDGFDKLEQQFKEKPEIVQKWRYALRETSHLAGHESTK-FRHDAQL 163 (1243)
Q Consensus 85 l~~i~~~~~~~~~~v~Pvfy~v~ps~vr~~~~~~~~~~~~~~~~~~~~~~~v~~w~~aL~~~~~~~g~~~~~-~~~e~~~ 163 (1243)
|++||+|+++++++|+||||+|||+|||+|+|.||+||++++++ ...+++++||+||++||+++|| +.. .++|+++
T Consensus 87 l~~i~~~~~~~~~~v~pvfy~v~p~~v~~~~g~f~~~f~~~~~~--~~~~~~~~w~~al~~~~~~~g~-~~~~~~~E~~~ 163 (1153)
T PLN03210 87 LLEIVRCKEELGQLVIPVFYGLDPSHVRKQTGDFGEAFEKTCQN--KTEDEKIQWKQALTDVANILGY-HSQNWPNEAKM 163 (1153)
T ss_pred HHHHHHhhhhcCceEEEEEecccHHHHhhccchHHHHHHHHhcc--cchhHHHHHHHHHHHHhCcCce-ecCCCCCHHHH
Confidence 99999999999999999999999999999999999999999876 4678999999999999999999 554 5899999
Q ss_pred HHHHHHHHHHHhhccccCCCCCCCcccchhhHHhHHHhhccCCCCCeEEEEEEecCCchhHHHHHHHHHHHhcccCceEE
Q 000874 164 VNKIVEDILKKLEKITVSTDSSNGLVGLNSRIEQIKPFLCMDLSDTVQIVGIWGMGGIGKTTLATAIFNQFSSEFEGRCF 243 (1243)
Q Consensus 164 i~~i~~~i~~~l~~~~~~~~~~~~~vGr~~~~~~l~~~L~~~~~~~~~vv~I~G~gGiGKTtLA~~v~~~~~~~F~~~~~ 243 (1243)
|++||++|+++++. +++.+.+++|||+.+++++..+|..+. +++++||||||||+||||||+++|+++..+|++.+|
T Consensus 164 i~~Iv~~v~~~l~~--~~~~~~~~~vG~~~~l~~l~~lL~l~~-~~~~vvgI~G~gGiGKTTLA~~l~~~l~~~F~g~vf 240 (1153)
T PLN03210 164 IEEIANDVLGKLNL--TPSNDFEDFVGIEDHIAKMSSLLHLES-EEVRMVGIWGSSGIGKTTIARALFSRLSRQFQSSVF 240 (1153)
T ss_pred HHHHHHHHHHhhcc--ccCcccccccchHHHHHHHHHHHcccc-CceEEEEEEcCCCCchHHHHHHHHHHHhhcCCeEEE
Confidence 99999999999998 788888999999999999999998776 789999999999999999999999999999999999
Q ss_pred Eeec--cccc---cC----CC-ChHHHHHHHHHhhhcc-cccccCCCccHHHHHhhcCceEEEEEecCCChhhhHHHhcC
Q 000874 244 MSDV--RRNS---ET----GG-GLEHLQKQMLSTILSE-KLEVAGPNIPQFTKERVRRMKVLIVLDDVNKVGQLEGLIGG 312 (1243)
Q Consensus 244 ~~~~--~~~~---~~----~~-~l~~l~~~ll~~l~~~-~~~~~~~~~~~~l~~~L~~kr~LlVLDdv~~~~~~~~l~~~ 312 (1243)
+... +... .. .. ....++++++.++... .... .....++++|++||+||||||||+..+|+.+.+.
T Consensus 241 v~~~~v~~~~~~~~~~~~~~~~~~~~l~~~~l~~il~~~~~~~---~~~~~~~~~L~~krvLLVLDdv~~~~~l~~L~~~ 317 (1153)
T PLN03210 241 IDRAFISKSMEIYSSANPDDYNMKLHLQRAFLSEILDKKDIKI---YHLGAMEERLKHRKVLIFIDDLDDQDVLDALAGQ 317 (1153)
T ss_pred eeccccccchhhcccccccccchhHHHHHHHHHHHhCCCCccc---CCHHHHHHHHhCCeEEEEEeCCCCHHHHHHHHhh
Confidence 8642 1111 00 01 1235666777664332 2211 1125688999999999999999999999999998
Q ss_pred CCCCCCCCeEEEEecccchhcccCCCcceEEecCCCCHHHHHHHHHHhhcCCCCCCchHHHHHHHHHHHhCCCchhHHHH
Q 000874 313 LDQYGPGSRIVVTTRDKGVLEKFGVEEEKIYGVNGLEFDEAFELFCNFAFEENHCPEDLNWHSRRVVWYATSNPLVLKVL 392 (1243)
Q Consensus 313 ~~~~~~gsrIIiTTR~~~v~~~~~~~~~~~~~v~~L~~~ea~~Lf~~~af~~~~~~~~~~~l~~~i~~~~~glPLal~~~ 392 (1243)
..|+++||+||||||+++++..++++ .+|+|+.|++++||+||+++||++..+++++.+++++|+++|+|+||||+++
T Consensus 318 ~~~~~~GsrIIiTTrd~~vl~~~~~~--~~~~v~~l~~~ea~~LF~~~Af~~~~~~~~~~~l~~~iv~~c~GLPLAl~vl 395 (1153)
T PLN03210 318 TQWFGSGSRIIVITKDKHFLRAHGID--HIYEVCLPSNELALEMFCRSAFKKNSPPDGFMELASEVALRAGNLPLGLNVL 395 (1153)
T ss_pred CccCCCCcEEEEEeCcHHHHHhcCCC--eEEEecCCCHHHHHHHHHHHhcCCCCCcHHHHHHHHHHHHHhCCCcHHHHHH
Confidence 89999999999999999999888877 8999999999999999999999988888889999999999999999999999
Q ss_pred hhhhCCCCHHHHHHHHHHHhhccCcchhhhHhHHhhccccCch-hhhhhhheeccccCCCCHHHHHHHHhh---cccchh
Q 000874 393 GSSLCLKRKSHWENVLDDLNRICESEIHDIYDILKISFNELIP-REKSMFLDIACFFEGEDKDILMRILDD---SESYAL 468 (1243)
Q Consensus 393 g~~L~~~~~~~w~~~l~~l~~~~~~~i~~v~~~l~~sy~~L~~-~~k~~fl~~a~f~~~~~~~~~~~~l~~---~~~~~~ 468 (1243)
|++|++++..+|+.++++++..++.++ .++|++||++|++ .+|.||++|||||++.+++.+..++++ .++.++
T Consensus 396 gs~L~~k~~~~W~~~l~~L~~~~~~~I---~~~L~~SYd~L~~~~~k~~Fl~ia~ff~~~~~~~v~~~l~~~~~~~~~~l 472 (1153)
T PLN03210 396 GSYLRGRDKEDWMDMLPRLRNGLDGKI---EKTLRVSYDGLNNKKDKAIFRHIACLFNGEKVNDIKLLLANSDLDVNIGL 472 (1153)
T ss_pred HHHHcCCCHHHHHHHHHHHHhCccHHH---HHHHHHhhhccCccchhhhhheehhhcCCCCHHHHHHHHHhcCCCchhCh
Confidence 999999999999999999988766656 9999999999976 589999999999999999999988876 456789
Q ss_pred hhcccccceEEcCCeEecchhHHHHHHHHhhccccCCCCCcccccChHHHHHHhhccCcccccceeeecCCCcccccccc
Q 000874 469 GVLIDKSLITISHNCLQMHDLLQEMGRQIVRQESQKEPGKRSRLWDPKEIRRVLKHNKGTDAIEGIFMDLSKIEGINLDS 548 (1243)
Q Consensus 469 ~~L~~~sLi~~~~~~~~mHdlv~~~~~~i~~~e~~~~~~~~~rl~~~~~~~~vl~~~~~~~~i~~i~l~ls~~~~~~l~~ 548 (1243)
+.|+++|||++..+++.|||++|+||++++++++ .+|++|+|+|+++|+++++..++|++.+++|++|++....+.+..
T Consensus 473 ~~L~~ksLi~~~~~~~~MHdLl~~~~r~i~~~~~-~~~~~r~~l~~~~di~~vl~~~~g~~~v~~i~l~~~~~~~~~i~~ 551 (1153)
T PLN03210 473 KNLVDKSLIHVREDIVEMHSLLQEMGKEIVRAQS-NEPGEREFLVDAKDICDVLEDNTGTKKVLGITLDIDEIDELHIHE 551 (1153)
T ss_pred HHHHhcCCEEEcCCeEEhhhHHHHHHHHHHHhhc-CCCCcceeEeCHHHHHHHHHhCcccceeeEEEeccCccceeeecH
Confidence 9999999999999999999999999999999998 789999999999999999999999999999999999999999999
Q ss_pred hhhcCCCccceEEEecCCcccchhhhhccCCceecCCCCCCCCCCceEEEecCCCCCCCCCCCcccccceeccccccccc
Q 000874 549 RAFTNMSNLRMLKFYVPKFLGMIIEEKLEDSKVQLPDGIDYLPKNLRYLHWYKYPLRTLPSNFKPKNIVELSLRFSKVEQ 628 (1243)
Q Consensus 549 ~~f~~l~~Lr~L~l~~~~l~~~~~~~~~~~~~~~l~~~~~~l~~~Lr~L~l~~~~l~~lp~~~~~~~L~~L~L~~n~i~~ 628 (1243)
++|.+|++|++|+++.+.+.. .......+|+++..+|.+||+|+|.+|+++.+|..+.+.+|++|+|++|.++.
T Consensus 552 ~aF~~m~~L~~L~~~~~~~~~------~~~~~~~lp~~~~~lp~~Lr~L~~~~~~l~~lP~~f~~~~L~~L~L~~s~l~~ 625 (1153)
T PLN03210 552 NAFKGMRNLLFLKFYTKKWDQ------KKEVRWHLPEGFDYLPPKLRLLRWDKYPLRCMPSNFRPENLVKLQMQGSKLEK 625 (1153)
T ss_pred HHHhcCccccEEEEecccccc------cccceeecCcchhhcCcccEEEEecCCCCCCCCCcCCccCCcEEECcCccccc
Confidence 999999999999998764211 11244678999999999999999999999999999999999999999999999
Q ss_pred ccccccccccccccccCCCcccccCCCCCCCCCccEEeccCCcCCCcCCCcccCCCCccccccccccceecccCCccccc
Q 000874 629 IWEGKKKAFKLKSIDLSHSEHLIRIPDLSEIPNLERIYLSNCTNLVHVPASIQNFKYLKFPQISGKITRLYLSQSAIEEV 708 (1243)
Q Consensus 629 l~~~~~~l~~L~~L~L~~~~~~~~~~~l~~l~~L~~L~L~~~~~l~~~p~~i~~L~~L~~l~~~~~L~~L~L~~n~i~~l 708 (1243)
+|.++..+++|+.|+|++|.....+|+++.+++|+.|+|++|..+. .+
T Consensus 626 L~~~~~~l~~Lk~L~Ls~~~~l~~ip~ls~l~~Le~L~L~~c~~L~--------------------------------~l 673 (1153)
T PLN03210 626 LWDGVHSLTGLRNIDLRGSKNLKEIPDLSMATNLETLKLSDCSSLV--------------------------------EL 673 (1153)
T ss_pred cccccccCCCCCEEECCCCCCcCcCCccccCCcccEEEecCCCCcc--------------------------------cc
Confidence 9999999999999999999988999999999999999999997766 56
Q ss_pred ccccccCCcceEEecccCcccccccccccccCccceeecccccCcCcCchhhhcCCcccEeeccccCccccCcccccccC
Q 000874 709 PSSIECLTDLVELDLRDCKRLKRISTRFCKLKSLVKLCLDDCLNLERFPEILEEMEHLKRIYLERTAITELPSSFENLLG 788 (1243)
Q Consensus 709 p~~i~~l~~L~~L~L~~~~~l~~lp~~~~~l~~L~~L~L~~~~~~~~~p~~l~~l~~L~~L~L~~n~l~~lp~~l~~l~~ 788 (1243)
|.+++++++|+.|++++|..++.+|..+ ++++|+.|++++|..+..+|.. ..+|+.|++++|.+..+|..+ .+++
T Consensus 674 p~si~~L~~L~~L~L~~c~~L~~Lp~~i-~l~sL~~L~Lsgc~~L~~~p~~---~~nL~~L~L~~n~i~~lP~~~-~l~~ 748 (1153)
T PLN03210 674 PSSIQYLNKLEDLDMSRCENLEILPTGI-NLKSLYRLNLSGCSRLKSFPDI---STNISWLDLDETAIEEFPSNL-RLEN 748 (1153)
T ss_pred chhhhccCCCCEEeCCCCCCcCccCCcC-CCCCCCEEeCCCCCCccccccc---cCCcCeeecCCCccccccccc-cccc
Confidence 6677788888999999998888888866 6899999999999888887764 457899999999999999866 5788
Q ss_pred CcEEeecCCCCCCc-------CCCccCCCCCCcEEEccCC-CCccCCccccCCCCCcEEEeccCCCCCCCChhhccCCCC
Q 000874 789 LEFLTVSGCSKLDK-------LPDNIGNLKSLDFIAAVGS-AISQLPSSVADSNVLRMLFFCRCRRLLSLPRLLLSGLSS 860 (1243)
Q Consensus 789 L~~L~L~~~~~~~~-------lp~~l~~l~~L~~L~l~~~-~i~~l~~~~~~l~~L~~L~l~~~~~l~~l~~~~~~~l~~ 860 (1243)
|+.|.+.+|..... .+......++|+.|++++| .+..+|.++.++++|+.|++++|..+..+|.. .++++
T Consensus 749 L~~L~l~~~~~~~l~~~~~~l~~~~~~~~~sL~~L~Ls~n~~l~~lP~si~~L~~L~~L~Ls~C~~L~~LP~~--~~L~s 826 (1153)
T PLN03210 749 LDELILCEMKSEKLWERVQPLTPLMTMLSPSLTRLFLSDIPSLVELPSSIQNLHKLEHLEIENCINLETLPTG--INLES 826 (1153)
T ss_pred cccccccccchhhccccccccchhhhhccccchheeCCCCCCccccChhhhCCCCCCEEECCCCCCcCeeCCC--CCccc
Confidence 88888887543211 1112233578999999998 46678999999999999999999999999873 27899
Q ss_pred CcEEEeccCCCC-CcchhhcCCCCCCEEeCcCCCCcccchhccCCCCCCEEeecCCCCCCcCCCc---CCCCcEEecccC
Q 000874 861 LKFLYISDCAVT-EIPQDIACLSSLTTLNLSGNNFESLPASIKQLSQLSSLYLKDCKMLQSLPEL---PLCLKYLDLRDC 936 (1243)
Q Consensus 861 L~~L~Ls~~~l~-~lp~~l~~l~~L~~L~Ls~n~l~~lp~~l~~l~~L~~L~L~~c~~l~~lp~l---~~~L~~L~l~~c 936 (1243)
|+.|+|++|... .+|.. .++|+.|+|++|.++.+|.++..+++|+.|+|++|+.+..+|.. .++|+.|++++|
T Consensus 827 L~~L~Ls~c~~L~~~p~~---~~nL~~L~Ls~n~i~~iP~si~~l~~L~~L~L~~C~~L~~l~~~~~~L~~L~~L~l~~C 903 (1153)
T PLN03210 827 LESLDLSGCSRLRTFPDI---STNISDLNLSRTGIEEVPWWIEKFSNLSFLDMNGCNNLQRVSLNISKLKHLETVDFSDC 903 (1153)
T ss_pred cCEEECCCCCcccccccc---ccccCEeECCCCCCccChHHHhcCCCCCEEECCCCCCcCccCcccccccCCCeeecCCC
Confidence 999999998544 45543 47899999999999999999999999999999999999998854 356888899999
Q ss_pred CCCCccCCCcccccccccccCCCCCCCCCCChhhhhcchhhhhhccCCCCCccccccccCcccEEEecCccccchHHhhh
Q 000874 937 NTLRSLPELPLCLESLKARNCKGLQSLPEIPSCLQELDASVLEKLSKHSPDRSIKWRYKTSTIYFEFTNCLELNGKANNK 1016 (1243)
Q Consensus 937 ~~l~~~~~~~~~l~~L~~l~~~~~~~~~~~p~~L~~L~~~~~~~Ls~n~~~~~~~~~~~~~l~~l~~~nC~~l~~~~~~~ 1016 (1243)
..+..++..- .|.. ...++.|..+ .+ ++...+.|.||++|++.+.
T Consensus 904 ~~L~~~~l~~-------------------~~~~--------~~~~~~n~~~-~~-----p~~~~l~f~nC~~L~~~a~-- 948 (1153)
T PLN03210 904 GALTEASWNG-------------------SPSE--------VAMATDNIHS-KL-----PSTVCINFINCFNLDQEAL-- 948 (1153)
T ss_pred cccccccCCC-------------------Cchh--------hhhhcccccc-cC-----CchhccccccccCCCchhh--
Confidence 8876554210 0000 0011111111 11 1223478899999997652
Q ss_pred HHHhHHHHHHHHHhhhccccccccccccccCCCCcEEEcCCCCCCCCccccCCCceEE-EECCCCCCCCCcceeEEEEEe
Q 000874 1017 ILADSRLRIQHLAIASLRLGYEKTNEEKLSEVDGPIIVLPGSEIPDWFSNQSSGSSIC-IQLPPHSFCRNLIGFALCAVL 1095 (1243)
Q Consensus 1017 ~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~pg~~iP~wf~~q~~g~si~-~~lp~~~~~~~~~gf~~c~v~ 1095 (1243)
+ +... ....+++||.++|+||.||+.|++++ |.+|+.|++..|.||++|+|+
T Consensus 949 l-----------~~~~----------------~~~~~~l~g~evp~~f~hr~~g~sl~~i~l~~~~~~~~~~~f~~c~v~ 1001 (1153)
T PLN03210 949 L-----------QQQS----------------IFKQLILSGEEVPSYFTHRTTGASLTNIPLLHISPCQPFFRFRACAVV 1001 (1153)
T ss_pred h-----------cccc----------------cceEEECCCccCchhccCCcccceeeeeccCCcccCCCccceEEEEEE
Confidence 1 1111 02358899999999999999999999 999999998899999999999
Q ss_pred ecCCCccCC-CCceEEEEEecCC-cccccccccccceeeccccCCCCCCCeEEEEeeec--CCC---CCCCCccceEEEE
Q 000874 1096 DFKQLHCDC-LSDFYVSCQLDLE-IKTLSKTKHVDLGFYLPYFKYSIDSDHVILGFKPC--SNV---GFPDGYHHTTASF 1168 (1243)
Q Consensus 1096 ~~~~~~~~~-~~~~~~~c~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~sdh~~~~~~~~--~~~---~~~~~~~~~~~~f 1168 (1243)
++....... ...+.|.|++.+. ++.++...+. ..+ .....++|++++.... ... .....|+|+.+.|
T Consensus 1002 ~~~~~~~~~~~~~~~~~c~~~~~~~~~~~~~~~~-~~~-----~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~f 1075 (1153)
T PLN03210 1002 DSESFFIISVSFDIQVCCRFIDRLGNHFDSPYQP-HVF-----SVTKKGSHLVIFDCCFPLNEDNAPLAELNYDHVDIQF 1075 (1153)
T ss_pred ecCccccCCCceeEEEEEEEECCCCCccccCCCc-eeE-----eeeccccceEEecccccccccccchhccCCceeeEEE
Confidence 887643221 1233478887554 3332111100 000 0011245665553211 000 0112466666666
Q ss_pred EEEEeccccceeEEeeeeEEEecCCCCCCCCcccccccccchhcccCCCCCCCCCc--cccCCCchhhhccc
Q 000874 1169 KFFAECHQKRHRIKRYGVCPVYANPSETKANTFTLNFATEVWKLDDLASASGTSDE--EELEPSPKRIFRAD 1238 (1243)
Q Consensus 1169 ~f~~~~~~~~~~vk~cGv~lvy~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~--~~~~~~~k~~~~~~ 1238 (1243)
+|... ...++||+|||+++|..+...++. +-...+.-.....+..++.++++ -|.+.++||+.++.
T Consensus 1076 ~~~~~--~~~~~~~~cg~~~~~~~~~~~~~~--~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 1143 (1153)
T PLN03210 1076 RLTNK--NSQLKLKGCGIRLSEDDSSLNNTL--PNVEEADDDNPVNGSEHWEDCEDSALERESERTKDREMR 1143 (1153)
T ss_pred EEecC--CCCeEEEeeeEEEeccCCCcccCC--CccccccccccccccccccccCCcchhccccccchhhhh
Confidence 66432 233699999999999765443332 10000000000111223344443 36778888877653
|
syringae 6; Provisional |
| >KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PLN03194 putative disease resistance protein; Provisional | Back alignment and domain information |
|---|
| >PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
| >PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
| >PF00931 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is the NB-ARC domain, a novel signalling motif found in bacteria and eukaryotes, shared by plant resistance gene products and regulators of cell death in animals [] | Back alignment and domain information |
|---|
| >KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0472 consensus Leucine-rich repeat protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0472 consensus Leucine-rich repeat protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PLN03210 Resistant to P | Back alignment and domain information |
|---|
| >KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF01582 TIR: TIR domain; InterPro: IPR000157 In Drosophila melanogaster the Toll protein is involved in establishment of dorso-ventral polarity in the embryo | Back alignment and domain information |
|---|
| >PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional | Back alignment and domain information |
|---|
| >PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional | Back alignment and domain information |
|---|
| >smart00255 TIR Toll - interleukin 1 - resistance | Back alignment and domain information |
|---|
| >KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional | Back alignment and domain information |
|---|
| >PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional | Back alignment and domain information |
|---|
| >KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily | Back alignment and domain information |
|---|
| >cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily | Back alignment and domain information |
|---|
| >PF13676 TIR_2: TIR domain; PDB: 3H16_B 3UB4_A 2Y92_A 3UB3_A 3UB2_A | Back alignment and domain information |
|---|
| >PRK04841 transcriptional regulator MalT; Provisional | Back alignment and domain information |
|---|
| >KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] | Back alignment and domain information |
|---|
| >PRK00411 cdc6 cell division control protein 6; Reviewed | Back alignment and domain information |
|---|
| >KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF05729 NACHT: NACHT domain | Back alignment and domain information |
|---|
| >COG4886 Leucine-rich repeat (LRR) protein [Function unknown] | Back alignment and domain information |
|---|
| >TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit | Back alignment and domain information |
|---|
| >PF01637 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 This domain has been found in a number of bacterial and archaeal proteins, all of which contain a conserved P-loop motif that is involved in binding ATP | Back alignment and domain information |
|---|
| >TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily | Back alignment and domain information |
|---|
| >KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] | Back alignment and domain information |
|---|
| >TIGR02928 orc1/cdc6 family replication initiation protein | Back alignment and domain information |
|---|
| >COG4886 Leucine-rich repeat (LRR) protein [Function unknown] | Back alignment and domain information |
|---|
| >PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed | Back alignment and domain information |
|---|
| >KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] | Back alignment and domain information |
|---|
| >COG3899 Predicted ATPase [General function prediction only] | Back alignment and domain information |
|---|
| >PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A | Back alignment and domain information |
|---|
| >COG2909 MalT ATP-dependent transcriptional regulator [Transcription] | Back alignment and domain information |
|---|
| >PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A | Back alignment and domain information |
|---|
| >KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK06893 DNA replication initiation factor; Validated | Back alignment and domain information |
|---|
| >PRK13342 recombination factor protein RarA; Reviewed | Back alignment and domain information |
|---|
| >PRK15386 type III secretion protein GogB; Provisional | Back alignment and domain information |
|---|
| >PRK15386 type III secretion protein GogB; Provisional | Back alignment and domain information |
|---|
| >PTZ00112 origin recognition complex 1 protein; Provisional | Back alignment and domain information |
|---|
| >PLN03150 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda | Back alignment and domain information |
|---|
| >PF13173 AAA_14: AAA domain | Back alignment and domain information |
|---|
| >COG3903 Predicted ATPase [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PLN03150 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG3678 consensus SARM protein (with sterile alpha and armadillo motifs) [Extracellular structures] | Back alignment and domain information |
|---|
| >KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >TIGR01242 26Sp45 26S proteasome subunit P45 family | Back alignment and domain information |
|---|
| >KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4341 consensus F-box protein containing LRR [General function prediction only] | Back alignment and domain information |
|---|
| >PRK12402 replication factor C small subunit 2; Reviewed | Back alignment and domain information |
|---|
| >PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A | Back alignment and domain information |
|---|
| >PRK14949 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold | Back alignment and domain information |
|---|
| >PRK14963 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK14961 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK07003 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PTZ00202 tuzin; Provisional | Back alignment and domain information |
|---|
| >PRK14960 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK05564 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PF13191 AAA_16: AAA ATPase domain; PDB: 2V1U_A | Back alignment and domain information |
|---|
| >PLN03025 replication factor C subunit; Provisional | Back alignment and domain information |
|---|
| >PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B | Back alignment and domain information |
|---|
| >PRK08727 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >TIGR02903 spore_lon_C ATP-dependent protease, Lon family | Back alignment and domain information |
|---|
| >PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed | Back alignment and domain information |
|---|
| >PRK07471 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PRK12323 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK14957 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK04195 replication factor C large subunit; Provisional | Back alignment and domain information |
|---|
| >PRK14962 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >KOG2028 consensus ATPase related to the helicase subunit of the Holliday junction resolvase [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PRK00440 rfc replication factor C small subunit; Reviewed | Back alignment and domain information |
|---|
| >PRK08691 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK14087 dnaA chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >PRK09087 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK07940 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A | Back alignment and domain information |
|---|
| >TIGR00678 holB DNA polymerase III, delta' subunit | Back alignment and domain information |
|---|
| >KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] | Back alignment and domain information |
|---|
| >PRK08084 DNA replication initiation factor; Provisional | Back alignment and domain information |
|---|
| >PRK06645 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair | Back alignment and domain information |
|---|
| >KOG4341 consensus F-box protein containing LRR [General function prediction only] | Back alignment and domain information |
|---|
| >PRK14956 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >TIGR02397 dnaX_nterm DNA polymerase III, subunit gamma and tau | Back alignment and domain information |
|---|
| >KOG2982 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PRK07994 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK03992 proteasome-activating nucleotidase; Provisional | Back alignment and domain information |
|---|
| >COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication | Back alignment and domain information |
|---|
| >PRK09112 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] | Back alignment and domain information |
|---|
| >PRK08903 DnaA regulatory inactivator Hda; Validated | Back alignment and domain information |
|---|
| >KOG2982 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PRK14964 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK14955 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK05642 DNA replication initiation factor; Validated | Back alignment and domain information |
|---|
| >PRK14951 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK14970 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK09376 rho transcription termination factor Rho; Provisional | Back alignment and domain information |
|---|
| >PRK14958 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK14969 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PHA02544 44 clamp loader, small subunit; Provisional | Back alignment and domain information |
|---|
| >PF14516 AAA_35: AAA-like domain | Back alignment and domain information |
|---|
| >TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA | Back alignment and domain information |
|---|
| >PRK05896 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B | Back alignment and domain information |
|---|
| >PRK06305 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK14959 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK00149 dnaA chromosomal replication initiation protein; Reviewed | Back alignment and domain information |
|---|
| >TIGR00362 DnaA chromosomal replication initiator protein DnaA | Back alignment and domain information |
|---|
| >PRK07764 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK14954 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PTZ00361 26 proteosome regulatory subunit 4-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG2543 consensus Origin recognition complex, subunit 5 [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PRK07133 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >cd01128 rho_factor Transcription termination factor rho is a bacterial ATP-dependent RNA/DNA helicase | Back alignment and domain information |
|---|
| >PRK09111 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >TIGR02881 spore_V_K stage V sporulation protein K | Back alignment and domain information |
|---|
| >TIGR03689 pup_AAA proteasome ATPase | Back alignment and domain information |
|---|
| >PRK14952 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK14950 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK14088 dnaA chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional | Back alignment and domain information |
|---|
| >TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family | Back alignment and domain information |
|---|
| >KOG2227 consensus Pre-initiation complex, subunit CDC6, AAA+ superfamily ATPase [Replication, recombination and repair; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PRK14953 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK08451 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >CHL00095 clpC Clp protease ATP binding subunit | Back alignment and domain information |
|---|
| >PRK12422 chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR00767 rho transcription termination factor Rho | Back alignment and domain information |
|---|
| >PRK10865 protein disaggregation chaperone; Provisional | Back alignment and domain information |
|---|
| >PRK06620 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK06647 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX | Back alignment and domain information |
|---|
| >COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] | Back alignment and domain information |
|---|
| >PRK14948 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >CHL00181 cbbX CbbX; Provisional | Back alignment and domain information |
|---|
| >PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >KOG0989 consensus Replication factor C, subunit RFC4 [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB | Back alignment and domain information |
|---|
| >PRK14971 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >CHL00195 ycf46 Ycf46; Provisional | Back alignment and domain information |
|---|
| >PRK14086 dnaA chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >PRK07952 DNA replication protein DnaC; Validated | Back alignment and domain information |
|---|
| >PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B | Back alignment and domain information |
|---|
| >KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] | Back alignment and domain information |
|---|
| >PRK05707 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport | Back alignment and domain information |
|---|
| >PRK08116 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >COG0593 DnaA ATPase involved in DNA replication initiation [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >CHL00176 ftsH cell division protein; Validated | Back alignment and domain information |
|---|
| >PRK14965 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK05563 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PF08937 DUF1863: MTH538 TIR-like domain (DUF1863); InterPro: IPR015032 This protein adopts the flavodoxin fold, that is, five parallel beta-strands and four helical segments | Back alignment and domain information |
|---|
| >COG1373 Predicted ATPase (AAA+ superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >PRK10536 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK12377 putative replication protein; Provisional | Back alignment and domain information |
|---|
| >KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] | Back alignment and domain information |
|---|
| >COG1222 RPT1 ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR00602 rad24 checkpoint protein rad24 | Back alignment and domain information |
|---|
| >KOG0991 consensus Replication factor C, subunit RFC2 [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] | Back alignment and domain information |
|---|
| >PF05673 DUF815: Protein of unknown function (DUF815); InterPro: IPR008533 This domain consists of several bacterial proteins of unknown function | Back alignment and domain information |
|---|
| >TIGR01241 FtsH_fam ATP-dependent metalloprotease FtsH | Back alignment and domain information |
|---|
| >PRK07399 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] | Back alignment and domain information |
|---|
| >cd01133 F1-ATPase_beta F1 ATP synthase beta subunit, nucleotide-binding domain | Back alignment and domain information |
|---|
| >smart00382 AAA ATPases associated with a variety of cellular activities | Back alignment and domain information |
|---|
| >PRK09183 transposase/IS protein; Provisional | Back alignment and domain information |
|---|
| >PRK06526 transposase; Provisional | Back alignment and domain information |
|---|
| >KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] | Back alignment and domain information |
|---|
| >PRK08181 transposase; Validated | Back alignment and domain information |
|---|
| >TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily | Back alignment and domain information |
|---|
| >PRK10865 protein disaggregation chaperone; Provisional | Back alignment and domain information |
|---|
| >PF05621 TniB: Bacterial TniB protein; InterPro: IPR008868 This family consists of several bacterial TniB NTP-binding proteins | Back alignment and domain information |
|---|
| >PLN00020 ribulose bisphosphate carboxylase/oxygenase activase -RuBisCO activase (RCA); Provisional | Back alignment and domain information |
|---|
| >PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif | Back alignment and domain information |
|---|
| >PRK11331 5-methylcytosine-specific restriction enzyme subunit McrB; Provisional | Back alignment and domain information |
|---|
| >PRK08058 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA | Back alignment and domain information |
|---|
| >PRK00771 signal recognition particle protein Srp54; Provisional | Back alignment and domain information |
|---|
| >COG2255 RuvB Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK06871 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PRK07261 topology modulation protein; Provisional | Back alignment and domain information |
|---|
| >TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily | Back alignment and domain information |
|---|
| >PRK08118 topology modulation protein; Reviewed | Back alignment and domain information |
|---|
| >TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB | Back alignment and domain information |
|---|
| >TIGR00763 lon ATP-dependent protease La | Back alignment and domain information |
|---|
| >KOG0735 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK08769 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] | Back alignment and domain information |
|---|
| >PRK06921 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] | Back alignment and domain information |
|---|
| >COG3267 ExeA Type II secretory pathway, component ExeA (predicted ATPase) [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN | Back alignment and domain information |
|---|
| >COG0466 Lon ATP-dependent Lon protease, bacterial type [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0741 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family | Back alignment and domain information |
|---|
| >PF04665 Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 This entry contains uncharacterised proteins belonging to the B354L family which include the pox virus A32 protein | Back alignment and domain information |
|---|
| >cd01131 PilT Pilus retraction ATPase PilT | Back alignment and domain information |
|---|
| >PRK10867 signal recognition particle protein; Provisional | Back alignment and domain information |
|---|
| >COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK10787 DNA-binding ATP-dependent protease La; Provisional | Back alignment and domain information |
|---|
| >TIGR00959 ffh signal recognition particle protein | Back alignment and domain information |
|---|
| >PRK06090 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >COG0542 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK07993 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A | Back alignment and domain information |
|---|
| >PRK06835 DNA replication protein DnaC; Validated | Back alignment and domain information |
|---|
| >PF02562 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH is a cytoplasmic protein and predicted ATPase that is induced by phosphate starvation and belongings to the phosphate regulon (pho) in Escherichia coli [] | Back alignment and domain information |
|---|
| >PF07728 AAA_5: AAA domain (dynein-related subfamily); InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] | Back alignment and domain information |
|---|
| >PRK14974 cell division protein FtsY; Provisional | Back alignment and domain information |
|---|
| >KOG0733 consensus Nuclear AAA ATPase (VCP subfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG1618 Predicted nucleotide kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >KOG0744 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR01425 SRP54_euk signal recognition particle protein SRP54 | Back alignment and domain information |
|---|
| >PRK12608 transcription termination factor Rho; Provisional | Back alignment and domain information |
|---|
| >TIGR02902 spore_lonB ATP-dependent protease LonB | Back alignment and domain information |
|---|
| >PRK06696 uridine kinase; Validated | Back alignment and domain information |
|---|
| >KOG0730 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >CHL00095 clpC Clp protease ATP binding subunit | Back alignment and domain information |
|---|
| >PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] | Back alignment and domain information |
|---|
| >KOG2228 consensus Origin recognition complex, subunit 4 [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >smart00763 AAA_PrkA PrkA AAA domain | Back alignment and domain information |
|---|
| >PF13177 DNA_pol3_delta2: DNA polymerase III, delta subunit; PDB: 1NJF_B 3GLG_G 1XXH_I 1NJG_A 3GLF_B 3GLI_G 1IQP_E 2GNO_A 1SXJ_E 1A5T_A | Back alignment and domain information |
|---|
| >PRK08939 primosomal protein DnaI; Reviewed | Back alignment and domain information |
|---|
| >PRK06964 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >TIGR00064 ftsY signal recognition particle-docking protein FtsY | Back alignment and domain information |
|---|
| >PRK10733 hflB ATP-dependent metalloprotease; Reviewed | Back alignment and domain information |
|---|
| >cd01120 RecA-like_NTPases RecA-like NTPases | Back alignment and domain information |
|---|
| >PRK07667 uridine kinase; Provisional | Back alignment and domain information |
|---|
| >PRK04132 replication factor C small subunit; Provisional | Back alignment and domain information |
|---|
| >KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] | Back alignment and domain information |
|---|
| >COG0542 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG2123 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >COG2812 DnaX DNA polymerase III, gamma/tau subunits [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >COG1223 Predicted ATPase (AAA+ superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >PF10443 RNA12: RNA12 protein; InterPro: IPR018850 Mitochondrial escape protein 2 (also known as RNA12) plays a role in maintaining the mitochondrial genome and in controlling mtDNA escape [, ] | Back alignment and domain information |
|---|
| >PRK05541 adenylylsulfate kinase; Provisional | Back alignment and domain information |
|---|
| >PF13604 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL_A 3E1S_A 3GP8_A | Back alignment and domain information |
|---|
| >PRK04296 thymidine kinase; Provisional | Back alignment and domain information |
|---|
| >PF08357 SEFIR: SEFIR domain; InterPro: IPR013568 This domain is found in IL17 receptors (IL17Rs, e | Back alignment and domain information |
|---|
| >KOG0729 consensus 26S proteasome regulatory complex, ATPase RPT1 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >KOG2004 consensus Mitochondrial ATP-dependent protease PIM1/LON [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF13238 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB_A 3IIM_A 2AXP_A 3KB2_A 1KHT_A 1NKS_A 3H86_C | Back alignment and domain information |
|---|
| >COG0470 HolB ATPase involved in DNA replication [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PF01583 APS_kinase: Adenylylsulphate kinase; InterPro: IPR002891 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases | Back alignment and domain information |
|---|
| >KOG1514 consensus Origin recognition complex, subunit 1, and related proteins [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] | Back alignment and domain information |
|---|
| >PRK08699 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PRK09361 radB DNA repair and recombination protein RadB; Provisional | Back alignment and domain information |
|---|
| >PF00485 PRK: Phosphoribulokinase / Uridine kinase family; InterPro: IPR006083 Phosphoribulokinase (PRK) 2 | Back alignment and domain information |
|---|
| >TIGR01420 pilT_fam pilus retraction protein PilT | Back alignment and domain information |
|---|
| >cd01121 Sms Sms (bacterial radA) DNA repair protein | Back alignment and domain information |
|---|
| >cd01858 NGP_1 NGP-1 | Back alignment and domain information |
|---|
| >cd00561 CobA_CobO_BtuR ATP:corrinoid adenosyltransferase BtuR/CobO/CobP | Back alignment and domain information |
|---|
| >KOG0738 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated | Back alignment and domain information |
|---|
| >PRK12724 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >COG0572 Udk Uridine kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PRK15429 formate hydrogenlyase transcriptional activator FhlA; Provisional | Back alignment and domain information |
|---|
| >cd01394 radB RadB | Back alignment and domain information |
|---|
| >KOG0652 consensus 26S proteasome regulatory complex, ATPase RPT5 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK10416 signal recognition particle-docking protein FtsY; Provisional | Back alignment and domain information |
|---|
| >COG1875 NYN ribonuclease and ATPase of PhoH family domains [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR01817 nifA Nif-specific regulatory protein | Back alignment and domain information |
|---|
| >TIGR02237 recomb_radB DNA repair and recombination protein RadB | Back alignment and domain information |
|---|
| >PRK12727 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >PF07726 AAA_3: ATPase family associated with various cellular activities (AAA); InterPro: IPR011703 This entry includes some of the AAA proteins not detected by the IPR003959 from INTERPRO model | Back alignment and domain information |
|---|
| >PRK11608 pspF phage shock protein operon transcriptional activator; Provisional | Back alignment and domain information |
|---|
| >PTZ00301 uridine kinase; Provisional | Back alignment and domain information |
|---|
| >PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A | Back alignment and domain information |
|---|
| >KOG2123 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF03215 Rad17: Rad17 cell cycle checkpoint protein | Back alignment and domain information |
|---|
| >cd03221 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth | Back alignment and domain information |
|---|
| >KOG0731 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG4608 AppF ABC-type oligopeptide transport system, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >COG0464 SpoVK ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK06067 flagellar accessory protein FlaH; Validated | Back alignment and domain information |
|---|
| >KOG0733 consensus Nuclear AAA ATPase (VCP subfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK15455 PrkA family serine protein kinase; Provisional | Back alignment and domain information |
|---|
| >PRK05480 uridine/cytidine kinase; Provisional | Back alignment and domain information |
|---|
| >cd03223 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette transporter (Pat) is involved in the import of very long-chain fatty acids (VLCFA) into the peroxisome | Back alignment and domain information |
|---|
| >COG2607 Predicted ATPase (AAA+ superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >COG2884 FtsE Predicted ATPase involved in cell division [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PRK04040 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >PF14532 Sigma54_activ_2: Sigma-54 interaction domain; PDB: 3CO5_B 3N70_H | Back alignment and domain information |
|---|
| >PRK03839 putative kinase; Provisional | Back alignment and domain information |
|---|
| >cd02019 NK Nucleoside/nucleotide kinase (NK) is a protein superfamily consisting of multiple families of enzymes that share structural similarity and are functionally related to the catalysis of the reversible phosphate group transfer from nucleoside triphosphates to nucleosides/nucleotides, nucleoside monophosphates, or sugars | Back alignment and domain information |
|---|
| >PRK08233 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >cd01129 PulE-GspE PulE/GspE The type II secretory pathway is the main terminal branch of the general secretory pathway (GSP) | Back alignment and domain information |
|---|
| >KOG1969 consensus DNA replication checkpoint protein CHL12/CTF18 [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] | Back alignment and domain information |
|---|
| >cd03222 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor (RLI) is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids | Back alignment and domain information |
|---|
| >TIGR02974 phageshock_pspF psp operon transcriptional activator PspF | Back alignment and domain information |
|---|
| >PRK05022 anaerobic nitric oxide reductase transcription regulator; Provisional | Back alignment and domain information |
|---|
| >PRK06762 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK00625 shikimate kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR00235 udk uridine kinase | Back alignment and domain information |
|---|
| >cd01393 recA_like RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response | Back alignment and domain information |
|---|
| >PRK12723 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >cd00983 recA RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response | Back alignment and domain information |
|---|
| >KOG0728 consensus 26S proteasome regulatory complex, ATPase RPT6 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd03214 ABC_Iron-Siderophores_B12_Hemin ABC transporters, involved in the uptake of siderophores, heme, and vitamin B12, are widely conserved in bacteria and archaea | Back alignment and domain information |
|---|
| >PF08433 KTI12: Chromatin associated protein KTI12 ; InterPro: IPR013641 This is a family of chromatin associated proteins which interact with the Elongator complex, a component of the elongating form of RNA polymerase II [] | Back alignment and domain information |
|---|
| >PRK12726 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >PRK06547 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG0651 consensus 26S proteasome regulatory complex, ATPase RPT4 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK13531 regulatory ATPase RavA; Provisional | Back alignment and domain information |
|---|
| >KOG0743 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF13671 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B | Back alignment and domain information |
|---|
| >PF00910 RNA_helicase: RNA helicase; InterPro: IPR000605 Helicases have been classified in 5 superfamilies (SF1-SF5) | Back alignment and domain information |
|---|
| >PTZ00088 adenylate kinase 1; Provisional | Back alignment and domain information |
|---|
| >cd01135 V_A-ATPase_B V/A-type ATP synthase (non-catalytic) subunit B | Back alignment and domain information |
|---|
| >cd03238 ABC_UvrA The excision repair protein UvrA; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion | Back alignment and domain information |
|---|
| >TIGR00416 sms DNA repair protein RadA | Back alignment and domain information |
|---|
| >TIGR01360 aden_kin_iso1 adenylate kinase, isozyme 1 subfamily | Back alignment and domain information |
|---|
| >PRK12597 F0F1 ATP synthase subunit beta; Provisional | Back alignment and domain information |
|---|
| >PHA00729 NTP-binding motif containing protein | Back alignment and domain information |
|---|
| >PRK06995 flhF flagellar biosynthesis regulator FlhF; Validated | Back alignment and domain information |
|---|
| >PRK00131 aroK shikimate kinase; Reviewed | Back alignment and domain information |
|---|
| >cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes | Back alignment and domain information |
|---|
| >PRK06217 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK09280 F0F1 ATP synthase subunit beta; Validated | Back alignment and domain information |
|---|
| >TIGR03499 FlhF flagellar biosynthetic protein FlhF | Back alignment and domain information |
|---|
| >KOG2035 consensus Replication factor C, subunit RFC3 [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] | Back alignment and domain information |
|---|
| >cd00544 CobU Adenosylcobinamide kinase / adenosylcobinamide phosphate guanyltransferase (CobU) | Back alignment and domain information |
|---|
| >COG1121 ZnuC ABC-type Mn/Zn transport systems, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK14723 flhF flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >COG1428 Deoxynucleoside kinases [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PRK09354 recA recombinase A; Provisional | Back alignment and domain information |
|---|
| >KOG1051 consensus Chaperone HSP104 and related ATP-dependent Clp proteases [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK13947 shikimate kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR02012 tigrfam_recA protein RecA | Back alignment and domain information |
|---|
| >PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A | Back alignment and domain information |
|---|
| >cd02028 UMPK_like Uridine monophosphate kinase_like (UMPK_like) is a family of proteins highly similar to the uridine monophosphate kinase (UMPK, EC 2 | Back alignment and domain information |
|---|
| >PRK08356 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK11823 DNA repair protein RadA; Provisional | Back alignment and domain information |
|---|
| >PRK12678 transcription termination factor Rho; Provisional | Back alignment and domain information |
|---|
| >PRK00889 adenylylsulfate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK05439 pantothenate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK09270 nucleoside triphosphate hydrolase domain-containing protein; Reviewed | Back alignment and domain information |
|---|
| >PF03205 MobB: Molybdopterin guanine dinucleotide synthesis protein B; PDB: 2F1R_B 1P9N_A 1NP6_B 2NPI_A 1XJC_A | Back alignment and domain information |
|---|
| >PRK10923 glnG nitrogen regulation protein NR(I); Provisional | Back alignment and domain information |
|---|
| >PF00006 ATP-synt_ab: ATP synthase alpha/beta family, nucleotide-binding domain This Pfam entry corresponds to chains a,b,c,d,e and f; InterPro: IPR000194 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane | Back alignment and domain information |
|---|
| >KOG0726 consensus 26S proteasome regulatory complex, ATPase RPT2 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0734 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK03846 adenylylsulfate kinase; Provisional | Back alignment and domain information |
|---|
| >PF00437 T2SE: Type II/IV secretion system protein; InterPro: IPR001482 A number of bacterial proteins, some of which are involved in a general secretion pathway (GSP) for the export of proteins (also called the type II pathway) belong to this group [, ] | Back alignment and domain information |
|---|
| >PRK05973 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] | Back alignment and domain information |
|---|
| >TIGR00554 panK_bact pantothenate kinase, bacterial type | Back alignment and domain information |
|---|
| >TIGR01039 atpD ATP synthase, F1 beta subunit | Back alignment and domain information |
|---|
| >KOG1532 consensus GTPase XAB1, interacts with DNA repair protein XPA [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PF10236 DAP3: Mitochondrial ribosomal death-associated protein 3; InterPro: IPR019368 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms | Back alignment and domain information |
|---|
| >COG3640 CooC CO dehydrogenase maturation factor [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >cd00227 CPT Chloramphenicol (Cm) phosphotransferase (CPT) | Back alignment and domain information |
|---|
| >TIGR03877 thermo_KaiC_1 KaiC domain protein, Ph0284 family | Back alignment and domain information |
|---|
| >cd02024 NRK1 Nicotinamide riboside kinase (NRK) is an enzyme involved in the metabolism of nicotinamide adenine dinucleotide (NAD+) | Back alignment and domain information |
|---|
| >cd01857 HSR1_MMR1 HSR1/MMR1 | Back alignment and domain information |
|---|
| >COG0055 AtpD F0F1-type ATP synthase, beta subunit [Energy production and conversion] | Back alignment and domain information |
|---|
| >PRK10820 DNA-binding transcriptional regulator TyrR; Provisional | Back alignment and domain information |
|---|
| >cd03240 ABC_Rad50 The catalytic domains of Rad50 are similar to the ATP-binding cassette of ABC transporters, but are not associated with membrane-spanning domains | Back alignment and domain information |
|---|
| >TIGR01359 UMP_CMP_kin_fam UMP-CMP kinase family | Back alignment and domain information |
|---|
| >cd02025 PanK Pantothenate kinase (PanK) catalyzes the phosphorylation of pantothenic acid to form 4'-phosphopantothenic, which is the first of five steps in coenzyme A (CoA) biosynthetic pathway | Back alignment and domain information |
|---|
| >COG1102 Cmk Cytidylate kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >cd03216 ABC_Carb_Monos_I This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos) | Back alignment and domain information |
|---|
| >PF00406 ADK: Adenylate kinase; InterPro: IPR000850 Adenylate kinases (ADK) are phosphotransferases that catalyse the reversible reaction |
Back alignment and domain information |
|---|
| >cd02023 UMPK Uridine monophosphate kinase (UMPK, EC 2 | Back alignment and domain information |
|---|
| >cd03228 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-like transporters are involved in drug, peptide, and lipid export | Back alignment and domain information |
|---|
| >PRK10463 hydrogenase nickel incorporation protein HypB; Provisional | Back alignment and domain information |
|---|
| >COG1066 Sms Predicted ATP-dependent serine protease [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG0003 ArsA Predicted ATPase involved in chromosome partitioning [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PRK13949 shikimate kinase; Provisional | Back alignment and domain information |
|---|
| >KOG1970 consensus Checkpoint RAD17-RFC complex, RAD17/RAD24 component [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] | Back alignment and domain information |
|---|
| >COG0488 Uup ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] | Back alignment and domain information |
|---|
| >PRK10751 molybdopterin-guanine dinucleotide biosynthesis protein B; Provisional | Back alignment and domain information |
|---|
| >PRK13948 shikimate kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR02858 spore_III_AA stage III sporulation protein AA | Back alignment and domain information |
|---|
| >cd01122 GP4d_helicase GP4d_helicase is a homohexameric 5'-3' helicases | Back alignment and domain information |
|---|
| >TIGR00390 hslU ATP-dependent protease HslVU, ATPase subunit | Back alignment and domain information |
|---|
| >PF03308 ArgK: ArgK protein; InterPro: IPR005129 Bacterial periplasmic transport systems require the function of a specific substrate-binding protein, located in the periplasm, and several cytoplasmic membrane transport components | Back alignment and domain information |
|---|
| >TIGR00150 HI0065_YjeE ATPase, YjeE family | Back alignment and domain information |
|---|
| >cd00071 GMPK Guanosine monophosphate kinase (GMPK, EC 2 | Back alignment and domain information |
|---|
| >cd02020 CMPK Cytidine monophosphate kinase (CMPK) catalyzes the reversible phosphorylation of cytidine monophosphate (CMP) to produce cytidine diphosphate (CDP), using ATP as the preferred phosphoryl donor | Back alignment and domain information |
|---|
| >PHA02244 ATPase-like protein | Back alignment and domain information |
|---|
| >PRK06002 fliI flagellum-specific ATP synthase; Validated | Back alignment and domain information |
|---|
| >PRK13946 shikimate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK11388 DNA-binding transcriptional regulator DhaR; Provisional | Back alignment and domain information |
|---|
| >cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases | Back alignment and domain information |
|---|
| >COG2401 ABC-type ATPase fused to a predicted acetyltransferase domain [General function prediction only] | Back alignment and domain information |
|---|
| >PF03266 NTPase_1: NTPase; InterPro: IPR004948 This entry represents a family of nucleoside-triphosphatases which have activity towards ATP, GTP, CTP, TTP and UTP and may hydrolyse nucleoside diphosphates with lower efficiency [] | Back alignment and domain information |
|---|
| >TIGR02322 phosphon_PhnN phosphonate metabolism protein/1,5-bisphosphokinase (PRPP-forming) PhnN | Back alignment and domain information |
|---|
| >cd00464 SK Shikimate kinase (SK) is the fifth enzyme in the shikimate pathway, a seven-step biosynthetic pathway which converts erythrose-4-phosphate to chorismic acid, found in bacteria, fungi and plants | Back alignment and domain information |
|---|
| >PRK08972 fliI flagellum-specific ATP synthase; Validated | Back alignment and domain information |
|---|
| >TIGR00708 cobA cob(I)alamin adenosyltransferase | Back alignment and domain information |
|---|
| >KOG3928 consensus Mitochondrial ribosome small subunit component, mediator of apoptosis DAP3 [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >cd02021 GntK Gluconate kinase (GntK) catalyzes the phosphoryl transfer from ATP to gluconate | Back alignment and domain information |
|---|
| >cd01132 F1_ATPase_alpha F1 ATP synthase alpha, central domain | Back alignment and domain information |
|---|
| >PRK14493 putative bifunctional molybdopterin-guanine dinucleotide biosynthesis protein MobB/MoaE; Provisional | Back alignment and domain information |
|---|
| >COG0703 AroK Shikimate kinase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >cd03283 ABC_MutS-like MutS-like homolog in eukaryotes | Back alignment and domain information |
|---|
| >TIGR02788 VirB11 P-type DNA transfer ATPase VirB11 | Back alignment and domain information |
|---|
| >TIGR02655 circ_KaiC circadian clock protein KaiC | Back alignment and domain information |
|---|
| >COG0465 HflB ATP-dependent Zn proteases [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF06068 TIP49: TIP49 C-terminus; InterPro: IPR010339 This family consists of the C-terminal region of several eukaryotic and archaeal RuvB-like 1 (Pontin or TIP49a) and RuvB-like 2 (Reptin or TIP49b) proteins | Back alignment and domain information |
|---|
| >PLN02796 D-glycerate 3-kinase | Back alignment and domain information |
|---|
| >PRK05201 hslU ATP-dependent protease ATP-binding subunit HslU; Provisional | Back alignment and domain information |
|---|
| >PRK08149 ATP synthase SpaL; Validated | Back alignment and domain information |
|---|
| >PRK13768 GTPase; Provisional | Back alignment and domain information |
|---|
| >PRK13975 thymidylate kinase; Provisional | Back alignment and domain information |
|---|
| >PLN03046 D-glycerate 3-kinase; Provisional | Back alignment and domain information |
|---|
| >COG1936 Predicted nucleotide kinase (related to CMP and AMP kinases) [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PF00154 RecA: recA bacterial DNA recombination protein; InterPro: IPR013765 The recA gene product is a multifunctional enzyme that plays a role in homologous recombination, DNA repair and induction of the SOS response [] | Back alignment and domain information |
|---|
| >PF12775 AAA_7: P-loop containing dynein motor region D3; PDB: 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A 3VKH_A 3VKG_A | Back alignment and domain information |
|---|
| >PRK05057 aroK shikimate kinase I; Reviewed | Back alignment and domain information |
|---|
| >TIGR00176 mobB molybdopterin-guanine dinucleotide biosynthesis protein MobB | Back alignment and domain information |
|---|
| >PF00625 Guanylate_kin: Guanylate kinase; InterPro: IPR008144 Guanylate kinase (2 | Back alignment and domain information |
|---|
| >PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] | Back alignment and domain information |
|---|
| >PRK14530 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK12339 2-phosphoglycerate kinase; Provisional | Back alignment and domain information |
|---|
| >cd00267 ABC_ATPase ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules | Back alignment and domain information |
|---|
| >TIGR03878 thermo_KaiC_2 KaiC domain protein, AF_0795 family | Back alignment and domain information |
|---|
| >TIGR02524 dot_icm_DotB Dot/Icm secretion system ATPase DotB | Back alignment and domain information |
|---|
| >TIGR02782 TrbB_P P-type conjugative transfer ATPase TrbB | Back alignment and domain information |
|---|
| >KOG0727 consensus 26S proteasome regulatory complex, ATPase RPT3 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK15453 phosphoribulokinase; Provisional | Back alignment and domain information |
|---|
| >COG3854 SpoIIIAA ncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >COG0468 RecA RecA/RadA recombinase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK14529 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >COG0563 Adk Adenylate kinase and related kinases [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >COG2019 AdkA Archaeal adenylate kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >COG0529 CysC Adenylylsulfate kinase and related kinases [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR03574 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal | Back alignment and domain information |
|---|
| >PRK14526 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >CHL00059 atpA ATP synthase CF1 alpha subunit | Back alignment and domain information |
|---|
| >TIGR03600 phage_DnaB phage replicative helicase, DnaB family, HK022 subfamily | Back alignment and domain information |
|---|
| >TIGR01287 nifH nitrogenase iron protein | Back alignment and domain information |
|---|
| >COG1224 TIP49 DNA helicase TIP49, TBP-interacting protein [Transcription] | Back alignment and domain information |
|---|
| >cd02034 CooC The accessory protein CooC, which contains a nucleotide-binding domain (P-loop) near the N-terminus, participates in the maturation of the nickel center of carbon monoxide dehydrogenase (CODH) | Back alignment and domain information |
|---|
| >CHL00060 atpB ATP synthase CF1 beta subunit | Back alignment and domain information |
|---|
| >PF03029 ATP_bind_1: Conserved hypothetical ATP binding protein; InterPro: IPR004130 Members of this family are found in a range of archaea and eukaryotes and have hypothesised ATP binding activity | Back alignment and domain information |
|---|
| >COG0194 Gmk Guanylate kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR03324 alt_F1F0_F1_al alternate F1F0 ATPase, F1 subunit alpha | Back alignment and domain information |
|---|
| >TIGR03263 guanyl_kin guanylate kinase | Back alignment and domain information |
|---|
| >PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D | Back alignment and domain information |
|---|
| >cd04121 Rab40 Rab40 subfamily | Back alignment and domain information |
|---|
| >COG0396 sufC Cysteine desulfurase activator ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd01983 Fer4_NifH The Fer4_NifH superfamily contains a variety of proteins which share a common ATP-binding domain | Back alignment and domain information |
|---|
| >PTZ00494 tuzin-like protein; Provisional | Back alignment and domain information |
|---|
| >PLN02200 adenylate kinase family protein | Back alignment and domain information |
|---|
| >COG1763 MobB Molybdopterin-guanine dinucleotide biosynthesis protein [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >COG1124 DppF ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >cd01136 ATPase_flagellum-secretory_path_III Flagellum-specific ATPase/type III secretory pathway virulence-related protein | Back alignment and domain information |
|---|
| >PRK14738 gmk guanylate kinase; Provisional | Back alignment and domain information |
|---|
| >COG0378 HypB Ni2+-binding GTPase involved in regulation of expression and maturation of urease and hydrogenase [Posttranslational modification, protein turnover, chaperones / Transcription] | Back alignment and domain information |
|---|
| >PRK03731 aroL shikimate kinase II; Reviewed | Back alignment and domain information |
|---|
| >cd02027 APSK Adenosine 5'-phosphosulfate kinase (APSK) catalyzes the phosphorylation of adenosine 5'-phosphosulfate to form 3'-phosphoadenosine 5'-phosphosulfate (PAPS) | Back alignment and domain information |
|---|
| >COG0467 RAD55 RecA-superfamily ATPases implicated in signal transduction [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0066 consensus eIF2-interacting protein ABC50 (ABC superfamily) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PRK04182 cytidylate kinase; Provisional | Back alignment and domain information |
|---|
| >PLN02318 phosphoribulokinase/uridine kinase | Back alignment and domain information |
|---|
| >PF02374 ArsA_ATPase: Anion-transporting ATPase; PDB: 2WOO_A 3IBG_B 3SJA_A 3H84_B 3SJD_A 3ZS9_A 3A37_A 2WOJ_A 3SJC_B 3A36_B | Back alignment and domain information |
|---|
| >cd03281 ABC_MSH5_euk MutS5 homolog in eukaryotes | Back alignment and domain information |
|---|
| >cd03116 MobB Molybdenum is an essential trace element in the form of molybdenum cofactor (Moco) which is associated with the metabolism of nitrogen, carbon and sulfur by redox active enzymes | Back alignment and domain information |
|---|
| >TIGR01069 mutS2 MutS2 family protein | Back alignment and domain information |
|---|
| >TIGR01313 therm_gnt_kin carbohydrate kinase, thermoresistant glucokinase family | Back alignment and domain information |
|---|
| >PRK09435 membrane ATPase/protein kinase; Provisional | Back alignment and domain information |
|---|
| >PRK15115 response regulator GlrR; Provisional | Back alignment and domain information |
|---|
| >cd01125 repA Hexameric Replicative Helicase RepA | Back alignment and domain information |
|---|
| >PRK08927 fliI flagellum-specific ATP synthase; Validated | Back alignment and domain information |
|---|
| >KOG0780 consensus Signal recognition particle, subunit Srp54 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PRK07132 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >TIGR03305 alt_F1F0_F1_bet alternate F1F0 ATPase, F1 subunit beta | Back alignment and domain information |
|---|
| >COG4088 Predicted nucleotide kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 1243 | ||||
| 3jrn_A | 176 | Crystal Structure Of Tir Domain From Arabidopsis Th | 4e-33 | ||
| 3ozi_A | 204 | Crystal Structure Of The Tir Domain From The Flax D | 3e-31 | ||
| 4fcg_A | 328 | Structure Of The Leucine-Rich Repeat Domain Of The | 4e-06 | ||
| 3sfz_A | 1249 | Crystal Structure Of Full-Length Murine Apaf-1 Leng | 8e-04 |
| >pdb|3JRN|A Chain A, Crystal Structure Of Tir Domain From Arabidopsis Thaliana Length = 176 | Back alignment and structure |
|
| >pdb|3OZI|A Chain A, Crystal Structure Of The Tir Domain From The Flax Disease Resistance Protein L6 Length = 204 | Back alignment and structure |
| >pdb|4FCG|A Chain A, Structure Of The Leucine-Rich Repeat Domain Of The Type Iii Effector Xcv3220 (Xopl) Length = 328 | Back alignment and structure |
| >pdb|3SFZ|A Chain A, Crystal Structure Of Full-Length Murine Apaf-1 Length = 1249 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 1243 | |||
| 3jrn_A | 176 | AT1G72930 protein; TIR domain arabidopsis thaliana | 7e-88 | |
| 3ozi_A | 204 | L6TR; plant TIR domain, plant protein; 2.30A {Linu | 2e-85 | |
| 3h16_A | 154 | TIR protein; bacteria TIR domain, signaling protei | 2e-64 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 6e-55 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 1e-46 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 3e-39 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 4e-35 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 1e-29 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 2e-21 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 3e-49 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 2e-11 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 5e-06 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 2e-41 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 8e-39 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 3e-35 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 1e-32 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 1e-23 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 2e-22 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 2e-10 | |
| 2a5y_B | 549 | CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis | 2e-40 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 1e-35 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 7e-33 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 3e-30 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 2e-28 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 1e-12 | |
| 3g06_A | 622 | SSPH2 (leucine-rich repeat protein); E3 ubiquitin | 5e-34 | |
| 3g06_A | 622 | SSPH2 (leucine-rich repeat protein); E3 ubiquitin | 4e-30 | |
| 3g06_A | 622 | SSPH2 (leucine-rich repeat protein); E3 ubiquitin | 1e-17 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 4e-33 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 4e-31 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 1e-21 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 2e-19 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 9e-15 | |
| 1z6t_A | 591 | APAF-1, apoptotic protease activating factor 1; ca | 7e-33 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 2e-32 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 5e-27 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 4e-25 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 8e-32 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 4e-30 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 1e-28 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 4e-18 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 1e-28 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 4e-24 | |
| 3fxi_A | 605 | TLR4, htoll, TOLL-like receptor 4; leucine rich re | 1e-28 | |
| 3fxi_A | 605 | TLR4, htoll, TOLL-like receptor 4; leucine rich re | 7e-24 | |
| 3fxi_A | 605 | TLR4, htoll, TOLL-like receptor 4; leucine rich re | 1e-19 | |
| 3fxi_A | 605 | TLR4, htoll, TOLL-like receptor 4; leucine rich re | 2e-11 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 2e-28 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 3e-28 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 2e-27 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 4e-24 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 3e-10 | |
| 3o6n_A | 390 | APL1; leucine-rich repeat, protein binding; HET: N | 2e-28 | |
| 3o6n_A | 390 | APL1; leucine-rich repeat, protein binding; HET: N | 2e-12 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 4e-28 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 2e-20 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 6e-19 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 8e-18 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 4e-11 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 4e-06 | |
| 2id5_A | 477 | Lingo-1, leucine rich repeat neuronal 6A; CNS-spec | 9e-28 | |
| 2id5_A | 477 | Lingo-1, leucine rich repeat neuronal 6A; CNS-spec | 4e-22 | |
| 2id5_A | 477 | Lingo-1, leucine rich repeat neuronal 6A; CNS-spec | 2e-14 | |
| 3jqh_A | 167 | C-type lectin domain family 4 member M; DC-signr, | 1e-27 | |
| 3jqh_A | 167 | C-type lectin domain family 4 member M; DC-signr, | 3e-27 | |
| 3jqh_A | 167 | C-type lectin domain family 4 member M; DC-signr, | 4e-24 | |
| 3jqh_A | 167 | C-type lectin domain family 4 member M; DC-signr, | 1e-19 | |
| 3o53_A | 317 | Protein LRIM1, AGAP006348-PA; leucine-rich repeat, | 5e-27 | |
| 3o53_A | 317 | Protein LRIM1, AGAP006348-PA; leucine-rich repeat, | 1e-22 | |
| 3o53_A | 317 | Protein LRIM1, AGAP006348-PA; leucine-rich repeat, | 5e-21 | |
| 3o53_A | 317 | Protein LRIM1, AGAP006348-PA; leucine-rich repeat, | 9e-14 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 9e-26 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 2e-25 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 3e-23 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 4e-23 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 9e-23 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 3e-20 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 2e-17 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 2e-04 | |
| 3bz5_A | 457 | Internalin-J, INLJ; leucine rich repeat (LRR), cys | 1e-25 | |
| 3bz5_A | 457 | Internalin-J, INLJ; leucine rich repeat (LRR), cys | 8e-25 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 2e-25 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 5e-23 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 1e-21 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 4e-20 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 4e-25 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 1e-21 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 1e-21 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 8e-16 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 1e-24 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 4e-20 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 5e-18 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 3e-17 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 9e-08 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 1e-24 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 8e-23 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 1e-22 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 7e-22 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 4e-16 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 4e-16 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 4e-12 | |
| 3zyi_A | 452 | Leucine-rich repeat-containing protein 4; cell adh | 5e-24 | |
| 3zyi_A | 452 | Leucine-rich repeat-containing protein 4; cell adh | 3e-23 | |
| 3zyi_A | 452 | Leucine-rich repeat-containing protein 4; cell adh | 5e-09 | |
| 3sfz_A | 1249 | APAF-1, apoptotic peptidase activating factor 1; a | 1e-23 | |
| 3cvr_A | 571 | Invasion plasmid antigen; leucine rich repeat and | 3e-23 | |
| 3cvr_A | 571 | Invasion plasmid antigen; leucine rich repeat and | 2e-13 | |
| 2z66_A | 306 | Variable lymphocyte receptor B, TOLL-like recepto; | 3e-23 | |
| 2z66_A | 306 | Variable lymphocyte receptor B, TOLL-like recepto; | 5e-12 | |
| 2z66_A | 306 | Variable lymphocyte receptor B, TOLL-like recepto; | 8e-09 | |
| 3zyj_A | 440 | Leucine-rich repeat-containing protein 4C; cell ad | 4e-23 | |
| 3zyj_A | 440 | Leucine-rich repeat-containing protein 4C; cell ad | 5e-23 | |
| 3zyj_A | 440 | Leucine-rich repeat-containing protein 4C; cell ad | 2e-09 | |
| 1xku_A | 330 | Decorin; proteoglycan, leucine-rich repeat, struct | 3e-21 | |
| 1xku_A | 330 | Decorin; proteoglycan, leucine-rich repeat, struct | 1e-19 | |
| 1xku_A | 330 | Decorin; proteoglycan, leucine-rich repeat, struct | 1e-08 | |
| 1xku_A | 330 | Decorin; proteoglycan, leucine-rich repeat, struct | 5e-07 | |
| 3v47_A | 455 | TOLL-like receptor 5B and variable lymphocyte REC | 6e-21 | |
| 3v47_A | 455 | TOLL-like receptor 5B and variable lymphocyte REC | 7e-14 | |
| 3v47_A | 455 | TOLL-like receptor 5B and variable lymphocyte REC | 3e-09 | |
| 3v47_A | 455 | TOLL-like receptor 5B and variable lymphocyte REC | 1e-07 | |
| 2z80_A | 353 | TOLL-like receptor 2, variable lymphocyte recepto; | 1e-20 | |
| 2z80_A | 353 | TOLL-like receptor 2, variable lymphocyte recepto; | 3e-10 | |
| 2z80_A | 353 | TOLL-like receptor 2, variable lymphocyte recepto; | 4e-05 | |
| 2xwt_C | 239 | Thyrotropin receptor; signaling protein-immune sys | 2e-20 | |
| 2xwt_C | 239 | Thyrotropin receptor; signaling protein-immune sys | 3e-13 | |
| 2xwt_C | 239 | Thyrotropin receptor; signaling protein-immune sys | 2e-11 | |
| 2xwt_C | 239 | Thyrotropin receptor; signaling protein-immune sys | 5e-05 | |
| 1ozn_A | 285 | Reticulon 4 receptor; NOGO receptor, MAD, myelinat | 2e-20 | |
| 1ozn_A | 285 | Reticulon 4 receptor; NOGO receptor, MAD, myelinat | 4e-18 | |
| 1ozn_A | 285 | Reticulon 4 receptor; NOGO receptor, MAD, myelinat | 7e-09 | |
| 1ozn_A | 285 | Reticulon 4 receptor; NOGO receptor, MAD, myelinat | 2e-05 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 2e-20 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 3e-19 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 3e-17 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 8e-17 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 1e-16 | |
| 2ft3_A | 332 | Biglycan; proteoglycan, dimer interface, structura | 3e-19 | |
| 2ft3_A | 332 | Biglycan; proteoglycan, dimer interface, structura | 2e-17 | |
| 2ft3_A | 332 | Biglycan; proteoglycan, dimer interface, structura | 2e-09 | |
| 2ft3_A | 332 | Biglycan; proteoglycan, dimer interface, structura | 1e-08 | |
| 2ft3_A | 332 | Biglycan; proteoglycan, dimer interface, structura | 1e-07 | |
| 1h6u_A | 308 | Internalin H; cell adhesion, leucine rich repeat, | 4e-19 | |
| 1h6u_A | 308 | Internalin H; cell adhesion, leucine rich repeat, | 6e-19 | |
| 1h6u_A | 308 | Internalin H; cell adhesion, leucine rich repeat, | 6e-16 | |
| 1h6u_A | 308 | Internalin H; cell adhesion, leucine rich repeat, | 4e-09 | |
| 1m9s_A | 605 | Internalin B; cell invasion, GW domains, SH3 domai | 5e-17 | |
| 1m9s_A | 605 | Internalin B; cell invasion, GW domains, SH3 domai | 1e-15 | |
| 1m9s_A | 605 | Internalin B; cell invasion, GW domains, SH3 domai | 1e-15 | |
| 1m9s_A | 605 | Internalin B; cell invasion, GW domains, SH3 domai | 9e-12 | |
| 1m9s_A | 605 | Internalin B; cell invasion, GW domains, SH3 domai | 8e-04 | |
| 1h6t_A | 291 | Internalin B; cell adhesion, leucine rich repeat, | 1e-16 | |
| 1h6t_A | 291 | Internalin B; cell adhesion, leucine rich repeat, | 9e-16 | |
| 1h6t_A | 291 | Internalin B; cell adhesion, leucine rich repeat, | 1e-11 | |
| 1h6t_A | 291 | Internalin B; cell adhesion, leucine rich repeat, | 9e-07 | |
| 4ay9_X | 350 | Follicle-stimulating hormone receptor; hormone-rec | 2e-16 | |
| 4ay9_X | 350 | Follicle-stimulating hormone receptor; hormone-rec | 1e-11 | |
| 3ub2_A | 146 | TOLL/interleukin-1 receptor domain-containing ADA | 8e-16 | |
| 3a79_B | 562 | TLR6, VLRB.59, TOLL-like receptor 6, variable lymp | 2e-15 | |
| 3a79_B | 562 | TLR6, VLRB.59, TOLL-like receptor 6, variable lymp | 1e-11 | |
| 3a79_B | 562 | TLR6, VLRB.59, TOLL-like receptor 6, variable lymp | 2e-05 | |
| 2z62_A | 276 | TOLL-like receptor 4, variable lymphocyte recepto; | 4e-15 | |
| 2z62_A | 276 | TOLL-like receptor 4, variable lymphocyte recepto; | 6e-13 | |
| 2z62_A | 276 | TOLL-like receptor 4, variable lymphocyte recepto; | 8e-04 | |
| 1ogq_A | 313 | PGIP-2, polygalacturonase inhibiting protein; inhi | 1e-14 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 5e-14 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 2e-11 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 1e-10 | |
| 2z7x_B | 520 | TOLL-like receptor 1, variable lymphocyte recepto; | 5e-14 | |
| 2z7x_B | 520 | TOLL-like receptor 1, variable lymphocyte recepto; | 3e-11 | |
| 2z7x_B | 520 | TOLL-like receptor 1, variable lymphocyte recepto; | 4e-09 | |
| 2z7x_B | 520 | TOLL-like receptor 1, variable lymphocyte recepto; | 2e-06 | |
| 1p9a_G | 290 | Platelet glycoprotein IB alpha chain precursor; pl | 5e-14 | |
| 1p9a_G | 290 | Platelet glycoprotein IB alpha chain precursor; pl | 4e-13 | |
| 1p9a_G | 290 | Platelet glycoprotein IB alpha chain precursor; pl | 6e-13 | |
| 1p9a_G | 290 | Platelet glycoprotein IB alpha chain precursor; pl | 1e-06 | |
| 1p9a_G | 290 | Platelet glycoprotein IB alpha chain precursor; pl | 6e-05 | |
| 2o6q_A | 270 | Variable lymphocyte receptor A; leucine-rich repea | 3e-13 | |
| 2o6q_A | 270 | Variable lymphocyte receptor A; leucine-rich repea | 3e-11 | |
| 2xot_A | 361 | Amphoterin-induced protein 1; cell adhesion, neuro | 3e-13 | |
| 2xot_A | 361 | Amphoterin-induced protein 1; cell adhesion, neuro | 6e-09 | |
| 2xot_A | 361 | Amphoterin-induced protein 1; cell adhesion, neuro | 1e-05 | |
| 4ezg_A | 197 | Putative uncharacterized protein; internalin-A, le | 4e-13 | |
| 4ezg_A | 197 | Putative uncharacterized protein; internalin-A, le | 1e-09 | |
| 1dce_A | 567 | Protein (RAB geranylgeranyltransferase alpha subun | 1e-12 | |
| 1dce_A | 567 | Protein (RAB geranylgeranyltransferase alpha subun | 5e-07 | |
| 1wwl_A | 312 | Monocyte differentiation antigen CD14; LPS, immune | 2e-12 | |
| 1wwl_A | 312 | Monocyte differentiation antigen CD14; LPS, immune | 1e-11 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 4e-11 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 4e-10 | |
| 1xeu_A | 263 | Internalin C; cellular invasion, leucine-rich repe | 5e-11 | |
| 1xeu_A | 263 | Internalin C; cellular invasion, leucine-rich repe | 1e-10 | |
| 1xeu_A | 263 | Internalin C; cellular invasion, leucine-rich repe | 2e-10 | |
| 1xeu_A | 263 | Internalin C; cellular invasion, leucine-rich repe | 2e-06 | |
| 1xeu_A | 263 | Internalin C; cellular invasion, leucine-rich repe | 4e-04 | |
| 2v9t_B | 220 | SLIT homolog 2 protein N-product; structural prote | 3e-10 | |
| 2v9t_B | 220 | SLIT homolog 2 protein N-product; structural prote | 8e-07 | |
| 2v9t_B | 220 | SLIT homolog 2 protein N-product; structural prote | 3e-04 | |
| 2ast_B | 336 | S-phase kinase-associated protein 2; SCF-substrate | 3e-10 | |
| 2v70_A | 220 | SLIT-2, SLIT homolog 2 protein N-product; neurogen | 6e-10 | |
| 2v70_A | 220 | SLIT-2, SLIT homolog 2 protein N-product; neurogen | 6e-07 | |
| 3m19_A | 251 | Variable lymphocyte receptor A diversity region; a | 9e-09 | |
| 3m19_A | 251 | Variable lymphocyte receptor A diversity region; a | 2e-05 | |
| 1z7x_W | 461 | Ribonuclease inhibitor; leucine-rich repeat, enzym | 1e-08 | |
| 2wfh_A | 193 | SLIT homolog 2 protein C-product; developmental pr | 1e-08 | |
| 1t3g_A | 159 | X-linked interleukin-1 receptor accessory protein- | 2e-08 | |
| 2ifg_A | 347 | High affinity nerve growth factor receptor; TRK, T | 2e-08 | |
| 2ifg_A | 347 | High affinity nerve growth factor receptor; TRK, T | 1e-04 | |
| 2ifg_A | 347 | High affinity nerve growth factor receptor; TRK, T | 7e-04 | |
| 2o6s_A | 208 | Variable lymphocyte receptor B; leucine-rich repea | 6e-08 | |
| 2o6s_A | 208 | Variable lymphocyte receptor B; leucine-rich repea | 2e-05 | |
| 3rfs_A | 272 | Internalin B, repeat modules, variable lymphocyte | 1e-07 | |
| 3rfs_A | 272 | Internalin B, repeat modules, variable lymphocyte | 7e-06 | |
| 2je0_A | 149 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 5e-07 | |
| 2je0_A | 149 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 1e-05 | |
| 2o6r_A | 177 | Variable lymphocyte receptor B; leucine-rich repea | 1e-06 | |
| 2ell_A | 168 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 2e-06 | |
| 2ell_A | 168 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 4e-04 | |
| 1ds9_A | 198 | Outer arm dynein; leucine-rich repeat, beta-BETA-a | 3e-06 | |
| 1ds9_A | 198 | Outer arm dynein; leucine-rich repeat, beta-BETA-a | 2e-05 | |
| 1ds9_A | 198 | Outer arm dynein; leucine-rich repeat, beta-BETA-a | 6e-05 | |
| 1ds9_A | 198 | Outer arm dynein; leucine-rich repeat, beta-BETA-a | 2e-04 | |
| 2j67_A | 178 | TOLL like receptor 10; TIR, IL-1, TLR10, membrane, | 2e-05 | |
| 3e6j_A | 229 | Variable lymphocyte receptor diversity region; var | 4e-05 | |
| 2ca6_A | 386 | RAN GTPase-activating protein 1; GAP, GTPase activ | 7e-05 | |
| 1w8a_A | 192 | SLIT protein; signaling protein, secreted protein, | 5e-04 | |
| 1a9n_A | 176 | U2A', U2A'; complex (nuclear protein/RNA), RNA, sn | 7e-04 |
| >3jrn_A AT1G72930 protein; TIR domain arabidopsis thaliana, plant protein; 2.00A {Arabidopsis thaliana} Length = 176 | Back alignment and structure |
|---|
Score = 280 bits (720), Expect = 7e-88
Identities = 76/179 (42%), Positives = 108/179 (60%), Gaps = 5/179 (2%)
Query: 1 MASSSSCNYDVFLSFRGVDTRASFTCHLYDSLFERKKIRTFIDDEELRQGDAISPVLLNA 60
M+S ++ YDVFLSFRG DTR +F LY L R+ IRTF DD+EL G SP L +
Sbjct: 1 MSSHTATKYDVFLSFRGHDTRHNFISFLYKEL-VRRSIRTFKDDKELENGQRFSPELKSP 59
Query: 61 IQGSKISLIIFSKDYASSKWCLNELVKILECKNTNGQIVIPVFYNVSPSDVRHQTGIFGD 120
I+ S+ ++++ S++YA+S WCL+ELV I++ + V+P+FY V P+ VR QTG+ +
Sbjct: 60 IEVSRFAVVVVSENYAASSWCLDELVTIMDFEKKGSITVMPIFYGVEPNHVRWQTGVLAE 119
Query: 121 GFDKLEQQFKEKPEIVQKWRYALRETSHLAGHESTKFRHDAQLVNKIVEDILKKLEKIT 179
F K +E PE V KWR AL + L+G S D++LV+KI +I K
Sbjct: 120 QFKKHAS--REDPEKVLKWRQALTNFAQLSGDCSG--DDDSKLVDKIANEISNKKTIYA 174
|
| >3ozi_A L6TR; plant TIR domain, plant protein; 2.30A {Linum usitatissimum} Length = 204 | Back alignment and structure |
|---|
| >3h16_A TIR protein; bacteria TIR domain, signaling protein; 2.50A {Paracoccus denitrificans PD1222} Length = 154 | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 | Back alignment and structure |
|---|
| >2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Length = 549 | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 | Back alignment and structure |
|---|
| >1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Length = 591 | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 | Back alignment and structure |
|---|
| >3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 | Back alignment and structure |
|---|
| >3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 | Back alignment and structure |
|---|
| >3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 | Back alignment and structure |
|---|
| >3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 | Back alignment and structure |
|---|
| >3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Length = 1249 | Back alignment and structure |
|---|
| >3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 | Back alignment and structure |
|---|
| >3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 | Back alignment and structure |
|---|
| >2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 | Back alignment and structure |
|---|
| >2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 | Back alignment and structure |
|---|
| >2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 | Back alignment and structure |
|---|
| >3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 | Back alignment and structure |
|---|
| >3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 | Back alignment and structure |
|---|
| >3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 | Back alignment and structure |
|---|
| >3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 | Back alignment and structure |
|---|
| >2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 | Back alignment and structure |
|---|
| >2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 | Back alignment and structure |
|---|
| >2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 | Back alignment and structure |
|---|
| >2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 | Back alignment and structure |
|---|
| >2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 | Back alignment and structure |
|---|
| >2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 | Back alignment and structure |
|---|
| >2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 | Back alignment and structure |
|---|
| >1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 | Back alignment and structure |
|---|
| >1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 | Back alignment and structure |
|---|
| >1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 | Back alignment and structure |
|---|
| >1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 | Back alignment and structure |
|---|
| >1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 | Back alignment and structure |
|---|
| >1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 | Back alignment and structure |
|---|
| >1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 | Back alignment and structure |
|---|
| >1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 | Back alignment and structure |
|---|
| >1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 | Back alignment and structure |
|---|
| >1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 | Back alignment and structure |
|---|
| >1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 | Back alignment and structure |
|---|
| >1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 | Back alignment and structure |
|---|
| >1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 | Back alignment and structure |
|---|
| >1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 | Back alignment and structure |
|---|
| >1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 | Back alignment and structure |
|---|
| >1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 | Back alignment and structure |
|---|
| >1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 | Back alignment and structure |
|---|
| >4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 | Back alignment and structure |
|---|
| >4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 | Back alignment and structure |
|---|
| >3ub2_A TOLL/interleukin-1 receptor domain-containing ADA protein; TIR domain, TLRS adaptor, immune system; 2.40A {Homo sapiens} PDB: 3ub3_A 3ub4_A 2y92_A Length = 146 | Back alignment and structure |
|---|
| >3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 | Back alignment and structure |
|---|
| >3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 | Back alignment and structure |
|---|
| >3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 | Back alignment and structure |
|---|
| >2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 | Back alignment and structure |
|---|
| >2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 | Back alignment and structure |
|---|
| >2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 | Back alignment and structure |
|---|
| >1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 | Back alignment and structure |
|---|
| >2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 | Back alignment and structure |
|---|
| >2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 | Back alignment and structure |
|---|
| >2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 | Back alignment and structure |
|---|
| >2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 | Back alignment and structure |
|---|
| >1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 | Back alignment and structure |
|---|
| >1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 | Back alignment and structure |
|---|
| >1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 | Back alignment and structure |
|---|
| >1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 | Back alignment and structure |
|---|
| >1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 | Back alignment and structure |
|---|
| >2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 | Back alignment and structure |
|---|
| >2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 | Back alignment and structure |
|---|
| >2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 | Back alignment and structure |
|---|
| >2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 | Back alignment and structure |
|---|
| >2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 | Back alignment and structure |
|---|
| >1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 | Back alignment and structure |
|---|
| >1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 | Back alignment and structure |
|---|
| >1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 | Back alignment and structure |
|---|
| >1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 | Back alignment and structure |
|---|
| >1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 | Back alignment and structure |
|---|
| >1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 | Back alignment and structure |
|---|
| >1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 | Back alignment and structure |
|---|
| >1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 | Back alignment and structure |
|---|
| >1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 | Back alignment and structure |
|---|
| >2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 | Back alignment and structure |
|---|
| >2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 | Back alignment and structure |
|---|
| >2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 | Back alignment and structure |
|---|
| >2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 | Back alignment and structure |
|---|
| >2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 | Back alignment and structure |
|---|
| >2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 | Back alignment and structure |
|---|
| >3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 | Back alignment and structure |
|---|
| >3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 | Back alignment and structure |
|---|
| >1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 | Back alignment and structure |
|---|
| >2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 | Back alignment and structure |
|---|
| >1t3g_A X-linked interleukin-1 receptor accessory protein-like 1; TIR, IL-1RAPL, IL-1R, TLR, membrane protein; 2.30A {Homo sapiens} Length = 159 | Back alignment and structure |
|---|
| >2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 | Back alignment and structure |
|---|
| >2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 | Back alignment and structure |
|---|
| >2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 | Back alignment and structure |
|---|
| >2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 | Back alignment and structure |
|---|
| >2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 | Back alignment and structure |
|---|
| >3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 | Back alignment and structure |
|---|
| >3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 | Back alignment and structure |
|---|
| >2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 | Back alignment and structure |
|---|
| >2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 | Back alignment and structure |
|---|
| >2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 | Back alignment and structure |
|---|
| >2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 | Back alignment and structure |
|---|
| >2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 | Back alignment and structure |
|---|
| >1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 | Back alignment and structure |
|---|
| >1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 | Back alignment and structure |
|---|
| >1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 | Back alignment and structure |
|---|
| >1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 | Back alignment and structure |
|---|
| >2j67_A TOLL like receptor 10; TIR, IL-1, TLR10, membrane, innate immunity, immune response, leucine-rich repeat, glycoprotein, transmembrane; 2.20A {Homo sapiens} PDB: 1fyv_A Length = 178 | Back alignment and structure |
|---|
| >3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 | Back alignment and structure |
|---|
| >2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 | Back alignment and structure |
|---|
| >1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 | Back alignment and structure |
|---|
| >1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
No hit with probability above 80.00
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 1243 | ||||
| d2a5yb3 | 277 | c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenor | 2e-31 | |
| d1fyxa_ | 149 | c.23.2.1 (A:) Toll-like receptor 2, TLR2 {Human (H | 3e-18 | |
| d1fyva_ | 161 | c.23.2.1 (A:) Toll-like receptor 1, TLR1 {Human (H | 2e-17 | |
| d1xkua_ | 305 | c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 | 4e-13 | |
| d1xkua_ | 305 | c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 | 1e-11 | |
| d1xkua_ | 305 | c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 | 1e-10 | |
| d1xkua_ | 305 | c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 | 1e-05 | |
| d1xkua_ | 305 | c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 | 0.002 | |
| d1jl5a_ | 353 | c.10.2.6 (A:) Leucine rich effector protein YopM { | 2e-12 | |
| d1jl5a_ | 353 | c.10.2.6 (A:) Leucine rich effector protein YopM { | 3e-10 | |
| d1jl5a_ | 353 | c.10.2.6 (A:) Leucine rich effector protein YopM { | 2e-05 | |
| d1jl5a_ | 353 | c.10.2.6 (A:) Leucine rich effector protein YopM { | 1e-04 | |
| d1jl5a_ | 353 | c.10.2.6 (A:) Leucine rich effector protein YopM { | 2e-04 | |
| d1jl5a_ | 353 | c.10.2.6 (A:) Leucine rich effector protein YopM { | 6e-04 | |
| d1jl5a_ | 353 | c.10.2.6 (A:) Leucine rich effector protein YopM { | 0.001 | |
| d1jl5a_ | 353 | c.10.2.6 (A:) Leucine rich effector protein YopM { | 0.001 | |
| d1jl5a_ | 353 | c.10.2.6 (A:) Leucine rich effector protein YopM { | 0.004 | |
| d2omza2 | 384 | c.10.2.1 (A:33-416) Internalin A {Listeria monocyt | 3e-10 | |
| d2omza2 | 384 | c.10.2.1 (A:33-416) Internalin A {Listeria monocyt | 3e-10 | |
| d2omza2 | 384 | c.10.2.1 (A:33-416) Internalin A {Listeria monocyt | 6e-07 | |
| d2omza2 | 384 | c.10.2.1 (A:33-416) Internalin A {Listeria monocyt | 2e-04 | |
| d1ogqa_ | 313 | c.10.2.8 (A:) Polygalacturonase inhibiting protein | 9e-10 | |
| d1ogqa_ | 313 | c.10.2.8 (A:) Polygalacturonase inhibiting protein | 0.001 | |
| d1p9ag_ | 266 | c.10.2.7 (G:) von Willebrand factor binding domain | 8e-09 | |
| d2ca6a1 | 344 | c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom | 6e-06 | |
| d2ca6a1 | 344 | c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom | 0.002 | |
| d2astb2 | 284 | c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 | 6e-06 | |
| d2astb2 | 284 | c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 | 3e-04 | |
| d2astb2 | 284 | c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 | 0.001 | |
| d1ozna_ | 284 | c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept | 1e-05 | |
| d1ozna_ | 284 | c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept | 3e-04 | |
| d1xwdc1 | 242 | c.10.2.7 (C:18-259) Follicle-stimulating hormone r | 2e-05 | |
| d1xwdc1 | 242 | c.10.2.7 (C:18-259) Follicle-stimulating hormone r | 7e-04 | |
| d1h6ua2 | 227 | c.10.2.1 (A:36-262) Internalin H {Listeria monocyt | 2e-04 | |
| d1h6ua2 | 227 | c.10.2.1 (A:36-262) Internalin H {Listeria monocyt | 0.002 | |
| d1dcea3 | 124 | c.10.2.2 (A:444-567) Rab geranylgeranyltransferase | 3e-04 | |
| d1z7xw1 | 460 | c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( | 3e-04 | |
| d1z7xw1 | 460 | c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( | 0.003 | |
| d1a9na_ | 162 | c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom | 0.001 | |
| d1h6ta2 | 210 | c.10.2.1 (A:31-240) Internalin B {Listeria monocyt | 0.002 |
| >d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Length = 277 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: P-loop containing nucleoside triphosphate hydrolases superfamily: P-loop containing nucleoside triphosphate hydrolases family: Extended AAA-ATPase domain domain: CED-4, NB-ARC domain species: Caenorhabditis elegans [TaxId: 6239]
Score = 122 bits (307), Expect = 2e-31
Identities = 35/266 (13%), Positives = 79/266 (29%), Gaps = 25/266 (9%)
Query: 188 LVGLNSRIEQIKPFLCMDLSDTVQIVGIWGMGGIGKTTLATAIFNQF----SSEFEGRCF 243
++++ L + + G G GK+ +A+ ++ ++ +
Sbjct: 22 CYIREYHVDRVIKKLDEMCDLDSFFLFLHGRAGSGKSVIASQALSKSDQLIGINYDSIVW 81
Query: 244 MSDVRRNSETGGGLEHLQKQMLSTILSEKLEVAGPNI--------PQFTKERVRRMKVLI 295
+ D ++ + +L + L + R L
Sbjct: 82 LKDSGTAPKS--TFDLFTDILLMLKSEDDLLNFPSVEHVTSVVLKRMICNALIDRPNTLF 139
Query: 296 VLDDVNKVGQLEGLIGGLDQYGPGSRIVVTTRDKGVLEKFGVEEEKIYGVNGLEFDEAFE 355
V DDV + + R +VTTRD + + + V LE DE ++
Sbjct: 140 VFDDVVQEETIRWA------QELRLRCLVTTRDVEISNAAS-QTCEFIEVTSLEIDECYD 192
Query: 356 LFCNFAFEENHCPEDLNWHSRRVVWYATSNPLVLKVLGSSLCLKRKSHWENVLDDLNRIC 415
+ ++ + + + ++ NP L + S K + + L
Sbjct: 193 FLEAYGMPMPVGEKEEDV-LNKTIELSSGNPATLMMFFKSCEPKTFEKMAQLNNKLES-- 249
Query: 416 ESEIHDIYDILKISFNELIPREKSMF 441
+ + I S+ L +
Sbjct: 250 -RGLVGVECITPYSYKSLAMALQRCV 274
|
| >d1fyxa_ c.23.2.1 (A:) Toll-like receptor 2, TLR2 {Human (Homo sapiens) [TaxId: 9606]} Length = 149 | Back information, alignment and structure |
|---|
| >d1fyva_ c.23.2.1 (A:) Toll-like receptor 1, TLR1 {Human (Homo sapiens) [TaxId: 9606]} Length = 161 | Back information, alignment and structure |
|---|
| >d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 | Back information, alignment and structure |
|---|
| >d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 | Back information, alignment and structure |
|---|
| >d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 | Back information, alignment and structure |
|---|
| >d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 | Back information, alignment and structure |
|---|
| >d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 | Back information, alignment and structure |
|---|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 | Back information, alignment and structure |
|---|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 | Back information, alignment and structure |
|---|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 | Back information, alignment and structure |
|---|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 | Back information, alignment and structure |
|---|
| >d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 | Back information, alignment and structure |
|---|
| >d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 | Back information, alignment and structure |
|---|
| >d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 | Back information, alignment and structure |
|---|
| >d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 | Back information, alignment and structure |
|---|
| >d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 | Back information, alignment and structure |
|---|
| >d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 | Back information, alignment and structure |
|---|
| >d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 | Back information, alignment and structure |
|---|
| >d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 | Back information, alignment and structure |
|---|
| >d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 | Back information, alignment and structure |
|---|
| >d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 | Back information, alignment and structure |
|---|
| >d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 | Back information, alignment and structure |
|---|
| >d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 | Back information, alignment and structure |
|---|
| >d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 | Back information, alignment and structure |
|---|
| >d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 | Back information, alignment and structure |
|---|
| >d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 | Back information, alignment and structure |
|---|
| >d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 | Back information, alignment and structure |
|---|
| >d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 1243 | |||
| d2a5yb3 | 277 | CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI | 100.0 | |
| d2omza2 | 384 | Internalin A {Listeria monocytogenes [TaxId: 1639] | 99.95 | |
| d2omza2 | 384 | Internalin A {Listeria monocytogenes [TaxId: 1639] | 99.94 | |
| d1xkua_ | 305 | Decorin {Cow (Bos taurus) [TaxId: 9913]} | 99.92 | |
| d1ogqa_ | 313 | Polygalacturonase inhibiting protein PGIP {Kidney | 99.92 | |
| d1ogqa_ | 313 | Polygalacturonase inhibiting protein PGIP {Kidney | 99.9 | |
| d1xkua_ | 305 | Decorin {Cow (Bos taurus) [TaxId: 9913]} | 99.89 | |
| d1jl5a_ | 353 | Leucine rich effector protein YopM {Yersinia pesti | 99.87 | |
| d1jl5a_ | 353 | Leucine rich effector protein YopM {Yersinia pesti | 99.87 | |
| d1p9ag_ | 266 | von Willebrand factor binding domain of glycoprote | 99.83 | |
| d1ozna_ | 284 | Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma | 99.82 | |
| d1ozna_ | 284 | Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma | 99.8 | |
| d1p9ag_ | 266 | von Willebrand factor binding domain of glycoprote | 99.79 | |
| d1h6ua2 | 227 | Internalin H {Listeria monocytogenes [TaxId: 1639] | 99.71 | |
| d1fyva_ | 161 | Toll-like receptor 1, TLR1 {Human (Homo sapiens) [ | 99.69 | |
| d1h6ua2 | 227 | Internalin H {Listeria monocytogenes [TaxId: 1639] | 99.65 | |
| d2omxa2 | 199 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 99.63 | |
| d1h6ta2 | 210 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 99.63 | |
| d1fyxa_ | 149 | Toll-like receptor 2, TLR2 {Human (Homo sapiens) [ | 99.63 | |
| d1xwdc1 | 242 | Follicle-stimulating hormone receptor {Human (Homo | 99.62 | |
| d1xwdc1 | 242 | Follicle-stimulating hormone receptor {Human (Homo | 99.61 | |
| d2astb2 | 284 | Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa | 99.57 | |
| d1h6ta2 | 210 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 99.56 | |
| d2astb2 | 284 | Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa | 99.56 | |
| d2omxa2 | 199 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 99.56 | |
| d1z7xw1 | 460 | Ribonuclease inhibitor {Human (Homo sapiens) [TaxI | 99.46 | |
| d1z7xw1 | 460 | Ribonuclease inhibitor {Human (Homo sapiens) [TaxI | 99.41 | |
| d2fnaa2 | 283 | Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ | 99.39 | |
| d1w8aa_ | 192 | Slit {Fruit fly (Drosophila melanogaster) [TaxId: | 99.31 | |
| d2ca6a1 | 344 | Rna1p (RanGAP1), N-terminal domain {Fission yeast | 99.28 | |
| d2ca6a1 | 344 | Rna1p (RanGAP1), N-terminal domain {Fission yeast | 99.26 | |
| d1w8aa_ | 192 | Slit {Fruit fly (Drosophila melanogaster) [TaxId: | 99.24 | |
| d1a9na_ | 162 | Splicesomal U2A' protein {Human (Homo sapiens) [Ta | 99.24 | |
| d1dcea3 | 124 | Rab geranylgeranyltransferase alpha-subunit, C-ter | 99.07 | |
| d1fnna2 | 276 | CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T | 98.95 | |
| d1dcea3 | 124 | Rab geranylgeranyltransferase alpha-subunit, C-ter | 98.93 | |
| d2ifga3 | 156 | High affinity nerve growth factor receptor, N-term | 98.92 | |
| d1sxjd2 | 237 | Replication factor C2 {Baker's yeast (Saccharomyce | 98.88 | |
| d1sxjc2 | 227 | Replication factor C3 {Baker's yeast (Saccharomyce | 98.84 | |
| d1r6bx2 | 268 | ClpA, an Hsp100 chaperone, AAA+ modules {Escherich | 98.81 | |
| d1m9la_ | 198 | Outer arm dynein light chain 1 {Green algae (Chlam | 98.77 | |
| d1sxjb2 | 224 | Replication factor C4 {Baker's yeast (Saccharomyce | 98.76 | |
| d1sxje2 | 252 | Replication factor C5 {Baker's yeast (Saccharomyce | 98.74 | |
| d1njfa_ | 239 | delta prime subunit of DNA polymerase III, N-domai | 98.72 | |
| d1iqpa2 | 231 | Replication factor C {Archaeon Pyrococcus furiosus | 98.69 | |
| d1w5sa2 | 287 | CDC6-like protein APE0152, N-terminal domain {Aero | 98.66 | |
| d1ixza_ | 247 | AAA domain of cell division protein FtsH {Thermus | 98.55 | |
| d1sxja2 | 253 | Replication factor C1 {Baker's yeast (Saccharomyce | 98.49 | |
| d1qvra2 | 387 | ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 | 98.49 | |
| d1a5ta2 | 207 | delta prime subunit of DNA polymerase III, N-domai | 98.44 | |
| d1jbka_ | 195 | ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} | 98.44 | |
| d1e32a2 | 258 | Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu | 98.44 | |
| d1lv7a_ | 256 | AAA domain of cell division protein FtsH {Escheric | 98.4 | |
| d1r7ra3 | 265 | Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu | 98.31 | |
| d1d2na_ | 246 | Hexamerization domain of N-ethylmalemide-sensitive | 98.26 | |
| d1in4a2 | 238 | Holliday junction helicase RuvB {Thermotoga mariti | 98.26 | |
| d1l8qa2 | 213 | Chromosomal replication initiation factor DnaA {Aq | 98.21 | |
| d1ixsb2 | 239 | Holliday junction helicase RuvB {Thermus thermophi | 98.18 | |
| d2gnoa2 | 198 | gamma subunit of DNA polymerase III, N-domain {The | 97.17 | |
| d1rz3a_ | 198 | Hypothetical protein rbstp0775 {Bacillus stearothe | 97.02 | |
| d1koha1 | 162 | mRNA export factor tap {Human (Homo sapiens) [TaxI | 96.99 | |
| d1m8pa3 | 183 | ATP sulfurylase C-terminal domain {Fungus (Penicil | 96.73 | |
| d1pgva_ | 167 | Tropomodulin C-terminal domain {nematode (Caenorha | 96.65 | |
| d1lw7a2 | 192 | Transcriptional regulator NadR, ribosylnicotinamid | 96.6 | |
| d1gvnb_ | 273 | Plasmid maintenance system epsilon/zeta, toxin zet | 96.55 | |
| d1ofha_ | 309 | HslU {Haemophilus influenzae [TaxId: 727]} | 96.52 | |
| d1ihua2 | 279 | Arsenite-translocating ATPase ArsA {Escherichia co | 96.51 | |
| d1x6va3 | 195 | Adenosine-5'phosphosulfate kinase (APS kinase) {Hu | 96.42 | |
| d1pgva_ | 167 | Tropomodulin C-terminal domain {nematode (Caenorha | 96.42 | |
| d1cp2a_ | 269 | Nitrogenase iron protein {Clostridium pasteurianum | 96.4 | |
| d1sq5a_ | 308 | Pantothenate kinase PanK {Escherichia coli [TaxId: | 96.35 | |
| d2i3ba1 | 189 | Cancer-related NTPase, C1orf57 {Human (Homo sapien | 96.28 | |
| d1kaga_ | 169 | Shikimate kinase (AroK) {Escherichia coli [TaxId: | 96.16 | |
| d1np6a_ | 170 | Molybdopterin-guanine dinucleotide biosynthesis pr | 96.06 | |
| d1ls1a2 | 207 | GTPase domain of the signal sequence recognition p | 96.06 | |
| d1qvra3 | 315 | ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 | 96.05 | |
| d2bdta1 | 176 | Hypothetical protein BH3686 {Bacillus halodurans [ | 96.02 | |
| d1knqa_ | 171 | Gluconate kinase {Escherichia coli [TaxId: 562]} | 95.97 | |
| d2qm8a1 | 323 | Metallochaperone MeaB {Methylobacterium extorquens | 95.9 | |
| d2p67a1 | 327 | LAO/AO transport system kinase ArgK {Escherichia c | 95.9 | |
| d2afhe1 | 289 | Nitrogenase iron protein {Azotobacter vinelandii [ | 95.87 | |
| d1rkba_ | 173 | Adenylate kinase {Human (Homo sapiens), isoenzyme | 95.86 | |
| d1r6bx3 | 315 | ClpA, an Hsp100 chaperone, AAA+ modules {Escherich | 95.84 | |
| d1khta_ | 190 | Adenylate kinase {Archaeon Methanococcus voltae [T | 95.81 | |
| d2iyva1 | 165 | Shikimate kinase (AroK) {Mycobacterium tuberculosi | 95.8 | |
| d2jdid3 | 276 | Central domain of beta subunit of F1 ATP synthase | 95.75 | |
| d1qhxa_ | 178 | Chloramphenicol phosphotransferase {Streptomyces v | 95.72 | |
| d1ly1a_ | 152 | Polynucleotide kinase, kinase domain {Bacteriophag | 95.7 | |
| d1viaa_ | 161 | Shikimate kinase (AroK) {Campylobacter jejuni [Tax | 95.67 | |
| d1ihua1 | 296 | Arsenite-translocating ATPase ArsA {Escherichia co | 95.63 | |
| d2qy9a2 | 211 | GTPase domain of the signal recognition particle r | 95.63 | |
| d1nksa_ | 194 | Adenylate kinase {Archaeon Sulfolobus acidocaldari | 95.58 | |
| d1svma_ | 362 | Papillomavirus large T antigen helicase domain {Si | 95.56 | |
| d1u94a1 | 263 | RecA protein, ATPase-domain {Escherichia coli [Tax | 95.53 | |
| d1bifa1 | 213 | 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata | 95.51 | |
| d1m7ga_ | 208 | Adenosine-5'phosphosulfate kinase (APS kinase) {Fu | 95.49 | |
| d1xjca_ | 165 | Molybdopterin-guanine dinucleotide biosynthesis pr | 95.39 | |
| d1qf9a_ | 194 | UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 | 95.37 | |
| d1e6ca_ | 170 | Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax | 95.36 | |
| d1ukza_ | 196 | Uridylate kinase {Baker's yeast (Saccharomyces cer | 95.34 | |
| d1uj2a_ | 213 | Uridine-cytidine kinase 2 {Human (Homo sapiens) [T | 95.22 | |
| d1y63a_ | 174 | Probable kinase LmjF30.1890 {Leishmania major [Tax | 95.18 | |
| d1tf7a2 | 242 | Circadian clock protein KaiC {Synechococcus sp. st | 95.17 | |
| d1io0a_ | 166 | Tropomodulin C-terminal domain {Chicken (Gallus ga | 95.14 | |
| d1zp6a1 | 176 | Hypothetical protein Atu3015 {Agrobacterium tumefa | 95.0 | |
| d1vmaa2 | 213 | GTPase domain of the signal recognition particle r | 94.98 | |
| d1ckea_ | 225 | CMP kinase {Escherichia coli [TaxId: 562]} | 94.97 | |
| d1g8pa_ | 333 | ATPase subunit of magnesium chelatase, BchI {Rhodo | 94.91 | |
| d1nn5a_ | 209 | Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 | 94.84 | |
| d1hyqa_ | 232 | Cell division regulator MinD {Archaeon Archaeoglob | 94.59 | |
| d1odfa_ | 286 | Hypothetical protein Ygr205W {Baker's yeast (Sacch | 94.56 | |
| d1ye8a1 | 178 | Hypothetical kinase-like protein Aq_1292 {Aquifex | 94.55 | |
| d1ak2a1 | 190 | Adenylate kinase {Cow (Bos taurus), mitochondrial | 94.49 | |
| d1ny5a2 | 247 | Transcriptional activator sigm54 (NtrC1), C-termin | 94.49 | |
| d1lvga_ | 190 | Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 | 94.41 | |
| d1q3ta_ | 223 | CMP kinase {Streptococcus pneumoniae [TaxId: 1313] | 94.41 | |
| d1xpua3 | 289 | Transcription termination factor Rho, ATPase domai | 94.38 | |
| d1yj5a2 | 172 | 5' polynucleotide kinase-3' phosphatase, C-termina | 94.26 | |
| d1teva_ | 194 | UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] | 94.25 | |
| d1okkd2 | 207 | GTPase domain of the signal recognition particle r | 94.21 | |
| d1g3qa_ | 237 | Cell division regulator MinD {Archaeon Pyrococcus | 94.18 | |
| d1fx0a3 | 276 | Central domain of alpha subunit of F1 ATP synthase | 94.18 | |
| d1gkya_ | 186 | Guanylate kinase {Baker's yeast (Saccharomyces cer | 94.14 | |
| d1j8yf2 | 211 | GTPase domain of the signal sequence recognition p | 93.97 | |
| d1zaka1 | 189 | Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} | 93.95 | |
| d1v5wa_ | 258 | Meiotic recombination protein DMC1/LIM15 homolog { | 93.93 | |
| d1a7ja_ | 288 | Phosphoribulokinase {Rhodobacter sphaeroides [TaxI | 93.93 | |
| d1w44a_ | 321 | NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} | 93.89 | |
| d1xp8a1 | 268 | RecA protein, ATPase-domain {Deinococcus radiodura | 93.81 | |
| d1zina1 | 182 | Adenylate kinase {Bacillus stearothermophilus [Tax | 93.68 | |
| d1akya1 | 180 | Adenylate kinase {Baker's yeast (Saccharomyces cer | 93.66 | |
| d1um8a_ | 364 | ClpX {Helicobacter pylori [TaxId: 210]} | 93.65 | |
| d1uf9a_ | 191 | Dephospho-CoA kinase {Thermus thermophilus [TaxId: | 93.63 | |
| d1kgda_ | 178 | Guanylate kinase-like domain of Cask {Human (Homo | 93.51 | |
| d2jdia3 | 285 | Central domain of alpha subunit of F1 ATP synthase | 93.46 | |
| d2ak3a1 | 189 | Adenylate kinase {Cow (Bos taurus), mitochondrial | 93.46 | |
| d2cdna1 | 181 | Adenylate kinase {Mycobacterium tuberculosis [TaxI | 93.42 | |
| d3adka_ | 194 | Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} | 93.4 | |
| d1s3ga1 | 182 | Adenylate kinase {Bacillus globisporus [TaxId: 145 | 93.2 | |
| d2ocpa1 | 241 | Deoxyguanosine kinase {Human (Homo sapiens) [TaxId | 93.13 | |
| d1pzna2 | 254 | DNA repair protein Rad51, catalytic domain {Archae | 92.88 | |
| d1znwa1 | 182 | Guanylate kinase {Mycobacterium tuberculosis [TaxI | 92.58 | |
| d1e4va1 | 179 | Adenylate kinase {Escherichia coli [TaxId: 562]} | 92.42 | |
| d1p9ra_ | 401 | Extracellular secretion NTPase EpsE {Vibrio choler | 92.33 | |
| d1gsia_ | 208 | Thymidylate kinase {Mycobacterium tuberculosis [Ta | 92.32 | |
| d1yrba1 | 244 | ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss | 92.31 | |
| d1byia_ | 224 | Dethiobiotin synthetase {Escherichia coli [TaxId: | 92.17 | |
| d1mo6a1 | 269 | RecA protein, ATPase-domain {Mycobacterium tubercu | 92.14 | |
| d2vp4a1 | 197 | Deoxyribonucleoside kinase {Fruit fly (Drosophila | 91.57 | |
| d2i1qa2 | 258 | DNA repair protein Rad51, catalytic domain {Archae | 91.54 | |
| d1tf7a1 | 242 | Circadian clock protein KaiC {Synechococcus sp. st | 91.41 | |
| d1n0wa_ | 242 | DNA repair protein Rad51, catalytic domain {Human | 91.34 | |
| d1vhta_ | 208 | Dephospho-CoA kinase {Escherichia coli [TaxId: 562 | 90.87 | |
| d1s96a_ | 205 | Guanylate kinase {Escherichia coli [TaxId: 562]} | 90.87 | |
| d1p6xa_ | 333 | Thymidine kinase {Equine herpesvirus type 4 [TaxId | 90.81 | |
| d1g6oa_ | 323 | Hexameric traffic ATPase, HP0525 {Helicobacter pyl | 90.78 | |
| d1tmka_ | 214 | Thymidylate kinase {Baker's yeast (Saccharomyces c | 90.67 | |
| d1szpa2 | 251 | DNA repair protein Rad51, catalytic domain {Baker' | 90.19 | |
| d1jjva_ | 205 | Dephospho-CoA kinase {Haemophilus influenzae [TaxI | 89.93 | |
| d1p5zb_ | 241 | Deoxycytidine kinase {Human (Homo sapiens) [TaxId: | 89.9 | |
| d1deka_ | 241 | Deoxynucleoside monophosphate kinase {Bacteriophag | 89.79 | |
| d1g41a_ | 443 | HslU {Haemophilus influenzae [TaxId: 727]} | 89.46 | |
| d1g2912 | 240 | Maltose transport protein MalK, N-terminal domain | 89.31 | |
| d1r0wa_ | 281 | Cystic fibrosis transmembrane conductance regulato | 89.25 | |
| d4tmka_ | 210 | Thymidylate kinase {Escherichia coli [TaxId: 562]} | 89.19 | |
| d1b0ua_ | 258 | ATP-binding subunit of the histidine permease {Sal | 89.04 | |
| d1f6ba_ | 186 | SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: | 88.91 | |
| d3b60a1 | 253 | Multidrug resistance ABC transporter MsbA, C-termi | 88.86 | |
| d3dhwc1 | 240 | Methionine import ATP-binding protein MetN {Escher | 88.82 | |
| d1l2ta_ | 230 | MJ0796 {Archaeon Methanococcus jannaschii [TaxId: | 88.35 | |
| d2pmka1 | 241 | Haemolysin B ATP-binding protein {Escherichia coli | 88.22 | |
| d2bv3a2 | 276 | Elongation factor G (EF-G), N-terminal (G) domain | 88.04 | |
| d1v43a3 | 239 | Hypothetical protein PH0022, N-terminal domain {Py | 87.96 | |
| d2awna2 | 232 | Maltose transport protein MalK, N-terminal domain | 87.95 | |
| d1mv5a_ | 242 | Multidrug resistance ABC transporter LmrA, C-termi | 87.8 | |
| d1c1ya_ | 167 | Rap1A {Human (Homo sapiens) [TaxId: 9606]} | 87.79 | |
| d1jj7a_ | 251 | Peptide transporter Tap1, C-terminal ABC domain {H | 87.67 | |
| d2atva1 | 168 | Ras-like estrogen-regulated growth inhibitor, RERG | 87.47 | |
| d1nlfa_ | 274 | Hexameric replicative helicase repA {Escherichia c | 87.34 | |
| d1nija1 | 222 | Hypothetical protein YjiA, N-terminal domain {Esch | 87.32 | |
| d1osna_ | 331 | Thymidine kinase {Varicella-zoster virus [TaxId: 1 | 87.28 | |
| d3d31a2 | 229 | Sulfate/molybdate ABC transporter, ATP-binding pro | 87.11 | |
| d1sgwa_ | 200 | Putative ABC transporter PF0895 {Pyrococcus furios | 86.99 | |
| d2onka1 | 240 | Molybdate/tungstate import ATP-binding protein Wtp | 86.96 | |
| d1fzqa_ | 176 | ADP-ribosylation factor {Mouse (Mus musculus), ARL | 86.81 | |
| d1r8sa_ | 160 | ADP-ribosylation factor {Human (Homo sapiens), ARF | 86.7 | |
| d1svia_ | 195 | Probable GTPase EngB {Bacillus subtilis [TaxId: 14 | 86.65 | |
| d1w36d1 | 359 | Exodeoxyribonuclease V alpha chain (RecD) {Escheri | 86.64 | |
| d1htwa_ | 158 | Hypothetical protein HI0065 {Haemophilus influenza | 86.39 | |
| d1z06a1 | 165 | Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} | 86.37 | |
| d2a5ja1 | 173 | Rab2b {Human (Homo sapiens) [TaxId: 9606]} | 86.19 | |
| d1z0fa1 | 166 | Rab14 {Human (Homo sapiens) [TaxId: 9606]} | 86.1 | |
| d1oxxk2 | 242 | Glucose transport protein GlcV, N-terminal domain | 85.95 | |
| d1z2aa1 | 164 | Rab23 {Mouse (Mus musculus) [TaxId: 10090]} | 85.71 | |
| d1yzqa1 | 164 | Rab6 {Human (Homo sapiens) [TaxId: 9606]} | 85.64 | |
| d2ew1a1 | 171 | Rab30 {Human (Homo sapiens) [TaxId: 9606]} | 85.56 | |
| d1upta_ | 169 | ADP-ribosylation factor {Human (Homo sapiens), ARL | 85.53 | |
| d1kmqa_ | 177 | RhoA {Human (Homo sapiens) [TaxId: 9606]} | 85.33 | |
| d1z08a1 | 167 | Rab21 {Human (Homo sapiens) [TaxId: 9606]} | 85.3 | |
| d2dy1a2 | 267 | Elongation factor G (EF-G), N-terminal (G) domain | 85.28 | |
| d3raba_ | 169 | Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} | 85.12 | |
| d1xtqa1 | 167 | GTP-binding protein RheB {Human (Homo sapiens) [Ta | 85.12 | |
| d2fn4a1 | 173 | r-Ras {Human (Homo sapiens) [TaxId: 9606]} | 85.11 | |
| d1n0ua2 | 341 | Elongation factor 2 (eEF-2), N-terminal (G) domain | 84.97 | |
| d1r2qa_ | 170 | Rab5a {Human (Homo sapiens) [TaxId: 9606]} | 84.76 | |
| d1mkya1 | 171 | Probable GTPase Der, N-terminal and middle domains | 84.62 | |
| d2bmea1 | 174 | Rab4a {Human (Homo sapiens) [TaxId: 9606]} | 84.62 | |
| d2fh5b1 | 207 | Signal recognition particle receptor beta-subunit | 84.57 | |
| d1mh1a_ | 183 | Rac {Human (Homo sapiens) [TaxId: 9606]} | 84.41 | |
| d2erya1 | 171 | r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} | 84.31 | |
| d1z0ja1 | 167 | Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} | 84.27 | |
| d2erxa1 | 171 | di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} | 84.24 | |
| d2bcgy1 | 194 | GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisi | 84.16 | |
| d1g6ha_ | 254 | MJ1267 {Archaeon Methanococcus jannaschii [TaxId: | 84.16 | |
| d1g16a_ | 166 | Rab-related protein Sec4 {Baker's yeast (Saccharom | 84.04 | |
| d2atxa1 | 185 | RhoQ {Human (Homo sapiens) [TaxId: 9606]} | 84.01 | |
| d1kaoa_ | 167 | Rap2a {Human (Homo sapiens) [TaxId: 9606]} | 83.97 | |
| d1ji0a_ | 240 | Branched chain aminoacid ABC transporter {Thermoto | 83.81 | |
| d1wf3a1 | 178 | GTPase Era, N-terminal domain {Thermus thermophilu | 83.78 | |
| d2f7sa1 | 186 | Rab27b {Human (Homo sapiens) [TaxId: 9606]} | 83.77 | |
| d1ky3a_ | 175 | Rab-related protein ypt7p {Baker's yeast (Saccharo | 83.71 | |
| d1vpla_ | 238 | Putative ABC transporter TM0544 {Thermotoga mariti | 83.69 | |
| d2gjsa1 | 168 | Rad {Human (Homo sapiens) [TaxId: 9606]} | 83.65 | |
| d1svsa1 | 195 | Transducin (alpha subunit) {Rat (Rattus norvegicus | 83.52 | |
| d1zcba2 | 200 | Transducin (alpha subunit) {Mouse (Mus musculus) [ | 83.22 | |
| d2ngra_ | 191 | CDC42 {Human (Homo sapiens) [TaxId: 9606]} | 83.05 | |
| d1ksha_ | 165 | ADP-ribosylation factor {Mouse (Mus musculus), ARL | 83.0 | |
| d2g6ba1 | 170 | Rab26 {Human (Homo sapiens) [TaxId: 9606]} | 82.95 | |
| d1m7ba_ | 179 | RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} | 82.94 | |
| d1nrjb_ | 209 | Signal recognition particle receptor beta-subunit | 82.82 | |
| d1moza_ | 182 | ADP-ribosylation factor {Baker's yeast (Saccharomy | 82.77 | |
| d2f9la1 | 175 | Rab11b {Human (Homo sapiens) [TaxId: 9606]} | 82.48 | |
| d1udxa2 | 180 | Obg GTP-binding protein middle domain {Thermus the | 82.37 | |
| d1ek0a_ | 170 | Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [T | 82.22 | |
| d1ctqa_ | 166 | cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 | 82.17 | |
| d1h65a_ | 257 | Chloroplast protein translocon GTPase Toc34 {Garde | 82.09 | |
| d2bcjq2 | 200 | Transducin (alpha subunit) {Mouse (Mus musculus) [ | 82.02 | |
| d1azta2 | 221 | Transducin (alpha subunit) {Cow (Bos taurus) [TaxI | 81.83 | |
| d2hyda1 | 255 | Putative multidrug export ATP-binding/permease pro | 81.83 | |
| d1egaa1 | 179 | GTPase Era, N-terminal domain {Escherichia coli [T | 81.82 | |
| d1vg8a_ | 184 | Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} | 81.79 | |
| d2g3ya1 | 172 | GTP-binding protein GEM {Human (Homo sapiens) [Tax | 81.76 | |
| d1kkma_ | 176 | HPr kinase HprK C-terminal domain {Lactobacillus c | 81.7 | |
| d1x3sa1 | 177 | Rab18 {Human (Homo sapiens) [TaxId: 9606]} | 81.52 | |
| d1u8za_ | 168 | Ras-related protein RalA {Cotton-top tamarin (Sagu | 81.18 | |
| d2bmja1 | 175 | Centaurin gamma 1, G domain {Human (Homo sapiens) | 81.12 | |
| d1e2ka_ | 329 | Thymidine kinase {Herpes simplex virus type 1, dif | 81.11 | |
| d1puja_ | 273 | Probable GTPase YlqF {Bacillus subtilis [TaxId: 14 | 80.76 | |
| d1knxa2 | 177 | HPr kinase HprK C-terminal domain {Mycoplasma pneu | 80.43 | |
| d1l7vc_ | 231 | ABC transporter involved in vitamin B12 uptake, Bt | 80.26 | |
| d1zd9a1 | 164 | ADP-ribosylation factor {Human (Homo sapiens), ARL | 80.15 | |
| d1x1ra1 | 169 | Ras-related protein M-Ras (XRas) {Mouse (Mus muscu | 80.1 |
| >d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: P-loop containing nucleoside triphosphate hydrolases superfamily: P-loop containing nucleoside triphosphate hydrolases family: Extended AAA-ATPase domain domain: CED-4, NB-ARC domain species: Caenorhabditis elegans [TaxId: 6239]
Probab=100.00 E-value=8.6e-43 Score=297.45 Aligned_cols=247 Identities=15% Similarity=0.112 Sum_probs=195.7
Q ss_pred CCCCCCCCCCHHHHHHHHHHHCCCCCCCEEEEEEEECCCCHHHHHHHHHHHH----HHCCCCCEEEEEECCCCCCCCCCH
Q ss_conf 8888984232246986887621578997099999913885367999999998----731567239976140001689993
Q 000874 182 TDSSNGLVGLNSRIEQIKPFLCMDLSDTVQIVGIWGMGGIGKTTLATAIFNQ----FSSEFEGRCFMSDVRRNSETGGGL 257 (1243)
Q Consensus 182 ~~~~~~~vGr~~~~~~l~~~L~~~~~~~~~~i~I~G~gGiGKTtLA~~v~~~----~~~~F~~~~~~~~~~~~~~~~~~l 257 (1243)
......++||+.+++++.++|....+.+.++|+|+|||||||||||+++|++ ....|++++|+...+. ...
T Consensus 16 ~p~~~~~~gR~~~~~~i~~~L~~~~~~~~~~v~I~GmgGiGKTtLA~~v~~~~~~~~~~~f~~~~Wv~vs~~-----~~~ 90 (277)
T d2a5yb3 16 VPKQMTCYIREYHVDRVIKKLDEMCDLDSFFLFLHGRAGSGKSVIASQALSKSDQLIGINYDSIVWLKDSGT-----APK 90 (277)
T ss_dssp CBCCCCSCCCHHHHHHHHHHHHHHTTSSSEEEEEECSTTSSHHHHHHHHHHHCSSTBTTTBSEEEEEECCCC-----STT
T ss_pred CCCCCCEECCHHHHHHHHHHHHHCCCCCCEEEEEECCCCCCHHHHHHHHHHHHHHHHHHCCCEEEEEEECCC-----CCH
T ss_conf 999886237399999999998734687840899977997888999999998556554012764899993687-----777
Q ss_pred HHHHHH---HHHHHHCCCCC---CCCCCC-----CHHHHHHHCCCEEEEEEECCCCHHHHHHHHCCCCCCCCCCEEEEEE
Q ss_conf 899999---99866025643---359995-----0889986528628999806998344678742989779997599993
Q 000874 258 EHLQKQ---MLSTILSEKLE---VAGPNI-----PQFTKERVRRMKVLIVLDDVNKVGQLEGLIGGLDQYGPGSRIVVTT 326 (1243)
Q Consensus 258 ~~l~~~---ll~~l~~~~~~---~~~~~~-----~~~l~~~L~~k~~LlVLDdv~~~~~~~~l~~~~~~~~~gsrIIiTT 326 (1243)
..+... ++..+...... ...... ...+.+.+.++|+|+||||||+..+++.+. ..||||||||
T Consensus 91 ~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~L~~kr~LlVLDDv~~~~~~~~~~------~~~srilvTT 164 (277)
T d2a5yb3 91 STFDLFTDILLMLKSEDDLLNFPSVEHVTSVVLKRMICNALIDRPNTLFVFDDVVQEETIRWAQ------ELRLRCLVTT 164 (277)
T ss_dssp HHHHHHHHHHHHHTTTSCCTTCCCCTTCCHHHHHHHHHHHHTTSTTEEEEEEEECCHHHHHHHH------HTTCEEEEEE
T ss_pred HHHHHHHHHHHHHHCCHHHCCCCCCHHHHHHHHHHHHHHHHHCCCCEEEECCHHHHHHHHHHHC------CCCCEEEEEE
T ss_conf 7899999999987220220278632123369999999999844688167525066776655520------4575599996
Q ss_pred CCCCHHCCCCCCCCEEEECCCCCHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHCCCCHHHHHHHHHHCCCCHHHHHH
Q ss_conf 35310000288853289658999878999997731298999913899999999981799346899864307999879999
Q 000874 327 RDKGVLEKFGVEEEKIYGVNGLEFDEAFELFCNFAFEENHCPEDLNWHSRRVVWYATSNPLVLKVLGSSLCLKRKSHWEN 406 (1243)
Q Consensus 327 R~~~v~~~~~~~~~~~~~v~~L~~~ea~~Lf~~~af~~~~~~~~~~~l~~~i~~~~~glPLal~~lg~~L~~~~~~~w~~ 406 (1243)
|++.++..+..+. .+|+|++|+.+||++||+.++|....+ +...+++++|+++|+|+|||++++|+.|+.++.+.|.+
T Consensus 165 R~~~v~~~~~~~~-~~~~l~~L~~~ea~~Lf~~~~~~~~~~-~~~~~~~~~iv~~c~GlPLAl~~ig~~l~~k~~~~~~~ 242 (277)
T d2a5yb3 165 RDVEISNAASQTC-EFIEVTSLEIDECYDFLEAYGMPMPVG-EKEEDVLNKTIELSSGNPATLMMFFKSCEPKTFEKMAQ 242 (277)
T ss_dssp SBGGGGGGCCSCE-EEEECCCCCHHHHHHHHHHTSCCCC---CHHHHHHHHHHHHHTTCHHHHHHHHTTCCSSSHHHHHH
T ss_pred EHHHHHHHCCCCC-CEEECCCCCHHHHHHHHHHHHCCCCCC-HHHHHHHHHHHHHHCCCHHHHHHHHHHHCCCCHHHHHH
T ss_conf 4489998637887-168778899799999999984776674-25679999999995899899999999865598999999
Q ss_pred HHHHHHHCCCCCHHHHHHHHHHCCCCCCHHHHHHHHEE
Q ss_conf 99887520574224568587501136715445354001
Q 000874 407 VLDDLNRICESEIHDIYDILKISFNELIPREKSMFLDI 444 (1243)
Q Consensus 407 ~l~~l~~~~~~~i~~i~~~l~~sy~~L~~~~k~~fl~~ 444 (1243)
..+.+......++ ..++..||+.|+.+.|.||.++
T Consensus 243 ~~~~L~~~~~~~v---~~il~~sY~~L~~~lk~c~~~l 277 (277)
T d2a5yb3 243 LNNKLESRGLVGV---ECITPYSYKSLAMALQRCVEVL 277 (277)
T ss_dssp HHHHHHHHCSSTT---CCCSSSSSSSHHHHHHHHHHTS
T ss_pred HHHHHHCCCHHHH---HHHHHHHHHCCCHHHHHHHHHC
T ss_conf 9999734867889---9999998851269999999739
|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} | Back information, alignment and structure |
|---|
| >d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} | Back information, alignment and structure |
|---|
| >d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} | Back information, alignment and structure |
|---|
| >d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1fyva_ c.23.2.1 (A:) Toll-like receptor 1, TLR1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1fyxa_ c.23.2.1 (A:) Toll-like receptor 2, TLR2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} | Back information, alignment and structure |
|---|
| >d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} | Back information, alignment and structure |
|---|
| >d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} | Back information, alignment and structure |
|---|
| >d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} | Back information, alignment and structure |
|---|
| >d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1ihua2 c.37.1.10 (A:308-586) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1cp2a_ c.37.1.10 (A:) Nitrogenase iron protein {Clostridium pasteurianum [TaxId: 1501]} | Back information, alignment and structure |
|---|
| >d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} | Back information, alignment and structure |
|---|
| >d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} | Back information, alignment and structure |
|---|
| >d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2afhe1 c.37.1.10 (E:1-289) Nitrogenase iron protein {Azotobacter vinelandii [TaxId: 354]} | Back information, alignment and structure |
|---|
| >d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} | Back information, alignment and structure |
|---|
| >d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2jdid3 c.37.1.11 (D:82-357) Central domain of beta subunit of F1 ATP synthase {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} | Back information, alignment and structure |
|---|
| >d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} | Back information, alignment and structure |
|---|
| >d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} | Back information, alignment and structure |
|---|
| >d1ihua1 c.37.1.10 (A:1-296) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} | Back information, alignment and structure |
|---|
| >d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} | Back information, alignment and structure |
|---|
| >d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} | Back information, alignment and structure |
|---|
| >d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} | Back information, alignment and structure |
|---|
| >d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} | Back information, alignment and structure |
|---|
| >d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} | Back information, alignment and structure |
|---|
| >d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} | Back information, alignment and structure |
|---|
| >d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} | Back information, alignment and structure |
|---|
| >d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hyqa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1ny5a2 c.37.1.20 (A:138-384) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d1xpua3 c.37.1.11 (A:129-417) Transcription termination factor Rho, ATPase domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d1g3qa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1fx0a3 c.37.1.11 (A:97-372) Central domain of alpha subunit of F1 ATP synthase {Spinach (Spinacia oleracea), chloroplast [TaxId: 3562]} | Back information, alignment and structure |
|---|
| >d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} | Back information, alignment and structure |
|---|
| >d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} | Back information, alignment and structure |
|---|
| >d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]} | Back information, alignment and structure |
|---|
| >d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} | Back information, alignment and structure |
|---|
| >d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]} | Back information, alignment and structure |
|---|
| >d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2jdia3 c.37.1.11 (A:95-379) Central domain of alpha subunit of F1 ATP synthase {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} | Back information, alignment and structure |
|---|
| >d2ocpa1 c.37.1.1 (A:37-277) Deoxyguanosine kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} | Back information, alignment and structure |
|---|
| >d1byia_ c.37.1.10 (A:) Dethiobiotin synthetase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} | Back information, alignment and structure |
|---|
| >d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} | Back information, alignment and structure |
|---|
| >d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vhta_ c.37.1.1 (A:) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1p6xa_ c.37.1.1 (A:) Thymidine kinase {Equine herpesvirus type 4 [TaxId: 10331]} | Back information, alignment and structure |
|---|
| >d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d1tmka_ c.37.1.1 (A:) Thymidylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1jjva_ c.37.1.1 (A:) Dephospho-CoA kinase {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1p5zb_ c.37.1.1 (B:) Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1deka_ c.37.1.1 (A:) Deoxynucleoside monophosphate kinase {Bacteriophage T4 [TaxId: 10665]} | Back information, alignment and structure |
|---|
| >d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} | Back information, alignment and structure |
|---|
| >d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} | Back information, alignment and structure |
|---|
| >d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2bv3a2 c.37.1.8 (A:7-282) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} | Back information, alignment and structure |
|---|
| >d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1nija1 c.37.1.10 (A:2-223) Hypothetical protein YjiA, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1osna_ c.37.1.1 (A:) Thymidine kinase {Varicella-zoster virus [TaxId: 10335]} | Back information, alignment and structure |
|---|
| >d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} | Back information, alignment and structure |
|---|
| >d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1htwa_ c.37.1.18 (A:) Hypothetical protein HI0065 {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dy1a2 c.37.1.8 (A:8-274) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus, EF-G-2 [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1n0ua2 c.37.1.8 (A:3-343) Elongation factor 2 (eEF-2), N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1svsa1 c.37.1.8 (A:32-60,A:182-347) Transducin (alpha subunit) {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} | Back information, alignment and structure |
|---|
| >d2bcjq2 c.37.1.8 (Q:38-66,Q:184-354) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1azta2 c.37.1.8 (A:35-65,A:202-391) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kkma_ c.91.1.2 (A:) HPr kinase HprK C-terminal domain {Lactobacillus casei [TaxId: 1582]} | Back information, alignment and structure |
|---|
| >d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} | Back information, alignment and structure |
|---|
| >d2bmja1 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1e2ka_ c.37.1.1 (A:) Thymidine kinase {Herpes simplex virus type 1, different strains [TaxId: 10298]} | Back information, alignment and structure |
|---|
| >d1puja_ c.37.1.8 (A:) Probable GTPase YlqF {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1knxa2 c.91.1.2 (A:133-309) HPr kinase HprK C-terminal domain {Mycoplasma pneumoniae [TaxId: 2104]} | Back information, alignment and structure |
|---|
| >d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|