Citrus Sinensis ID: 000888

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------1000------1010------1020------1030------1040------1050------1060------1070------1080------1090------1100------1110------1120------1130------1140------1150------1160------1170------1180------1190------1200------1210------1220------1230------124
MVSTRRSGSFSGNNSKRSSSSEDKPPSPKRQKVENGGTVEKPVQSTDNSKEVCTPAAPDPGECGTGDTPIAGEGVSGGKTEATPAVSVTAPIAEGSTPGVMEKPRSSFSSWSLYQKQNPTFETSTPWCRLLSQSGQNSNVPICASIFTVGSSRQCNFPLKDQAISAVLCKIKHVQSEGSAVAMVESIGSKGLQVNGKNLKKNTSCELRSGDEVVFGSLGNHAYIFQQLLNEVAVKGAEVQSGPGKFLQLERRSGDPSAVAGASILASLSSLRSDLSRWKSPAQSTSKIHLGSELPTPSADNDGVEVDLDGLEGNSTANTDSDKAADIGSIGKNIPVECNQDAGIEAGNVKFSGVNDLLRPFLRMLAPSSSCNLKLSKSICKQVLDGRNEWRRDSQPASTLGMSLRCAVFREDILAGILDGTNLQESFENFPYYLSENTKNVLIAASYIHLKHKDHAKYTSELTTVNPRILLSGPAGSEIYQEMLAKALAHYFGAKLLIFDSHSLLGGLSSKEAELLKDGTSAEKSCGCVKQGPTSTDLAKSINLPVSESDTPSSSNPPPQGPESQPKMETDTTLTSAGTSKNHMLRIGDRVRFVGSTSGGLYPTASPTRGPPCGTRGKVALLFEDNPSSKIGVRFDKPIPDGVDLGGQCEGGHGFFCNVTDLRLENSGTEDLDKLLINTLFEVVFSESRSCPFILFMKDAEKSIAGNSDSYSTFKSRLEKLPDKVIVIGSHTHTDNRKEKSHPGGLLFTKFGSNQTALLDLAFPDSFGRLHDRGKEIPKATKLLTKLFPNKVTIHMPQDEALLASWKHQLDRDSETLKMKGNLNHLRTVLGRSGLECEGLETLCIRDQSLTNESAEKIVGWALSHHLMQNPEADPDARLVLSCESIQYGIGIFQAIQNESKSLKKSLKDVVTENEFEKRLLADVIPPSDIGVTFDDIGALENVKDTLKELVMLPLQRPELFCKGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFGEGEKYVKAVFSLASKIAPSVIFVDEVDSMLGRRENPGEHEAMRKMKNEFMVNWDGLRTKDTERILVLAATNRPFDLDEAVIRRLPRRLMVNLPDAPNRAKILQVILAKEDLSPDVDFDAIANMTDGYSGSDLKNLCVTAAHRPIKEILEKEKKERAAAMAEGKPAPALSGCADIRPLNMDDFKYAHERVCASVSSESVNMSELLQWNELYGEGGSRRKKALSYFM
ccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHccccccccEEEEEcEEEEccccccccccccccccccEEEEEEEEEcccEEEEEEEEccccEEEccEEcccccEEEEccccEEEEcccccccEEEEccccccccccccccccccccEEEEccccccccccHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHccccccccccccccHHHHHHcccccccccccccccccccHHHHHHHHHHHHccccccccccccccccccccHHHHHHHHHHHHHHcccccccccccccccccccEEEcccccHHHHHHHHHHHHHHHHcccEEEEEcccccccccHHHHHHHccccccccccccccccccccHHHHHccccccccccccccccccccccccccccccccccccccccccccccccEEEEEccccccccccccccccccccccccEEEccccccccccccccccccccccccccccccccccEEEcccccccccccccHHHHHHHHHHHHHccccccccEEEEEEccHHHccccccHHHHHHHHHHHccccEEEEEEcccccccccccccccccEEccccccHHHcccccccccccccccccccHHHHHHHHccccccEEEcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHcccHHHHHHHHHHHHHHccccccccHHHHHHHHcccccccccccccccccccHHHHHHHHHHHHccccccccccccccccccccEEEEcccccHHHHHHHHHHHHcccEEEEEEccccccccccHHHHHHHHHHHHHHHccccEEEEEccHHcccccccccccHHHHHHHHHHHHHHccccccccccEEEEEEccccccHHHHHHHccccccccccccHHHHHHHHHHHcccccccccccHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccHHHHHHHHHHccccccHHHHHcHHHHHHHHHHccccccccccccccc
cccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHccccccccccccHHHHHHccccccccEEEcccEEEEcccccccccccccccccHEEEEEEEcccccEEEEEEEEcccEEEEccEEEEcccEEEEccccEEEEcccccEEEEEEEccccccEEEEEccccccccEEEEcccccccHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHccccccccEccccccEEccHHHHHHHHHHHHHHHHHHHHHHHHHccccccccEEEcccccHHHHHHHHHHHHHHHccccEEEEEccccccccccccccccccccccccccHHHcccccHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccEEEEEcccccccccccccccccccccccEEEEEccccccEEEEEEcccccccccccccccccccccEEcHHHccccccccccHHHHHHHHHHHHHHHHcccccEEEEEccHHHHHcccHHHHHHHHHHHHHccccEEEEEccccccccccccccccEEEEEcccccccHcccccccccccccccccccccHHHHHHHHccccEEEcccccHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccccccHcHHcHccccccHHHHHHHHHHHHHHHHHHcccccccccEEEccHHHHHHHHHHHHHHccccccccccccccccccccccccHcccccccccccHHcHHHHHHHHHHHHHHHHcccccHHHHHHccccccccEEEEEcccccHHHHHHHHHHHHccccEEEEccHHHHHHHccccHHHHHHHHHHHHHcccEEEEEEcHHHHccccccccccHHHHHHHHHHHHHHccccccccccEEEEEEccccccccHHHHHHcccEEEcccccHHHHHHHHHHHHccccccccccHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccHHHHHHHHHHccccccHHHHHHcHHHHHHHHcccccccccccccccc
mvstrrsgsfsgnnskrssssedkppspkrqkvenggtvekpvqstdnskevctpaapdpgecgtgdtpiagegvsggkteatpavsvtapiaegstpgvmekprssfsswslyqkqnptfetstpwcrllsqsgqnsnvpicasiftvgssrqcnfplkdQAISAVLCKIKHVQSEGSAVAMVESIGskglqvngknlkkntscelrsgdevvfgslGNHAYIFQQLLNEVAVKgaevqsgpgkflqlerrsgdpsavAGASILASLSSLRSDlsrwkspaqstskihlgselptpsadndgvevdldglegnstantdsdkaadigsigknipvecnqdagieagnvkfsgvndlLRPFLrmlapssscnlklSKSICKQVLDgrnewrrdsqpastlgmsLRCAVFREDILAgildgtnlqesfenfpyylsenTKNVLIAASYIHLKhkdhakytselttvnprillsgpagSEIYQEMLAKALAHYFGAKLLIFdshsllgglsskEAELlkdgtsaekscgcvkqgptstdlaksinlpvsesdtpsssnpppqgpesqpkmetdttltsagtsknhmlriGDRVrfvgstsgglyptasptrgppcgtrgkVALLfednpsskigvrfdkpipdgvdlggqcegghgffcnvtdlrlensgtedLDKLLINTLFEVVfsesrscpfiLFMKDAeksiagnsdsySTFKSRleklpdkvIVIGshthtdnrkekshpggllftkfgsnqtalldlafpdsfgrlhdrgkeiPKATKLLTklfpnkvtihmpqdEALLASWKHQLDRDSETLKMKGNLNHLRTVLgrsglecegletLCIRDQSLTNESAEKIVGWALSHhlmqnpeadpdarLVLSCESIQYGIGIFQAIQNESKSLKKSLKDVVTENEFEKRlladvippsdigvtfddigALENVKDTLKELVMlplqrpelfckgqltkpckgillfgppgtgkTMLAKAVATEAGANFINISMSSITSKWFGEGEKYVKAVFSLASkiapsvifVDEVdsmlgrrenpgeHEAMRKMKNEFMvnwdglrtkDTERILVLAAtnrpfdldeAVIRRLPrrlmvnlpdapnRAKILQVILAkedlspdvdfdaianmtdgysgsdlknlcvtaAHRPIKEILEKEKKERAAAMaegkpapalsgcadirplnmddfkYAHERVCASVSSESVNMSELLQWNELYGEGGSRRKKALSYFM
mvstrrsgsfsgnnskrssssedkppspkrqkvenggtvekpvqstdnskevCTPAAPDPGECGTGDTPIAGEGVSGGKTEATPAVSvtapiaegstpgvmEKPRSSFSSWSLYQKQNPTFETSTPWCRLLSQSGQNSNVPICASIFTVGSSRQCNFPLKDQAISAVLCKIKHVQSEGSAVAMVESIgskglqvngknlkkntscelrsGDEVVFGSLGNHAYIFQQLLNEVAVKGAEVQSGPGKFLQLERRSGDPSAVAGASILASLSSLRSDLSRWKSPaqstskihlgselptpsadNDGVEVDLDGLEGnstantdsdkaadIGSIGKNIPVECNQDAGIEAGNVKFSGVNDLLRPFLRMLAPssscnlklsKSICKQVLdgrnewrrdsqpastlgmSLRCAVFREDILAGILDGTNLQESFENFPYYLSENTKNVLIAASYIHLKHKDHAKYTSELTTVNPRILLSGPAGSEIYQEMLAKALAHYFGAKLLIFDSHSLLGGLSSKEAELLKDGtsaekscgcvkqgptstdlakSINLPVsesdtpsssnpppqgpesqpkmETDTTLTsagtsknhmlriGDRVRFVGSTSGglyptasptrgppCGTRGKVALLFEDNPSSKIGVRFDKPIPDGVDLGGQCEGGHGFFCNVTDLRLENSGTEDLDKLLINTLFEVVFSESRSCPFILFMKDAEKSIAGNSDSYSTFKSRLEKLPDKVIVIGshthtdnrkekshPGGLLFTKFGSNQTALLDLAFPDSFGRLHDRGKEIPKATKLLTKLFPNKVTIHMPQDEALLASWKHQLDRDSETLKMKGNLNHLRTVLGRSGLECEGLETLCIRDQSLTNESAEKIVGWALSHHLMQNPEADPDARLVLSCESIQYGIGIFQAIQNESKSLKKSLKDVVTENEFEkrlladvippsdiGVTFDDIGALENVKDTLKELVMLPLQRPELFCKGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFGEGEKYVKAVFSLASKIAPSVIFVDEVDSMLGRRENPGEHEAMRKMKNEFMVNWDGLRTKDTERILVLaatnrpfdldeavirrlprrlmvnlpdapnRAKILQVILAKEDLSPDVDFDAIANMTdgysgsdlkNLCVTAAHRPIKEILEKEKKERAAAMaegkpapalsgcadIRPLNMDDFKYAHERVCASVssesvnmseLLQWnelygeggsrrKKALSYFM
MVstrrsgsfsgnnskrssssedkppspkRQKVENGGTVEKPVQSTDNSKEVCTPAAPDPGECGTGDTPIAGEGVSGGKTEATPAVSVTAPIAEGSTPGVMEKPRSSFSSWSLYQKQNPTFETSTPWCRLLSQSGQNSNVPICASIFTVGSSRQCNFPLKDQAISAVLCKIKHVQSEGSAVAMVESIGSKGLQVNGKNLKKNTSCELRSGDEVVFGSLGNHAYIFQQLLNEVAVKGAEVQSGPGKFLQLERRSGDPsavagasilaslsslrsdlsRWKSPAQSTSKIHLGSELPTPSADNDGVEVDLDGLEGNSTANTDSDKAADIGSIGKNIPVECNQDAGIEAGNVKFSGVNDLLRPFLRMLAPSSSCNLKLSKSICKQVLDGRNEWRRDSQPASTLGMSLRCAVFREDILAGILDGTNLQESFENFPYYLSENTKNVLIAASYIHLKHKDHAKYTSELTTVNPRILLSGPAGSEIYQEMLAKALAHYFGAKLLIFDSHSLLGGLSSKEAELLKDGTSAEKSCGCVKQGPTSTDLAKSINLPVSESDTPSSSNPPPQGPESQPKMETDTTLTSAGTSKNHMLRIGDRVRFVGSTSGGLYPTASPTRGPPCGTRGKVALLFEDNPSSKIGVRFDKPIPDGVDLGGQCEGGHGFFCNVTDLRLENSGTEDLDKLLINTLFEVVFSESRSCPFILFMKDAEKSIAGNSDSYSTFKSRLEKLPDKVIVIGSHTHTDNRKEKSHPGGLLFTKFGSNQTALLDLAFPDSFGRLHDRGKEIPKATKLLTKLFPNKVTIHMPQDEALLASWKHQLDRDSETLKMKGNLNHLRTVLGRSGLECEGLETLCIRDQSLTNESAEKIVGWALSHHLMQNPEADPDARLVLSCESIQYGIGIFQAIQNEskslkkslkDVVTENEFEKRLLADVIPPSDIGVTFDDIGALENVKDTLKELVMLPLQRPELFCKGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFGEGEKYVKAVFSLASKIAPSVIFVDEVDSMLGRRENPGEHEAMRKMKNEFMVNWDGLRTKDTERILVLAATNRPFDLDEAVIRRLPRRLMVNLPDAPNRAKILQVILAKEDLSPDVDFDAIANMTDGYSGSDLKNLCVTAAHRPIkeilekekkeraaamaegkpapaLSGCADIRPLNMDDFKYAHERVCASVSSESVNMSELLQWNELYGEGGSRRKKALSYFM
************************************************************************************************************************FETSTPWCRLLSQSGQNSNVPICASIFTVGSSRQCNFPLKDQAISAVLCKIKHVQSEGSAVAMVESIGS*GLQV*********SCELRSGDEVVFGSLGNHAYIFQQLLNEVAVKGAE*******************************************************************************************IGKNIPVECNQDAGIEAGNVKFSGVNDLLRPFLRMLAPSSSCNLKLSKSICKQVLDGRNEW********TLGMSLRCAVFREDILAGILDGTNLQESFENFPYYLSENTKNVLIAASYIHLKHKDHAKYTSELTTVNPRILLSGPAGSEIYQEMLAKALAHYFGAKLLIFDSHSLLGGL*****************************************************************************RIGDRVRFVGS********************GKVALLFED***SKIGVRFDKPIPDGVDLGGQCEGGHGFFCNVTDLRLENSGTEDLDKLLINTLFEVVFSESRSCPFILFMKDA********************LPDKVIVIG***************GLLFTKFGSNQTALLDLAFPDSFGRLHDRGKEIPKATKLLTKLFPNKVTIHMPQDEALLASWKHQLD****TLKMKGNLNHLRTVLGRSGLECEGLETLCIRDQSLTNESAEKIVGWALSHHLMQNP*ADPDARLVLSCESIQYGIGIFQAIQN********LKDVVTENEFEKRLLADVIPPSDIGVTFDDIGALENVKDTLKELVMLPLQRPELFCKGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFGEGEKYVKAVFSLASKIAPSVIFVDEVD********************EFMVNWDGLRTKDTERILVLAATNRPFDLDEAVIRRLPRRLMVNLPDAPNRAKILQVILAKEDLSPDVDFDAIANMTDGYSGSDLKNLCVTAAHRPIKE***********************GCADIRPLNMDDFKYAHERVCASVS***VNMSELLQWNELY***************
******************************************************************************************************************************WCRLLSQSGQNSNVPICASIFTVGSSRQCNFPLKDQAISAVLCKIKHVQSEGSAVAMVESIGSKGLQVNGKNLKKNTSCELRSGDEVVFGSLGNHAYIFQQ***************************DPSAVAGASILASLSS**********************************************************************************GVNDLLRPFLRMLAPSSSCNLKLSKSICKQ**************************************TNLQESFENFPYYLSENTKNVLIAASYIHLKHKDHAKYTS******P**LLSGPAGSEIYQEMLAKALAHYFGAKLLIFDSHSLLG***************************************************************************************************************KVALLFEDNPSSKIG*****************EGGHGFFCNVTDLRLENSGTEDLDKLLINTLFEVVFSESRSCPFILFMKDAEKSIAGNSDSYSTFKSRLEKLPDKVIVIG********************KFGSNQTALLDLAFPD****************KLLTKLFPNKVTIHMPQDEALLASWKHQLDRDSETLKMKGNLNHLRTVLGRSGLECEGLETLCIRDQSLTNESAEKIVGWALSH**************************************************FEKRLLADVIPPSDIGVTFDDIGALENVKDTLKELVMLPLQRPELFCKGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFGEGEKYVKAVFSLASKIAPSVIFVDEVDS******************NEFMVNWDGLRTKDTERILVLAATNRPFDLDEAVIRRLPRRLMVNLPDAPNRAKILQVILAKEDLSPDVDFDAIANMTDGYSGSDLKNLCVTAAHRPIKEI************************ADIRPLNMDDFKYA********************W***************SYFM
*****************************************************TPAAPDPGECGTGDTPIAGEGVSGGKTEATPAVSVTAPIAEGSTPGVMEKPRSSFSSWSLYQKQNPTFETSTPWCRLLSQSGQNSNVPICASIFTVGSSRQCNFPLKDQAISAVLCKIKHVQSEGSAVAMVESIGSKGLQVNGKNLKKNTSCELRSGDEVVFGSLGNHAYIFQQLLNEVAVKGAEVQSGPGKFLQLE*********AGASILASLSSL****************IHLGSELPTPSADNDGVEVDLDGLEGNSTANTDSDKAADIGSIGKNIPVECNQDAGIEAGNVKFSGVNDLLRPFLRMLAPSSSCNLKLSKSICKQVLDGRNEWRRDSQPASTLGMSLRCAVFREDILAGILDGTNLQESFENFPYYLSENTKNVLIAASYIHLKHKDHAKYTSELTTVNPRILLSGPAGSEIYQEMLAKALAHYFGAKLLIFDSHSLLGGLSSKEAELLKDGTSAEKSCGCVKQGPTSTDLAKSINLP********************************GTSKNHMLRIGDRVRFVGSTSGGLYPTASPTRGPPCGTRGKVALLFEDNPSSKIGVRFDKPIPDGVDLGGQCEGGHGFFCNVTDLRLENSGTEDLDKLLINTLFEVVFSESRSCPFILFMKDAEKSIAGNSDSYSTFKSRLEKLPDKVIVIGSHTHTDNRKEKSHPGGLLFTKFGSNQTALLDLAFPDSFGRLHDRGKEIPKATKLLTKLFPNKVTIHMPQDEALLASWKHQLDRDSETLKMKGNLNHLRTVLGRSGLECEGLETLCIRDQSLTNESAEKIVGWALSHHLMQNPEADPDARLVLSCESIQYGIGIFQAIQNESKSLKKSLKDVVTENEFEKRLLADVIPPSDIGVTFDDIGALENVKDTLKELVMLPLQRPELFCKGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFGEGEKYVKAVFSLASKIAPSVIFVDEVDSMLGRRENPGEHEAMRKMKNEFMVNWDGLRTKDTERILVLAATNRPFDLDEAVIRRLPRRLMVNLPDAPNRAKILQVILAKEDLSPDVDFDAIANMTDGYSGSDLKNLCVTAAHRPIKEILEKEK*************PALSGCADIRPLNMDDFKYAHERVCASVSSESVNMSELLQWNELYGEGGSRRKKALSYFM
**************************************************************************************************************************TSTPWCRLLSQSGQNSNVPICASIFTVGSSRQCNFPLKDQAISAVLCKIKHVQSEGSAVAMVESIGSKGLQVNGKNLKKNTSCELRSGDEVVFGSLGNHAYIFQQLLNEVAVKGAEVQSGPGKFLQLERRSGDPSAVAGASILASLSSLRSDLSRWKSP****************************************************************AGNVKFSGVNDLLRPFLRMLAPSSSCNLKLSKSICKQVLDGRNEWRRDS*****LGMSLRCAVFREDILAGILDGTNLQESFENFPYYLSENTKNVLIAASYIHLKHKDHAKYTSELTTVNPRILLSGPAGSEIYQEMLAKALAHYFGAKLLIFDSHSLLG******************************************************************************LRIGDRVRFVGSTSGGLYPTASPTRGPPCGTRGKVALLFEDNPSSKIGVRFDKPIPDGVDLGGQCEGGHGFFCNVTDLRLENSGTEDLDKLLINTLFEVVFSESRSCPFILFMKDAEKSIAGNSDSYSTFKSRLEKLPDKVIVIGSHTHTDNRKEKSHPGGLLFTKFGSNQTALLDLAFPDSFGRLHDRGKEIPKATKLLTKLFPNKVTIHMPQDEALLASWKHQLDRDSETLKMKGNLNHLRTVLGRSGLECEGLETLCIRDQSLTNESAEKIVGWALSHHLMQNPEADPDARLVLSCESIQYGIGIFQAIQNESKSLKKSLKDVVTENEFEKRLLADVIPPSDIGVTFDDIGALENVKDTLKELVMLPLQRPELFCKGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFGEGEKYVKAVFSLASKIAPSVIFVDEVDSMLGRRENPGEHEAMRKMKNEFMVNWDGLRTKDTERILVLAATNRPFDLDEAVIRRLPRRLMVNLPDAPNRAKILQVILAKEDLSPDVDFDAIANMTDGYSGSDLKNLCVTAAHRPIKEILEKEKKERAAAM************ADIRPLNMDDFKYAHERVCASVSSESVNMSELLQWNELYGE*************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVSTRRSGSFSGNNSKRSSSSEDKPPSPKRQKVENGGTVEKPVQSTDNSKEVCTPAAPDPGECGTGDTPIAGEGVSGGKTEATPAVSVTAPIAEGSTPGVMEKPRSSFSSWSLYQKQNPTFETSTPWCRLLSQSGQNSNVPICASIFTVGSSRQCNFPLKDQAISAVLCKIKHVQSEGSAVAMVESIGSKGLQVNGKNLKKNTSCELRSGDEVVFGSLGNHAYIFQQLLNEVAVKGAEVQSGPGKFLQLERRSGDPSAVAGASILASLSSLRSDLSRWKSPAQSTSKIHLGSELPTPSADNDGVEVDLDGLEGNSTANTDSDKAADIGSIGKNIPVECNQDAGIEAGNVKFSGVNDLLRPFLRMLAPSSSCNLKLSKSICKQVLDGRNEWRRDSQPASTLGMSLRCAVFREDILAGILDGTNLQESFENFPYYLSENTKNVLIAASYIHLKHKDHAKYTSELTTVNPRILLSGPAGSEIYQEMLAKALAHYFGAKLLIFDSHSLLGGLSSKEAELLKDGTSAEKSCGCVKQGPTSTDLAKSINLPVSESDTPSSSNPPPQGPESQPKMETDTTLTSAGTSKNHMLRIGDRVRFVGSTSGGLYPTASPTRGPPCGTRGKVALLFEDNPSSKIGVRFDKPIPDGVDLGGQCEGGHGFFCNVTDLRLENSGTEDLDKLLINTLFEVVFSESRSCPFILFMKDAEKSIAGNSDSYSTFKSRLEKLPDKVIVIGSHTHTDNRKEKSHPGGLLFTKFGSNQTALLDLAFPDSFGRLHDRGKEIPKATKLLTKLFPNKVTIHMPQDEALLASWKHQLDRDSETLKMKGNLNHLRTVLGRSGLECEGLETLCIRDQSLTNESAEKIVGWALSHHLMQNPEADPDARLVLSCESIQYGIGIFQAIQNESKSLKKSLKDVVTENEFEKRLLADVIPPSDIGVTFDDIGALENVKDTLKELVMLPLQRPELFCKGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFGEGEKYVKAVFSLASKIAPSVIFVDEVDSMLGRRENPGEHEAMRKMKNEFMVNWDGLRTKDTERILVLAATNRPFDLDEAVIRRLPRRLMVNLPDAPNRAKILQVILAKEDLSPDVDFDAIANMTDGYSGSDLKNLCVTAAHRPIKEILEKEKKERAAAMAEGKPAPALSGCADIRPLNMDDFKYAHERVCASVSSESVNMSELLQWNELYGEGGSRRKKALSYFM
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query1237 2.2.26 [Sep-21-2011]
Q5ZK92613 Spastin OS=Gallus gallus yes no 0.230 0.464 0.429 4e-63
B4G437788 Spastin OS=Drosophila per N/A no 0.236 0.371 0.439 1e-62
P28737362 Protein MSP1 OS=Saccharom yes no 0.223 0.765 0.442 2e-62
B4NBP4777 Spastin OS=Drosophila wil N/A no 0.229 0.365 0.440 2e-62
Q9QYY8614 Spastin OS=Mus musculus G yes no 0.243 0.490 0.421 3e-62
B2RYN7581 Spastin OS=Rattus norvegi yes no 0.243 0.518 0.421 3e-62
Q298L4788 Spastin OS=Drosophila pse no no 0.236 0.371 0.439 3e-62
B4K799765 Spastin OS=Drosophila moj N/A no 0.229 0.371 0.440 8e-62
A2VDN5614 Spastin OS=Bos taurus GN= yes no 0.243 0.490 0.417 1e-61
Q8BPY9683 Fidgetin-like protein 1 O no no 0.222 0.402 0.433 1e-61
>sp|Q5ZK92|SPAST_CHICK Spastin OS=Gallus gallus GN=SPAST PE=2 SV=1 Back     alignment and function desciption
 Score =  244 bits (622), Expect = 4e-63,   Method: Compositional matrix adjust.
 Identities = 132/307 (42%), Positives = 200/307 (65%), Gaps = 22/307 (7%)

Query: 920  LLADVIPPSDIGVTFDDIGALENVKDTLKELVMLPLQRPELFCKGQLTKPCKGILLFGPP 979
            L+ + I  S   V FDDI   E  K  L+E+V+LP  RPELF    L  P +G+LLFGPP
Sbjct: 324  LILNEIVDSGPAVKFDDIAGQELAKQALQEIVILPSLRPELFTG--LRAPARGLLLFGPP 381

Query: 980  GTGKTMLAKAVATEAGANFINISMSSITSKWFGEGEKYVKAVFSLASKIAPSVIFVDEVD 1039
            G GKTMLAKAVA E+ A F NIS +S+TSK+ GEGEK V+A+F++A ++ PS+IF+DEVD
Sbjct: 382  GNGKTMLAKAVAAESNATFFNISAASLTSKYVGEGEKLVRALFAVARELQPSIIFIDEVD 441

Query: 1040 SMLGRRENPGEHEAMRKMKNEFMVNWDGLRTKDTERILVLAATNRPFDLDEAVIRRLPRR 1099
            S+L  R   GEH+A R++K EF++ +DG+++   +RILV+ ATNRP +LD+AV+RR  +R
Sbjct: 442  SLLCERRE-GEHDASRRLKTEFLIEFDGVQSSGEDRILVMGATNRPQELDDAVLRRFTKR 500

Query: 1100 LMVNLPDAPNRAKILQVILAKEDLSP--DVDFDAIANMTDGYSGSDLKNLCVTAAHRPIK 1157
            + V+LP+   R  +L+ +L+K+  SP    +   +A MTDGYSGSDL  L   AA  PI+
Sbjct: 501  VYVSLPNEETRLILLKNLLSKQG-SPLTQKELAQLARMTDGYSGSDLTALVKDAALGPIR 559

Query: 1158 EILEKEKKERAAAMAEGKPAPALSGCADIRPLNMDDFKYAHERVCASVSSESVNMSELLQ 1217
            E+  ++ K  +A              +++R + + DF  + +++  S+S ++  +   ++
Sbjct: 560  ELKPEQVKNMSA--------------SEMRNIKLSDFTESLKKIKRSLSPQT--LEAYIR 603

Query: 1218 WNELYGE 1224
            WN+ +G+
Sbjct: 604  WNKDFGD 610
ATP-dependent microtubule severing protein. Microtubule severing may promote reorganization of cellular microtubule arrays and the release of microtubules from the centrosome following nucleation. Required for membrane traffic from the endoplasmic reticulum (ER) to the Golgi and for completion of the abscission stage of cytokinesis. Also plays a role in axon growth and the formation of axonal branches.
Gallus gallus (taxid: 9031)
EC: 3EC: .EC: 6EC: .EC: 4EC: .EC: 3
>sp|B4G437|SPAST_DROPE Spastin OS=Drosophila persimilis GN=spas PE=3 SV=1 Back     alignment and function description
>sp|P28737|MSP1_YEAST Protein MSP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MSP1 PE=1 SV=2 Back     alignment and function description
>sp|B4NBP4|SPAST_DROWI Spastin OS=Drosophila willistoni GN=spas PE=3 SV=1 Back     alignment and function description
>sp|Q9QYY8|SPAST_MOUSE Spastin OS=Mus musculus GN=Spast PE=2 SV=3 Back     alignment and function description
>sp|B2RYN7|SPAST_RAT Spastin OS=Rattus norvegicus GN=Spast PE=2 SV=1 Back     alignment and function description
>sp|Q298L4|SPAST_DROPS Spastin OS=Drosophila pseudoobscura pseudoobscura GN=spas PE=3 SV=1 Back     alignment and function description
>sp|B4K799|SPAST_DROMO Spastin OS=Drosophila mojavensis GN=spas PE=3 SV=1 Back     alignment and function description
>sp|A2VDN5|SPAST_BOVIN Spastin OS=Bos taurus GN=SPAST PE=2 SV=1 Back     alignment and function description
>sp|Q8BPY9|FIGL1_MOUSE Fidgetin-like protein 1 OS=Mus musculus GN=Fignl1 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1237
3594910661247 PREDICTED: uncharacterized protein LOC10 0.995 0.987 0.798 0.0
2555402731240 ATP binding protein, putative [Ricinus c 0.993 0.991 0.805 0.0
2977344031216 unnamed protein product [Vitis vinifera] 0.970 0.987 0.780 0.0
4494696271244 PREDICTED: uncharacterized protein LOC10 0.999 0.993 0.793 0.0
4495037121254 PREDICTED: LOW QUALITY PROTEIN: uncharac 0.982 0.968 0.782 0.0
3565088001234 PREDICTED: uncharacterized protein LOC10 0.989 0.991 0.765 0.0
3565652781229 PREDICTED: uncharacterized protein LOC10 0.983 0.990 0.755 0.0
3565165651238 PREDICTED: uncharacterized protein LOC10 0.991 0.990 0.759 0.0
3574636291260 Spastin [Medicago truncatula] gi|3554911 0.985 0.967 0.734 0.0
3565367271247 PREDICTED: uncharacterized protein LOC10 0.950 0.943 0.565 0.0
>gi|359491066|ref|XP_002279926.2| PREDICTED: uncharacterized protein LOC100266414 [Vitis vinifera] Back     alignment and taxonomy information
 Score = 2027 bits (5252), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1000/1252 (79%), Positives = 1092/1252 (87%), Gaps = 20/1252 (1%)

Query: 1    MVSTRRSGSFSGNNSKRSSSSEDKPPSPKRQKVENGGTV-EKPVQSTDNSKEVC-TPAAP 58
            MVSTRRSGS SGN +KRSS SEDKPPSPKRQKV+N G   EK   + DNSKE C T +  
Sbjct: 1    MVSTRRSGSLSGNTNKRSSPSEDKPPSPKRQKVDNSGAASEKAAPAVDNSKEFCATASGA 60

Query: 59   DPGECGTGDTPIAG----EGVSGGKTEATPAVSVTAPIAEGSTPGVMEKPRSSFSSWSLY 114
            DP ECG+GD PI+G    E V+ GK EA  A  V+APIAEG++P V++KPRSSFSSWS+Y
Sbjct: 61   DPVECGSGDPPISGGASGEAVNSGKDEAALAAPVSAPIAEGTSPIVVDKPRSSFSSWSVY 120

Query: 115  QKQNPTFETSTPWCRLLSQSGQNSNVPICASIFTVGSSRQCNFPLKDQAISAVLCKIKHV 174
            QKQN  +ETS PWC+LLSQ  QN NV I    FT+GSSR CNFPLKDQ IS +LCKIKH 
Sbjct: 121  QKQN--YETSMPWCKLLSQFSQNPNVSIGVINFTIGSSRHCNFPLKDQTISPILCKIKHS 178

Query: 175  QSEGSAVAMVESIGSKG-LQVNGKNLKKNTSCELRSGDEVVFGSLGNHAYIFQQLLNEVA 233
            Q EGSAVA++ES GSKG +QVNG  +K+ TSC L SGDEVVFG LGNHAYIFQQL+ EVA
Sbjct: 179  QREGSAVAVLESSGSKGSVQVNGTFIKRGTSCVLNSGDEVVFGLLGNHAYIFQQLVTEVA 238

Query: 234  VK-------GAEVQSGPGKFLQLERRSGDPSAVAGASILASLSSLRSDLSRWKSPAQSTS 286
            +K       GAEVQS  GK+L +ERRSGDPSAVAGASILASLSSLR DLSRWKSP  +T 
Sbjct: 239  IKAPSSGATGAEVQSSVGKYLHVERRSGDPSAVAGASILASLSSLRQDLSRWKSPPLTTG 298

Query: 287  KIHLGSELPTPSADNDGVEVDLDGLEGNSTANTDSDKAADIGSIGKNIPVECNQDAGIEA 346
            K   G+ELP     +D  EV+ +GLEGNSTAN  SDKAADI ++ KN+ ++CNQD+G EA
Sbjct: 299  KTQQGTELPPHPIIHDSPEVEFNGLEGNSTANGGSDKAADIAAVSKNLSLDCNQDSGAEA 358

Query: 347  GNVKFSGVNDLLRPFLRMLAPSSSCNLKLSKSICKQVLDGRNEWRRDSQPASTLGMSLRC 406
            GNVKFSG+NDL+   L+M A S+SCNL+LSKSI KQVL+ RNEW RDS PAST GMSLRC
Sbjct: 359  GNVKFSGMNDLV---LKMFAQSTSCNLELSKSIFKQVLEERNEWTRDSLPASTSGMSLRC 415

Query: 407  AVFREDILAGILDGTNLQESFENFPYYLSENTKNVLIAASYIHLKHKDHAKYTSELTTVN 466
            AVF+EDI AGILDG  +Q SF++FPYYLSENTKNVLIAAS+IHLKH++HAK+TSELTTVN
Sbjct: 416  AVFKEDIHAGILDGKEIQVSFDDFPYYLSENTKNVLIAASFIHLKHREHAKFTSELTTVN 475

Query: 467  PRILLSGPAGSEIYQEMLAKALAHYFGAKLLIFDSHSLLGGLSSKEAELLKDGTSAEKSC 526
            PRILLSGPAGSEIYQEMLAKALA+YFGAKLLIFDSHS LGGLSSKEAELLKDG++AEK C
Sbjct: 476  PRILLSGPAGSEIYQEMLAKALANYFGAKLLIFDSHSFLGGLSSKEAELLKDGSNAEKFC 535

Query: 527  GCVKQGPTSTDLAKSINLPVSESDTPSSSNPPPQGP-ESQPKMETDTTLTSAGTSKNHML 585
             C KQ   ST+LAK++     E+DTP+ +N P     ESQPK+E DT  +S+GT+KNH+ 
Sbjct: 536  SCTKQSSGSTELAKNMASSAGEADTPNIANAPISCELESQPKLENDTVPSSSGTTKNHLF 595

Query: 586  RIGDRVRFVGSTSGGLYPTASPTRGPPCGTRGKVALLFEDNPSSKIGVRFDKPIPDGVDL 645
            RIGDRVRF+GS SGG Y   S +RGP  G RGKV L FEDNP SKIGVRFDK I DGVDL
Sbjct: 596  RIGDRVRFMGSASGGSYSAVSASRGPTFGIRGKVLLPFEDNPLSKIGVRFDKLITDGVDL 655

Query: 646  GGQCEGGHGFFCNVTDLRLENSGTEDLDKLLINTLFEVVFSESRSCPFILFMKDAEKSIA 705
            GG CE G+GFFCNV DLRLEN+G EDLDKLLINTLFE V+SESR  PFILFMKDAEKSI 
Sbjct: 656  GGLCEPGYGFFCNVNDLRLENTGVEDLDKLLINTLFEAVYSESRDSPFILFMKDAEKSIV 715

Query: 706  GNSDSYSTFKSRLEKLPDKVIVIGSHTHTDNRKEKSHPGGLLFTKFGSNQTALLDLAFPD 765
            GNS+SYS FKSRLEKLPD V++IGSHTHTDNRKEKSHPGGLLFTKFGSNQTALLDLAFPD
Sbjct: 716  GNSESYSMFKSRLEKLPDNVVIIGSHTHTDNRKEKSHPGGLLFTKFGSNQTALLDLAFPD 775

Query: 766  SFGRLHDRGKEIPKATKLLTKLFPNKVTIHMPQDEALLASWKHQLDRDSETLKMKGNLNH 825
            SFGRLHDRGK++PK TKLLTKLFPNKVTIHMPQDEALLA WKHQLDRDSETLKMKGNLNH
Sbjct: 776  SFGRLHDRGKDVPKTTKLLTKLFPNKVTIHMPQDEALLACWKHQLDRDSETLKMKGNLNH 835

Query: 826  LRTVLGRSGLECEGLETLCIRDQSLTNESAEKIVGWALSHHLMQNPEADPDARLVLSCES 885
            LRTVL RSG+EC+GLE LCI+DQ+LTNESAEK+VGWA+SH+LM NPEAD D RLVLS ES
Sbjct: 836  LRTVLTRSGMECDGLEKLCIKDQTLTNESAEKVVGWAVSHYLMSNPEADADTRLVLSSES 895

Query: 886  IQYGIGIFQAIQNESKSLKKSLKDVVTENEFEKRLLADVIPPSDIGVTFDDIGALENVKD 945
            IQYGIGI QAIQNESKSLKKSLKDVVTENEFEKRLLADVIPPSDIGVTFDDIGALENVKD
Sbjct: 896  IQYGIGILQAIQNESKSLKKSLKDVVTENEFEKRLLADVIPPSDIGVTFDDIGALENVKD 955

Query: 946  TLKELVMLPLQRPELFCKGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSS 1005
            TLKELVMLPLQRPELFCKGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSS
Sbjct: 956  TLKELVMLPLQRPELFCKGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSS 1015

Query: 1006 ITSKWFGEGEKYVKAVFSLASKIAPSVIFVDEVDSMLGRRENPGEHEAMRKMKNEFMVNW 1065
            ITSKWFGEGEKYVKAVFSLASKIAPSV+FVDEVDSMLGRRENPGEHEAMRKMKNEFMVNW
Sbjct: 1016 ITSKWFGEGEKYVKAVFSLASKIAPSVVFVDEVDSMLGRRENPGEHEAMRKMKNEFMVNW 1075

Query: 1066 DGLRTKDTERILVLAATNRPFDLDEAVIRRLPRRLMVNLPDAPNRAKILQVILAKEDLSP 1125
            DGLRTKDTER+LVLAATNRPFDLDEAVIRRLPRRLMVNLPDAPNRAKIL+VILAKEDLSP
Sbjct: 1076 DGLRTKDTERVLVLAATNRPFDLDEAVIRRLPRRLMVNLPDAPNRAKILKVILAKEDLSP 1135

Query: 1126 DVDFDAIANMTDGYSGSDLKNLCVTAAHRPIKEILEKEKKERAAAMAEGKPAPALSGCAD 1185
            DVD DA+A+MTDGYSGSDLKNLCVTAAHRPI+EILEKEKKERAAA AEG+P PALSG AD
Sbjct: 1136 DVDLDAVASMTDGYSGSDLKNLCVTAAHRPIREILEKEKKERAAAQAEGRPPPALSGSAD 1195

Query: 1186 IRPLNMDDFKYAHERVCASVSSESVNMSELLQWNELYGEGGSRRKKALSYFM 1237
            IRPLN+DDFKYAHERVCASVSSESVNM+EL+QWNELYGEGGSRRKKALSYFM
Sbjct: 1196 IRPLNIDDFKYAHERVCASVSSESVNMTELIQWNELYGEGGSRRKKALSYFM 1247

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|255540273|ref|XP_002511201.1| ATP binding protein, putative [Ricinus communis] gi|223550316|gb|EEF51803.1| ATP binding protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|297734403|emb|CBI15650.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|449469627|ref|XP_004152520.1| PREDICTED: uncharacterized protein LOC101214766 [Cucumis sativus] Back     alignment and taxonomy information
>gi|449503712|ref|XP_004162139.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC101228711 [Cucumis sativus] Back     alignment and taxonomy information
>gi|356508800|ref|XP_003523142.1| PREDICTED: uncharacterized protein LOC100780098 [Glycine max] Back     alignment and taxonomy information
>gi|356565278|ref|XP_003550869.1| PREDICTED: uncharacterized protein LOC100816731 [Glycine max] Back     alignment and taxonomy information
>gi|356516565|ref|XP_003526964.1| PREDICTED: uncharacterized protein LOC100778164 [Glycine max] Back     alignment and taxonomy information
>gi|357463629|ref|XP_003602096.1| Spastin [Medicago truncatula] gi|355491144|gb|AES72347.1| Spastin [Medicago truncatula] Back     alignment and taxonomy information
>gi|356536727|ref|XP_003536887.1| PREDICTED: uncharacterized protein LOC100794406 [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1237
TAIR|locus:21332981265 AT4G02480 [Arabidopsis thalian 0.950 0.929 0.521 1.1e-307
TAIR|locus:21267831122 AT4G24860 [Arabidopsis thalian 0.375 0.414 0.674 8.9e-276
TAIR|locus:4010714050829 AT5G52882 [Arabidopsis thalian 0.264 0.394 0.583 1.8e-151
TAIR|locus:2132922830 AT4G28000 [Arabidopsis thalian 0.264 0.393 0.574 4.7e-151
TAIR|locus:2024522829 DAA1 "DUO1-activated ATPase 1" 0.265 0.395 0.601 7.3e-141
TAIR|locus:20310051003 AT1G50140 [Arabidopsis thalian 0.405 0.499 0.438 1.7e-125
TAIR|locus:2137777398 AT4G27680 [Arabidopsis thalian 0.211 0.658 0.520 6.8e-69
TAIR|locus:2168646403 AT5G53540 [Arabidopsis thalian 0.198 0.610 0.522 4.6e-66
ZFIN|ZDB-GENE-040426-2331570 spast "spastin" [Danio rerio ( 0.235 0.510 0.410 1.4e-61
MGI|MGI:1858896614 Spast "spastin" [Mus musculus 0.230 0.464 0.423 3.4e-60
TAIR|locus:2133298 AT4G02480 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 2952 (1044.2 bits), Expect = 1.1e-307, P = 1.1e-307
 Identities = 643/1233 (52%), Positives = 806/1233 (65%)

Query:    33 VENGGTVEKP-VQSTDNSKEVCTPAAPDPGE-CGTGDTPIAGEGVSGGKTEATPAVSVTA 90
             +EN G    P  +S +       P A D  +   T D P+     +  +T+A P V V A
Sbjct:    62 IENQGPASDPGSESGEPELGSSDPQAMDAEKPVVTTDVPVME---NSPETDANPEVEVLA 118

Query:    91 -PIAEGSTPGVMEKPRSSFSSWSLYQKQNPTFETSTPWCRLLSQSGQNSNVPICASIFTV 149
              P   G      +K +++       +K+        PW +LLSQ  QN +  I   +FTV
Sbjct:   119 TPTVAGEAVADADKSKAA-------KKR----ALKAPWAKLLSQYSQNPHRVIRGPVFTV 167

Query:   150 GSSRQCNFPLKDQAISAVLCKIKHVQSEGSAVAMVESIGSKGL-QVNGKNLKKNTSCELR 208
             G  R C+  ++DQA+ + LC++K  +  G +VA +E +G+  +  VNGK  +K+T   LR
Sbjct:   168 GR-RGCDLSIRDQAMPSTLCELKQSEHGGPSVASLEILGNGVIVHVNGKCYQKSTCVHLR 226

Query:   209 SGDEVVFGSLGNHAYIFQQLLNE--VAVKGA------EVQSGPGKFLQLERRSGD-PXXX 259
              GDEV+F   G HAYIFQ + +E   A   A      E +  P K + +E R+GD     
Sbjct:   227 GGDEVIFSLNGKHAYIFQPVKDENLAAPDRASSLSICEARGAPLKGVHVETRAGDVDGAS 286

Query:   260 XXXXXXXXXXXXXXXXXRWKSPAQSTSKIHLGSELPT-PSADNDGV-EVDLDGLEGNS-- 315
                                  P     K      +P  PS+ ND + + D++  + N+  
Sbjct:   287 DVDGASILASLSKLRSFHLLPPIAKAGKRQQNPAVPVVPSSFNDCISDTDMNDADSNNDH 346

Query:   316 --TANTDSDKAADI-GSIGKNIPVE-CNQDAGIEA--GNVKFSGVNDLLRPFLRMLAPSS 369
                A+ +   AA   G+  +N+ V+    D   EA  GNV  +G    +RP + +L  SS
Sbjct:   347 AAVASVEKIAAASTPGTANENLNVDGSGLDPFQEADGGNVPAAGYE--IRPIVHLLGESS 404

Query:   370 SCNLKLSKSICKQVLDGRNEWR---RDSQPASTLGMSLRCAVFREDILAGILDGTNLQES 426
             S +++ S S   ++LD R E +   R+   +ST+  S R   F++ +  G+L+  N+  S
Sbjct:   405 SFDIRGSIS---RLLDERREVKEFLREFDLSSTI--STRRQAFKDSLRGGVLNAQNIDIS 459

Query:   427 FENFPYYLSENTKNVLIAASYIHLKH-KDHAKYTSELTTVNPRILLSGPAGSEIYQEMLA 485
             FENFPYYLS  TK VL+ + Y+H+     +A + ++LTT  PRILLSGP+GSEIYQEMLA
Sbjct:   460 FENFPYYLSATTKGVLMISMYVHMNGGSKYANFATDLTTACPRILLSGPSGSEIYQEMLA 519

Query:   486 KALAHYFGAKLLIFDSHSLLGGLSSKEAELLKDGTSAEKSCGCVKQGPTSTDLAKSINLP 545
             KALA  FGAKL+I DS  L GG  ++EAE  K+G+  E+     K+   +  + +    P
Sbjct:   520 KALAKQFGAKLMIVDSLLLPGGSPAREAESSKEGSRRERLSMLAKRAVQAAQVLQH-KKP 578

Query:   546 VSESDTPSSSNPPPQGPESQPKMETDTTLTSAGTSKNHMLRIGDRVRFVGSTSGGLYPTA 605
              S  D   +        ++ PK E  T      TSK++  + GDRV+FVG ++  +    
Sbjct:   579 TSSVDADITGGSTLSS-QALPKQEVSTA-----TSKSYTFKAGDRVKFVGPSASAISSLQ 632

Query:   606 SPTRGPPCGTRGKVALLFEDNPSSKIGVRFDKPIPDGVDLGGQCEGGHGFFCNVTDLRLE 665
                RGP  G++GKVAL FEDN +SKIG+RFD+P+ DG DLGG CE  HGFFC  + LRLE
Sbjct:   633 GQLRGPAIGSQGKVALAFEDNCASKIGIRFDRPVQDGNDLGGLCEEDHGFFCAASSLRLE 692

Query:   666 NSGTEDLDKLLINTLFEVVFSESRSCPFILFMKDAEKSIAGNSDSYSTFKSRLEKLPDKV 725
              S ++D DKL +N +FEV  SES     ILF+KD EKS+ GNSD Y+T KS+LE LP+ +
Sbjct:   693 GSSSDDADKLAVNEIFEVALSESEGGSLILFLKDIEKSLVGNSDVYATLKSKLETLPENI 752

Query:   726 IVIGSHTHTDNRKEKSHPGGLLFTKFGSNQTALLDLAFPDSFGRLHDRGKEIPKATKLLT 785
             +VI S T  D+RKEKSHPGG LFTKFG NQTALLDLAFPD+FG+LHDR KE PK+ K +T
Sbjct:   753 VVIASQTQLDSRKEKSHPGGFLFTKFGGNQTALLDLAFPDNFGKLHDRSKETPKSMKQIT 812

Query:   786 KLFPNKVTIHMPQDEALLASWKHQLDRDSETLKMKGNLNHLRTVLGRSGLECEGLETLCI 845
             +LFPNK+ I +PQ+EALL+ WK +LDRD+E LK++ N+  +  VL ++ L+C  L TLCI
Sbjct:   813 RLFPNKIAIQLPQEEALLSDWKEKLDRDTEILKVQANITSILAVLAKNKLDCPDLGTLCI 872

Query:   846 RDQSLTNESAEKIVGWALSHHLMQNPEAD-PDARLVLSCESIQYGIGIFQAIQNEXXXXX 904
             +DQ+L +ES EK+VGWA  HHLM   E    D +LV+S ESI YG+     IQNE     
Sbjct:   873 KDQTLPSESVEKVVGWAFGHHLMICTEPIVKDNKLVISAESISYGLQTLHDIQNENKSLK 932

Query:   905 XXXXDVVTENEFEKRLLADVIPPSDIGVTFDDIGALENVKDTLKELVMLPLQRPELFCKG 964
                 DVVTENEFEK+LL+DVIPPSDIGV+FDDIGALENVK+TLKELVMLPLQRPELF KG
Sbjct:   933 KSLKDVVTENEFEKKLLSDVIPPSDIGVSFDDIGALENVKETLKELVMLPLQRPELFDKG 992

Query:   965 QLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFGEGEKYVKAVFSL 1024
             QLTKP KGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFGEGEKYVKAVFSL
Sbjct:   993 QLTKPTKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFGEGEKYVKAVFSL 1052

Query:  1025 ASKIAPSVIFVDEVDSMLGRRENPGEHEAMRKMKNEFMVNWDGLRTKDTERILVLAATNR 1084
             ASKIAPSVIFVDEVDSMLGRRENPGEHEAMRKMKNEFMVNWDGLRTKD ER+LVLAATNR
Sbjct:  1053 ASKIAPSVIFVDEVDSMLGRRENPGEHEAMRKMKNEFMVNWDGLRTKDRERVLVLAATNR 1112

Query:  1085 PFDLDEAVIRRLPRRLMVNLPDAPNRAKILQVILAKEDLSPDVDFDAIANMTDGYSGSDL 1144
             PFDLDEAVIRRLPRRLMVNLPDA NR+KIL VILAKE+++PDVD +AIANMTDGYSGSDL
Sbjct:  1113 PFDLDEAVIRRLPRRLMVNLPDATNRSKILSVILAKEEIAPDVDLEAIANMTDGYSGSDL 1172

Query:  1145 KNLCVTAAHRPIXXXXXXXXXXXXXXXXXXXXXXXLSGCADIRPLNMDDFKYAHERVCAS 1204
             KNLCVTAAH PI                       L  C D+R L M+DFK AH++VCAS
Sbjct:  1173 KNLCVTAAHFPIREILEKEKKEKTAAQAENRPTPPLYSCTDVRSLTMNDFKAAHDQVCAS 1232

Query:  1205 VSSESVNMSELLQWNELYGEGGSRRKKALSYFM 1237
             VSS+S NM+EL QWNELYGEGGSR+K +LSYFM
Sbjct:  1233 VSSDSSNMNELQQWNELYGEGGSRKKTSLSYFM 1265
GO:0000166 "nucleotide binding" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA
GO:0009507 "chloroplast" evidence=ISM
GO:0016887 "ATPase activity" evidence=ISS
GO:0017111 "nucleoside-triphosphatase activity" evidence=IEA
GO:0006487 "protein N-linked glycosylation" evidence=RCA
GO:0009630 "gravitropism" evidence=RCA
TAIR|locus:2126783 AT4G24860 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:4010714050 AT5G52882 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2132922 AT4G28000 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2024522 DAA1 "DUO1-activated ATPase 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2031005 AT1G50140 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2137777 AT4G27680 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2168646 AT5G53540 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040426-2331 spast "spastin" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
MGI|MGI:1858896 Spast "spastin" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00017926001
SubName- Full=Chromosome chr17 scaffold_16, whole genome shotgun sequence; (1188 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1237
COG0464494 COG0464, SpoVK, ATPases of the AAA+ class [Posttra 3e-78
COG1222406 COG1222, RPT1, ATP-dependent 26S proteasome regula 5e-61
PRK03992389 PRK03992, PRK03992, proteasome-activating nucleoti 3e-60
TIGR01242364 TIGR01242, 26Sp45, 26S proteasome subunit P45 fami 8e-56
TIGR01243733 TIGR01243, CDC48, AAA family ATPase, CDC48 subfami 2e-53
TIGR01243 733 TIGR01243, CDC48, AAA family ATPase, CDC48 subfami 5e-52
TIGR01241 495 TIGR01241, FtsH_fam, ATP-dependent metalloprotease 2e-48
pfam00004131 pfam00004, AAA, ATPase family associated with vari 9e-47
CHL00176 638 CHL00176, ftsH, cell division protein; Validated 1e-45
PTZ00454398 PTZ00454, PTZ00454, 26S protease regulatory subuni 5e-45
PTZ00361438 PTZ00361, PTZ00361, 26 proteosome regulatory subun 9e-44
COG0465 596 COG0465, HflB, ATP-dependent Zn proteases [Posttra 2e-39
PRK10733 644 PRK10733, hflB, ATP-dependent metalloprotease; Rev 3e-38
COG1223368 COG1223, COG1223, Predicted ATPase (AAA+ superfami 4e-36
COG0464 494 COG0464, SpoVK, ATPases of the AAA+ class [Posttra 2e-30
TIGR03689512 TIGR03689, pup_AAA, proteasome ATPase 3e-25
cd00009151 cd00009, AAA, The AAA+ (ATPases Associated with a 4e-24
smart00382148 smart00382, AAA, ATPases associated with a variety 9e-18
CHL00195489 CHL00195, ycf46, Ycf46; Provisional 4e-14
COG0714329 COG0714, COG0714, MoxR-like ATPases [General funct 2e-08
PRK13342 413 PRK13342, PRK13342, recombination factor protein R 7e-08
cd00060102 cd00060, FHA, Forkhead associated domain (FHA); fo 1e-07
PRK04195 482 PRK04195, PRK04195, replication factor C large sub 2e-06
COG2256 436 COG2256, MGS1, ATPase related to the helicase subu 4e-06
pfam0049867 pfam00498, FHA, FHA domain 5e-06
COG1224 450 COG1224, TIP49, DNA helicase TIP49, TBP-interactin 2e-05
pfam07724168 pfam07724, AAA_2, AAA domain (Cdc48 subfamily) 9e-05
PRK00080328 PRK00080, ruvB, Holliday junction DNA helicase Ruv 1e-04
COG2255332 COG2255, RuvB, Holliday junction resolvasome, heli 2e-04
PHA02544316 PHA02544, 44, clamp loader, small subunit; Provisi 7e-04
pfam05496231 pfam05496, RuvB_N, Holliday junction DNA helicase 8e-04
TIGR00763 775 TIGR00763, lon, ATP-dependent protease La 9e-04
COG0466 782 COG0466, Lon, ATP-dependent Lon protease, bacteria 0.001
pfam06068395 pfam06068, TIP49, TIP49 C-terminus 0.001
pfam01078207 pfam01078, Mg_chelatase, Magnesium chelatase, subu 0.002
pfam13207114 pfam13207, AAA_17, AAA domain 0.002
pfam07728135 pfam07728, AAA_5, AAA domain (dynein-related subfa 0.003
>gnl|CDD|223540 COG0464, SpoVK, ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information 
 Score =  266 bits (682), Expect = 3e-78
 Identities = 123/323 (38%), Positives = 180/323 (55%), Gaps = 39/323 (12%)

Query: 895  AIQNESKSLKKSLKDVVTENEFEKRLLADVIPPSDIG-----VTFDDIGALENVKDTLKE 949
              +             VTE++FE+  L  V+P   +      VT DDIG LE  K+ LKE
Sbjct: 198  LRELRRAIDLVGEYIGVTEDDFEE-ALKKVLPSRGVLFEDEDVTLDDIGGLEEAKEELKE 256

Query: 950  LVMLPLQRPELFCKGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSK 1009
             +  PL+RPELF K  L +P KG+LL+GPPGTGKT+LAKAVA E+ + FI++  S + SK
Sbjct: 257  AIETPLKRPELFRKLGL-RPPKGVLLYGPPGTGKTLLAKAVALESRSRFISVKGSELLSK 315

Query: 1010 WFGEGEKYVKAVFSLASKIAPSVIFVDEVDSMLGRRENPGEHEAMRKMKNEFMVNWDGLR 1069
            W GE EK ++ +F  A K+APS+IF+DE+DS+   R  P E  + R++  + +   DG+ 
Sbjct: 316  WVGESEKNIRELFEKARKLAPSIIFIDEIDSLASGR-GPSEDGSGRRVVGQLLTELDGI- 373

Query: 1070 TKDTERILVLAATNRPFDLDEAVIR--RLPRRLMVNLPDAPNRAKILQVILAKED--LSP 1125
             +  E +LV+AATNRP DLD A++R  R  R + V LPD   R +I ++ L  +   L+ 
Sbjct: 374  -EKAEGVLVIAATNRPDDLDPALLRPGRFDRLIYVPLPDLEERLEIFKIHLRDKKPPLAE 432

Query: 1126 DVDFDAIANMTDGYSGSDLKNLCVTAAHRPIKEILEKEKKERAAAMAEGKPAPALSGCAD 1185
            DVD + +A +T+GYSG+D+  L   AA   ++E                           
Sbjct: 433  DVDLEELAEITEGYSGADIAALVREAALEALREAR------------------------- 467

Query: 1186 IRPLNMDDFKYAHERVCASVSSE 1208
             R + +DDF  A +++  SV+ E
Sbjct: 468  RREVTLDDFLDALKKIKPSVTYE 490

Length = 494
>gnl|CDD|224143 COG1222, RPT1, ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|179699 PRK03992, PRK03992, proteasome-activating nucleotidase; Provisional Back     alignment and domain information
>gnl|CDD|130309 TIGR01242, 26Sp45, 26S proteasome subunit P45 family Back     alignment and domain information
>gnl|CDD|233328 TIGR01243, CDC48, AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>gnl|CDD|233328 TIGR01243, CDC48, AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>gnl|CDD|233327 TIGR01241, FtsH_fam, ATP-dependent metalloprotease FtsH Back     alignment and domain information
>gnl|CDD|215649 pfam00004, AAA, ATPase family associated with various cellular activities (AAA) Back     alignment and domain information
>gnl|CDD|214386 CHL00176, ftsH, cell division protein; Validated Back     alignment and domain information
>gnl|CDD|240423 PTZ00454, PTZ00454, 26S protease regulatory subunit 6B-like protein; Provisional Back     alignment and domain information
>gnl|CDD|185575 PTZ00361, PTZ00361, 26 proteosome regulatory subunit 4-like protein; Provisional Back     alignment and domain information
>gnl|CDD|223541 COG0465, HflB, ATP-dependent Zn proteases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|182683 PRK10733, hflB, ATP-dependent metalloprotease; Reviewed Back     alignment and domain information
>gnl|CDD|224144 COG1223, COG1223, Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>gnl|CDD|223540 COG0464, SpoVK, ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|200312 TIGR03689, pup_AAA, proteasome ATPase Back     alignment and domain information
>gnl|CDD|99707 cd00009, AAA, The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>gnl|CDD|214640 smart00382, AAA, ATPases associated with a variety of cellular activities Back     alignment and domain information
>gnl|CDD|177094 CHL00195, ycf46, Ycf46; Provisional Back     alignment and domain information
>gnl|CDD|223786 COG0714, COG0714, MoxR-like ATPases [General function prediction only] Back     alignment and domain information
>gnl|CDD|237355 PRK13342, PRK13342, recombination factor protein RarA; Reviewed Back     alignment and domain information
>gnl|CDD|238017 cd00060, FHA, Forkhead associated domain (FHA); found in eukaryotic and prokaryotic proteins Back     alignment and domain information
>gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional Back     alignment and domain information
>gnl|CDD|225165 COG2256, MGS1, ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|215951 pfam00498, FHA, FHA domain Back     alignment and domain information
>gnl|CDD|224145 COG1224, TIP49, DNA helicase TIP49, TBP-interacting protein [Transcription] Back     alignment and domain information
>gnl|CDD|219536 pfam07724, AAA_2, AAA domain (Cdc48 subfamily) Back     alignment and domain information
>gnl|CDD|234619 PRK00080, ruvB, Holliday junction DNA helicase RuvB; Reviewed Back     alignment and domain information
>gnl|CDD|225164 COG2255, RuvB, Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|222866 PHA02544, 44, clamp loader, small subunit; Provisional Back     alignment and domain information
>gnl|CDD|203260 pfam05496, RuvB_N, Holliday junction DNA helicase ruvB N-terminus Back     alignment and domain information
>gnl|CDD|233119 TIGR00763, lon, ATP-dependent protease La Back     alignment and domain information
>gnl|CDD|223542 COG0466, Lon, ATP-dependent Lon protease, bacterial type [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|147949 pfam06068, TIP49, TIP49 C-terminus Back     alignment and domain information
>gnl|CDD|144608 pfam01078, Mg_chelatase, Magnesium chelatase, subunit ChlI Back     alignment and domain information
>gnl|CDD|221983 pfam13207, AAA_17, AAA domain Back     alignment and domain information
>gnl|CDD|219538 pfam07728, AAA_5, AAA domain (dynein-related subfamily) Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 1237
KOG0733802 consensus Nuclear AAA ATPase (VCP subfamily) [Post 100.0
KOG0730693 consensus AAA+-type ATPase [Posttranslational modi 100.0
KOG0737386 consensus AAA+-type ATPase [Posttranslational modi 100.0
TIGR01243733 CDC48 AAA family ATPase, CDC48 subfamily. This sub 100.0
KOG0736953 consensus Peroxisome assembly factor 2 containing 100.0
KOG0738491 consensus AAA+-type ATPase [Posttranslational modi 100.0
COG0464494 SpoVK ATPases of the AAA+ class [Posttranslational 100.0
COG1222406 RPT1 ATP-dependent 26S proteasome regulatory subun 100.0
KOG0733 802 consensus Nuclear AAA ATPase (VCP subfamily) [Post 100.0
KOG0735952 consensus AAA+-type ATPase [Posttranslational modi 100.0
KOG0739439 consensus AAA+-type ATPase [Posttranslational modi 100.0
KOG0741744 consensus AAA+-type ATPase [Posttranslational modi 100.0
CHL00195489 ycf46 Ycf46; Provisional 100.0
KOG0734 752 consensus AAA+-type ATPase containing the peptidas 100.0
KOG0740428 consensus AAA+-type ATPase [Posttranslational modi 100.0
KOG0652424 consensus 26S proteasome regulatory complex, ATPas 100.0
KOG0728404 consensus 26S proteasome regulatory complex, ATPas 100.0
KOG0727408 consensus 26S proteasome regulatory complex, ATPas 100.0
KOG0731 774 consensus AAA+-type ATPase containing the peptidas 100.0
COG0542786 clpA ATP-binding subunits of Clp protease and DnaK 100.0
KOG0726440 consensus 26S proteasome regulatory complex, ATPas 100.0
COG1223368 Predicted ATPase (AAA+ superfamily) [General funct 100.0
PTZ00454398 26S protease regulatory subunit 6B-like protein; P 100.0
KOG0732 1080 consensus AAA+-type ATPase containing the bromodom 100.0
PRK03992389 proteasome-activating nucleotidase; Provisional 100.0
KOG0729435 consensus 26S proteasome regulatory complex, ATPas 99.98
COG0465 596 HflB ATP-dependent Zn proteases [Posttranslational 99.97
TIGR01241 495 FtsH_fam ATP-dependent metalloprotease FtsH. HflB( 99.97
PTZ00361438 26 proteosome regulatory subunit 4-like protein; P 99.97
KOG0730 693 consensus AAA+-type ATPase [Posttranslational modi 99.97
TIGR02639731 ClpA ATP-dependent Clp protease ATP-binding subuni 99.97
TIGR01242364 26Sp45 26S proteasome subunit P45 family. Many pro 99.96
PRK11034758 clpA ATP-dependent Clp protease ATP-binding subuni 99.96
TIGR03689512 pup_AAA proteasome ATPase. In the Actinobacteria, 99.96
CHL00176 638 ftsH cell division protein; Validated 99.96
TIGR01243 733 CDC48 AAA family ATPase, CDC48 subfamily. This sub 99.96
TIGR03345852 VI_ClpV1 type VI secretion ATPase, ClpV1 family. M 99.96
PRK10733 644 hflB ATP-dependent metalloprotease; Reviewed 99.96
KOG0651388 consensus 26S proteasome regulatory complex, ATPas 99.95
CHL00095821 clpC Clp protease ATP binding subunit 99.95
TIGR03346852 chaperone_ClpB ATP-dependent chaperone ClpB. Membe 99.95
KOG0732 1080 consensus AAA+-type ATPase containing the bromodom 99.95
CHL00206 2281 ycf2 Ycf2; Provisional 99.95
PRK10865857 protein disaggregation chaperone; Provisional 99.94
KOG0741 744 consensus AAA+-type ATPase [Posttranslational modi 99.94
PLN00020413 ribulose bisphosphate carboxylase/oxygenase activa 99.93
KOG0737386 consensus AAA+-type ATPase [Posttranslational modi 99.93
COG1222406 RPT1 ATP-dependent 26S proteasome regulatory subun 99.9
KOG0736 953 consensus Peroxisome assembly factor 2 containing 99.86
KOG0738491 consensus AAA+-type ATPase [Posttranslational modi 99.82
CHL00181287 cbbX CbbX; Provisional 99.8
TIGR02880284 cbbX_cfxQ probable Rubsico expression protein CbbX 99.78
KOG0735 952 consensus AAA+-type ATPase [Posttranslational modi 99.78
KOG0742630 consensus AAA+-type ATPase [Posttranslational modi 99.78
TIGR02881261 spore_V_K stage V sporulation protein K. Members o 99.78
KOG0744423 consensus AAA+-type ATPase [Posttranslational modi 99.77
PF00004132 AAA: ATPase family associated with various cellula 99.76
KOG0739439 consensus AAA+-type ATPase [Posttranslational modi 99.74
CHL00195489 ycf46 Ycf46; Provisional 99.74
KOG0740428 consensus AAA+-type ATPase [Posttranslational modi 99.73
PTZ00454398 26S protease regulatory subunit 6B-like protein; P 99.73
KOG0734752 consensus AAA+-type ATPase containing the peptidas 99.72
KOG1051898 consensus Chaperone HSP104 and related ATP-depende 99.72
PRK03992389 proteasome-activating nucleotidase; Provisional 99.72
COG1223368 Predicted ATPase (AAA+ superfamily) [General funct 99.68
COG0464 494 SpoVK ATPases of the AAA+ class [Posttranslational 99.67
PTZ00361438 26 proteosome regulatory subunit 4-like protein; P 99.66
KOG0728404 consensus 26S proteasome regulatory complex, ATPas 99.65
PF05496233 RuvB_N: Holliday junction DNA helicase ruvB N-term 99.65
KOG0743457 consensus AAA+-type ATPase [Posttranslational modi 99.65
TIGR01241495 FtsH_fam ATP-dependent metalloprotease FtsH. HflB( 99.64
CHL002062281 ycf2 Ycf2; Provisional 99.64
TIGR02639 731 ClpA ATP-dependent Clp protease ATP-binding subuni 99.63
PRK00080328 ruvB Holliday junction DNA helicase RuvB; Reviewed 99.63
TIGR00635305 ruvB Holliday junction DNA helicase, RuvB subunit. 99.63
COG2256 436 MGS1 ATPase related to the helicase subunit of the 99.62
KOG0727408 consensus 26S proteasome regulatory complex, ATPas 99.62
TIGR03689512 pup_AAA proteasome ATPase. In the Actinobacteria, 99.61
KOG0731774 consensus AAA+-type ATPase containing the peptidas 99.61
PLN00020413 ribulose bisphosphate carboxylase/oxygenase activa 99.58
TIGR00763 775 lon ATP-dependent protease La. This protein is ind 99.58
CHL00176638 ftsH cell division protein; Validated 99.56
KOG0726440 consensus 26S proteasome regulatory complex, ATPas 99.56
TIGR01242364 26Sp45 26S proteasome subunit P45 family. Many pro 99.55
PRK12323 700 DNA polymerase III subunits gamma and tau; Provisi 99.55
COG2255332 RuvB Holliday junction resolvasome, helicase subun 99.54
PRK14956 484 DNA polymerase III subunits gamma and tau; Provisi 99.54
PRK07003 830 DNA polymerase III subunits gamma and tau; Validat 99.53
KOG0615475 consensus Serine/threonine protein kinase Chk2 and 99.51
PRK11034 758 clpA ATP-dependent Clp protease ATP-binding subuni 99.51
PRK10733644 hflB ATP-dependent metalloprotease; Reviewed 99.5
KOG2004 906 consensus Mitochondrial ATP-dependent protease PIM 99.5
PRK14960 702 DNA polymerase III subunits gamma and tau; Provisi 99.5
PRK14962 472 DNA polymerase III subunits gamma and tau; Provisi 99.5
PRK14961363 DNA polymerase III subunits gamma and tau; Provisi 99.49
TIGR02902 531 spore_lonB ATP-dependent protease LonB. Members of 99.49
KOG0729435 consensus 26S proteasome regulatory complex, ATPas 99.48
PRK14949 944 DNA polymerase III subunits gamma and tau; Provisi 99.48
TIGR03345 852 VI_ClpV1 type VI secretion ATPase, ClpV1 family. M 99.48
PRK14958 509 DNA polymerase III subunits gamma and tau; Provisi 99.48
PRK05342412 clpX ATP-dependent protease ATP-binding subunit Cl 99.47
PRK07994 647 DNA polymerase III subunits gamma and tau; Validat 99.47
PRK14964 491 DNA polymerase III subunits gamma and tau; Provisi 99.46
PRK08691 709 DNA polymerase III subunits gamma and tau; Validat 99.45
PRK13342 413 recombination factor protein RarA; Reviewed 99.45
KOG0652424 consensus 26S proteasome regulatory complex, ATPas 99.44
TIGR02928365 orc1/cdc6 family replication initiation protein. M 99.44
PRK10865 857 protein disaggregation chaperone; Provisional 99.44
PRK06645 507 DNA polymerase III subunits gamma and tau; Validat 99.43
PRK00149450 dnaA chromosomal replication initiation protein; R 99.43
KOG2028 554 consensus ATPase related to the helicase subunit o 99.43
PRK07940394 DNA polymerase III subunit delta'; Validated 99.42
PRK04195 482 replication factor C large subunit; Provisional 99.42
TIGR03346 852 chaperone_ClpB ATP-dependent chaperone ClpB. Membe 99.42
CHL00095 821 clpC Clp protease ATP binding subunit 99.42
PRK14951 618 DNA polymerase III subunits gamma and tau; Provisi 99.42
PRK14969 527 DNA polymerase III subunits gamma and tau; Provisi 99.42
TIGR00390441 hslU ATP-dependent protease HslVU, ATPase subunit. 99.41
PRK00411394 cdc6 cell division control protein 6; Reviewed 99.41
TIGR00362405 DnaA chromosomal replication initiator protein Dna 99.41
PLN03025319 replication factor C subunit; Provisional 99.41
PRK14957 546 DNA polymerase III subunits gamma and tau; Provisi 99.41
PRK14959 624 DNA polymerase III subunits gamma and tau; Provisi 99.41
KOG0651388 consensus 26S proteasome regulatory complex, ATPas 99.41
PRK05563 559 DNA polymerase III subunits gamma and tau; Validat 99.39
PRK07764 824 DNA polymerase III subunits gamma and tau; Validat 99.38
TIGR02397355 dnaX_nterm DNA polymerase III, subunit gamma and t 99.38
PRK05201443 hslU ATP-dependent protease ATP-binding subunit Hs 99.38
TIGR00382413 clpX endopeptidase Clp ATP-binding regulatory subu 99.38
PRK14963 504 DNA polymerase III subunits gamma and tau; Provisi 99.37
PRK12402337 replication factor C small subunit 2; Reviewed 99.37
PRK14952 584 DNA polymerase III subunits gamma and tau; Provisi 99.37
COG0466 782 Lon ATP-dependent Lon protease, bacterial type [Po 99.37
PTZ001121164 origin recognition complex 1 protein; Provisional 99.36
PRK14965 576 DNA polymerase III subunits gamma and tau; Provisi 99.36
PRK05896 605 DNA polymerase III subunits gamma and tau; Validat 99.35
TIGR03420226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Me 99.35
PRK08903227 DnaA regulatory inactivator Hda; Validated 99.34
PRK06893229 DNA replication initiation factor; Validated 99.34
PRK08084235 DNA replication initiation factor; Provisional 99.34
PRK12422445 chromosomal replication initiation protein; Provis 99.34
KOG0989346 consensus Replication factor C, subunit RFC4 [Repl 99.34
PRK14953 486 DNA polymerase III subunits gamma and tau; Provisi 99.32
PHA02544316 44 clamp loader, small subunit; Provisional 99.32
PRK06647 563 DNA polymerase III subunits gamma and tau; Validat 99.32
PRK07133 725 DNA polymerase III subunits gamma and tau; Validat 99.32
PRK10787 784 DNA-binding ATP-dependent protease La; Provisional 99.32
PF0049868 FHA: FHA domain; InterPro: IPR000253 The forkhead- 99.32
PRK13341 725 recombination factor protein RarA/unknown domain f 99.31
PRK06305 451 DNA polymerase III subunits gamma and tau; Validat 99.31
PRK09111 598 DNA polymerase III subunits gamma and tau; Validat 99.31
PF05673249 DUF815: Protein of unknown function (DUF815); Inte 99.3
PRK14086617 dnaA chromosomal replication initiation protein; P 99.3
PRK14088440 dnaA chromosomal replication initiation protein; P 99.29
COG0465596 HflB ATP-dependent Zn proteases [Posttranslational 99.29
PRK08727233 hypothetical protein; Validated 99.28
PRK14970367 DNA polymerase III subunits gamma and tau; Provisi 99.27
PRK08451 535 DNA polymerase III subunits gamma and tau; Validat 99.26
PRK00440319 rfc replication factor C small subunit; Reviewed 99.25
PRK14955397 DNA polymerase III subunits gamma and tau; Provisi 99.25
COG2812 515 DnaX DNA polymerase III, gamma/tau subunits [DNA r 99.25
PRK14948 620 DNA polymerase III subunits gamma and tau; Provisi 99.24
PRK14950 585 DNA polymerase III subunits gamma and tau; Provisi 99.23
CHL00081350 chlI Mg-protoporyphyrin IX chelatase 99.22
TIGR02640262 gas_vesic_GvpN gas vesicle protein GvpN. Members o 99.21
PRK14954 620 DNA polymerase III subunits gamma and tau; Provisi 99.2
PRK14087450 dnaA chromosomal replication initiation protein; P 99.19
PRK13407334 bchI magnesium chelatase subunit I; Provisional 99.19
PRK06620214 hypothetical protein; Validated 99.19
PRK05642234 DNA replication initiation factor; Validated 99.19
TIGR02903 615 spore_lon_C ATP-dependent protease, Lon family. Me 99.15
PRK14971 614 DNA polymerase III subunits gamma and tau; Provisi 99.14
cd00060102 FHA Forkhead associated domain (FHA); found in euk 99.12
cd00009151 AAA The AAA+ (ATPases Associated with a wide varie 99.11
COG1474366 CDC6 Cdc6-related protein, AAA superfamily ATPase 99.1
COG0593408 DnaA ATPase involved in DNA replication initiation 99.09
PF00308219 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013 99.09
TIGR02030337 BchI-ChlI magnesium chelatase ATPase subunit I. Th 99.07
PRK05564313 DNA polymerase III subunit delta'; Validated 99.07
PRK09112351 DNA polymerase III subunit delta'; Validated 99.06
TIGR01650327 PD_CobS cobaltochelatase, CobS subunit. This model 99.04
TIGR02442 633 Cob-chelat-sub cobaltochelatase subunit. A number 99.03
PRK09087226 hypothetical protein; Validated 99.02
PHA02244383 ATPase-like protein 99.0
KOG0991333 consensus Replication factor C, subunit RFC2 [Repl 99.0
PF07724171 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR 99.0
COG2607287 Predicted ATPase (AAA+ superfamily) [General funct 98.99
PRK07471365 DNA polymerase III subunit delta'; Validated 98.99
TIGR00678188 holB DNA polymerase III, delta' subunit. At positi 98.95
smart00350509 MCM minichromosome maintenance proteins. 98.95
COG0542 786 clpA ATP-binding subunits of Clp protease and DnaK 98.94
TIGR03015269 pepcterm_ATPase putative secretion ATPase, PEP-CTE 98.93
COG1219408 ClpX ATP-dependent protease Clp, ATPase subunit [P 98.93
PRK07399314 DNA polymerase III subunit delta'; Validated 98.92
KOG0745564 consensus Putative ATP-dependent Clp-type protease 98.9
smart00382148 AAA ATPases associated with a variety of cellular 98.9
PF07728139 AAA_5: AAA domain (dynein-related subfamily); Inte 98.89
PRK05707328 DNA polymerase III subunit delta'; Validated 98.88
COG1239423 ChlI Mg-chelatase subunit ChlI [Coenzyme metabolis 98.88
KOG0744423 consensus AAA+-type ATPase [Posttranslational modi 98.87
COG1224450 TIP49 DNA helicase TIP49, TBP-interacting protein 98.86
COG0714329 MoxR-like ATPases [General function prediction onl 98.86
KOG1969 877 consensus DNA replication checkpoint protein CHL12 98.86
TIGR03354396 VI_FHA type VI secretion system FHA domain protein 98.85
TIGR02031 589 BchD-ChlD magnesium chelatase ATPase subunit D. Th 98.85
COG0470325 HolB ATPase involved in DNA replication [DNA repli 98.83
PF00004132 AAA: ATPase family associated with various cellula 98.82
PRK11331459 5-methylcytosine-specific restriction enzyme subun 98.8
PRK08058329 DNA polymerase III subunit delta'; Validated 98.8
PF01078206 Mg_chelatase: Magnesium chelatase, subunit ChlI; I 98.8
PRK04132846 replication factor C small subunit; Provisional 98.79
PF05621302 TniB: Bacterial TniB protein; InterPro: IPR008868 98.78
TIGR00764 608 lon_rel lon-related putative ATP-dependent proteas 98.77
COG3829560 RocR Transcriptional regulator containing PAS, AAA 98.75
COG1220444 HslU ATP-dependent protease HslVU (ClpYQ), ATPase 98.74
PRK13531 498 regulatory ATPase RavA; Provisional 98.71
PRK06871325 DNA polymerase III subunit delta'; Validated 98.7
PF07726131 AAA_3: ATPase family associated with various cellu 98.7
TIGR02974329 phageshock_pspF psp operon transcriptional activat 98.68
KOG2035351 consensus Replication factor C, subunit RFC3 [Cell 98.67
PF06068398 TIP49: TIP49 C-terminus; InterPro: IPR010339 This 98.67
PRK07993334 DNA polymerase III subunit delta'; Validated 98.67
COG1221403 PspF Transcriptional regulators containing an AAA- 98.67
PRK11608326 pspF phage shock protein operon transcriptional ac 98.66
COG2204464 AtoC Response regulator containing CheY-like recei 98.65
TIGR00368499 Mg chelatase-related protein. The N-terminal end m 98.65
PRK15424538 propionate catabolism operon regulatory protein Pr 98.65
TIGR00602 637 rad24 checkpoint protein rad24. This family is bas 98.63
TIGR02329526 propionate_PrpR propionate catabolism operon regul 98.61
TIGR01817534 nifA Nif-specific regulatory protein. This model r 98.6
PRK08769319 DNA polymerase III subunit delta'; Validated 98.6
KOG1514767 consensus Origin recognition complex, subunit 1, a 98.6
PRK05022509 anaerobic nitric oxide reductase transcription reg 98.58
PRK15429686 formate hydrogenlyase transcriptional activator Fh 98.56
PRK06964342 DNA polymerase III subunit delta'; Validated 98.56
COG3604550 FhlA Transcriptional regulator containing GAF, AAA 98.55
PRK10820520 DNA-binding transcriptional regulator TyrR; Provis 98.55
PF13177162 DNA_pol3_delta2: DNA polymerase III, delta subunit 98.55
KOG2227529 consensus Pre-initiation complex, subunit CDC6, AA 98.54
PRK06090319 DNA polymerase III subunit delta'; Validated 98.54
PRK11388638 DNA-binding transcriptional regulator DhaR; Provis 98.5
PTZ00111 915 DNA replication licensing factor MCM4; Provisional 98.49
smart0024052 FHA Forkhead associated domain. Found in eukaryoti 98.47
PRK12377248 putative replication protein; Provisional 98.45
PRK08116268 hypothetical protein; Validated 98.4
KOG0742630 consensus AAA+-type ATPase [Posttranslational modi 98.38
KOG0482721 consensus DNA replication licensing factor, MCM7 c 98.37
COG1716191 FOG: FHA domain [Signal transduction mechanisms] 98.36
PF00158168 Sigma54_activat: Sigma-54 interaction domain; Inte 98.36
TIGR02915445 PEP_resp_reg putative PEP-CTERM system response re 98.33
smart00763361 AAA_PrkA PrkA AAA domain. This is a family of PrkA 98.32
PRK07952244 DNA replication protein DnaC; Validated 98.32
PLN02927668 antheraxanthin epoxidase/zeaxanthin epoxidase 98.32
COG1241682 MCM2 Predicted ATPase involved in replication cont 98.32
PRK09862506 putative ATP-dependent protease; Provisional 98.3
PRK13406 584 bchD magnesium chelatase subunit D; Provisional 98.29
PF03215 519 Rad17: Rad17 cell cycle checkpoint protein 98.29
KOG0990360 consensus Replication factor C, subunit RFC5 [Repl 98.29
TIGR02881261 spore_V_K stage V sporulation protein K. Members o 98.25
KOG1942456 consensus DNA helicase, TBP-interacting protein [R 98.24
PRK08699325 DNA polymerase III subunit delta'; Validated 98.23
COG0606490 Predicted ATPase with chaperone activity [Posttran 98.23
KOG0478804 consensus DNA replication licensing factor, MCM4 c 98.22
PF01637234 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 98.2
PRK13765 637 ATP-dependent protease Lon; Provisional 98.18
KOG2680454 consensus DNA helicase TIP49, TBP-interacting prot 98.17
PRK10923469 glnG nitrogen regulation protein NR(I); Provisiona 98.16
PRK08181269 transposase; Validated 98.14
PRK06835329 DNA replication protein DnaC; Validated 98.07
CHL00181287 cbbX CbbX; Provisional 98.06
PRK11361457 acetoacetate metabolism regulatory protein AtoC; P 98.05
PF13401131 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S 98.04
PF13173128 AAA_14: AAA domain 98.02
PRK08939306 primosomal protein DnaI; Reviewed 98.02
PRK15115444 response regulator GlrR; Provisional 98.01
COG3456430 Predicted component of the type VI protein secreti 97.99
TIGR01818463 ntrC nitrogen regulation protein NR(I). This model 97.98
PRK05342412 clpX ATP-dependent protease ATP-binding subunit Cl 97.98
PF14532138 Sigma54_activ_2: Sigma-54 interaction domain; PDB: 97.98
COG1219408 ClpX ATP-dependent protease Clp, ATPase subunit [P 97.96
KOG0480 764 consensus DNA replication licensing factor, MCM6 c 97.95
TIGR00763775 lon ATP-dependent protease La. This protein is ind 97.95
PRK06526254 transposase; Provisional 97.92
PF01695178 IstB_IS21: IstB-like ATP binding protein; InterPro 97.92
PRK05917290 DNA polymerase III subunit delta'; Validated 97.9
PRK10365441 transcriptional regulatory protein ZraR; Provision 97.86
COG1484254 DnaC DNA replication protein [DNA replication, rec 97.85
PRK06921266 hypothetical protein; Provisional 97.85
cd01120165 RecA-like_NTPases RecA-like NTPases. This family i 97.83
PF00493331 MCM: MCM2/3/5 family This family extends the MCM d 97.83
PF05729166 NACHT: NACHT domain 97.83
TIGR00382413 clpX endopeptidase Clp ATP-binding regulatory subu 97.82
PF12774231 AAA_6: Hydrolytic ATP binding site of dynein motor 97.81
PRK07276290 DNA polymerase III subunit delta'; Validated 97.81
TIGR02880284 cbbX_cfxQ probable Rubsico expression protein CbbX 97.8
PRK09183259 transposase/IS protein; Provisional 97.79
KOG1970 634 consensus Checkpoint RAD17-RFC complex, RAD17/RAD2 97.77
PF12775272 AAA_7: P-loop containing dynein motor region D3; P 97.75
PRK07132299 DNA polymerase III subunit delta'; Validated 97.74
PRK05818261 DNA polymerase III subunit delta'; Validated 97.66
KOG0477854 consensus DNA replication licensing factor, MCM2 c 97.65
COG3283511 TyrR Transcriptional regulator of aromatic amino a 97.64
PF00931287 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is 97.62
KOG2170344 consensus ATPase of the AAA+ superfamily [General 97.6
KOG1881793 consensus Anion exchanger adaptor protein Kanadapt 97.57
KOG2228408 consensus Origin recognition complex, subunit 4 [R 97.56
KOG0481729 consensus DNA replication licensing factor, MCM5 c 97.56
COG1618179 Predicted nucleotide kinase [Nucleotide transport 97.55
PF03969362 AFG1_ATPase: AFG1-like ATPase; InterPro: IPR005654 97.5
PRK00080328 ruvB Holliday junction DNA helicase RuvB; Reviewed 97.43
KOG0479 818 consensus DNA replication licensing factor, MCM3 c 97.34
PF00910107 RNA_helicase: RNA helicase; InterPro: IPR000605 He 97.34
PRK00771437 signal recognition particle protein Srp54; Provisi 97.32
TIGR01618220 phage_P_loop phage nucleotide-binding protein. Thi 97.32
TIGR02237209 recomb_radB DNA repair and recombination protein R 97.31
cd01124187 KaiC KaiC is a circadian clock protein primarily f 97.29
PHA00729226 NTP-binding motif containing protein 97.28
KOG1968 871 consensus Replication factor C, subunit RFC1 (larg 97.28
COG3284606 AcoR Transcriptional activator of acetoin/glycerol 97.27
TIGR00635305 ruvB Holliday junction DNA helicase, RuvB subunit. 97.24
COG3267269 ExeA Type II secretory pathway, component ExeA (pr 97.22
PLN03210 1153 Resistant to P. syringae 6; Provisional 97.14
KOG1882293 consensus Transcriptional regulator SNIP1, contain 97.09
PF13207121 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6 97.09
PF05673249 DUF815: Protein of unknown function (DUF815); Inte 97.08
cd01121372 Sms Sms (bacterial radA) DNA repair protein. This 97.04
PRK13342413 recombination factor protein RarA; Reviewed 97.04
PRK14962472 DNA polymerase III subunits gamma and tau; Provisi 97.0
COG5271 4600 MDN1 AAA ATPase containing von Willebrand factor t 96.99
PRK11823446 DNA repair protein RadA; Provisional 96.94
PRK08118167 topology modulation protein; Reviewed 96.93
PF03266168 NTPase_1: NTPase; InterPro: IPR004948 This entry r 96.93
PHA02544316 44 clamp loader, small subunit; Provisional 96.92
PF14516331 AAA_35: AAA-like domain 96.88
COG2256436 MGS1 ATPase related to the helicase subunit of the 96.88
PRK07261171 topology modulation protein; Provisional 96.87
KOG1051 898 consensus Chaperone HSP104 and related ATP-depende 96.85
PRK00149450 dnaA chromosomal replication initiation protein; R 96.82
PRK12724432 flagellar biosynthesis regulator FlhF; Provisional 96.8
PRK14974336 cell division protein FtsY; Provisional 96.8
PRK15455 644 PrkA family serine protein kinase; Provisional 96.78
TIGR02640262 gas_vesic_GvpN gas vesicle protein GvpN. Members o 96.77
PRK00131175 aroK shikimate kinase; Reviewed 96.76
PF05707193 Zot: Zonular occludens toxin (Zot); InterPro: IPR0 96.73
PRK09361225 radB DNA repair and recombination protein RadB; Pr 96.72
TIGR02012321 tigrfam_recA protein RecA. This model describes or 96.71
PRK08533230 flagellar accessory protein FlaH; Reviewed 96.71
PRK04841 903 transcriptional regulator MalT; Provisional 96.69
PRK10787784 DNA-binding ATP-dependent protease La; Provisional 96.68
COG5271 4600 MDN1 AAA ATPase containing von Willebrand factor t 96.68
COG4650531 RtcR Sigma54-dependent transcription regulator con 96.68
cd01129264 PulE-GspE PulE/GspE The type II secretory pathway 96.63
) proteins. It has been suggested that torsins play a role in effectively managing protein folding and that possible breakdown in a neuroprotective mechanism that is, in part, mediated by torsins may be responsible for the neuronal dysfunction associated with dystonia [].; GO: 0005524 ATP binding, 0051085 chaperone mediated protein folding requiring cofactor" target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=PF06309">PF06309127 Torsin: Torsin; InterPro: IPR010448 This family co 96.59
cd00983325 recA RecA is a bacterial enzyme which has roles in 96.56
PRK13695174 putative NTPase; Provisional 96.55
PF13671143 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1 96.55
COG3854308 SpoIIIAA ncharacterized protein conserved in bacte 96.51
cd01131198 PilT Pilus retraction ATPase PilT. PilT is a nucle 96.48
PRK13947171 shikimate kinase; Provisional 96.48
PRK10867433 signal recognition particle protein; Provisional 96.48
PRK05800170 cobU adenosylcobinamide kinase/adenosylcobinamide- 96.47
PRK04296190 thymidine kinase; Provisional 96.44
TIGR00390441 hslU ATP-dependent protease HslVU, ATPase subunit. 96.44
PF13191185 AAA_16: AAA ATPase domain; PDB: 2V1U_A. 96.41
PRK03839180 putative kinase; Provisional 96.41
TIGR02858270 spore_III_AA stage III sporulation protein AA. Mem 96.4
PF13604196 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL 96.39
PRK10536262 hypothetical protein; Provisional 96.38
cd01394218 radB RadB. The archaeal protein radB shares simila 96.36
KOG2543 438 consensus Origin recognition complex, subunit 5 [R 96.36
COG1373398 Predicted ATPase (AAA+ superfamily) [General funct 96.33
PHA02624647 large T antigen; Provisional 96.32
PRK12723388 flagellar biosynthesis regulator FlhF; Provisional 96.31
KOG2383467 consensus Predicted ATPase [General function predi 96.3
cd00464154 SK Shikimate kinase (SK) is the fifth enzyme in th 96.29
PRK00625173 shikimate kinase; Provisional 96.28
TIGR00416454 sms DNA repair protein RadA. The gene protuct code 96.24
cd00046144 DEXDc DEAD-like helicases superfamily. A diverse f 96.22
PRK09376416 rho transcription termination factor Rho; Provisio 96.2
COG1485367 Predicted ATPase [General function prediction only 96.2
cd03283199 ABC_MutS-like MutS-like homolog in eukaryotes. The 96.19
TIGR00959428 ffh signal recognition particle protein. This mode 96.18
PRK06217183 hypothetical protein; Validated 96.16
PHA02774613 E1; Provisional 96.16
PRK14532188 adenylate kinase; Provisional 96.14
PRK14722374 flhF flagellar biosynthesis regulator FlhF; Provis 96.13
PF06745226 KaiC: KaiC; InterPro: IPR014774 This entry represe 96.13
PRK13949169 shikimate kinase; Provisional 96.13
PRK14088440 dnaA chromosomal replication initiation protein; P 96.11
TIGR03877237 thermo_KaiC_1 KaiC domain protein, Ph0284 family. 96.1
PRK06067234 flagellar accessory protein FlaH; Validated 96.09
PRK06581263 DNA polymerase III subunit delta'; Validated 96.08
TIGR01359183 UMP_CMP_kin_fam UMP-CMP kinase family. This subfam 96.06
PRK04195482 replication factor C large subunit; Provisional 96.04
PF00448196 SRP54: SRP54-type protein, GTPase domain; InterPro 96.02
PRK06762166 hypothetical protein; Provisional 96.02
cd00544169 CobU Adenosylcobinamide kinase / adenosylcobinamid 96.01
PRK13948182 shikimate kinase; Provisional 95.98
PRK09354349 recA recombinase A; Provisional 95.98
cd01393226 recA_like RecA is a bacterial enzyme which has rol 95.95
PF13479213 AAA_24: AAA domain 95.93
cd01122271 GP4d_helicase GP4d_helicase is a homohexameric 5'- 95.92
PRK05973237 replicative DNA helicase; Provisional 95.91
PRK04040188 adenylate kinase; Provisional 95.91
KOG3347176 consensus Predicted nucleotide kinase/nuclear prot 95.91
PRK14531183 adenylate kinase; Provisional 95.9
TIGR01425429 SRP54_euk signal recognition particle protein SRP5 95.89
TIGR01420343 pilT_fam pilus retraction protein PilT. This model 95.88
COG0703172 AroK Shikimate kinase [Amino acid transport and me 95.88
cd00984242 DnaB_C DnaB helicase C terminal domain. The hexame 95.87
cd02020147 CMPK Cytidine monophosphate kinase (CMPK) catalyze 95.87
COG0563178 Adk Adenylate kinase and related kinases [Nucleoti 95.86
TIGR01650327 PD_CobS cobaltochelatase, CobS subunit. This model 95.86
TIGR02533486 type_II_gspE general secretory pathway protein E. 95.85
cd01428194 ADK Adenylate kinase (ADK) catalyzes the reversibl 95.85
cd02021150 GntK Gluconate kinase (GntK) catalyzes the phospho 95.84
PF00437270 T2SE: Type II/IV secretion system protein; InterPr 95.84
cd01123235 Rad51_DMC1_radA Rad51_DMC1_radA,B. This group of r 95.82
PRK08233182 hypothetical protein; Provisional 95.81
TIGR02928365 orc1/cdc6 family replication initiation protein. M 95.8
PRK14530215 adenylate kinase; Provisional 95.79
PF05496233 RuvB_N: Holliday junction DNA helicase ruvB N-term 95.78
PRK11889436 flhF flagellar biosynthesis regulator FlhF; Provis 95.74
PRK10436462 hypothetical protein; Provisional 95.71
COG5245 3164 DYN1 Dynein, heavy chain [Cytoskeleton] 95.69
PTZ00088229 adenylate kinase 1; Provisional 95.68
PRK12726407 flagellar biosynthesis regulator FlhF; Provisional 95.66
PRK03731171 aroL shikimate kinase II; Reviewed 95.65
TIGR01313163 therm_gnt_kin carbohydrate kinase, thermoresistant 95.63
TIGR03878259 thermo_KaiC_2 KaiC domain protein, AF_0795 family. 95.63
TIGR03420226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Me 95.62
COG2804500 PulE Type II secretory pathway, ATPase PulE/Tfp pi 95.59
cd00227175 CPT Chloramphenicol (Cm) phosphotransferase (CPT). 95.58
TIGR03574249 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal. Mem 95.58
PRK14528186 adenylate kinase; Provisional 95.57
cd01128249 rho_factor Transcription termination factor rho is 95.56
cd03281213 ABC_MSH5_euk MutS5 homolog in eukaryotes. The MutS 95.53
PRK02496184 adk adenylate kinase; Provisional 95.52
cd03243202 ABC_MutS_homologs The MutS protein initiates DNA m 95.51
COG4088261 Predicted nucleotide kinase [Nucleotide transport 95.51
TIGR02782299 TrbB_P P-type conjugative transfer ATPase TrbB. Th 95.48
TIGR03880224 KaiC_arch_3 KaiC domain protein, AF_0351 family. T 95.48
PRK06547172 hypothetical protein; Provisional 95.48
PRK13946184 shikimate kinase; Provisional 95.47
PF10236309 DAP3: Mitochondrial ribosomal death-associated pro 95.46
PRK13764602 ATPase; Provisional 95.43
TIGR02525372 plasmid_TraJ plasmid transfer ATPase TraJ. Members 95.43
PRK05057172 aroK shikimate kinase I; Reviewed 95.4
TIGR01360188 aden_kin_iso1 adenylate kinase, isozyme 1 subfamil 95.4
PRK10416318 signal recognition particle-docking protein FtsY; 95.38
smart00487201 DEXDc DEAD-like helicases superfamily. 95.37
PRK05201443 hslU ATP-dependent protease ATP-binding subunit Hs 95.36
TIGR00064272 ftsY signal recognition particle-docking protein F 95.35
cd02027149 APSK Adenosine 5'-phosphosulfate kinase (APSK) cat 95.34
TIGR02538564 type_IV_pilB type IV-A pilus assembly ATPase PilB. 95.33
PF04665241 Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 95.32
TIGR01448 720 recD_rel helicase, putative, RecD/TraA family. Thi 95.31
PRK04328249 hypothetical protein; Provisional 95.3
cd03280200 ABC_MutS2 MutS2 homologs in bacteria and eukaryote 95.29
PRK00279215 adk adenylate kinase; Reviewed 95.29
smart00534185 MUTSac ATPase domain of DNA mismatch repair MUTS f 95.25
PLN02200234 adenylate kinase family protein 95.25
COG4619223 ABC-type uncharacterized transport system, ATPase 95.24
TIGR01351210 adk adenylate kinases. Adenylate kinase (EC 2.7.4. 95.24
PRK08154309 anaerobic benzoate catabolism transcriptional regu 95.2
TIGR03499282 FlhF flagellar biosynthetic protein FlhF. 95.18
PF13481193 AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C. 95.17
PF13238129 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB 95.16
cd01130186 VirB11-like_ATPase Type IV secretory pathway compo 95.16
PF09848352 DUF2075: Uncharacterized conserved protein (DUF207 95.13
PRK13900332 type IV secretion system ATPase VirB11; Provisiona 95.13
KOG0745564 consensus Putative ATP-dependent Clp-type protease 95.13
cd03216163 ABC_Carb_Monos_I This family represents the domain 95.12
PRK14960702 DNA polymerase III subunits gamma and tau; Provisi 95.11
PF07693325 KAP_NTPase: KAP family P-loop domain; InterPro: IP 95.09
COG0541451 Ffh Signal recognition particle GTPase [Intracellu 95.07
PRK14956484 DNA polymerase III subunits gamma and tau; Provisi 95.06
cd03115173 SRP The signal recognition particle (SRP) mediates 95.06
COG1102179 Cmk Cytidylate kinase [Nucleotide transport and me 95.05
PRK06696223 uridine kinase; Validated 95.03
KOG2028554 consensus ATPase related to the helicase subunit o 94.96
COG0324308 MiaA tRNA delta(2)-isopentenylpyrophosphate transf 94.95
PRK04301317 radA DNA repair and recombination protein RadA; Va 94.89
PRK00411394 cdc6 cell division control protein 6; Reviewed 94.89
COG2874235 FlaH Predicted ATPases involved in biogenesis of a 94.88
TIGR03881229 KaiC_arch_4 KaiC domain protein, PAE1156 family. M 94.86
PRK14527191 adenylate kinase; Provisional 94.85
PRK04182180 cytidylate kinase; Provisional 94.85
PF06414199 Zeta_toxin: Zeta toxin; InterPro: IPR010488 This e 94.83
TIGR02655484 circ_KaiC circadian clock protein KaiC. Members of 94.82
COG1066456 Sms Predicted ATP-dependent serine protease [Postt 94.82
PRK07003 830 DNA polymerase III subunits gamma and tau; Validat 94.81
PTZ00202550 tuzin; Provisional 94.8
KOG02451221 consensus Kinesin-like protein [Cytoskeleton] 94.79
PRK13833323 conjugal transfer protein TrbB; Provisional 94.78
PRK13894319 conjugal transfer ATPase TrbB; Provisional 94.77
TIGR02788308 VirB11 P-type DNA transfer ATPase VirB11. The VirB 94.76
COG2909 894 MalT ATP-dependent transcriptional regulator [Tran 94.75
PF08433270 KTI12: Chromatin associated protein KTI12 ; InterP 94.72
PF00406151 ADK: Adenylate kinase; InterPro: IPR000850 Adenyla 94.71
>KOG0733 consensus Nuclear AAA ATPase (VCP subfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information 
Probab=100.00  E-value=2.4e-67  Score=608.60  Aligned_cols=563  Identities=29%  Similarity=0.439  Sum_probs=438.6

Q ss_pred             CCccccccccccccccchhHHHHHHHHhhhcccCCcccccccccccCCCceeeecCCCchHHHHHHHHHHHhHhCCeEEE
Q 000888          419 DGTNLQESFENFPYYLSENTKNVLIAASYIHLKHKDHAKYTSELTTVNPRILLSGPAGSEIYQEMLAKALAHYFGAKLLI  498 (1237)
Q Consensus       419 ~~~~~~vsf~~fpYylse~tk~~L~~~~~~hL~~~~~~~~~~~l~~~~~~iLLsgp~GsE~Yqe~LakALA~~f~a~ll~  498 (1237)
                      .....+|+|.++...  +.|-..|..-+ .|++|+++..|+--.  .++.|||.||||  |.++|||.|+|.++|+++|-
T Consensus       181 ~~~~snv~f~diGG~--d~~~~el~~li-~~i~~Pe~~~~lGv~--PprGvLlHGPPG--CGKT~lA~AiAgel~vPf~~  253 (802)
T KOG0733|consen  181 EFPESNVSFSDIGGL--DKTLAELCELI-IHIKHPEVFSSLGVR--PPRGVLLHGPPG--CGKTSLANAIAGELGVPFLS  253 (802)
T ss_pred             CCCCCCcchhhccCh--HHHHHHHHHHH-HHhcCchhHhhcCCC--CCCceeeeCCCC--ccHHHHHHHHhhhcCCceEe
Confidence            355668999997665  66666666544 579999998776433  357899999999  99999999999999999987


Q ss_pred             EeccccCCCCchhhHhhhhcCCccccccccccCCCChhhhhhhcCCCCCCCCCCCCCCCCCCCCCCCCcccccccccccc
Q 000888          499 FDSHSLLGGLSSKEAELLKDGTSAEKSCGCVKQGPTSTDLAKSINLPVSESDTPSSSNPPPQGPESQPKMETDTTLTSAG  578 (1237)
Q Consensus       499 ~d~~~~~~~~~~~~~~~~~~~~~~e~~~~~~k~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  578 (1237)
                      +-...+-+|+                                                                      
T Consensus       254 isApeivSGv----------------------------------------------------------------------  263 (802)
T KOG0733|consen  254 ISAPEIVSGV----------------------------------------------------------------------  263 (802)
T ss_pred             ecchhhhccc----------------------------------------------------------------------
Confidence            6554333221                                                                      


Q ss_pred             cccccccccCCeeeEecCCCCCCCCCCCCCCCCCCCCCCceeEeeccCCCCcceeeccCCCCCCCCCCCCCCCCCccccc
Q 000888          579 TSKNHMLRIGDRVRFVGSTSGGLYPTASPTRGPPCGTRGKVALLFEDNPSSKIGVRFDKPIPDGVDLGGQCEGGHGFFCN  658 (1237)
Q Consensus       579 ~s~~~~~~~gdrvk~~g~~~~~~~~~~~~~r~~~~g~~g~v~~~~e~n~s~kvgV~Fd~~~~~~~~l~~~c~~~~~ff~~  658 (1237)
                                                                                                      
T Consensus       264 --------------------------------------------------------------------------------  263 (802)
T KOG0733|consen  264 --------------------------------------------------------------------------------  263 (802)
T ss_pred             --------------------------------------------------------------------------------
Confidence                                                                                            


Q ss_pred             cccccccCCCcchhHHHHHHHHHHHHhhhccCCCeEEEEcchhhhhc----CCcchhhhHHHHHhcC----------CCc
Q 000888          659 VTDLRLENSGTEDLDKLLINTLFEVVFSESRSCPFILFMKDAEKSIA----GNSDSYSTFKSRLEKL----------PDK  724 (1237)
Q Consensus       659 ~~~~~l~~~~~e~~~k~~i~~L~ev~~~~~~~~p~ILfi~di~~~~~----~~~~~~~~lk~~L~~l----------~g~  724 (1237)
                               .||  .+.-|+.||+.+.+   ..|+||||||||.+-.    .+.++-..+...|...          ..+
T Consensus       264 ---------SGE--SEkkiRelF~~A~~---~aPcivFiDeIDAI~pkRe~aqreMErRiVaQLlt~mD~l~~~~~~g~~  329 (802)
T KOG0733|consen  264 ---------SGE--SEKKIRELFDQAKS---NAPCIVFIDEIDAITPKREEAQREMERRIVAQLLTSMDELSNEKTKGDP  329 (802)
T ss_pred             ---------Ccc--cHHHHHHHHHHHhc---cCCeEEEeecccccccchhhHHHHHHHHHHHHHHHhhhcccccccCCCC
Confidence                     123  55589999999999   9999999999999775    4455555666666221          248


Q ss_pred             EEEEEeeccCCCccccCCCCCccccccCCcccccccccCCCccccccccCCCchHHHHHHhhhCCCeEEEeCCCHHHHHH
Q 000888          725 VIVIGSHTHTDNRKEKSHPGGLLFTKFGSNQTALLDLAFPDSFGRLHDRGKEIPKATKLLTKLFPNKVTIHMPQDEALLA  804 (1237)
Q Consensus       725 vvvIGst~~~d~~~~~~~~~~~~l~r~gr~~~~l~d~al~~~~~r~~~~~~~~~~~d~~L~rrF~~~IeI~LPdeE~RL~  804 (1237)
                      |+|||+||++|+.||+       |||.||                                  |+++|.++.|++.+|.+
T Consensus       330 VlVIgATnRPDslDpa-------LRRaGR----------------------------------FdrEI~l~vP~e~aR~~  368 (802)
T KOG0733|consen  330 VLVIGATNRPDSLDPA-------LRRAGR----------------------------------FDREICLGVPSETAREE  368 (802)
T ss_pred             eEEEecCCCCcccCHH-------Hhcccc----------------------------------ccceeeecCCchHHHHH
Confidence            9999999999999999       999999                                  99999999999999999


Q ss_pred             HHHHhhhhhhhhhhhcCCchhHHHHhhcCCCCccCcccccccccccchHHHHHHHHHHHHhhhhcCCCCC-----Ccc--
Q 000888          805 SWKHQLDRDSETLKMKGNLNHLRTVLGRSGLECEGLETLCIRDQSLTNESAEKIVGWALSHHLMQNPEAD-----PDA--  877 (1237)
Q Consensus       805 IwK~qL~~~~e~l~l~~Nv~~l~~vL~~~glsgaDL~~Lci~d~~ls~~~ie~iV~~A~s~~l~~~~~p~-----~~~--  877 (1237)
                      ||+++.+.    +.+.-++++-+.+-.+.||-|+||.+||.++..+           |+.|++.....|.     ...  
T Consensus       369 IL~~~~~~----lrl~g~~d~~qlA~lTPGfVGADL~AL~~~Aa~v-----------AikR~ld~~~~p~~~~~~~ed~~  433 (802)
T KOG0733|consen  369 ILRIICRG----LRLSGDFDFKQLAKLTPGFVGADLMALCREAAFV-----------AIKRILDQSSSPLTKVPISEDSS  433 (802)
T ss_pred             HHHHHHhh----CCCCCCcCHHHHHhcCCCccchhHHHHHHHHHHH-----------HHHHHhhcccCccccCCcccccc
Confidence            99987644    6777788888889999999999999999987663           4444444222111     000  


Q ss_pred             -------c--ccccch-----hhhhHHHHHHHHHHhhhhhh--hcccccCCHHHHHHHHh--------cCcCCCCCCCcc
Q 000888          878 -------R--LVLSCE-----SIQYGIGIFQAIQNESKSLK--KSLKDVVTENEFEKRLL--------ADVIPPSDIGVT  933 (1237)
Q Consensus       878 -------~--l~l~~e-----d~~~al~~lq~i~~~~k~~k--~~~k~~v~~~e~e~~ll--------~~ii~~~~~~vt  933 (1237)
                             .  +.++..     ++...+  .+.+.....++.  ..-.-.+.-+||+..+.        .+++.  .++++
T Consensus       434 ~~~~~~d~S~i~~~~~~~~~~~ld~v~--~~~i~~~~d~~S~E~~~~L~i~~eDF~~Al~~iQPSakREGF~t--VPdVt  509 (802)
T KOG0733|consen  434 NKDAEEDQSSIKITSNAERPLELDRVV--QDAILNNPDPLSKELLEGLSIKFEDFEEALSKIQPSAKREGFAT--VPDVT  509 (802)
T ss_pred             CCCccchhhhhhcCCcccccccHHHHH--HHHHHhCCCCcChHHhccceecHHHHHHHHHhcCcchhccccee--cCCCC
Confidence                   0  111000     111111  011222111111  01112255677776542        12222  35799


Q ss_pred             chhccccHHHHHHHHHHHhCccCchhhhhcCCCCCCCceEEEEcCCCChHHHHHHHHHHHhCCcEEEEeccccccccccc
Q 000888          934 FDDIGALENVKDTLKELVMLPLQRPELFCKGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSITSKWFGE 1013 (1237)
Q Consensus       934 f~dI~Gle~vK~~L~e~V~~pl~~pe~f~k~~l~kP~~gVLL~GPPGTGKT~LAkAIA~eLg~~fi~Id~seL~s~~~G~ 1013 (1237)
                      |+|||++++++.+|...|.+|.++|+.|...|+..| .||||+||||||||.||+|+|++.+++|+.|..++|+.+|+|+
T Consensus       510 W~dIGaL~~vR~eL~~aI~~PiK~pd~~k~lGi~~P-sGvLL~GPPGCGKTLlAKAVANEag~NFisVKGPELlNkYVGE  588 (802)
T KOG0733|consen  510 WDDIGALEEVRLELNMAILAPIKRPDLFKALGIDAP-SGVLLCGPPGCGKTLLAKAVANEAGANFISVKGPELLNKYVGE  588 (802)
T ss_pred             hhhcccHHHHHHHHHHHHhhhccCHHHHHHhCCCCC-CceEEeCCCCccHHHHHHHHhhhccCceEeecCHHHHHHHhhh
Confidence            999999999999999999999999999999997665 8999999999999999999999999999999999999999999


Q ss_pred             cHHHHHHHHHHHHhcCCcEEEEccchhhhcCCCCCchhHHHHHHHHHHHHHhcCCcccCCccEEEEEecCCCCCCcHHHH
Q 000888         1014 GEKYVKAVFSLASKIAPSVIFVDEVDSMLGRRENPGEHEAMRKMKNEFMVNWDGLRTKDTERILVLAATNRPFDLDEAVI 1093 (1237)
Q Consensus      1014 se~~I~~lF~~A~k~~PsILfIDEID~L~~~r~~~~~~~a~~~il~eLL~~ldgl~~~~~~~VlVIaTTN~p~~Ld~aLl 1093 (1237)
                      +|..++++|..|+.++|||||+||||.|++.|+... .....+++|+||+.|||+..  +..|.|||+||+|+.+||+++
T Consensus       589 SErAVR~vFqRAR~saPCVIFFDEiDaL~p~R~~~~-s~~s~RvvNqLLtElDGl~~--R~gV~viaATNRPDiIDpAiL  665 (802)
T KOG0733|consen  589 SERAVRQVFQRARASAPCVIFFDEIDALVPRRSDEG-SSVSSRVVNQLLTELDGLEE--RRGVYVIAATNRPDIIDPAIL  665 (802)
T ss_pred             HHHHHHHHHHHhhcCCCeEEEecchhhcCcccCCCC-chhHHHHHHHHHHHhccccc--ccceEEEeecCCCcccchhhc
Confidence            999999999999999999999999999999987644 67778999999999999954  578999999999999999999


Q ss_pred             h--hccccccCCCCCHHHHHHHHHHHHh--hCCCCChhhHHHHHHHcC--CCcHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q 000888         1094 R--RLPRRLMVNLPDAPNRAKILQVILA--KEDLSPDVDFDAIANMTD--GYSGSDLKNLCVTAAHRPIKEILEKEKKER 1167 (1237)
Q Consensus      1094 r--RFd~~I~v~~Pd~eeR~eILk~~L~--~~~l~~d~dl~~LA~~T~--GySgaDL~~L~~~Aa~~aireil~~e~~~~ 1167 (1237)
                      |  |||..++|++|+.++|..||+.+.+  +..+.+++|+++||+.+.  ||+|+||..||++|...++++.+...... 
T Consensus       666 RPGRlDk~LyV~lPn~~eR~~ILK~~tkn~k~pl~~dVdl~eia~~~~c~gftGADLaaLvreAsi~AL~~~~~~~~~~-  744 (802)
T KOG0733|consen  666 RPGRLDKLLYVGLPNAEERVAILKTITKNTKPPLSSDVDLDEIARNTKCEGFTGADLAALVREASILALRESLFEIDSS-  744 (802)
T ss_pred             CCCccCceeeecCCCHHHHHHHHHHHhccCCCCCCcccCHHHHhhcccccCCchhhHHHHHHHHHHHHHHHHHhhcccc-
Confidence            9  9999999999999999999999998  667889999999999876  99999999999999999999866422110 


Q ss_pred             HHHHhcCCCCCCCCCCCCCccccHHHHHHHHHHhccCccccccchhhhHHHHHHhcCCCCc
Q 000888         1168 AAAMAEGKPAPALSGCADIRPLNMDDFKYAHERVCASVSSESVNMSELLQWNELYGEGGSR 1228 (1237)
Q Consensus      1168 ~~a~~e~~~~~~~~~~~~~r~Lt~eDF~~AL~~v~pS~s~e~~~~~~lvkW~diyG~~gsr 1228 (1237)
                             .  ....-......+++.||++|+++++||+++....  -|.+-+..+|..-..
T Consensus       745 -------~--~~~~~~~~~~~~t~~hF~eA~~~i~pSv~~~dr~--~Yd~l~k~~~L~~~~  794 (802)
T KOG0733|consen  745 -------E--DDVTVRSSTIIVTYKHFEEAFQRIRPSVSERDRK--KYDRLNKSRSLSTAT  794 (802)
T ss_pred             -------C--cccceeeeeeeecHHHHHHHHHhcCCCccHHHHH--HHHHHhhhhcccccC
Confidence                   0  0000000124689999999999999999977443  356666666654433

>KOG0730 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0737 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>KOG0736 consensus Peroxisome assembly factor 2 containing the AAA+-type ATPase domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0738 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG0464 SpoVK ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1222 RPT1 ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0733 consensus Nuclear AAA ATPase (VCP subfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0735 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0739 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0741 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>CHL00195 ycf46 Ycf46; Provisional Back     alignment and domain information
>KOG0734 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0740 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0652 consensus 26S proteasome regulatory complex, ATPase RPT5 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0728 consensus 26S proteasome regulatory complex, ATPase RPT6 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0727 consensus 26S proteasome regulatory complex, ATPase RPT3 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0731 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG0542 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0726 consensus 26S proteasome regulatory complex, ATPase RPT2 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1223 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional Back     alignment and domain information
>KOG0732 consensus AAA+-type ATPase containing the bromodomain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK03992 proteasome-activating nucleotidase; Provisional Back     alignment and domain information
>KOG0729 consensus 26S proteasome regulatory complex, ATPase RPT1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG0465 HflB ATP-dependent Zn proteases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR01241 FtsH_fam ATP-dependent metalloprotease FtsH Back     alignment and domain information
>PTZ00361 26 proteosome regulatory subunit 4-like protein; Provisional Back     alignment and domain information
>KOG0730 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA Back     alignment and domain information
>TIGR01242 26Sp45 26S proteasome subunit P45 family Back     alignment and domain information
>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR03689 pup_AAA proteasome ATPase Back     alignment and domain information
>CHL00176 ftsH cell division protein; Validated Back     alignment and domain information
>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family Back     alignment and domain information
>PRK10733 hflB ATP-dependent metalloprotease; Reviewed Back     alignment and domain information
>KOG0651 consensus 26S proteasome regulatory complex, ATPase RPT4 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>CHL00095 clpC Clp protease ATP binding subunit Back     alignment and domain information
>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB Back     alignment and domain information
>KOG0732 consensus AAA+-type ATPase containing the bromodomain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>CHL00206 ycf2 Ycf2; Provisional Back     alignment and domain information
>PRK10865 protein disaggregation chaperone; Provisional Back     alignment and domain information
>KOG0741 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN00020 ribulose bisphosphate carboxylase/oxygenase activase -RuBisCO activase (RCA); Provisional Back     alignment and domain information
>KOG0737 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1222 RPT1 ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0736 consensus Peroxisome assembly factor 2 containing the AAA+-type ATPase domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0738 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>CHL00181 cbbX CbbX; Provisional Back     alignment and domain information
>TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX Back     alignment and domain information
>KOG0735 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0742 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02881 spore_V_K stage V sporulation protein K Back     alignment and domain information
>KOG0744 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport Back     alignment and domain information
>KOG0739 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>CHL00195 ycf46 Ycf46; Provisional Back     alignment and domain information
>KOG0740 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional Back     alignment and domain information
>KOG0734 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1051 consensus Chaperone HSP104 and related ATP-dependent Clp proteases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK03992 proteasome-activating nucleotidase; Provisional Back     alignment and domain information
>COG1223 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>COG0464 SpoVK ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PTZ00361 26 proteosome regulatory subunit 4-like protein; Provisional Back     alignment and domain information
>KOG0728 consensus 26S proteasome regulatory complex, ATPase RPT6 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair Back     alignment and domain information
>KOG0743 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR01241 FtsH_fam ATP-dependent metalloprotease FtsH Back     alignment and domain information
>CHL00206 ycf2 Ycf2; Provisional Back     alignment and domain information
>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA Back     alignment and domain information
>PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed Back     alignment and domain information
>TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit Back     alignment and domain information
>COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0727 consensus 26S proteasome regulatory complex, ATPase RPT3 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03689 pup_AAA proteasome ATPase Back     alignment and domain information
>KOG0731 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN00020 ribulose bisphosphate carboxylase/oxygenase activase -RuBisCO activase (RCA); Provisional Back     alignment and domain information
>TIGR00763 lon ATP-dependent protease La Back     alignment and domain information
>CHL00176 ftsH cell division protein; Validated Back     alignment and domain information
>KOG0726 consensus 26S proteasome regulatory complex, ATPase RPT2 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR01242 26Sp45 26S proteasome subunit P45 family Back     alignment and domain information
>PRK12323 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG2255 RuvB Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK14956 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK07003 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>KOG0615 consensus Serine/threonine protein kinase Chk2 and related proteins [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional Back     alignment and domain information
>PRK10733 hflB ATP-dependent metalloprotease; Reviewed Back     alignment and domain information
>KOG2004 consensus Mitochondrial ATP-dependent protease PIM1/LON [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14960 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14962 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14961 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR02902 spore_lonB ATP-dependent protease LonB Back     alignment and domain information
>KOG0729 consensus 26S proteasome regulatory complex, ATPase RPT1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14949 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family Back     alignment and domain information
>PRK14958 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK05342 clpX ATP-dependent protease ATP-binding subunit ClpX; Provisional Back     alignment and domain information
>PRK07994 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14964 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK08691 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK13342 recombination factor protein RarA; Reviewed Back     alignment and domain information
>KOG0652 consensus 26S proteasome regulatory complex, ATPase RPT5 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02928 orc1/cdc6 family replication initiation protein Back     alignment and domain information
>PRK10865 protein disaggregation chaperone; Provisional Back     alignment and domain information
>PRK06645 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK00149 dnaA chromosomal replication initiation protein; Reviewed Back     alignment and domain information
>KOG2028 consensus ATPase related to the helicase subunit of the Holliday junction resolvase [Replication, recombination and repair] Back     alignment and domain information
>PRK07940 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK04195 replication factor C large subunit; Provisional Back     alignment and domain information
>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB Back     alignment and domain information
>CHL00095 clpC Clp protease ATP binding subunit Back     alignment and domain information
>PRK14951 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14969 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR00390 hslU ATP-dependent protease HslVU, ATPase subunit Back     alignment and domain information
>PRK00411 cdc6 cell division control protein 6; Reviewed Back     alignment and domain information
>TIGR00362 DnaA chromosomal replication initiator protein DnaA Back     alignment and domain information
>PLN03025 replication factor C subunit; Provisional Back     alignment and domain information
>PRK14957 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14959 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>KOG0651 consensus 26S proteasome regulatory complex, ATPase RPT4 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK05563 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK07764 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR02397 dnaX_nterm DNA polymerase III, subunit gamma and tau Back     alignment and domain information
>PRK05201 hslU ATP-dependent protease ATP-binding subunit HslU; Provisional Back     alignment and domain information
>TIGR00382 clpX endopeptidase Clp ATP-binding regulatory subunit (clpX) Back     alignment and domain information
>PRK14963 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK12402 replication factor C small subunit 2; Reviewed Back     alignment and domain information
>PRK14952 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG0466 Lon ATP-dependent Lon protease, bacterial type [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PTZ00112 origin recognition complex 1 protein; Provisional Back     alignment and domain information
>PRK14965 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK05896 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda Back     alignment and domain information
>PRK08903 DnaA regulatory inactivator Hda; Validated Back     alignment and domain information
>PRK06893 DNA replication initiation factor; Validated Back     alignment and domain information
>PRK08084 DNA replication initiation factor; Provisional Back     alignment and domain information
>PRK12422 chromosomal replication initiation protein; Provisional Back     alignment and domain information
>KOG0989 consensus Replication factor C, subunit RFC4 [Replication, recombination and repair] Back     alignment and domain information
>PRK14953 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PHA02544 44 clamp loader, small subunit; Provisional Back     alignment and domain information
>PRK06647 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK07133 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK10787 DNA-binding ATP-dependent protease La; Provisional Back     alignment and domain information
>PF00498 FHA: FHA domain; InterPro: IPR000253 The forkhead-associated (FHA) domain [] is a phosphopeptide recognition domain found in many regulatory proteins Back     alignment and domain information
>PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed Back     alignment and domain information
>PRK06305 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK09111 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PF05673 DUF815: Protein of unknown function (DUF815); InterPro: IPR008533 This domain consists of several bacterial proteins of unknown function Back     alignment and domain information
>PRK14086 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK14088 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>COG0465 HflB ATP-dependent Zn proteases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK08727 hypothetical protein; Validated Back     alignment and domain information
>PRK14970 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK08451 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK00440 rfc replication factor C small subunit; Reviewed Back     alignment and domain information
>PRK14955 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG2812 DnaX DNA polymerase III, gamma/tau subunits [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK14948 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14950 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>CHL00081 chlI Mg-protoporyphyrin IX chelatase Back     alignment and domain information
>TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN Back     alignment and domain information
>PRK14954 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14087 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK13407 bchI magnesium chelatase subunit I; Provisional Back     alignment and domain information
>PRK06620 hypothetical protein; Validated Back     alignment and domain information
>PRK05642 DNA replication initiation factor; Validated Back     alignment and domain information
>TIGR02903 spore_lon_C ATP-dependent protease, Lon family Back     alignment and domain information
>PRK14971 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>cd00060 FHA Forkhead associated domain (FHA); found in eukaryotic and prokaryotic proteins Back     alignment and domain information
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG0593 DnaA ATPase involved in DNA replication initiation [DNA replication, recombination, and repair] Back     alignment and domain information
>PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication Back     alignment and domain information
>TIGR02030 BchI-ChlI magnesium chelatase ATPase subunit I Back     alignment and domain information
>PRK05564 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK09112 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR01650 PD_CobS cobaltochelatase, CobS subunit Back     alignment and domain information
>TIGR02442 Cob-chelat-sub cobaltochelatase subunit Back     alignment and domain information
>PRK09087 hypothetical protein; Validated Back     alignment and domain information
>PHA02244 ATPase-like protein Back     alignment and domain information
>KOG0991 consensus Replication factor C, subunit RFC2 [Replication, recombination and repair] Back     alignment and domain information
>PF07724 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR013093 ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] Back     alignment and domain information
>COG2607 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>PRK07471 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR00678 holB DNA polymerase III, delta' subunit Back     alignment and domain information
>smart00350 MCM minichromosome maintenance proteins Back     alignment and domain information
>COG0542 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily Back     alignment and domain information
>COG1219 ClpX ATP-dependent protease Clp, ATPase subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK07399 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>KOG0745 consensus Putative ATP-dependent Clp-type protease (AAA+ ATPase superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00382 AAA ATPases associated with a variety of cellular activities Back     alignment and domain information
>PF07728 AAA_5: AAA domain (dynein-related subfamily); InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] Back     alignment and domain information
>PRK05707 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>COG1239 ChlI Mg-chelatase subunit ChlI [Coenzyme metabolism] Back     alignment and domain information
>KOG0744 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1224 TIP49 DNA helicase TIP49, TBP-interacting protein [Transcription] Back     alignment and domain information
>COG0714 MoxR-like ATPases [General function prediction only] Back     alignment and domain information
>KOG1969 consensus DNA replication checkpoint protein CHL12/CTF18 [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] Back     alignment and domain information
>TIGR03354 VI_FHA type VI secretion system FHA domain protein Back     alignment and domain information
>TIGR02031 BchD-ChlD magnesium chelatase ATPase subunit D Back     alignment and domain information
>COG0470 HolB ATPase involved in DNA replication [DNA replication, recombination, and repair] Back     alignment and domain information
>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport Back     alignment and domain information
>PRK11331 5-methylcytosine-specific restriction enzyme subunit McrB; Provisional Back     alignment and domain information
>PRK08058 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PF01078 Mg_chelatase: Magnesium chelatase, subunit ChlI; InterPro: IPR000523 Magnesium-chelatase is a three-component enzyme that catalyses the insertion of Mg2+ into protoporphyrin IX Back     alignment and domain information
>PRK04132 replication factor C small subunit; Provisional Back     alignment and domain information
>PF05621 TniB: Bacterial TniB protein; InterPro: IPR008868 This family consists of several bacterial TniB NTP-binding proteins Back     alignment and domain information
>TIGR00764 lon_rel lon-related putative ATP-dependent protease Back     alignment and domain information
>COG3829 RocR Transcriptional regulator containing PAS, AAA-type ATPase, and DNA-binding domains [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>COG1220 HslU ATP-dependent protease HslVU (ClpYQ), ATPase subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK13531 regulatory ATPase RavA; Provisional Back     alignment and domain information
>PRK06871 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PF07726 AAA_3: ATPase family associated with various cellular activities (AAA); InterPro: IPR011703 This entry includes some of the AAA proteins not detected by the IPR003959 from INTERPRO model Back     alignment and domain information
>TIGR02974 phageshock_pspF psp operon transcriptional activator PspF Back     alignment and domain information
>KOG2035 consensus Replication factor C, subunit RFC3 [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] Back     alignment and domain information
>PF06068 TIP49: TIP49 C-terminus; InterPro: IPR010339 This family consists of the C-terminal region of several eukaryotic and archaeal RuvB-like 1 (Pontin or TIP49a) and RuvB-like 2 (Reptin or TIP49b) proteins Back     alignment and domain information
>PRK07993 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>COG1221 PspF Transcriptional regulators containing an AAA-type ATPase domain and a DNA-binding domain [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>PRK11608 pspF phage shock protein operon transcriptional activator; Provisional Back     alignment and domain information
>COG2204 AtoC Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains [Signal transduction mechanisms] Back     alignment and domain information
>TIGR00368 Mg chelatase-related protein Back     alignment and domain information
>PRK15424 propionate catabolism operon regulatory protein PrpR; Provisional Back     alignment and domain information
>TIGR00602 rad24 checkpoint protein rad24 Back     alignment and domain information
>TIGR02329 propionate_PrpR propionate catabolism operon regulatory protein PrpR Back     alignment and domain information
>TIGR01817 nifA Nif-specific regulatory protein Back     alignment and domain information
>PRK08769 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>KOG1514 consensus Origin recognition complex, subunit 1, and related proteins [Replication, recombination and repair] Back     alignment and domain information
>PRK05022 anaerobic nitric oxide reductase transcription regulator; Provisional Back     alignment and domain information
>PRK15429 formate hydrogenlyase transcriptional activator FhlA; Provisional Back     alignment and domain information
>PRK06964 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>COG3604 FhlA Transcriptional regulator containing GAF, AAA-type ATPase, and DNA binding domains [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>PRK10820 DNA-binding transcriptional regulator TyrR; Provisional Back     alignment and domain information
>PF13177 DNA_pol3_delta2: DNA polymerase III, delta subunit; PDB: 1NJF_B 3GLG_G 1XXH_I 1NJG_A 3GLF_B 3GLI_G 1IQP_E 2GNO_A 1SXJ_E 1A5T_A Back     alignment and domain information
>KOG2227 consensus Pre-initiation complex, subunit CDC6, AAA+ superfamily ATPase [Replication, recombination and repair; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK06090 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK11388 DNA-binding transcriptional regulator DhaR; Provisional Back     alignment and domain information
>PTZ00111 DNA replication licensing factor MCM4; Provisional Back     alignment and domain information
>smart00240 FHA Forkhead associated domain Back     alignment and domain information
>PRK12377 putative replication protein; Provisional Back     alignment and domain information
>PRK08116 hypothetical protein; Validated Back     alignment and domain information
>KOG0742 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0482 consensus DNA replication licensing factor, MCM7 component [Replication, recombination and repair] Back     alignment and domain information
>COG1716 FOG: FHA domain [Signal transduction mechanisms] Back     alignment and domain information
>PF00158 Sigma54_activat: Sigma-54 interaction domain; InterPro: IPR002078 Some bacterial regulatory proteins activate the expression of genes from promoters recognised by core RNA polymerase associated with the alternative sigma-54 factor Back     alignment and domain information
>TIGR02915 PEP_resp_reg putative PEP-CTERM system response regulator Back     alignment and domain information
>smart00763 AAA_PrkA PrkA AAA domain Back     alignment and domain information
>PRK07952 DNA replication protein DnaC; Validated Back     alignment and domain information
>PLN02927 antheraxanthin epoxidase/zeaxanthin epoxidase Back     alignment and domain information
>COG1241 MCM2 Predicted ATPase involved in replication control, Cdc46/Mcm family [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK09862 putative ATP-dependent protease; Provisional Back     alignment and domain information
>PRK13406 bchD magnesium chelatase subunit D; Provisional Back     alignment and domain information
>PF03215 Rad17: Rad17 cell cycle checkpoint protein Back     alignment and domain information
>KOG0990 consensus Replication factor C, subunit RFC5 [Replication, recombination and repair] Back     alignment and domain information
>TIGR02881 spore_V_K stage V sporulation protein K Back     alignment and domain information
>KOG1942 consensus DNA helicase, TBP-interacting protein [Replication, recombination and repair] Back     alignment and domain information
>PRK08699 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>COG0606 Predicted ATPase with chaperone activity [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0478 consensus DNA replication licensing factor, MCM4 component [Replication, recombination and repair] Back     alignment and domain information
>PF01637 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 This domain has been found in a number of bacterial and archaeal proteins, all of which contain a conserved P-loop motif that is involved in binding ATP Back     alignment and domain information
>PRK13765 ATP-dependent protease Lon; Provisional Back     alignment and domain information
>KOG2680 consensus DNA helicase TIP49, TBP-interacting protein [Transcription] Back     alignment and domain information
>PRK10923 glnG nitrogen regulation protein NR(I); Provisional Back     alignment and domain information
>PRK08181 transposase; Validated Back     alignment and domain information
>PRK06835 DNA replication protein DnaC; Validated Back     alignment and domain information
>CHL00181 cbbX CbbX; Provisional Back     alignment and domain information
>PRK11361 acetoacetate metabolism regulatory protein AtoC; Provisional Back     alignment and domain information
>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B Back     alignment and domain information
>PF13173 AAA_14: AAA domain Back     alignment and domain information
>PRK08939 primosomal protein DnaI; Reviewed Back     alignment and domain information
>PRK15115 response regulator GlrR; Provisional Back     alignment and domain information
>COG3456 Predicted component of the type VI protein secretion system, contains a FHA domain [Intracellular trafficking, secretion, and vesicular transport; Signal transduction mechanisms] Back     alignment and domain information
>TIGR01818 ntrC nitrogen regulation protein NR(I) Back     alignment and domain information
>PRK05342 clpX ATP-dependent protease ATP-binding subunit ClpX; Provisional Back     alignment and domain information
>PF14532 Sigma54_activ_2: Sigma-54 interaction domain; PDB: 3CO5_B 3N70_H Back     alignment and domain information
>COG1219 ClpX ATP-dependent protease Clp, ATPase subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0480 consensus DNA replication licensing factor, MCM6 component [Replication, recombination and repair] Back     alignment and domain information
>TIGR00763 lon ATP-dependent protease La Back     alignment and domain information
>PRK06526 transposase; Provisional Back     alignment and domain information
>PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif Back     alignment and domain information
>PRK05917 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK10365 transcriptional regulatory protein ZraR; Provisional Back     alignment and domain information
>COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK06921 hypothetical protein; Provisional Back     alignment and domain information
>cd01120 RecA-like_NTPases RecA-like NTPases Back     alignment and domain information
>PF00493 MCM: MCM2/3/5 family This family extends the MCM domain of Prosite Back     alignment and domain information
>PF05729 NACHT: NACHT domain Back     alignment and domain information
>TIGR00382 clpX endopeptidase Clp ATP-binding regulatory subunit (clpX) Back     alignment and domain information
>PF12774 AAA_6: Hydrolytic ATP binding site of dynein motor region D1; PDB: 3VKH_A 3VKG_A 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A Back     alignment and domain information
>PRK07276 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX Back     alignment and domain information
>PRK09183 transposase/IS protein; Provisional Back     alignment and domain information
>KOG1970 consensus Checkpoint RAD17-RFC complex, RAD17/RAD24 component [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] Back     alignment and domain information
>PF12775 AAA_7: P-loop containing dynein motor region D3; PDB: 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A 3VKH_A 3VKG_A Back     alignment and domain information
>PRK07132 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK05818 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>KOG0477 consensus DNA replication licensing factor, MCM2 component [Replication, recombination and repair] Back     alignment and domain information
>COG3283 TyrR Transcriptional regulator of aromatic amino acids metabolism [Transcription / Amino acid transport and metabolism] Back     alignment and domain information
>PF00931 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is the NB-ARC domain, a novel signalling motif found in bacteria and eukaryotes, shared by plant resistance gene products and regulators of cell death in animals [] Back     alignment and domain information
>KOG2170 consensus ATPase of the AAA+ superfamily [General function prediction only] Back     alignment and domain information
>KOG1881 consensus Anion exchanger adaptor protein Kanadaptin, contains FHA domain [General function prediction only] Back     alignment and domain information
>KOG2228 consensus Origin recognition complex, subunit 4 [Replication, recombination and repair] Back     alignment and domain information
>KOG0481 consensus DNA replication licensing factor, MCM5 component [Replication, recombination and repair] Back     alignment and domain information
>COG1618 Predicted nucleotide kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PF03969 AFG1_ATPase: AFG1-like ATPase; InterPro: IPR005654 ATPase family gene 1 (AFG1) ATPase is a 377 amino acid putative protein with an ATPase motif typical of the protein family including SEC18p PAS1, CDC48-VCP and TBP Back     alignment and domain information
>PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed Back     alignment and domain information
>KOG0479 consensus DNA replication licensing factor, MCM3 component [Replication, recombination and repair] Back     alignment and domain information
>PF00910 RNA_helicase: RNA helicase; InterPro: IPR000605 Helicases have been classified in 5 superfamilies (SF1-SF5) Back     alignment and domain information
>PRK00771 signal recognition particle protein Srp54; Provisional Back     alignment and domain information
>TIGR01618 phage_P_loop phage nucleotide-binding protein Back     alignment and domain information
>TIGR02237 recomb_radB DNA repair and recombination protein RadB Back     alignment and domain information
>cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs Back     alignment and domain information
>PHA00729 NTP-binding motif containing protein Back     alignment and domain information
>KOG1968 consensus Replication factor C, subunit RFC1 (large subunit) [Replication, recombination and repair] Back     alignment and domain information
>COG3284 AcoR Transcriptional activator of acetoin/glycerol metabolism [Secondary metabolites biosynthesis, transport, and catabolism / Transcription] Back     alignment and domain information
>TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit Back     alignment and domain information
>COG3267 ExeA Type II secretory pathway, component ExeA (predicted ATPase) [Intracellular trafficking and secretion] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG1882 consensus Transcriptional regulator SNIP1, contains FHA domain [Signal transduction mechanisms] Back     alignment and domain information
>PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A Back     alignment and domain information
>PF05673 DUF815: Protein of unknown function (DUF815); InterPro: IPR008533 This domain consists of several bacterial proteins of unknown function Back     alignment and domain information
>cd01121 Sms Sms (bacterial radA) DNA repair protein Back     alignment and domain information
>PRK13342 recombination factor protein RarA; Reviewed Back     alignment and domain information
>PRK14962 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG5271 MDN1 AAA ATPase containing von Willebrand factor type A (vWA) domain [General function prediction only] Back     alignment and domain information
>PRK11823 DNA repair protein RadA; Provisional Back     alignment and domain information
>PRK08118 topology modulation protein; Reviewed Back     alignment and domain information
>PF03266 NTPase_1: NTPase; InterPro: IPR004948 This entry represents a family of nucleoside-triphosphatases which have activity towards ATP, GTP, CTP, TTP and UTP and may hydrolyse nucleoside diphosphates with lower efficiency [] Back     alignment and domain information
>PHA02544 44 clamp loader, small subunit; Provisional Back     alignment and domain information
>PF14516 AAA_35: AAA-like domain Back     alignment and domain information
>COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK07261 topology modulation protein; Provisional Back     alignment and domain information
>KOG1051 consensus Chaperone HSP104 and related ATP-dependent Clp proteases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK00149 dnaA chromosomal replication initiation protein; Reviewed Back     alignment and domain information
>PRK12724 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK14974 cell division protein FtsY; Provisional Back     alignment and domain information
>PRK15455 PrkA family serine protein kinase; Provisional Back     alignment and domain information
>TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN Back     alignment and domain information
>PRK00131 aroK shikimate kinase; Reviewed Back     alignment and domain information
>PF05707 Zot: Zonular occludens toxin (Zot); InterPro: IPR008900 This entry consists of bacterial and viral proteins which are very similar to the Zonular occludens toxin (Zot) Back     alignment and domain information
>PRK09361 radB DNA repair and recombination protein RadB; Provisional Back     alignment and domain information
>TIGR02012 tigrfam_recA protein RecA Back     alignment and domain information
>PRK08533 flagellar accessory protein FlaH; Reviewed Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>PRK10787 DNA-binding ATP-dependent protease La; Provisional Back     alignment and domain information
>COG5271 MDN1 AAA ATPase containing von Willebrand factor type A (vWA) domain [General function prediction only] Back     alignment and domain information
>COG4650 RtcR Sigma54-dependent transcription regulator containing an AAA-type ATPase domain and a DNA-binding domain [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>cd01129 PulE-GspE PulE/GspE The type II secretory pathway is the main terminal branch of the general secretory pathway (GSP) Back     alignment and domain information
>PF06309 Torsin: Torsin; InterPro: IPR010448 This family consists of several eukaryotic torsin proteins Back     alignment and domain information
>cd00983 recA RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response Back     alignment and domain information
>PRK13695 putative NTPase; Provisional Back     alignment and domain information
>PF13671 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B Back     alignment and domain information
>COG3854 SpoIIIAA ncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>cd01131 PilT Pilus retraction ATPase PilT Back     alignment and domain information
>PRK13947 shikimate kinase; Provisional Back     alignment and domain information
>PRK10867 signal recognition particle protein; Provisional Back     alignment and domain information
>PRK05800 cobU adenosylcobinamide kinase/adenosylcobinamide-phosphate guanylyltransferase; Validated Back     alignment and domain information
>PRK04296 thymidine kinase; Provisional Back     alignment and domain information
>TIGR00390 hslU ATP-dependent protease HslVU, ATPase subunit Back     alignment and domain information
>PF13191 AAA_16: AAA ATPase domain; PDB: 2V1U_A Back     alignment and domain information
>PRK03839 putative kinase; Provisional Back     alignment and domain information
>TIGR02858 spore_III_AA stage III sporulation protein AA Back     alignment and domain information
>PF13604 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL_A 3E1S_A 3GP8_A Back     alignment and domain information
>PRK10536 hypothetical protein; Provisional Back     alignment and domain information
>cd01394 radB RadB Back     alignment and domain information
>KOG2543 consensus Origin recognition complex, subunit 5 [Replication, recombination and repair] Back     alignment and domain information
>COG1373 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>PHA02624 large T antigen; Provisional Back     alignment and domain information
>PRK12723 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>KOG2383 consensus Predicted ATPase [General function prediction only] Back     alignment and domain information
>cd00464 SK Shikimate kinase (SK) is the fifth enzyme in the shikimate pathway, a seven-step biosynthetic pathway which converts erythrose-4-phosphate to chorismic acid, found in bacteria, fungi and plants Back     alignment and domain information
>PRK00625 shikimate kinase; Provisional Back     alignment and domain information
>TIGR00416 sms DNA repair protein RadA Back     alignment and domain information
>cd00046 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>PRK09376 rho transcription termination factor Rho; Provisional Back     alignment and domain information
>COG1485 Predicted ATPase [General function prediction only] Back     alignment and domain information
>cd03283 ABC_MutS-like MutS-like homolog in eukaryotes Back     alignment and domain information
>TIGR00959 ffh signal recognition particle protein Back     alignment and domain information
>PRK06217 hypothetical protein; Validated Back     alignment and domain information
>PHA02774 E1; Provisional Back     alignment and domain information
>PRK14532 adenylate kinase; Provisional Back     alignment and domain information
>PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PF06745 KaiC: KaiC; InterPro: IPR014774 This entry represents a domain within bacterial and archaeal proteins, most of which are hypothetical Back     alignment and domain information
>PRK13949 shikimate kinase; Provisional Back     alignment and domain information
>PRK14088 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>TIGR03877 thermo_KaiC_1 KaiC domain protein, Ph0284 family Back     alignment and domain information
>PRK06067 flagellar accessory protein FlaH; Validated Back     alignment and domain information
>PRK06581 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR01359 UMP_CMP_kin_fam UMP-CMP kinase family Back     alignment and domain information
>PRK04195 replication factor C large subunit; Provisional Back     alignment and domain information
>PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] Back     alignment and domain information
>PRK06762 hypothetical protein; Provisional Back     alignment and domain information
>cd00544 CobU Adenosylcobinamide kinase / adenosylcobinamide phosphate guanyltransferase (CobU) Back     alignment and domain information
>PRK13948 shikimate kinase; Provisional Back     alignment and domain information
>PRK09354 recA recombinase A; Provisional Back     alignment and domain information
>cd01393 recA_like RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response Back     alignment and domain information
>PF13479 AAA_24: AAA domain Back     alignment and domain information
>cd01122 GP4d_helicase GP4d_helicase is a homohexameric 5'-3' helicases Back     alignment and domain information
>PRK05973 replicative DNA helicase; Provisional Back     alignment and domain information
>PRK04040 adenylate kinase; Provisional Back     alignment and domain information
>KOG3347 consensus Predicted nucleotide kinase/nuclear protein involved oxidative stress response [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK14531 adenylate kinase; Provisional Back     alignment and domain information
>TIGR01425 SRP54_euk signal recognition particle protein SRP54 Back     alignment and domain information
>TIGR01420 pilT_fam pilus retraction protein PilT Back     alignment and domain information
>COG0703 AroK Shikimate kinase [Amino acid transport and metabolism] Back     alignment and domain information
>cd00984 DnaB_C DnaB helicase C terminal domain Back     alignment and domain information
>cd02020 CMPK Cytidine monophosphate kinase (CMPK) catalyzes the reversible phosphorylation of cytidine monophosphate (CMP) to produce cytidine diphosphate (CDP), using ATP as the preferred phosphoryl donor Back     alignment and domain information
>COG0563 Adk Adenylate kinase and related kinases [Nucleotide transport and metabolism] Back     alignment and domain information
>TIGR01650 PD_CobS cobaltochelatase, CobS subunit Back     alignment and domain information
>TIGR02533 type_II_gspE general secretory pathway protein E Back     alignment and domain information
>cd01428 ADK Adenylate kinase (ADK) catalyzes the reversible phosphoryl transfer from adenosine triphosphates (ATP) to adenosine monophosphates (AMP) and to yield adenosine diphosphates (ADP) Back     alignment and domain information
>cd02021 GntK Gluconate kinase (GntK) catalyzes the phosphoryl transfer from ATP to gluconate Back     alignment and domain information
>PF00437 T2SE: Type II/IV secretion system protein; InterPro: IPR001482 A number of bacterial proteins, some of which are involved in a general secretion pathway (GSP) for the export of proteins (also called the type II pathway) belong to this group [, ] Back     alignment and domain information
>cd01123 Rad51_DMC1_radA Rad51_DMC1_radA,B Back     alignment and domain information
>PRK08233 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02928 orc1/cdc6 family replication initiation protein Back     alignment and domain information
>PRK14530 adenylate kinase; Provisional Back     alignment and domain information
>PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair Back     alignment and domain information
>PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK10436 hypothetical protein; Provisional Back     alignment and domain information
>COG5245 DYN1 Dynein, heavy chain [Cytoskeleton] Back     alignment and domain information
>PTZ00088 adenylate kinase 1; Provisional Back     alignment and domain information
>PRK12726 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK03731 aroL shikimate kinase II; Reviewed Back     alignment and domain information
>TIGR01313 therm_gnt_kin carbohydrate kinase, thermoresistant glucokinase family Back     alignment and domain information
>TIGR03878 thermo_KaiC_2 KaiC domain protein, AF_0795 family Back     alignment and domain information
>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda Back     alignment and domain information
>COG2804 PulE Type II secretory pathway, ATPase PulE/Tfp pilus assembly pathway, ATPase PilB [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>cd00227 CPT Chloramphenicol (Cm) phosphotransferase (CPT) Back     alignment and domain information
>TIGR03574 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal Back     alignment and domain information
>PRK14528 adenylate kinase; Provisional Back     alignment and domain information
>cd01128 rho_factor Transcription termination factor rho is a bacterial ATP-dependent RNA/DNA helicase Back     alignment and domain information
>cd03281 ABC_MSH5_euk MutS5 homolog in eukaryotes Back     alignment and domain information
>PRK02496 adk adenylate kinase; Provisional Back     alignment and domain information
>cd03243 ABC_MutS_homologs The MutS protein initiates DNA mismatch repair by recognizing mispaired and unpaired bases embedded in duplex DNA and activating endo- and exonucleases to remove the mismatch Back     alignment and domain information
>COG4088 Predicted nucleotide kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>TIGR02782 TrbB_P P-type conjugative transfer ATPase TrbB Back     alignment and domain information
>TIGR03880 KaiC_arch_3 KaiC domain protein, AF_0351 family Back     alignment and domain information
>PRK06547 hypothetical protein; Provisional Back     alignment and domain information
>PRK13946 shikimate kinase; Provisional Back     alignment and domain information
>PF10236 DAP3: Mitochondrial ribosomal death-associated protein 3; InterPro: IPR019368 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>PRK13764 ATPase; Provisional Back     alignment and domain information
>TIGR02525 plasmid_TraJ plasmid transfer ATPase TraJ Back     alignment and domain information
>PRK05057 aroK shikimate kinase I; Reviewed Back     alignment and domain information
>TIGR01360 aden_kin_iso1 adenylate kinase, isozyme 1 subfamily Back     alignment and domain information
>PRK10416 signal recognition particle-docking protein FtsY; Provisional Back     alignment and domain information
>smart00487 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>PRK05201 hslU ATP-dependent protease ATP-binding subunit HslU; Provisional Back     alignment and domain information
>TIGR00064 ftsY signal recognition particle-docking protein FtsY Back     alignment and domain information
>cd02027 APSK Adenosine 5'-phosphosulfate kinase (APSK) catalyzes the phosphorylation of adenosine 5'-phosphosulfate to form 3'-phosphoadenosine 5'-phosphosulfate (PAPS) Back     alignment and domain information
>TIGR02538 type_IV_pilB type IV-A pilus assembly ATPase PilB Back     alignment and domain information
>PF04665 Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 This entry contains uncharacterised proteins belonging to the B354L family which include the pox virus A32 protein Back     alignment and domain information
>TIGR01448 recD_rel helicase, putative, RecD/TraA family Back     alignment and domain information
>PRK04328 hypothetical protein; Provisional Back     alignment and domain information
>cd03280 ABC_MutS2 MutS2 homologs in bacteria and eukaryotes Back     alignment and domain information
>PRK00279 adk adenylate kinase; Reviewed Back     alignment and domain information
>smart00534 MUTSac ATPase domain of DNA mismatch repair MUTS family Back     alignment and domain information
>PLN02200 adenylate kinase family protein Back     alignment and domain information
>COG4619 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>TIGR01351 adk adenylate kinases Back     alignment and domain information
>PRK08154 anaerobic benzoate catabolism transcriptional regulator; Reviewed Back     alignment and domain information
>TIGR03499 FlhF flagellar biosynthetic protein FlhF Back     alignment and domain information
>PF13481 AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C Back     alignment and domain information
>PF13238 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB_A 3IIM_A 2AXP_A 3KB2_A 1KHT_A 1NKS_A 3H86_C Back     alignment and domain information
>cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases Back     alignment and domain information
>PF09848 DUF2075: Uncharacterized conserved protein (DUF2075); InterPro: IPR018647 This domain, found in putative ATP/GTP binding proteins, has no known function Back     alignment and domain information
>PRK13900 type IV secretion system ATPase VirB11; Provisional Back     alignment and domain information
>KOG0745 consensus Putative ATP-dependent Clp-type protease (AAA+ ATPase superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd03216 ABC_Carb_Monos_I This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information
>PRK14960 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF07693 KAP_NTPase: KAP family P-loop domain; InterPro: IPR011646 The KAP (after Kidins220/ARMS and PifA) family of predicted NTPases are sporadically distributed across a wide phylogenetic range in bacteria and in animals Back     alignment and domain information
>COG0541 Ffh Signal recognition particle GTPase [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK14956 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes Back     alignment and domain information
>COG1102 Cmk Cytidylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK06696 uridine kinase; Validated Back     alignment and domain information
>KOG2028 consensus ATPase related to the helicase subunit of the Holliday junction resolvase [Replication, recombination and repair] Back     alignment and domain information
>COG0324 MiaA tRNA delta(2)-isopentenylpyrophosphate transferase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK04301 radA DNA repair and recombination protein RadA; Validated Back     alignment and domain information
>PRK00411 cdc6 cell division control protein 6; Reviewed Back     alignment and domain information
>COG2874 FlaH Predicted ATPases involved in biogenesis of archaeal flagella [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR03881 KaiC_arch_4 KaiC domain protein, PAE1156 family Back     alignment and domain information
>PRK14527 adenylate kinase; Provisional Back     alignment and domain information
>PRK04182 cytidylate kinase; Provisional Back     alignment and domain information
>PF06414 Zeta_toxin: Zeta toxin; InterPro: IPR010488 This entry represents a domain originally identified in bacterial zeta toxin proteins, where it comprises the whole protein [] Back     alignment and domain information
>TIGR02655 circ_KaiC circadian clock protein KaiC Back     alignment and domain information
>COG1066 Sms Predicted ATP-dependent serine protease [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK07003 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PTZ00202 tuzin; Provisional Back     alignment and domain information
>KOG0245 consensus Kinesin-like protein [Cytoskeleton] Back     alignment and domain information
>PRK13833 conjugal transfer protein TrbB; Provisional Back     alignment and domain information
>PRK13894 conjugal transfer ATPase TrbB; Provisional Back     alignment and domain information
>TIGR02788 VirB11 P-type DNA transfer ATPase VirB11 Back     alignment and domain information
>COG2909 MalT ATP-dependent transcriptional regulator [Transcription] Back     alignment and domain information
>PF08433 KTI12: Chromatin associated protein KTI12 ; InterPro: IPR013641 This is a family of chromatin associated proteins which interact with the Elongator complex, a component of the elongating form of RNA polymerase II [] Back     alignment and domain information
>PF00406 ADK: Adenylate kinase; InterPro: IPR000850 Adenylate kinases (ADK) are phosphotransferases that catalyse the reversible reaction AMP + MgATP = ADP + MgADP an essential reaction for many processes in living cells Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1237
3vfd_A389 Human Spastin Aaa Domain Length = 389 1e-59
3d8b_A357 Crystal Structure Of Human Fidgetin-Like Protein 1 6e-58
3b9p_A297 Spastin Length = 297 1e-56
2qp9_X355 Crystal Structure Of S.Cerevisiae Vps4 Length = 355 2e-49
2rko_A331 Crystal Structure Of The Vps4p-Dimer Length = 331 2e-49
3eih_A340 Crystal Structure Of S.Cerevisiae Vps4 In The Prese 5e-49
3eie_A322 Crystal Structure Of S.Cerevisiae Vps4 In The So4-B 7e-49
2zam_A444 Crystal Structure Of Mouse Skd1VPS4B APO-Form Lengt 3e-48
1xwi_A322 Crystal Structure Of Vps4b Length = 322 9e-47
3cf1_A806 Structure Of P97VCP IN COMPLEX WITH ADPADP.ALFX Len 1e-43
3cf1_A 806 Structure Of P97VCP IN COMPLEX WITH ADPADP.ALFX Len 7e-42
1r7r_A816 The Crystal Structure Of Murine P97VCP AT 3.6A Leng 1e-43
1r7r_A 816 The Crystal Structure Of Murine P97VCP AT 3.6A Leng 1e-41
3cf0_A301 Structure Of D2 Subdomain Of P97VCP IN COMPLEX WITH 1e-43
3h4m_A285 Aaa Atpase Domain Of The Proteasome- Activating Nuc 7e-43
3hu1_A489 Structure Of P97 N-D1 R95g Mutant In Complex With A 7e-42
3hu3_A489 Structure Of P97 N-D1 R155h Mutant In Complex With 7e-42
3hu2_A489 Structure Of P97 N-D1 R86a Mutant In Complex With A 8e-42
1e32_A458 Structure Of The N-Terminal Domain And The D1 Aaa D 6e-41
4b4t_L437 Near-Atomic Resolution Structural Model Of The Yeas 2e-40
2x8a_A274 Human Nuclear Valosin Containing Protein Like (Nvl) 1e-36
1lv7_A257 Crystal Structure Of The Aaa Domain Of Ftsh Length 2e-36
4b4t_I437 Near-Atomic Resolution Structural Model Of The Yeas 3e-36
2ce7_A 476 Edta Treated Length = 476 6e-36
4b4t_M434 Near-Atomic Resolution Structural Model Of The Yeas 2e-35
3kds_E 465 Apo-ftsh Crystal Structure Length = 465 3e-35
4b4t_J405 Near-Atomic Resolution Structural Model Of The Yeas 2e-34
4b4t_K428 Near-Atomic Resolution Structural Model Of The Yeas 3e-33
4b4t_H467 Near-Atomic Resolution Structural Model Of The Yeas 2e-31
2r62_A268 Crystal Structure Of Helicobacter Pylori Atp Depend 2e-31
2qz4_A262 Human Paraplegin, Aaa Domain In Complex With Adp Le 4e-29
4eiw_A 508 Whole Cytosolic Region Of Atp-Dependent Metalloprot 2e-27
2dhr_A 499 Whole Cytosolic Region Of Atp-Dependent Metalloprot 2e-27
1ixz_A254 Crystal Structure Of The Ftsh Atpase Domain From Th 5e-27
1iy2_A278 Crystal Structure Of The Ftsh Atpase Domain From Th 8e-27
3m6a_A 543 Crystal Structure Of Bacillus Subtilis Lon C-Termin 5e-06
1ofh_A310 Asymmetric Complex Between Hslv And I-domain Delete 3e-04
1ixr_C312 Ruva-Ruvb Complex Length = 312 8e-04
1ixs_B318 Structure Of Ruvb Complexed With Ruva Domain Iii Le 8e-04
>pdb|3VFD|A Chain A, Human Spastin Aaa Domain Length = 389 Back     alignment and structure 
Iteration: 1

 Score =  228 bits (582), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 127/307 (41%), Positives = 191/307 (62%), Gaps = 22/307 (7%)
Query: 920  LLADVIPPSDIGVTFDDIGALENVKDTLKELVMLPLQRPELFCKGQLTKPCKGILLFGPP 979
            L+ + I  +   V FDDI   +  K  L+E+V+LP  RPELF    L  P +G+LLFGPP
Sbjct: 100  LIMNEIVDNGTAVKFDDIAGQDLAKQALQEIVILPSLRPELFTG--LRAPARGLLLFGPP 157
Query: 980  GTGKTMLAKAVATEAGANFINISMSSITSKWFGEGEKYVKAVFSLASKIAPSVIFVDEVD 1039
            G GKTMLAKAVA E+ A F NIS +S+TSK+ GEGEK V+A+F++A ++ PS+IF+D+VD
Sbjct: 158  GNGKTMLAKAVAAESNATFFNISAASLTSKYVGEGEKLVRALFAVARELQPSIIFIDQVD 217
Query: 1040 SMLGRRENPGEHEAMRKMKNEFMVNWDGLRTKDTERILVLAATNRPFDLDEAVIRRLPRR 1099
            S+L  R   GEH+A R++K EF++ +DG+++   +R+LV+ ATNRP +LDEAV+RR  +R
Sbjct: 218  SLLCERRE-GEHDASRRLKTEFLIEFDGVQSAGDDRVLVMGATNRPQELDEAVLRRFIKR 276
Query: 1100 LMVNLPDAPNRAKILQVILAKEDLSP--DVDFDAIANMTDGYSGSDLKNLCVTAAHRPIX 1157
            + V+LP+   R  +L+ +L K+  SP    +   +A MTDGYSGSDL  L   AA  PI 
Sbjct: 277  VYVSLPNEETRLLLLKNLLCKQG-SPLTQKELAQLARMTDGYSGSDLTALAKDAALGPIR 335
Query: 1158 XXXXXXXXXXXXXXXXXXXXXXLSGCADIRPLNMDDFKYAHERVCASVSSESVNMSELLQ 1217
                                      +++R + + DF  + +++  SVS ++  +   ++
Sbjct: 336  ELKPEQVKNM--------------SASEMRNIRLSDFTESLKKIKRSVSPQT--LEAYIR 379
Query: 1218 WNELYGE 1224
            WN+ +G+
Sbjct: 380  WNKDFGD 386
>pdb|3D8B|A Chain A, Crystal Structure Of Human Fidgetin-Like Protein 1 In Complex With Adp Length = 357 Back     alignment and structure
>pdb|3B9P|A Chain A, Spastin Length = 297 Back     alignment and structure
>pdb|2QP9|X Chain X, Crystal Structure Of S.Cerevisiae Vps4 Length = 355 Back     alignment and structure
>pdb|2RKO|A Chain A, Crystal Structure Of The Vps4p-Dimer Length = 331 Back     alignment and structure
>pdb|3EIH|A Chain A, Crystal Structure Of S.Cerevisiae Vps4 In The Presence Of Atpgammas Length = 340 Back     alignment and structure
>pdb|3EIE|A Chain A, Crystal Structure Of S.Cerevisiae Vps4 In The So4-Bound State Length = 322 Back     alignment and structure
>pdb|2ZAM|A Chain A, Crystal Structure Of Mouse Skd1VPS4B APO-Form Length = 444 Back     alignment and structure
>pdb|1XWI|A Chain A, Crystal Structure Of Vps4b Length = 322 Back     alignment and structure
>pdb|3CF1|A Chain A, Structure Of P97VCP IN COMPLEX WITH ADPADP.ALFX Length = 806 Back     alignment and structure
>pdb|3CF1|A Chain A, Structure Of P97VCP IN COMPLEX WITH ADPADP.ALFX Length = 806 Back     alignment and structure
>pdb|1R7R|A Chain A, The Crystal Structure Of Murine P97VCP AT 3.6A Length = 816 Back     alignment and structure
>pdb|1R7R|A Chain A, The Crystal Structure Of Murine P97VCP AT 3.6A Length = 816 Back     alignment and structure
>pdb|3CF0|A Chain A, Structure Of D2 Subdomain Of P97VCP IN COMPLEX WITH ADP Length = 301 Back     alignment and structure
>pdb|3H4M|A Chain A, Aaa Atpase Domain Of The Proteasome- Activating Nucleotidase Length = 285 Back     alignment and structure
>pdb|3HU1|A Chain A, Structure Of P97 N-D1 R95g Mutant In Complex With Atpgs Length = 489 Back     alignment and structure
>pdb|3HU3|A Chain A, Structure Of P97 N-D1 R155h Mutant In Complex With Atpgs Length = 489 Back     alignment and structure
>pdb|3HU2|A Chain A, Structure Of P97 N-D1 R86a Mutant In Complex With Atpgs Length = 489 Back     alignment and structure
>pdb|1E32|A Chain A, Structure Of The N-Terminal Domain And The D1 Aaa Domain Of Membrane Fusion Atpase P97 Length = 458 Back     alignment and structure
>pdb|4B4T|L Chain L, Near-Atomic Resolution Structural Model Of The Yeast 26s Proteasome Length = 437 Back     alignment and structure
>pdb|2X8A|A Chain A, Human Nuclear Valosin Containing Protein Like (Nvl), C- Terminal Aaa-Atpase Domain Length = 274 Back     alignment and structure
>pdb|1LV7|A Chain A, Crystal Structure Of The Aaa Domain Of Ftsh Length = 257 Back     alignment and structure
>pdb|4B4T|I Chain I, Near-Atomic Resolution Structural Model Of The Yeast 26s Proteasome Length = 437 Back     alignment and structure
>pdb|2CE7|A Chain A, Edta Treated Length = 476 Back     alignment and structure
>pdb|4B4T|M Chain M, Near-Atomic Resolution Structural Model Of The Yeast 26s Proteasome Length = 434 Back     alignment and structure
>pdb|3KDS|E Chain E, Apo-ftsh Crystal Structure Length = 465 Back     alignment and structure
>pdb|4B4T|J Chain J, Near-Atomic Resolution Structural Model Of The Yeast 26s Proteasome Length = 405 Back     alignment and structure
>pdb|4B4T|K Chain K, Near-Atomic Resolution Structural Model Of The Yeast 26s Proteasome Length = 428 Back     alignment and structure
>pdb|4B4T|H Chain H, Near-Atomic Resolution Structural Model Of The Yeast 26s Proteasome Length = 467 Back     alignment and structure
>pdb|2R62|A Chain A, Crystal Structure Of Helicobacter Pylori Atp Dependent Protease, Ftsh Length = 268 Back     alignment and structure
>pdb|2QZ4|A Chain A, Human Paraplegin, Aaa Domain In Complex With Adp Length = 262 Back     alignment and structure
>pdb|4EIW|A Chain A, Whole Cytosolic Region Of Atp-Dependent Metalloprotease Ftsh (G399l) Length = 508 Back     alignment and structure
>pdb|2DHR|A Chain A, Whole Cytosolic Region Of Atp-Dependent Metalloprotease Ftsh (G399l) Length = 499 Back     alignment and structure
>pdb|1IXZ|A Chain A, Crystal Structure Of The Ftsh Atpase Domain From Thermus Thermophilus Length = 254 Back     alignment and structure
>pdb|1IY2|A Chain A, Crystal Structure Of The Ftsh Atpase Domain From Thermus Thermophilus Length = 278 Back     alignment and structure
>pdb|3M6A|A Chain A, Crystal Structure Of Bacillus Subtilis Lon C-Terminal Domain Length = 543 Back     alignment and structure
>pdb|1OFH|A Chain A, Asymmetric Complex Between Hslv And I-domain Deleted Hslu (h. Influenzae) Length = 310 Back     alignment and structure
>pdb|1IXR|C Chain C, Ruva-Ruvb Complex Length = 312 Back     alignment and structure
>pdb|1IXS|B Chain B, Structure Of Ruvb Complexed With Ruva Domain Iii Length = 318 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1237
3b9p_A297 CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc 1e-145
3vfd_A389 Spastin; ATPase, microtubule severing, hydrolase; 1e-144
3d8b_A357 Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s 1e-138
3eie_A322 Vacuolar protein sorting-associated protein 4; AAA 1e-134
1xwi_A322 SKD1 protein; VPS4B, AAA ATPase, protein transport 1e-132
2qp9_X355 Vacuolar protein sorting-associated protein 4; ATP 1e-127
2zan_A444 Vacuolar protein sorting-associating protein 4B; S 1e-121
3cf0_A301 Transitional endoplasmic reticulum ATPase; AAA, P9 1e-82
1ypw_A806 Transitional endoplasmic reticulum ATPase; AAA, P9 6e-79
1ypw_A 806 Transitional endoplasmic reticulum ATPase; AAA, P9 9e-68
2x8a_A274 Nuclear valosin-containing protein-like; nuclear p 8e-77
3h4m_A285 Proteasome-activating nucleotidase; ATPase, PAN, A 2e-74
3hu3_A489 Transitional endoplasmic reticulum ATPase; VCP, tr 3e-72
3t15_A293 Ribulose bisphosphate carboxylase/oxygenase activ 3e-52
2r62_A268 Cell division protease FTSH homolog; ATPase domain 2e-50
1ixz_A254 ATP-dependent metalloprotease FTSH; AAA domain fol 2e-49
1lv7_A257 FTSH; alpha/beta domain, four helix bundle, hydrol 4e-49
2qz4_A262 Paraplegin; AAA+, SPG7, protease, ADP, structural 7e-49
1iy2_A278 ATP-dependent metalloprotease FTSH; AAA domain fol 2e-48
1d2n_A272 N-ethylmaleimide-sensitive fusion protein; hexamer 2e-47
2ce7_A 476 Cell division protein FTSH; metalloprotease; HET: 1e-43
2dhr_A 499 FTSH; AAA+ protein, hexameric Zn metalloprotease, 2e-43
1lgp_A116 Cell cycle checkpoint protein CHFR; FHA, tungstate 1e-20
1gxc_A149 CHK2, CDS1, serine/threonine-protein kinase CHK2; 1e-18
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-18
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 7e-17
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 9e-10
1vt4_I1221 APAF-1 related killer DARK; drosophila apoptosome, 7e-07
3syl_A309 Protein CBBX; photosynthesis, rubisco activase, AA 2e-14
2krk_A86 26S protease regulatory subunit 8; structural geno 1e-13
3kw6_A78 26S protease regulatory subunit 8; structural geno 9e-13
3i6u_A419 CDS1, serine/threonine-protein kinase CHK2; Ser/Th 9e-12
1sxj_A 516 Activator 1 95 kDa subunit; clamp loader, processi 5e-11
2dzn_B82 26S protease regulatory subunit 6B homolog; ankyri 5e-11
3aji_B83 S6C, proteasome (prosome, macropain) 26S subunit, 9e-11
2c9o_A 456 RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP- 2e-09
3vlf_B88 26S protease regulatory subunit 7 homolog; heat re 4e-09
3pvs_A 447 Replication-associated recombination protein A; ma 6e-09
2jqj_A151 DNA damage response protein kinase DUN1; protein/p 4e-07
1g6g_A127 Protein kinase RAD53; beta-sandwich, phosphopeptid 5e-07
1g3g_A164 Protien kinase SPK1; FHA domain, RAD53, phosphopep 5e-07
3els_A158 PRE-mRNA leakage protein 1; intrinsically unstruct 1e-06
1qu5_A182 Protein kinase SPK1; FHA, RAD53, transferase; NMR 3e-06
1dmz_A158 Protein (protein kinase SPK1); beta-sandwich, anti 3e-06
3va4_A132 Mediator of DNA damage checkpoint protein 1; cell 7e-06
2chg_A226 Replication factor C small subunit; DNA-binding pr 8e-06
2jpe_A140 Nuclear inhibitor of protein phosphatase 1; FHA do 2e-05
2qby_B384 CDC6 homolog 3, cell division control protein 6 ho 2e-05
3hx1_A131 SLR1951 protein; P74513_SYNY3, adenylate cyclase-l 2e-05
3pie_A1155 5'->3' exoribonuclease (XRN1); beta berrel, tudor 2e-05
1iqp_A327 RFCS; clamp loader, extended AAA-ATPase domain, co 2e-05
2chq_A319 Replication factor C small subunit; DNA-binding pr 3e-05
3elv_A205 PRE-mRNA leakage protein 1; intrinsically unstruct 3e-05
2qgz_A308 Helicase loader, putative primosome component; str 3e-05
1fnn_A389 CDC6P, cell division control protein 6; ORC1, AAA 7e-05
2qby_A386 CDC6 homolog 1, cell division control protein 6 ho 9e-05
3ec2_A180 DNA replication protein DNAC; helicase loader, rep 1e-04
3pfi_A338 Holliday junction ATP-dependent DNA helicase RUVB; 2e-04
1sxj_C340 Activator 1 40 kDa subunit; clamp loader, processi 2e-04
1in4_A334 RUVB, holliday junction DNA helicase RUVB; AAA+-cl 3e-04
1hqc_A324 RUVB; extended AAA-ATPase domain, complex with nuc 3e-04
2w58_A202 DNAI, primosome component (helicase loader); ATP-b 3e-04
3po8_A100 RV0020C protein, putative uncharacterized protein 4e-04
3m6a_A 543 ATP-dependent protease LA 1; alpha, beta, ATP-bind 4e-04
2g1l_A104 Kinesin-like protein KIF1C; transport, FHA domain, 7e-04
>3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} Length = 297 Back     alignment and structure
 Score =  440 bits (1134), Expect = e-145
 Identities = 132/309 (42%), Positives = 190/309 (61%), Gaps = 21/309 (6%)

Query: 918  KRLLADVIPPSDIGVTFDDIGALENVKDTLKELVMLPLQRPELFCKGQLTKPCKGILLFG 977
             +L+ D I      V + DI   +  K  L+E+V+LP  RPELF    L  P KG+LLFG
Sbjct: 4    VQLILDEIVEGGAKVEWTDIAGQDVAKQALQEMVILPSVRPELFTG--LRAPAKGLLLFG 61

Query: 978  PPGTGKTMLAKAVATEAGANFINISMSSITSKWFGEGEKYVKAVFSLASKIAPSVIFVDE 1037
            PPG GKT+LA+AVATE  A F+NIS +S+TSK+ G+GEK V+A+F++A  + PS+IF+DE
Sbjct: 62   PPGNGKTLLARAVATECSATFLNISAASLTSKYVGDGEKLVRALFAVARHMQPSIIFIDE 121

Query: 1038 VDSMLGRRENPGEHEAMRKMKNEFMVNWDGLRT-KDTERILVLAATNRPFDLDEAVIRRL 1096
            VDS+L  R +  EHEA R++K EF+V +DGL    D +RI+VLAATNRP +LDEA +RR 
Sbjct: 122  VDSLLSERSS-SEHEASRRLKTEFLVEFDGLPGNPDGDRIVVLAATNRPQELDEAALRRF 180

Query: 1097 PRRLMVNLPDAPNRAKILQVILAKEDLSPDV-DFDAIANMTDGYSGSDLKNLCVTAAHRP 1155
             +R+ V+LPD   R  +L  +L K+    D      +A +TDGYSGSDL  L   AA  P
Sbjct: 181  TKRVYVSLPDEQTRELLLNRLLQKQGSPLDTEALRRLAKITDGYSGSDLTALAKDAALEP 240

Query: 1156 IKEILEKEKKERAAAMAEGKPAPALSGCADIRPLNMDDFKYAHERVCASVSSESVNMSEL 1215
            I+E+  ++ K                  + +R +   DF  + +R+  SV+ +S  ++  
Sbjct: 241  IRELNVEQVKCLDI--------------SAMRAITEQDFHSSLKRIRRSVAPQS--LNSY 284

Query: 1216 LQWNELYGE 1224
             +W++ YG+
Sbjct: 285  EKWSQDYGD 293
>3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} Length = 389 Back     alignment and structure
>3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} Length = 357 Back     alignment and structure
>3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C Length = 322 Back     alignment and structure
>1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} Length = 322 Back     alignment and structure
>2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* Length = 355 Back     alignment and structure
>2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A Length = 444 Back     alignment and structure
>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} Length = 301 Back     alignment and structure
>2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} Length = 274 Back     alignment and structure
>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Length = 285 Back     alignment and structure
>3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* 2pjh_B Length = 489 Back     alignment and structure
>3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A Length = 293 Back     alignment and structure
>2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* Length = 268 Back     alignment and structure
>1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* Length = 254 Back     alignment and structure
>1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 Length = 257 Back     alignment and structure
>2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} Length = 262 Back     alignment and structure
>1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 Length = 278 Back     alignment and structure
>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* Length = 272 Back     alignment and structure
>2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* Length = 476 Back     alignment and structure
>2dhr_A FTSH; AAA+ protein, hexameric Zn metalloprotease, hydrolase; HET: ADP; 3.90A {Thermus thermophilus} Length = 499 Back     alignment and structure
>1lgp_A Cell cycle checkpoint protein CHFR; FHA, tungstate, domain swapping; 2.00A {Homo sapiens} SCOP: b.26.1.2 PDB: 1lgq_A Length = 116 Back     alignment and structure
>1gxc_A CHK2, CDS1, serine/threonine-protein kinase CHK2; phosphoprotein-binding domain, checkpoint kinase, transferase; HET: TPO; 2.7A {Homo sapiens} SCOP: b.26.1.2 Length = 149 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* Length = 309 Back     alignment and structure
>2krk_A 26S protease regulatory subunit 8; structural genomics, northeast structural genomics consortium (NESG), target HR3102A, PSI-2; NMR {Homo sapiens} Length = 86 Back     alignment and structure
>3kw6_A 26S protease regulatory subunit 8; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.10A {Homo sapiens} Length = 78 Back     alignment and structure
>3i6u_A CDS1, serine/threonine-protein kinase CHK2; Ser/Thr protein kinase, FHA domain, ATP-binding, cell cycle, mutation, LI-fraumeni syndrome, magnesium; 3.00A {Homo sapiens} PDB: 3i6w_A Length = 419 Back     alignment and structure
>1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Length = 516 Back     alignment and structure
>2dzn_B 26S protease regulatory subunit 6B homolog; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} PDB: 2dzo_B Length = 82 Back     alignment and structure
>3aji_B S6C, proteasome (prosome, macropain) 26S subunit, ATPA; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dwz_B* 2dvw_B* Length = 83 Back     alignment and structure
>2c9o_A RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-binding, chromatin regulator, growth regulation, hydrolase, nuclear protein, DNA recombination; HET: ADP; 2.2A {Homo sapiens} PDB: 2xsz_A* Length = 456 Back     alignment and structure
>3vlf_B 26S protease regulatory subunit 7 homolog; heat repeat, chaperone, chaperone-protein binding complex; HET: DNA; 3.80A {Saccharomyces cerevisiae} PDB: 4a3v_B* Length = 88 Back     alignment and structure
>3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} Length = 447 Back     alignment and structure
>2jqj_A DNA damage response protein kinase DUN1; protein/phosphopeptide, cell cycle; HET: DNA; NMR {Saccharomyces cerevisiae} PDB: 2jql_A* Length = 151 Back     alignment and structure
>1g6g_A Protein kinase RAD53; beta-sandwich, phosphopeptide complex, cell cycle; HET: TPO; 1.60A {Saccharomyces cerevisiae} SCOP: b.26.1.2 Length = 127 Back     alignment and structure
>1g3g_A Protien kinase SPK1; FHA domain, RAD53, phosphopeptide, phosphoprotein, transferase; NMR {Saccharomyces cerevisiae} SCOP: b.26.1.2 PDB: 1j4o_A 1j4p_A* 1j4q_A* 1k3j_A 1k3n_A* 1k3q_A* 2a0t_A* 2jqi_A* Length = 164 Back     alignment and structure
>3els_A PRE-mRNA leakage protein 1; intrinsically unstructured domain, forkhead-associated domai domain, PRE-mRNA retention and splicing; 1.80A {Saccharomyces cerevisiae} Length = 158 Back     alignment and structure
>1qu5_A Protein kinase SPK1; FHA, RAD53, transferase; NMR {Saccharomyces cerevisiae} SCOP: b.26.1.2 Length = 182 Back     alignment and structure
>1dmz_A Protein (protein kinase SPK1); beta-sandwich, antiparallel beta-sheets, transferase; NMR {Saccharomyces cerevisiae} SCOP: b.26.1.2 PDB: 1fhq_A 1fhr_A* 1j4k_A* 1j4l_A* 1k2m_A* 1k2n_A* Length = 158 Back     alignment and structure
>3va4_A Mediator of DNA damage checkpoint protein 1; cell cycle, FHA domain, DNA-damage, CHK2 and MDC1 dimerizati; HET: TPO; 1.54A {Mus musculus} PDB: 3va1_A* 3umz_A 3unm_A 3unn_A* 3uot_A* 3un0_B Length = 132 Back     alignment and structure
>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} Length = 226 Back     alignment and structure
>2jpe_A Nuclear inhibitor of protein phosphatase 1; FHA domain, NIPP1, mRNA splicing, transcription; NMR {Mus musculus} Length = 140 Back     alignment and structure
>2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Length = 384 Back     alignment and structure
>3hx1_A SLR1951 protein; P74513_SYNY3, adenylate cyclase-like protein, NESG, structural genomics, PSI-2, protein structure initiative; 2.50A {Synechocystis SP} Length = 131 Back     alignment and structure
>3pie_A 5'->3' exoribonuclease (XRN1); beta berrel, tudor domain, chromo domain, mRNA turnover, RRN processing, RNA binding, DNA binding; 2.90A {Kluyveromyces lactis} PDB: 3pif_A Length = 1155 Back     alignment and structure
>1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 Length = 327 Back     alignment and structure
>2chq_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATP ATP-binding, nucleotide-binding; HET: ANP; 3.5A {Archaeoglobus fulgidus} PDB: 2chv_A Length = 319 Back     alignment and structure
>3elv_A PRE-mRNA leakage protein 1; intrinsically unstructured domain, forkhead-associated domai domain, PRE-mRNA retention and splicing; 2.40A {Saccharomyces cerevisiae} PDB: 2jkd_A Length = 205 Back     alignment and structure
>2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} Length = 308 Back     alignment and structure
>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 Length = 389 Back     alignment and structure
>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Length = 386 Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Length = 180 Back     alignment and structure
>3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} Length = 338 Back     alignment and structure
>1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Length = 340 Back     alignment and structure
>1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* Length = 334 Back     alignment and structure
>1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* Length = 324 Back     alignment and structure
>2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} Length = 202 Back     alignment and structure
>3po8_A RV0020C protein, putative uncharacterized protein TB39.8; FHA domain, synthetic peptide, peptide binding protein; 1.50A {Mycobacterium tuberculosis} PDB: 3poa_A* 2lc1_A Length = 100 Back     alignment and structure
>3m6a_A ATP-dependent protease LA 1; alpha, beta, ATP-binding, hydrolase, nucleotide-binding, Pro serine protease, stress response; HET: ADP; 3.40A {Bacillus subtilis} PDB: 1x37_A Length = 543 Back     alignment and structure
>2g1l_A Kinesin-like protein KIF1C; transport, FHA domain, structural genomics consortium, kines transport protein; 2.60A {Homo sapiens} SCOP: b.26.1.2 Length = 104 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

No hit with probability above 80.00

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 1237
d1lv7a_256 c.37.1.20 (A:) AAA domain of cell division protein 4e-81
d1ixza_247 c.37.1.20 (A:) AAA domain of cell division protein 1e-77
d1r7ra3265 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p 1e-61
d1e32a2258 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p 1e-55
d1w44a_321 c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [Ta 8e-38
d1svma_362 c.37.1.20 (A:) Papillomavirus large T antigen heli 3e-30
d1d2na_246 c.37.1.20 (A:) Hexamerization domain of N-ethylmal 5e-30
d1gvnb_273 c.37.1.21 (B:) Plasmid maintenance system epsilon/ 3e-29
d1ofha_309 c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId 2e-22
d1ixsb2239 c.37.1.20 (B:4-242) Holliday junction helicase Ruv 1e-18
d1gxca_116 b.26.1.2 (A:) Chk2 kinase {Human (Homo sapiens) [T 9e-17
d1in4a2238 c.37.1.20 (A:17-254) Holliday junction helicase Ru 1e-15
d1fnna2276 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrob 5e-14
d1sxja2253 c.37.1.20 (A:295-547) Replication factor C1 {Baker 2e-13
d1lgpa_113 b.26.1.2 (A:) Cell cycle checkpoint protein Chfr { 9e-11
d1w5sa2287 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-t 1e-08
d1dmza_158 b.26.1.2 (A:) Phosphotyrosine binding domain of Ra 3e-08
d1g41a_ 443 c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId 6e-07
d2affa198 b.26.1.2 (A:3-100) Antigen ki-67 {Human (Homo sapi 6e-06
d1uhta_118 b.26.1.2 (A:) FHA domain containing protein At4G14 1e-05
d1viaa_161 c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobact 1e-05
d1lw7a2192 c.37.1.1 (A:220-411) Transcriptional regulator Nad 2e-05
d1g6ga_127 b.26.1.2 (A:) Phosphotyrosine binding domain of Ra 2e-05
d1njfa_239 c.37.1.20 (A:) delta prime subunit of DNA polymera 2e-05
d2fnaa2283 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfo 2e-05
d2ff4a399 b.26.1.2 (A:284-382) Probable regulatory protein E 4e-05
d1r6bx2268 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, A 5e-05
d1zp6a1176 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 { 6e-05
d1g8pa_333 c.37.1.20 (A:) ATPase subunit of magnesium chelata 8e-05
d1mzka_122 b.26.1.2 (A:) Kinase associated protein phosphatas 1e-04
d1sxje2252 c.37.1.20 (E:4-255) Replication factor C5 {Baker's 1e-04
d2bdta1176 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {B 1e-04
d2g1la1102 b.26.1.2 (A:498-599) Kinesin-like protein kif1c {H 2e-04
d1qf9a_194 c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoi 2e-04
d1ny5a2247 c.37.1.20 (A:138-384) Transcriptional activator si 3e-04
d2piea1127 b.26.1.2 (A:13-139) Ubiquitin ligase protein RNF8 3e-04
d1qhxa_178 c.37.1.3 (A:) Chloramphenicol phosphotransferase { 3e-04
d1ukza_196 c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Sac 6e-04
d2i3ba1189 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 7e-04
d1rkba_173 c.37.1.1 (A:) Adenylate kinase {Human (Homo sapien 0.001
d1kaga_169 c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia 0.001
d3adka_194 c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [ 0.001
d1e6ca_170 c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chr 0.002
d1szpa2251 c.37.1.11 (A:145-395) DNA repair protein Rad51, ca 0.004
d1zaka1189 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Mai 0.004
d1a5ta2207 c.37.1.20 (A:1-207) delta prime subunit of DNA pol 0.004
d1ly1a_152 c.37.1.1 (A:) Polynucleotide kinase, kinase domain 0.004
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Length = 256 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: AAA domain of cell division protein FtsH
species: Escherichia coli [TaxId: 562]

 Score =  264 bits (676), Expect = 4e-81
 Identities = 98/282 (34%), Positives = 147/282 (52%), Gaps = 34/282 (12%)

Query: 924  VIPPSDIGVTFDDIGALENVKDTLKELVMLPLQRPELFCKGQLTKPCKGILLFGPPGTGK 983
            ++    I  TF D+   +  K+ + ELV   L+ P  F K     P KG+L+ GPPGTGK
Sbjct: 1    MLTEDQIKTTFADVAGCDEAKEEVAELVEY-LREPSRFQKLGGKIP-KGVLMVGPPGTGK 58

Query: 984  TMLAKAVATEAGANFINISMSSITSKWFGEGEKYVKAVFSLASKIAPSVIFVDEVDSMLG 1043
            T+LAKA+A EA   F  IS S     + G G   V+ +F  A K AP +IF+DE+D++  
Sbjct: 59   TLLAKAIAGEAKVPFFTISGSDFVEMFVGVGASRVRDMFEQAKKAAPCIIFIDEIDAVGR 118

Query: 1044 RRENP--GEHEAMRKMKNEFMVNWDGLRTKDTERILVLAATNRPFDLDEAVIR--RLPRR 1099
            +R     G H+   +  N+ +V  DG   +  E I+V+AATNRP  LD A++R  R  R+
Sbjct: 119  QRGAGLGGGHDEREQTLNQMLVEMDGF--EGNEGIIVIAATNRPDVLDPALLRPGRFDRQ 176

Query: 1100 LMVNLPDAPNRAKILQVILAKEDLSPDVDFDAIANMTDGYSGSDLKNLCVTAAHRPIKEI 1159
            ++V LPD   R +IL+V + +  L+PD+D   IA  T G+SG+DL NL   AA    +  
Sbjct: 177  VVVGLPDVRGREQILKVHMRRVPLAPDIDAAIIARGTPGFSGADLANLVNEAALFAARG- 235

Query: 1160 LEKEKKERAAAMAEGKPAPALSGCADIRPLNMDDFKYAHERV 1201
                                     + R ++M +F+ A +++
Sbjct: 236  -------------------------NKRVVSMVEFEKAKDKI 252
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Length = 247 Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Length = 265 Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Length = 258 Back     information, alignment and structure
>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Length = 321 Back     information, alignment and structure
>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Length = 362 Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Length = 246 Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Length = 273 Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Length = 309 Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Length = 239 Back     information, alignment and structure
>d1gxca_ b.26.1.2 (A:) Chk2 kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 116 Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Length = 238 Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Length = 276 Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 253 Back     information, alignment and structure
>d1lgpa_ b.26.1.2 (A:) Cell cycle checkpoint protein Chfr {Human (Homo sapiens) [TaxId: 9606]} Length = 113 Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Length = 287 Back     information, alignment and structure
>d1dmza_ b.26.1.2 (A:) Phosphotyrosine binding domain of Rad53 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 158 Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Length = 443 Back     information, alignment and structure
>d2affa1 b.26.1.2 (A:3-100) Antigen ki-67 {Human (Homo sapiens) [TaxId: 9606]} Length = 98 Back     information, alignment and structure
>d1uhta_ b.26.1.2 (A:) FHA domain containing protein At4G14490 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 118 Back     information, alignment and structure
>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} Length = 161 Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Length = 192 Back     information, alignment and structure
>d1g6ga_ b.26.1.2 (A:) Phosphotyrosine binding domain of Rad53 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 127 Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Length = 239 Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Length = 283 Back     information, alignment and structure
>d2ff4a3 b.26.1.2 (A:284-382) Probable regulatory protein EmbR, C-terminal domain {Mycobacterium tuberculosis [TaxId: 1773]} Length = 99 Back     information, alignment and structure
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Length = 268 Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Length = 176 Back     information, alignment and structure
>d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} Length = 333 Back     information, alignment and structure
>d1mzka_ b.26.1.2 (A:) Kinase associated protein phosphatase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 122 Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 252 Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Length = 176 Back     information, alignment and structure
>d2g1la1 b.26.1.2 (A:498-599) Kinesin-like protein kif1c {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Length = 194 Back     information, alignment and structure
>d1ny5a2 c.37.1.20 (A:138-384) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]} Length = 247 Back     information, alignment and structure
>d2piea1 b.26.1.2 (A:13-139) Ubiquitin ligase protein RNF8 {Human (Homo sapiens) [TaxId: 9606]} Length = 127 Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Length = 178 Back     information, alignment and structure
>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 196 Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Length = 189 Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Length = 173 Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Length = 169 Back     information, alignment and structure
>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} Length = 194 Back     information, alignment and structure
>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} Length = 170 Back     information, alignment and structure
>d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 251 Back     information, alignment and structure
>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} Length = 189 Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Length = 207 Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Length = 152 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query1237
d1lv7a_256 AAA domain of cell division protein FtsH {Escheric 100.0
d1ixza_247 AAA domain of cell division protein FtsH {Thermus 100.0
d1e32a2258 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 100.0
d1r7ra3265 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 100.0
d1d2na_246 Hexamerization domain of N-ethylmalemide-sensitive 99.92
d1lv7a_256 AAA domain of cell division protein FtsH {Escheric 99.91
d1e32a2258 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 99.9
d1ofha_309 HslU {Haemophilus influenzae [TaxId: 727]} 99.9
d1gxca_116 Chk2 kinase {Human (Homo sapiens) [TaxId: 9606]} 99.88
d1ixza_247 AAA domain of cell division protein FtsH {Thermus 99.87
d1w44a_321 NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} 99.87
d1in4a2238 Holliday junction helicase RuvB {Thermotoga mariti 99.86
d1r7ra3265 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 99.83
d1ixsb2239 Holliday junction helicase RuvB {Thermus thermophi 99.81
d1lgpa_113 Cell cycle checkpoint protein Chfr {Human (Homo sa 99.74
d1njfa_239 delta prime subunit of DNA polymerase III, N-domai 99.73
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 99.73
d1sxjc2227 Replication factor C3 {Baker's yeast (Saccharomyce 99.72
d1qvra3315 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 99.68
d1sxjd2237 Replication factor C2 {Baker's yeast (Saccharomyce 99.68
d1r6bx3315 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 99.68
d1fnna2276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 99.66
d1sxja2253 Replication factor C1 {Baker's yeast (Saccharomyce 99.66
d1sxjb2224 Replication factor C4 {Baker's yeast (Saccharomyce 99.66
d1r6bx2268 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 99.64
d1sxje2252 Replication factor C5 {Baker's yeast (Saccharomyce 99.63
d1um8a_364 ClpX {Helicobacter pylori [TaxId: 210]} 99.62
d1w5sa2287 CDC6-like protein APE0152, N-terminal domain {Aero 99.6
d1dmza_158 Phosphotyrosine binding domain of Rad53 {Baker's y 99.54
d1g41a_443 HslU {Haemophilus influenzae [TaxId: 727]} 99.5
d1qvra2387 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 99.49
d1qvra2387 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 99.48
d1l8qa2213 Chromosomal replication initiation factor DnaA {Aq 99.47
d1svma_362 Papillomavirus large T antigen helicase domain {Si 99.47
d1g8pa_333 ATPase subunit of magnesium chelatase, BchI {Rhodo 99.46
d1a5ta2207 delta prime subunit of DNA polymerase III, N-domai 99.44
d1r6bx2268 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 99.44
d1g6ga_127 Phosphotyrosine binding domain of Rad53 {Baker's y 99.42
d1jbka_195 ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} 99.4
d2brfa1101 Polynucleotide kinase 3'-phosphatase {Human (Homo 99.34
d2piea1127 Ubiquitin ligase protein RNF8 {Human (Homo sapiens 99.32
d2ff4a399 Probable regulatory protein EmbR, C-terminal domai 99.31
d1w44a_321 NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} 99.3
d1d2na_246 Hexamerization domain of N-ethylmalemide-sensitive 99.29
d1ofha_309 HslU {Haemophilus influenzae [TaxId: 727]} 99.25
d2affa198 Antigen ki-67 {Human (Homo sapiens) [TaxId: 9606]} 99.22
d1uhta_118 FHA domain containing protein At4G14490 {Thale cre 99.2
d1mzka_122 Kinase associated protein phosphatase {Thale cress 99.14
d2g1la1102 Kinesin-like protein kif1c {Human (Homo sapiens) [ 99.14
d1ny5a2247 Transcriptional activator sigm54 (NtrC1), C-termin 98.98
d1jbka_195 ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} 98.94
d1wlna1107 Afadin {Mouse (Mus musculus) [TaxId: 10090]} 98.92
d1gvnb_273 Plasmid maintenance system epsilon/zeta, toxin zet 98.92
d2gnoa2198 gamma subunit of DNA polymerase III, N-domain {The 98.86
d2fnaa2283 Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ 98.84
d1in4a2238 Holliday junction helicase RuvB {Thermotoga mariti 98.22
d1sxja2253 Replication factor C1 {Baker's yeast (Saccharomyce 98.12
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 98.03
d2a5yb3277 CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI 97.77
d1sxje2252 Replication factor C5 {Baker's yeast (Saccharomyce 97.63
d1um8a_364 ClpX {Helicobacter pylori [TaxId: 210]} 97.55
d1qvra3315 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 97.46
d1tf7a2242 Circadian clock protein KaiC {Synechococcus sp. st 97.29
d1g41a_443 HslU {Haemophilus influenzae [TaxId: 727]} 97.23
d1ixsb2239 Holliday junction helicase RuvB {Thermus thermophi 97.22
d1r6bx3315 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 97.21
d1lw7a2192 Transcriptional regulator NadR, ribosylnicotinamid 97.19
d1kaga_169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 97.18
d1p9ra_401 Extracellular secretion NTPase EpsE {Vibrio choler 97.15
d1u94a1263 RecA protein, ATPase-domain {Escherichia coli [Tax 97.11
d1okkd2207 GTPase domain of the signal recognition particle r 97.03
d1xp8a1268 RecA protein, ATPase-domain {Deinococcus radiodura 96.96
d1cr2a_277 Gene 4 protein (g4p, DNA primase), helicase domain 96.95
d1rkba_173 Adenylate kinase {Human (Homo sapiens), isoenzyme 96.9
d2qy9a2211 GTPase domain of the signal recognition particle r 96.84
d1viaa_161 Shikimate kinase (AroK) {Campylobacter jejuni [Tax 96.83
d1vmaa2213 GTPase domain of the signal recognition particle r 96.81
d1e6ca_170 Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax 96.77
d1zp6a1176 Hypothetical protein Atu3015 {Agrobacterium tumefa 96.71
d2iyva1165 Shikimate kinase (AroK) {Mycobacterium tuberculosi 96.68
d1w36d1359 Exodeoxyribonuclease V alpha chain (RecD) {Escheri 96.66
d1qhxa_178 Chloramphenicol phosphotransferase {Streptomyces v 96.61
d1tuea_205 Replication protein E1 helicase domain {Human papi 96.59
d1bifa1213 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata 96.56
d1ak2a1190 Adenylate kinase {Cow (Bos taurus), mitochondrial 96.53
d1qf9a_194 UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 96.51
d2ak3a1189 Adenylate kinase {Cow (Bos taurus), mitochondrial 96.5
d1knqa_171 Gluconate kinase {Escherichia coli [TaxId: 562]} 96.48
d1zina1182 Adenylate kinase {Bacillus stearothermophilus [Tax 96.46
d1zaka1189 Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} 96.41
d1y63a_174 Probable kinase LmjF30.1890 {Leishmania major [Tax 96.4
d2i3ba1189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 96.36
d2bdta1176 Hypothetical protein BH3686 {Bacillus halodurans [ 96.36
d1svma_362 Papillomavirus large T antigen helicase domain {Si 96.3
d2cdna1181 Adenylate kinase {Mycobacterium tuberculosis [TaxI 96.28
d1ukza_196 Uridylate kinase {Baker's yeast (Saccharomyces cer 96.21
d1g6oa_323 Hexameric traffic ATPase, HP0525 {Helicobacter pyl 96.19
d1s3ga1182 Adenylate kinase {Bacillus globisporus [TaxId: 145 96.19
d1teva_194 UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] 96.17
d3adka_194 Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} 96.17
d1akya1180 Adenylate kinase {Baker's yeast (Saccharomyces cer 96.14
d1njfa_239 delta prime subunit of DNA polymerase III, N-domai 96.12
d1j8yf2211 GTPase domain of the signal sequence recognition p 96.1
d1yj5a2172 5' polynucleotide kinase-3' phosphatase, C-termina 96.07
d1ckea_225 CMP kinase {Escherichia coli [TaxId: 562]} 96.06
d1e4va1179 Adenylate kinase {Escherichia coli [TaxId: 562]} 96.0
d1mo6a1269 RecA protein, ATPase-domain {Mycobacterium tubercu 95.98
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 95.95
d1tf7a1242 Circadian clock protein KaiC {Synechococcus sp. st 95.95
d1sxjc2227 Replication factor C3 {Baker's yeast (Saccharomyce 95.94
d1m8pa3183 ATP sulfurylase C-terminal domain {Fungus (Penicil 95.82
d1q3ta_223 CMP kinase {Streptococcus pneumoniae [TaxId: 1313] 95.8
d1w5sa2287 CDC6-like protein APE0152, N-terminal domain {Aero 95.77
d1a1va1136 HCV helicase domain {Human hepatitis C virus (HCV) 95.77
d1ls1a2207 GTPase domain of the signal sequence recognition p 95.48
d1x6va3195 Adenosine-5'phosphosulfate kinase (APS kinase) {Hu 95.45
d1a5ta2207 delta prime subunit of DNA polymerase III, N-domai 95.18
d1u0ja_267 Rep 40 protein helicase domain {Adeno-associated v 95.14
d1sxjd2237 Replication factor C2 {Baker's yeast (Saccharomyce 95.06
d1gvnb_273 Plasmid maintenance system epsilon/zeta, toxin zet 95.01
d1szpa2251 DNA repair protein Rad51, catalytic domain {Baker' 94.95
d1nlfa_274 Hexameric replicative helicase repA {Escherichia c 94.9
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 94.84
d1m7ga_208 Adenosine-5'phosphosulfate kinase (APS kinase) {Fu 94.56
d1fnna2276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 94.14
d1np6a_170 Molybdopterin-guanine dinucleotide biosynthesis pr 94.13
d1lw7a2192 Transcriptional regulator NadR, ribosylnicotinamid 94.11
d1khta_190 Adenylate kinase {Archaeon Methanococcus voltae [T 94.09
d1sxjb2224 Replication factor C4 {Baker's yeast (Saccharomyce 94.02
d1nksa_194 Adenylate kinase {Archaeon Sulfolobus acidocaldari 93.7
d1h65a_257 Chloroplast protein translocon GTPase Toc34 {Garde 93.68
d1yksa1140 YFV helicase domain {Yellow fever virus [TaxId: 11 93.61
d1lvga_190 Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 93.51
d2g9na1218 Initiation factor 4a {Human (Homo sapiens) [TaxId: 92.91
d1gkya_186 Guanylate kinase {Baker's yeast (Saccharomyces cer 92.89
d1rz3a_198 Hypothetical protein rbstp0775 {Bacillus stearothe 92.86
d2pmka1241 Haemolysin B ATP-binding protein {Escherichia coli 92.24
d2gj8a1161 Probable tRNA modification GTPase TrmE (MnmE), G d 92.2
d1gkub1237 Helicase-like "domain" of reverse gyrase {Archaeon 92.16
d2fz4a1206 DNA repair protein RAD25 {Archaeoglobus fulgidus [ 92.14
d1sq5a_308 Pantothenate kinase PanK {Escherichia coli [TaxId: 92.05
d1ksha_165 ADP-ribosylation factor {Mouse (Mus musculus), ARL 91.27
d1htwa_158 Hypothetical protein HI0065 {Haemophilus influenza 90.96
d1jj7a_251 Peptide transporter Tap1, C-terminal ABC domain {H 90.9
d1v5wa_258 Meiotic recombination protein DMC1/LIM15 homolog { 90.85
d1zd9a1164 ADP-ribosylation factor {Human (Homo sapiens), ARL 90.76
d1l8qa2213 Chromosomal replication initiation factor DnaA {Aq 90.66
d2fh5b1207 Signal recognition particle receptor beta-subunit 90.57
d2hyda1255 Putative multidrug export ATP-binding/permease pro 90.57
d1xjca_165 Molybdopterin-guanine dinucleotide biosynthesis pr 90.53
d1uj2a_213 Uridine-cytidine kinase 2 {Human (Homo sapiens) [T 90.27
d1q0ua_209 Probable DEAD box RNA helicase YqfR {Bacillus stea 90.24
d1pzna2254 DNA repair protein Rad51, catalytic domain {Archae 90.12
d1pjra1318 DEXX box DNA helicase {Bacillus stearothermophilus 90.11
d1n0wa_242 DNA repair protein Rad51, catalytic domain {Human 90.09
d1veca_206 DEAD box RNA helicase rck/p54 {Human (Homo sapiens 90.05
d1wf3a1178 GTPase Era, N-terminal domain {Thermus thermophilu 90.0
d1uaaa1306 DEXX box DNA helicase {Escherichia coli, RepD [Tax 89.93
d1qdea_212 Initiation factor 4a {Baker's yeast (Saccharomyces 89.93
d1znwa1182 Guanylate kinase {Mycobacterium tuberculosis [TaxI 89.9
d1qhxa_178 Chloramphenicol phosphotransferase {Streptomyces v 89.55
d1fzqa_176 ADP-ribosylation factor {Mouse (Mus musculus), ARL 89.38
d1wb9a2234 DNA repair protein MutS, the C-terminal domain {Es 89.33
d1kkma_176 HPr kinase HprK C-terminal domain {Lactobacillus c 89.21
d2a5ja1173 Rab2b {Human (Homo sapiens) [TaxId: 9606]} 89.19
d1azta2221 Transducin (alpha subunit) {Cow (Bos taurus) [TaxI 89.04
d1hv8a1208 Putative DEAD box RNA helicase {Archaeon Methanoco 88.88
d1ctqa_166 cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 88.86
d2bmfa2305 Dengue virus helicase {Dengue virus type 2 [TaxId: 88.8
d1uf9a_191 Dephospho-CoA kinase {Thermus thermophilus [TaxId: 88.73
d2j0sa1222 Probable ATP-dependent RNA helicase DDX48 {Human ( 88.71
d1nn5a_209 Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 88.66
d1nrjb_209 Signal recognition particle receptor beta-subunit 88.59
d2p6ra3202 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 88.37
d1yrba1244 ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss 88.09
d1e9ra_433 Bacterial conjugative coupling protein TrwB {Esche 88.06
d1kgda_178 Guanylate kinase-like domain of Cask {Human (Homo 87.99
d1rkba_173 Adenylate kinase {Human (Homo sapiens), isoenzyme 87.96
d1moza_182 ADP-ribosylation factor {Baker's yeast (Saccharomy 87.83
d1kaoa_167 Rap2a {Human (Homo sapiens) [TaxId: 9606]} 87.77
d1ko7a2169 HPr kinase HprK C-terminal domain {Staphylococcus 87.63
d1odfa_286 Hypothetical protein Ygr205W {Baker's yeast (Sacch 87.54
d1zj6a1177 ADP-ribosylation factor {Human (Homo sapiens), ARL 87.3
d1s96a_205 Guanylate kinase {Escherichia coli [TaxId: 562]} 87.2
d1knxa2177 HPr kinase HprK C-terminal domain {Mycoplasma pneu 86.91
d1gsia_208 Thymidylate kinase {Mycobacterium tuberculosis [Ta 86.75
d2iyva1165 Shikimate kinase (AroK) {Mycobacterium tuberculosi 86.64
d1zp6a1176 Hypothetical protein Atu3015 {Agrobacterium tumefa 86.52
d1wmsa_174 Rab9a {Human (Homo sapiens) [TaxId: 9606]} 86.36
d2i1qa2258 DNA repair protein Rad51, catalytic domain {Archae 86.15
d1ewqa2224 DNA repair protein MutS, the C-terminal domain {Th 86.1
d1g2912240 Maltose transport protein MalK, N-terminal domain 85.45
d1kaga_169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 85.14
d1oxxk2242 Glucose transport protein GlcV, N-terminal domain 85.13
d2vp4a1197 Deoxyribonucleoside kinase {Fruit fly (Drosophila 84.94
d1u8za_168 Ras-related protein RalA {Cotton-top tamarin (Sagu 84.83
d1vhta_208 Dephospho-CoA kinase {Escherichia coli [TaxId: 562 84.6
d1zcba2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 84.56
d2gjsa1168 Rad {Human (Homo sapiens) [TaxId: 9606]} 83.78
d3b60a1253 Multidrug resistance ABC transporter MsbA, C-termi 83.74
d2gnoa2198 gamma subunit of DNA polymerase III, N-domain {The 83.59
d2ocpa1241 Deoxyguanosine kinase {Human (Homo sapiens) [TaxId 83.58
d1viaa_161 Shikimate kinase (AroK) {Campylobacter jejuni [Tax 83.56
d1wrba1238 putative ATP-dependent RNA helicase VlgB {Flatworm 83.24
d1jjva_205 Dephospho-CoA kinase {Haemophilus influenzae [TaxI 83.09
d1knqa_171 Gluconate kinase {Escherichia coli [TaxId: 562]} 82.36
d1f6ba_186 SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 82.17
d1a7ja_288 Phosphoribulokinase {Rhodobacter sphaeroides [TaxI 82.06
d2p67a1327 LAO/AO transport system kinase ArgK {Escherichia c 81.98
d1e0sa_173 ADP-ribosylation factor {Human (Homo sapiens), ARF 81.76
d4tmka_210 Thymidylate kinase {Escherichia coli [TaxId: 562]} 81.61
d1s2ma1206 Putative ATP-dependent RNA helicase DHH1 {Baker's 81.52
d1deka_241 Deoxynucleoside monophosphate kinase {Bacteriophag 81.38
d1tmka_214 Thymidylate kinase {Baker's yeast (Saccharomyces c 81.32
d1e6ca_170 Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax 80.78
d1r0wa_281 Cystic fibrosis transmembrane conductance regulato 80.68
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: AAA domain of cell division protein FtsH
species: Escherichia coli [TaxId: 562]

Probab=100.00  E-value=1.9e-40  Score=302.56  Aligned_cols=247  Identities=39%  Similarity=0.612  Sum_probs=220.1

Q ss_pred             CCCCCCCCHHCCCCHHHHHHHHHHHHCCCCCHHHHHCCCCCCCCCEEEEECCCCCHHHHHHHHHHHHHCCCEEEEECCCC
Q ss_conf             99987661000040999999999985725762556308888998169999379882999999999991995899955632
Q 000888          927 PSDIGVTFDDIGALENVKDTLKELVMLPLQRPELFCKGQLTKPCKGILLFGPPGTGKTMLAKAVATEAGANFINISMSSI 1006 (1237)
Q Consensus       927 ~~~~~vtfddI~Gle~iK~~L~e~I~~pl~~~e~f~k~~~~kP~~gILL~GPpGTGKT~LAkAIA~eLg~~fi~Id~seL 1006 (1237)
                      ..++.++|+|++|++++++.|.+.+.+ +.+++.|.+.+.. +++++||+||||||||++|+++|++++.+++.++++++
T Consensus         4 ~~~~~~t~~Di~Gl~~~k~~l~e~v~~-~~~~~~~~~~g~~-~~~~iLL~GppGtGKT~la~~iA~~~~~~~~~i~~~~l   81 (256)
T d1lv7a_           4 EDQIKTTFADVAGCDEAKEEVAELVEY-LREPSRFQKLGGK-IPKGVLMVGPPGTGKTLLAKAIAGEAKVPFFTISGSDF   81 (256)
T ss_dssp             ECSSCCCGGGSCSCHHHHHHTHHHHHH-HHCGGGC-----C-CCCEEEEECCTTSCHHHHHHHHHHHHTCCEEEECSCSS
T ss_pred             CCCCCCCHHHHHCHHHHHHHHHHHHHH-HHCHHHHHHCCCC-CCCEEEEECCCCCCCCHHHHHHHHHCCCCEEEEEHHHH
T ss_conf             889998999981639999999999999-8799999986999-88867866899888228999999982998799886994


Q ss_pred             CCCCCCCCHHHHHHHHHHHHHCCCCEEEECCCHHHHCCCCCC--CHHHHHHHHHHHHHHHHCCCCCCCCCCEEEEEECCC
Q ss_conf             100124408999999999972199179993420100488998--426999989999998823886567764899983289
Q 000888         1007 TSKWFGEGEKYVKAVFSLASKIAPSVIFVDEVDSMLGRRENP--GEHEAMRKMKNEFMVNWDGLRTKDTERILVLAATNR 1084 (1237)
Q Consensus      1007 ~s~~~G~se~~I~~lF~~A~k~~PsIIiIDEID~L~~~r~~~--~~~~a~~~il~~LL~~Ld~l~~~~~~~VlVIaTTN~ 1084 (1237)
                      .+.|+|+++..++.+|..|+...||||||||||.++..+...  .......+++++|+..++++..  +.+++||||||.
T Consensus        82 ~~~~~g~~~~~l~~~f~~A~~~~P~il~iDeiD~l~~~r~~~~~~~~~~~~~~~~~ll~~~d~~~~--~~~v~vIatTn~  159 (256)
T d1lv7a_          82 VEMFVGVGASRVRDMFEQAKKAAPCIIFIDEIDAVGRQRGAGLGGGHDEREQTLNQMLVEMDGFEG--NEGIIVIAATNR  159 (256)
T ss_dssp             TTSCCCCCHHHHHHHHHHHHTTCSEEEEETTHHHHTCCCSTTSCCTTCHHHHHHHHHHHHHHTCCS--SSCEEEEEEESC
T ss_pred             HHCCHHHHHHHHHHHHHHHHHCCCEEEEEECHHHHCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCC--CCCEEEEEECCC
T ss_conf             260010789999999999997599899997756657567898888748999999999999538777--799899980799


Q ss_pred             CCCCCHHHHH--HCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             9998499982--03435369999988999999999841799990419999997589919999999999997779999999
Q 000888         1085 PFDLDEAVIR--RLPRRLMVNLPDAPNRAKILQVILAKEDLSPDVDFDAIANMTDGYSGSDLKNLCVTAAHRPIKEILEK 1162 (1237)
Q Consensus      1085 p~~Ld~aLlr--RFd~~I~v~~Pd~eeR~~ILk~~l~k~~i~~didl~~LA~~T~G~sg~DL~~Lv~~Aa~~airelle~ 1162 (1237)
                      ++.+|++++|  ||+..++|+.|+.++|.+||+.++.+..+..++++..+++.|+||+++||.++|++|+..++++    
T Consensus       160 ~~~ld~al~R~gRfd~~i~i~~P~~~~R~~il~~~l~~~~~~~~~~~~~la~~t~G~s~adi~~l~~~A~~~a~~~----  235 (256)
T d1lv7a_         160 PDVLDPALLRPGRFDRQVVVGLPDVRGREQILKVHMRRVPLAPDIDAAIIARGTPGFSGADLANLVNEAALFAARG----  235 (256)
T ss_dssp             TTTSCGGGGSTTSSCEEEECCCCCHHHHHHHHHHHHTTSCBCTTCCHHHHHHTCTTCCHHHHHHHHHHHHHHHHHT----
T ss_pred             CCCCCHHHCCCCCCCEEEECCCCCHHHHHHHHHHHCCCCCCCCCCCHHHHHHHCCCCCHHHHHHHHHHHHHHHHHC----
T ss_conf             3107985768987877987799599999999998425998686569999998689989999999999999999982----


Q ss_pred             HHHHHHHHHHCCCCCCCCCCCCCCCCCCHHHHHHHHHHHCC
Q ss_conf             99999998751999998779888766459999999998236
Q 000888         1163 EKKERAAAMAEGKPAPALSGCADIRPLNMDDFKYAHERVCA 1203 (1237)
Q Consensus      1163 ~~~~~~~a~ae~~~~~~~~~~~~~r~Vt~eDf~~Al~~v~p 1203 (1237)
                                            ..+.++++||++|+++|..
T Consensus       236 ----------------------~~~~i~~~d~~~Al~rv~~  254 (256)
T d1lv7a_         236 ----------------------NKRVVSMVEFEKAKDKIMM  254 (256)
T ss_dssp             ----------------------TCSSBCHHHHHHHHHHHTT
T ss_pred             ----------------------CCCCCCHHHHHHHHHHHHC
T ss_conf             ----------------------8983489999999999966
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1gxca_ b.26.1.2 (A:) Chk2 kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1lgpa_ b.26.1.2 (A:) Cell cycle checkpoint protein Chfr {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1dmza_ b.26.1.2 (A:) Phosphotyrosine binding domain of Rad53 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Back     information, alignment and structure
>d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g6ga_ b.26.1.2 (A:) Phosphotyrosine binding domain of Rad53 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2brfa1 b.26.1.2 (A:8-108) Polynucleotide kinase 3'-phosphatase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2piea1 b.26.1.2 (A:13-139) Ubiquitin ligase protein RNF8 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ff4a3 b.26.1.2 (A:284-382) Probable regulatory protein EmbR, C-terminal domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2affa1 b.26.1.2 (A:3-100) Antigen ki-67 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uhta_ b.26.1.2 (A:) FHA domain containing protein At4G14490 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1mzka_ b.26.1.2 (A:) Kinase associated protein phosphatase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2g1la1 b.26.1.2 (A:498-599) Kinesin-like protein kif1c {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ny5a2 c.37.1.20 (A:138-384) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wlna1 b.26.1.2 (A:8-114) Afadin {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1tuea_ c.37.1.20 (A:) Replication protein E1 helicase domain {Human papillomavirus type 18 [TaxId: 333761]} Back     information, alignment and structure
>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} Back     information, alignment and structure
>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Back     information, alignment and structure
>d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} Back     information, alignment and structure
>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1u0ja_ c.37.1.20 (A:) Rep 40 protein helicase domain {Adeno-associated virus 2, AAV2 [TaxId: 10804]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2g9na1 c.37.1.19 (A:21-238) Initiation factor 4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} Back     information, alignment and structure
>d1htwa_ c.37.1.18 (A:) Hypothetical protein HI0065 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q0ua_ c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} Back     information, alignment and structure
>d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1veca_ c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} Back     information, alignment and structure
>d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} Back     information, alignment and structure
>d1wb9a2 c.37.1.12 (A:567-800) DNA repair protein MutS, the C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kkma_ c.91.1.2 (A:) HPr kinase HprK C-terminal domain {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1azta2 c.37.1.8 (A:35-65,A:202-391) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Back     information, alignment and structure
>d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1e9ra_ c.37.1.11 (A:) Bacterial conjugative coupling protein TrwB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} Back     information, alignment and structure
>d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ko7a2 c.91.1.2 (A:130-298) HPr kinase HprK C-terminal domain {Staphylococcus xylosus [TaxId: 1288]} Back     information, alignment and structure
>d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} Back     information, alignment and structure
>d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1knxa2 c.91.1.2 (A:133-309) HPr kinase HprK C-terminal domain {Mycoplasma pneumoniae [TaxId: 2104]} Back     information, alignment and structure
>d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1ewqa2 c.37.1.12 (A:542-765) DNA repair protein MutS, the C-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} Back     information, alignment and structure
>d1vhta_ c.37.1.1 (A:) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2ocpa1 c.37.1.1 (A:37-277) Deoxyguanosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1wrba1 c.37.1.19 (A:164-401) putative ATP-dependent RNA helicase VlgB {Flatworm (Dugesia japonica) [TaxId: 6161]} Back     information, alignment and structure
>d1jjva_ c.37.1.1 (A:) Dephospho-CoA kinase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} Back     information, alignment and structure
>d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1s2ma1 c.37.1.19 (A:46-251) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1deka_ c.37.1.1 (A:) Deoxynucleoside monophosphate kinase {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1tmka_ c.37.1.1 (A:) Thymidylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure