Citrus Sinensis ID: 000905

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------1000------1010------1020------1030------1040------1050------1060------1070------1080------1090------1100------1110------1120------1130------1140------1150------1160------1170------1180------1190------1200------1210------1220------1230-
MAFLGTLLGGLSWTCEGEFDLGSFCIQSTIIDVINLVFFCVFYLSLLVGSFRKNHNYGRIRRECVSIVVSACCAVVGIAYLGYCLWNLIAKNDSSMSWLVSTVRGLIWVSLAISLLVKRSKWIRMLITLWWMSFSLLVLALNIEILARTYTINVVYILPLPVNLLLLFSAFRNFSHFTSPNREDKSLSEPLLAEKNQTELGKAGLLRKLTFSWINPLLSLGYSKPLALEDIPSLVPEDEASFAYQKFAYAWDSLVRENNSNNNGNLVRKVITNVYLKENIFIAICALLRTIAVVVGPLLLYAFVNYSNRGEENLQEGLSIVGCLIITKVVESFTQRHCFFGSRRSGMRMRSALMVAVYQKQLKLSSLGRKKHSTGEIVNYIAVDAYRMGEFPFWFHLTWSLALQLFLAIGVLFGVVGLGALPGLVLFLICGLLNVPFAKILQKCQSEFMIAQDERLRSTSEILNNMKIIKLQSWEEKFKSLIESRREKEFKWLSEAQLRKAYGTVIYWMSPTIISSVIFLGCALTGSAPLNASTIFTVLATLRSMGEPVRMIPEALSIMIQVKVSFDRINAFLLDHELNNDDVRRISLQKSDRSVKIQEGNFSWDPELAIPTLRGVNLDIKWAQKIAVCGSVGAGKSSLLYAILGEIPKISGTVNLYGSIAYVSQTSWIQSGSIRDNILYGKPMDKARYDKAIKACALDKDINNFDHGDLTEIGQRGLNLSGGQKQRIQLARAVYNDADIYLFDDPFSAVDAHTAATLFNECVMAALEKKTVILVTHQVEFLSEVDRILVLEGGQITQSGNYQELLLAGTAFEQLVNAHRDAITGLGPLDNAGQGGAEKVEKGRTARPEEPNGIYPRKESSEGEISVKGLTQLTEDEEMEIGDVGWKPFMDYLNVSKGMSLLCLGVLAQSGFVGLQAAATYWLAYAIQIPKITSGILIGVYAGVSTASAVFVYFRSFFAAHLGLKASKAFFSGFTNSIFKAPMLFFDSTPVGRILTRLSSDLSILDFDIPFSIVFVAASGTELLAIIGIMTFVTWQVLVVAIFAMVAVRFVQRYYIATARELIRINGTTKAPVMNYTAETSQGVVTIRAFNMVDRFFQNYLKLVDIDASLFFHTNGVMEWLILRVEALQNLTLFTAALFLVLIPRGYVAPGLVGLSLSYAFTLTGTQVFLSRWYCYLANYIISVERIKQFMHIPPEPPAIVEDKRPPSSWPFKGRIELRQLKVSLHMELIY
ccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHccccccccccccccccccccHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccEEEEEEEEEEcccccccccccEEEEEEcccEEEEEccccccHHHHHHHHHcccccccEEEEEccEEEEEccccccccccccccccccccccHHHHHHHHHHHcccHHHHccccccccccccccccccHHHHHHHHHHHHHHccccEEEcccccHHHcHHHHHHHHHHHHHHHHcccEEEEEcccccccccccEEEEEEccEEEEEccHHHHHHcccHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHcccccHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccEEHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHcccHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHcccHHHHccccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccEEEEEEEEEEEcccccc
cccHcHHccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHcccccccHHHccccccHcHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccEEEEEEEEEEEcccccccEEccEEEEEccccEEEEEEcccccHHHHHHHHHHHccccccEEEEEcEEEEEccccEEEcccHHHcccccccccHHHHHHHHHHHHcHHHHHHcccccccEEcccHHHccHHHHHHHHHHHHHcccccEEEEEccccccccHHHHHHHHHHHHHHHccccEEEEcccHHHHHHHcEEEEEcccEEEEcccHHHHHHcccHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccEEEEHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHccHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHEEHHHHHHHcccccccccEEcccccccccccccEEEEEEEEEEEcccccc
MAFLGTLlgglswtcegefdlgsfciqSTIIDVINLVFFCVFYLSLLVGSfrknhnygrirRECVSIVVSACCAVVGIAYLGYCLWNLIAKNDSSMSWLVSTVRGLIWVSLAISLLVKRSKWIRMLITLWWMSFSLLVLALNIEILARTYTINVVYILPLPVNLLLLFSAFrnfshftspnredkslsepllaekNQTELGKAGLLRKLTFswinpllslgyskplaledipslvpedeasFAYQKFAYAWDSLVRennsnnngnLVRKVITNVYLKENIFIAICALLRTIAVVVGPLLLYAFVNYSNRGEENLQEGLSIVGCLIITKVVESFTQrhcffgsrrsgmRMRSALMVAVYQKQLKLsslgrkkhstgeIVNYIAVDayrmgefpfWFHLTWSLALQLFLAIGVLFGVVGLGALPGLVLFLICGLLNVPFAKILQKCQSEFMIAQDERLRSTSEILNNMKIIKLQSWEEKFKSLIESRREKEFKWLSEAQLRKAYGTVIYWMSPTIISSVIFLGCaltgsaplnasTIFTVLATLrsmgepvrmIPEALSIMIQVKVSFDRINAFLldhelnnddVRRISlqksdrsvkiqegnfswdpelaiptlrgvnldiKWAQKIAVCGSVGAGKSSLLYAILGeipkisgtvNLYGSIAYVsqtswiqsgsirdnilygkpmdkaRYDKAIKACAldkdinnfdhgdlteigqrglnlsggQKQRIQLARAVYndadiylfddpfsavdahtAATLFNECVMAALEKKTVILVTHQVEFLSEVDRILVLeggqitqsgnYQELLLAGTAFEQLVNAHRDaitglgpldnagqggaekvekgrtarpeepngiyprkessegeisvkgltqltedeemeigdvgwkpfMDYLNVSKGMSLLCLGVLAQSGFVGLQAAATYWLAYAIQIPKITSGILIGVYAGVSTASAVFVYFRSFFAAHLGLKaskaffsgftnsifkapmlffdstpvgrILTRLssdlsildfdipFSIVFVAASGTELLAIIGIMTFVTWQVLVVAIFAMVAVRFVQRYYIATARELIRingttkapvmnytaetsqGVVTIRAFNMVDRFFQNYLKLVDIDASLFFHTNGVMEWLILRVEALQNLTLFTAALFLVLIprgyvapglVGLSLSYAFTLTGTQVFLSRWYCYLANYIISVERIKqfmhippeppaivedkrppsswpfkgrieLRQLKVSLHMELIY
MAFLGTLLGGLSWTCEGEFDLGSFCIQSTIIDVINLVFFCVFYLSLLVGSFRKNHNYGRIRRECVSIVVSACCAVVGIAYLGYCLWNLIAKNDSSMSWLVSTVRGLIWVSLAISLLVKRSKWIRMLITLWWMSFSLLVLALNIEILARTYTINVVYILPLPVNLLLLFSAFRNFSHFtspnredkslsePLLAEKNQTELGKAGLLRKLTFSWINPLLSLGYSKPLALEDIPSLVPEDEASFAYQKFAYAWDSLVRennsnnngnlVRKVITNVYLKENIFIAICALLRTIAVVVGPLLLYAFVNYSNRGEENLQEGLSIVGCLIITKVVESFTQRHCFfgsrrsgmrMRSALMVAVYQKQLKlsslgrkkhstgEIVNYIAVDAYRMGEFPFWFHLTWSLALQLFLAIGVLFGVVGLGALPGLVLFLICGLLNVPFAKILQKCQSEFMIAQDERLRSTSEILNNMKIIKLQSWEEKFKSLIESRREKEFKWLSEAQLRKAYGTVIYWMSPTIISSVIFLGCALTGSAPLNASTIFTVLATLRSMGEPVRMIPEALSIMIQVKVSFDRINAFLLdhelnnddvrrislqksdrsvkiqegnfswdpelaiPTLRGVNLDIKWAQKIAVCGSVGAGKSSLLYAILGEIPKISGTVNLYGSIAYVSqtswiqsgsirDNILYGKPMDKARYDKAIKACALDKDINNFDHGDLTEIGQRGLNLSGGQKQRIQLARAVYNDADIYLFDDPFSAVDAHTAATLFNECVMAALEKKTVILVTHQVEFLSEVDRILVLEGGQITQSGNYQELLLAGTAFEQLVNAHRDAITGlgpldnagqggaekvekgrtarpeepngiyprkessegeisvkgltqltedeemEIGDVGWKPFMDYLNVSKGMSLLCLGVLAQSGFVGLQAAATYWLAYAIQIPKITSGILIGVYAGVSTASAVFVYFRSFFAAHLGLKASKAFFSGFTNSIFKAPMLFFDSTPVGRILTRLSSDLSILDFDIPFSIVFVAASGTELLAIIGIMTFVTWQVLVVAIFAMVAVRFVQRYYIATARELIringttkapvmnytAETSQGVVTIRAFNMVDRFFQNYLKLVDIDASLFFHTNGVMEWLILRVEALQNLTLFTAALFLVLIPRGYVAPGLVGLSLSYAFTLTGTQVFLSRWYCYLANYIISVERIKQFMHIPPEppaivedkrppssWPFKGRIELRQLKVSLHMELIY
MAFLGTLLGGLSWTCEGEFDLGSFCIQSTIIDVINLVFFCVFYLSLLVGSFRKNHNYGRIRREcvsivvsaccavvgiaYLGYCLWNLIAKNDSSMSWLVSTVRGLIWVSLAISLLVKRSKWIRMLITLWWMSFSLLVLALNIEILARTYTINVVYIlplpvnllllFSAFRNFSHFTSPNREDKSLSEPLLAEKNQTELGKAGLLRKLTFSWINPLLSLGYSKPLALEDIPSLVPEDEASFAYQKFAYAWDSLVRENNSNNNGNLVRKVITNVYLKENIFIAICALLRTIAVVVGPLLLYAFVNYSNRGEENLQEGLSIVGCLIITKVVESFTQRHCFFgsrrsgmrmrsALMVAVYQKQLKLSSLGRKKHSTGEIVNYIAVDAYRMGEFPFWFHLTWSLALQlflaigvlfgvvglgalpglvlfliCGLLNVPFAKILQKCQSEFMIAQDERLRSTSEILNNMKIIKLQSWEEKFKSLIESRREKEFKWLSEAQLRKAYGTVIYWMSPTIISSVIFLGCALTGSAPLNASTIFTVLATLRSMGEPVRMIPEALSIMIQVKVSFDRINAFLLDHELNNDDVRRISLQKSDRSVKIQEGNFSWDPELAIPTLRGVNLDIKWAQKIAVCGSVGAGKSSLLYAILGEIPKISGTVNLYGSIAYVSQTSWIQSGSIRDNILYGKPMDKARYDKAIKACALDKDINNFDHGDLTEIGQRGLNLSGGQKQRIQLARAVYNDADIYLFDDPFSAVDAHTAATLFNECVMAALEKKTVILVTHQVEFLSEVDRILVLEGGQITQSGNYQELLLAGTAFEQLVNAHRDAITGLGPLDNAGQGGAEKVEKGRTARPEEPNGIYPRKESSEGEISVKGLTQLTEDEEMEIGDVGWKPFMDYLNVSKGMSLLCLGVLAQSGFVGLQAAATYWLAYAIQIPKITSGILIGVYAGVSTASAVFVYFRSFFAAHLGLKASKAFFSGFTNSIFKAPMLFFDSTPVGRILTRLSSDLSILDFDIPFSIVFVAASGTELLAIIGIMTFVTWQVLVVAIFAMVAVRFVQRYYIATARELIRINGTTKAPVMNYTAETSQGVVTIRAFNMVDRFFQNYLKLVDIDASLFFHTNGVMEWLILRVEALQNltlftaalflVLIPRGYVAPGLVGLSLSYAFTLTGTQVFLSRWYCYLANYIISVERIKQFMHIPPEPPAIVEDKRPPSSWPFKGRIELRQLKVSLHMELIY
**FLGTLLGGLSWTCEGEFDLGSFCIQSTIIDVINLVFFCVFYLSLLVGSFRKNHNYGRIRRECVSIVVSACCAVVGIAYLGYCLWNLIAKNDSSMSWLVSTVRGLIWVSLAISLLVKRSKWIRMLITLWWMSFSLLVLALNIEILARTYTINVVYILPLPVNLLLLFSAFRNFSHF**********************LGKAGLLRKLTFSWINPLLSLGYSKPLALEDIPSLVPEDEASFAYQKFAYAWDSLVRENNSNNNGNLVRKVITNVYLKENIFIAICALLRTIAVVVGPLLLYAFVNYSNRGEENLQEGLSIVGCLIITKVVESFTQRHCFFGSRRSGMRMRSALMVAVYQKQLKLSSLGRKKHSTGEIVNYIAVDAYRMGEFPFWFHLTWSLALQLFLAIGVLFGVVGLGALPGLVLFLICGLLNVPFAKILQKCQSEFMIAQDERLRSTSEILNNMKIIKLQSWEEKFKSLIESRREKEFKWLSEAQLRKAYGTVIYWMSPTIISSVIFLGCALTGSAPLNASTIFTVLATLRSMGEPVRMIPEALSIMIQVKVSFDRINAFLLDHELNNDDVRRISL******VKIQEGNFSWDPELAIPTLRGVNLDIKWAQKIAVCGSVGAGKSSLLYAILGEIPKISGTVNLYGSIAYVSQTSWIQSGSIRDNILYGKPMDKARYDKAIKACALDKDINNFDHGDLTEIGQRGLNLSGGQKQRIQLARAVYNDADIYLFDDPFSAVDAHTAATLFNECVMAALEKKTVILVTHQVEFLSEVDRILVLEGGQITQSGNYQELLLAGTAFEQLVNAHRDAITGLG***************************************************MEIGDVGWKPFMDYLNVSKGMSLLCLGVLAQSGFVGLQAAATYWLAYAIQIPKITSGILIGVYAGVSTASAVFVYFRSFFAAHLGLKASKAFFSGFTNSIFKAPMLFFDSTPVGRILTRLSSDLSILDFDIPFSIVFVAASGTELLAIIGIMTFVTWQVLVVAIFAMVAVRFVQRYYIATARELIRINGTTKAPVMNYTAETSQGVVTIRAFNMVDRFFQNYLKLVDIDASLFFHTNGVMEWLILRVEALQNLTLFTAALFLVLIPRGYVAPGLVGLSLSYAFTLTGTQVFLSRWYCYLANYIISVERIKQFMHI*********************RIELRQLKV********
MAFLGTLLGGLSWTCEGEFDLGSFCIQSTIIDVINLVFFCVFYLSLLVGSFRKNHNYGRIRRECVSIVVSACCAVVGIAYLGYCLWNLIAKNDSSMSWLVSTVRGLIWVSLAISLLVKRSKWIRMLITLWWMSFSLLVLALNIEILARTYTINVVYILPLPVNLLLLFSAFRNFSHFTSP*******************LGKAGLLRKLTFSWINPLLSLGYSKPLALEDIPSLVPEDEASFAYQKFAYAW****************RKVITNVYLKENIFIAICALLRTIAVVVGPLLLYAFVNYSNRGEENLQEGLSIVGCLIITKVVESFTQRHCFFGSRRSGMRMRSALMVAVYQKQL***************VNYIAVDAYRMGEFPFWFHLTWSLALQLFLAIGVLFGVVGLGALPGLVLFLICGLLNVPFAKILQKCQSEFMIAQDERLRSTSEILNNMKIIKLQSWEEKFKSLIESRREKEFKWLSEAQLRKAYGTVIYWMSPTIISSVIFLGCALTGSAPLNASTIFTVLATLRSMGEPVRMIPEALSIMIQVKVSFDRINAFLLDHEL****************VKIQEGNFSWDPELAIPTLRGVNLDIKWAQKIAVCGSVGAGKSSLLYAILGEIPKISGTVNLYGSIAYVSQTSWIQSGSIRDNILYGKPMDKARYDKAIKACALDKDINNFDHGDLTEIGQRGLNLSGGQKQRIQLARAVYNDADIYLFDDPFSAVDAHTAATLFNECVMAALEKKTVILVTHQVEFLSEVDRILVLEGGQITQSGNYQELLLAGTAFEQ************************************************************************KPFMDYLNVSKGMSLLCLGVLAQSGFVGLQAAATYWLAYAIQIPKITSGILIGVYAGVSTASAVFVYFRSFFAAHLGLKASKAFFSGFTNSIFKAPMLFFDSTPVGRILTRLSSDLSILDFDIPFSIVFVAASGTELLAIIGIMTFVTWQVLVVAIFAMVAVRFVQRYYIATARELIRINGTTKAPVMNYTAETSQGVVTIRAFNMVDRFFQNYLKLVDIDASLFFHTNGVMEWLILRVEALQNLTLFTAALFLVLIPRGYVAPGLVGLSLSYAFTLTGTQVFLSRWYCYLANYIISVERIKQFMHIPPEPP**********SWPFKGRIELRQLKVSLHMELI*
MAFLGTLLGGLSWTCEGEFDLGSFCIQSTIIDVINLVFFCVFYLSLLVGSFRKNHNYGRIRRECVSIVVSACCAVVGIAYLGYCLWNLIAKNDSSMSWLVSTVRGLIWVSLAISLLVKRSKWIRMLITLWWMSFSLLVLALNIEILARTYTINVVYILPLPVNLLLLFSAFRNFSHFTS********SEPLLAEKNQTELGKAGLLRKLTFSWINPLLSLGYSKPLALEDIPSLVPEDEASFAYQKFAYAWDSLVRENNSNNNGNLVRKVITNVYLKENIFIAICALLRTIAVVVGPLLLYAFVNYSNRGEENLQEGLSIVGCLIITKVVESFTQRHCFFGSRRSGMRMRSALMVAVYQKQLKLSSLGRKKHSTGEIVNYIAVDAYRMGEFPFWFHLTWSLALQLFLAIGVLFGVVGLGALPGLVLFLICGLLNVPFAKILQKCQSEFMIAQDERLRSTSEILNNMKIIKLQSWEEKFKSLIESRREKEFKWLSEAQLRKAYGTVIYWMSPTIISSVIFLGCALTGSAPLNASTIFTVLATLRSMGEPVRMIPEALSIMIQVKVSFDRINAFLLDHELNNDDVRRISLQKSDRSVKIQEGNFSWDPELAIPTLRGVNLDIKWAQKIAVCGSVGAGKSSLLYAILGEIPKISGTVNLYGSIAYVSQTSWIQSGSIRDNILYGKPMDKARYDKAIKACALDKDINNFDHGDLTEIGQRGLNLSGGQKQRIQLARAVYNDADIYLFDDPFSAVDAHTAATLFNECVMAALEKKTVILVTHQVEFLSEVDRILVLEGGQITQSGNYQELLLAGTAFEQLVNAHRDAITGLGPLDNA*****************EPNGIYPRKESSEGEISVKGLTQLTEDEEMEIGDVGWKPFMDYLNVSKGMSLLCLGVLAQSGFVGLQAAATYWLAYAIQIPKITSGILIGVYAGVSTASAVFVYFRSFFAAHLGLKASKAFFSGFTNSIFKAPMLFFDSTPVGRILTRLSSDLSILDFDIPFSIVFVAASGTELLAIIGIMTFVTWQVLVVAIFAMVAVRFVQRYYIATARELIRINGTTKAPVMNYTAETSQGVVTIRAFNMVDRFFQNYLKLVDIDASLFFHTNGVMEWLILRVEALQNLTLFTAALFLVLIPRGYVAPGLVGLSLSYAFTLTGTQVFLSRWYCYLANYIISVERIKQFMHIPPEPPAIVEDKRPPSSWPFKGRIELRQLKVSLHMELIY
*AFLGTLLGGLSWTCEGEFDLGSFCIQSTIIDVINLVFFCVFYLSLLVGSFRKNHNYGRIRRECVSIVVSACCAVVGIAYLGYCLWNLIAKNDSSMSWLVSTVRGLIWVSLAISLLVKRSKWIRMLITLWWMSFSLLVLALNIEILARTYTINVVYILPLPVNLLLLFSAFRNFSHFTSPNREDKSLSEPLLAEKNQTELGKAGLLRKLTFSWINPLLSLGYSKPLALEDIPSLVPEDEASFAYQKFAYAWDSLVRENNSNNNGNLVRKVITNVYLKENIFIAICALLRTIAVVVGPLLLYAFVNYSNRGEENLQEGLSIVGCLIITKVVESFTQRHCFFGSRRSGMRMRSALMVAVYQKQLKLSSLGRKKHSTGEIVNYIAVDAYRMGEFPFWFHLTWSLALQLFLAIGVLFGVVGLGALPGLVLFLICGLLNVPFAKILQKCQSEFMIAQDERLRSTSEILNNMKIIKLQSWEEKFKSLIESRREKEFKWLSEAQLRKAYGTVIYWMSPTIISSVIFLGCALTGSAPLNASTIFTVLATLRSMGEPVRMIPEALSIMIQVKVSFDRINAFLLDHELNNDDVRRISLQKSDRSVKIQEGNFSWDPELAIPTLRGVNLDIKWAQKIAVCGSVGAGKSSLLYAILGEIPKISGTVNLYGSIAYVSQTSWIQSGSIRDNILYGKPMDKARYDKAIKACALDKDINNFDHGDLTEIGQRGLNLSGGQKQRIQLARAVYNDADIYLFDDPFSAVDAHTAATLFNECVMAALEKKTVILVTHQVEFLSEVDRILVLEGGQITQSGNYQELLLAGTAFEQLVNAHRDA************************************************TQLTEDEEMEIGDVGWKPFMDYLNVSKGMSLLCLGVLAQSGFVGLQAAATYWLAYAIQIPKITSGILIGVYAGVSTASAVFVYFRSFFAAHLGLKASKAFFSGFTNSIFKAPMLFFDSTPVGRILTRLSSDLSILDFDIPFSIVFVAASGTELLAIIGIMTFVTWQVLVVAIFAMVAVRFVQRYYIATARELIRINGTTKAPVMNYTAETSQGVVTIRAFNMVDRFFQNYLKLVDIDASLFFHTNGVMEWLILRVEALQNLTLFTAALFLVLIPRGYVAPGLVGLSLSYAFTLTGTQVFLSRWYCYLANYIISVERIKQFMHIPPEPPAIVEDKRPPSSWPFKGRIELRQLKVSLHMELIY
ooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiHHHHHHHHHHHHHHHHHHooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHoooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHoooHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHoooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSoooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHoooooooooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHoooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAFLGTLLGGLSWTCEGEFDLGSFCIQSTIIDVINLVFFCVFYLSLLVGSFRKNHNYGRIRRECVSIVVSACCAVVGIAYLGYCLWNLIAKNDSSMSWLVSTVRGLIWVSLAISLLVKRSKWIRMLITLWWMSFSLLVLALNIEILARTYTINVVYILPLPVNLLLLFSAFRNFSHFTSPNREDKSLSEPLLAEKNQTELGKAGLLRKLTFSWINPLLSLGYSKPLALEDIPSLVPEDEASFAYQKFAYAWDSLVRENNSNNNGNLVRKVITNVYLKENIFIAICALLRTIAVVVGPLLLYAFVNYSNRGEENLQEGLSIVGCLIITKVVESFTQRHCFFGSRRSGMRMRSALMVAVYQKQLKLSSLGRKKHSTGEIVNYIAVDAYRMGEFPFWFHLTWSLALQLFLAIGVLFGVVGLGALPGLVLFLICGLLNVPFAKILQKCQSEFMIAQDERLRSTSEILNNMKIIKLQSWEEKFKSLIESRREKEFKWLSEAQLRKAYGTVIYWMSPTIISSVIFLGCALTGSAPLNASTIFTVLATLRSMGEPVRMIPEALSIMIQVKVSFDRINAFLLDHELNNDDVRRISLQKSDRSVKIQEGNFSWDPELAIPTLRGVNLDIKWAQKIAVCGSVGAGKSSLLYAILGEIPKISGTVNLYGSIAYVSQTSWIQSGSIRDNILYGKPMDKARYDKAIKACALDKDINNFDHGDLTEIGQRGLNLSGGQKQRIQLARAVYNDADIYLFDDPFSAVDAHTAATLFNECVMAALEKKTVILVTHQVEFLSEVDRILVLEGGQITQSGNYQELLLAGTAFEQLVNAHRDAITGLGPLDNAGQGGAEKVEKGRTARPEEPNGIYPRKESSEGEISVKGLTQLTEDEEMEIGDVGWKPFMDYLNVSKGMSLLCLGVLAQSGFVGLQAAATYWLAYAIQIPKITSGILIGVYAGVSTASAVFVYFRSFFAAHLGLKASKAFFSGFTNSIFKAPMLFFDSTPVGRILTRLSSDLSILDFDIPFSIVFVAASGTELLAIIGIMTFVTWQVLVVAIFAMVAVRFVQRYYIATARELIRINGTTKAPVMNYTAETSQGVVTIRAFNMVDRFFQNYLKLVDIDASLFFHTNGVMEWLILRVEALQNLTLFTAALFLVLIPRGYVAPGLVGLSLSYAFTLTGTQVFLSRWYCYLANYIISVERIKQFMHIPPEPPAIVEDKRPPSSWPFKGRIELRQLKVSLHMELIY
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query1231 2.2.26 [Sep-21-2011]
Q8LGU1 1464 ABC transporter C family yes no 0.985 0.828 0.625 0.0
Q9LYS2 1453 ABC transporter C family no no 0.946 0.801 0.401 0.0
Q7GB25 1514 ABC transporter C family no no 0.905 0.736 0.4 0.0
Q9M1C7 1506 ABC transporter C family no no 0.971 0.794 0.372 0.0
Q9LK64 1514 ABC transporter C family no no 0.832 0.677 0.405 0.0
Q8VZZ4 1466 ABC transporter C family no no 0.924 0.776 0.376 0.0
Q9LZJ5 1539 ABC transporter C family no no 0.925 0.740 0.350 0.0
Q7DM58 1516 ABC transporter C family no no 0.920 0.747 0.356 0.0
Q9LK62 1493 ABC transporter C family no no 0.826 0.681 0.382 0.0
Q7FB56 1053 Putative ABC transporter no no 0.650 0.760 0.412 0.0
>sp|Q8LGU1|AB8C_ARATH ABC transporter C family member 8 OS=Arabidopsis thaliana GN=ABCC8 PE=2 SV=3 Back     alignment and function desciption
 Score = 1472 bits (3810), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 769/1229 (62%), Positives = 943/1229 (76%), Gaps = 16/1229 (1%)

Query: 4    LGTLLGGLSWTCEGEFDLGSFCIQSTIIDVINLVFFCVFYLSLLVGSFRKNHNYGRIRRE 63
            +   +G L W C+ E +L S C Q T I  +NL+F C+FYL  L+ S    H   R R++
Sbjct: 1    MAAFIGSLPW-CDVELNLASSCFQRTAIAFVNLLFLCIFYL-FLIASCVSTHFIVRGRKK 58

Query: 64   C-VSIVVSACCAVVGIAYLGYCLWNLI-AKND-SSMSWLVSTVRGLIWVSLAISLLVKRS 120
              + + V+ CCA+    +LG  L +LI   ND + +SW+   V G+IWVSLA+SLLV  S
Sbjct: 59   GWIFVAVAICCAITSFIFLGVGLNSLIHGGNDVTEISWVACFVEGIIWVSLAVSLLVNGS 118

Query: 121  KWIRMLITLWWMSFSLLVLALNIEILARTYTINVVYILPLPVNLLLLFSAFRNFSHFTSP 180
            KW+ +L+++WW+SF+LL L     IL +   I ++ IL LP++LLLL  ++ N    +S 
Sbjct: 119  KWVNILVSVWWVSFALLDLVAKSGILLQGNGIRILDILTLPMSLLLLLCSWMNLRS-SSA 177

Query: 181  NREDKS---LSEPLLAE---KNQTELGKAGLLRKLTFSWINPLLSLGYSKPLALEDIPSL 234
              +D S   LS+PLL +   K    L  AG    L+FSW+NPLLSLG+ KPL+ EDIPS+
Sbjct: 178  AAQDCSVTGLSDPLLTKNPRKESARLATAGFFSILSFSWMNPLLSLGFKKPLSPEDIPSV 237

Query: 235  VPEDEASFAYQKFAYAWDSLVRENNSNNNGNLVRKVITNVYLKENIFIAICALLRTIAVV 294
            VPEDEA  AY+KF+ AWD+L+ + +S    NLV + +  VY KENIFIA+ A LRT AVV
Sbjct: 238  VPEDEAQLAYKKFSQAWDTLLGDESSTKERNLVFRAVVKVYFKENIFIAVFAFLRTFAVV 297

Query: 295  VGPLLLYAFVNYSNRGEENLQEGLSIVGCLIITKVVESFTQRHCFFGSRRSGMRMRSALM 354
              PL+LY FV+Y+N    +L+ G   + CL++ K+VES T RH +F SRRSGMR+RSALM
Sbjct: 298  SLPLMLYVFVDYANSDHRDLRNGFFNLACLVMLKLVESLTMRHWYFASRRSGMRIRSALM 357

Query: 355  VAVYQKQLKLSSLGRKKHSTGEIVNYIAVDAYRMGEFPFWFHLTWSLALQLFLAIGVLFG 414
            VA Y+KQLKLSSLGRK+HS+GEIVNYIAVDAYRMGEF +WFH  WSL+LQL L+  VLFG
Sbjct: 358  VAAYKKQLKLSSLGRKRHSSGEIVNYIAVDAYRMGEFLWWFHSGWSLSLQLLLSTAVLFG 417

Query: 415  VVGLGALPGLVLFLICGLLNVPFAKILQKCQSEFMIAQDERLRSTSEILNNMKIIKLQSW 474
            VVG GA PGL+L L+CGLLN+PFAK+LQ CQ++FMIAQD+RLRSTSEILN+MK+IKLQSW
Sbjct: 418  VVGAGAFPGLILLLLCGLLNLPFAKMLQNCQTQFMIAQDKRLRSTSEILNSMKVIKLQSW 477

Query: 475  EEKFKSLIESRREKEFKWLSEAQLRKAYGTVIYWMSPTIISSVIFLGCALTGSAPLNAST 534
            E++FK  IES R+ EF WL++AQL KA+G+ +YWMSPTI+SSV+FLGCAL  SAPLNAST
Sbjct: 478  EDEFKKKIESCRDDEFTWLAKAQLTKAFGSFLYWMSPTIVSSVVFLGCALLKSAPLNAST 537

Query: 535  IFTVLATLRSMGEPVRMIPEALSIMIQVKVSFDRINAFLLDHELNNDDVRRISLQKSDRS 594
            IFTVLATLR M EPV++IP+A+S +IQ  VSF R+N FLLD EL  D++ R  L  S  +
Sbjct: 538  IFTVLATLRVMSEPVKIIPDAISAIIQGNVSFQRLNNFLLDDELKMDEIERSGLDASGTA 597

Query: 595  VKIQEGNFSWDPELAIPTLRGVNLDIKWAQKIAVCGSVGAGKSSLLYAILGEIPKISGTV 654
            V IQ GNF W+PE  IPTLR ++L+IK  QK+AVCG VGAGKSSLL+A+LGEIPK+SGTV
Sbjct: 598  VDIQVGNFGWEPETKIPTLRNIHLEIKHGQKVAVCGPVGAGKSSLLHAVLGEIPKVSGTV 657

Query: 655  NLYGSIAYVSQTSWIQSGSIRDNILYGKPMDKARYDKAIKACALDKDINNFDHGDLTEIG 714
             ++GSIAYVSQTSWIQSG+IRDNILYGKPM+  RY+ AIKACALDKD+N F HGDLTEIG
Sbjct: 658  KVFGSIAYVSQTSWIQSGTIRDNILYGKPMESRRYNAAIKACALDKDMNGFGHGDLTEIG 717

Query: 715  QRGLNLSGGQKQRIQLARAVYNDADIYLFDDPFSAVDAHTAATLFNECVMAALEKKTVIL 774
            QRG+NLSGGQKQRIQLARAVY DAD+YL DDPFSAVDAHTA  LF++CV  +L++KTVIL
Sbjct: 718  QRGINLSGGQKQRIQLARAVYADADVYLLDDPFSAVDAHTAGVLFHKCVEDSLKEKTVIL 777

Query: 775  VTHQVEFLSEVDRILVLEGGQITQSGNYQELLLAGTAFEQLVNAHRDAITGLGPLDNAGQ 834
            VTHQVEFLSEVD+ILV+E G ITQSG Y+ELL+ GTAF+QLVNAH DA+T L    N   
Sbjct: 778  VTHQVEFLSEVDQILVMEEGTITQSGKYEELLMMGTAFQQLVNAHNDAVTVLPLASNESL 837

Query: 835  GGAEKVEKGRTARPEEPNGIYPRKESSEGEISVKGLTQLTEDEEMEIGDVGWKPFMDYLN 894
            G   K  K R  R    N     K   E E +     QLT++EE E G VG KPF+DY+ 
Sbjct: 838  GDLRKEGKDREIR----NMTVVEKIEEEIEKTDIPGVQLTQEEEKESGYVGMKPFLDYIG 893

Query: 895  VSKGMSLLCLGVLAQSGFVGLQAAATYWLAYAIQIPKITSGILIGVYAGVSTASAVFVYF 954
            VS+G  LL   VL Q GFV  QAA+TYWLA+AI IPKIT+ +LIGVY+ +ST SA FVY 
Sbjct: 894  VSRGWCLLWSSVLGQVGFVVFQAASTYWLAFAIGIPKITNTMLIGVYSIISTLSAGFVYA 953

Query: 955  RSFFAAHLGLKASKAFFSGFTNSIFKAPMLFFDSTPVGRILTRLSSDLSILDFDIPFSIV 1014
            R+   AHLGLKASKAFFSGFTN++FKAPMLFFDSTPVGRILTR SSDL++LD+D+PF+ +
Sbjct: 954  RAITTAHLGLKASKAFFSGFTNAVFKAPMLFFDSTPVGRILTRASSDLNVLDYDVPFAFI 1013

Query: 1015 FVAASGTELLAIIGIMTFVTWQVLVVAIFAMVAVRFVQRYYIATARELIRINGTTKAPVM 1074
            FV A   EL A + IMT+VTWQV+++A+ A+ A + VQ YY+A+ARELIRINGTTKAPVM
Sbjct: 1014 FVVAPAVELTAALLIMTYVTWQVIIIALLALAATKVVQDYYLASARELIRINGTTKAPVM 1073

Query: 1075 NYTAETSQGVVTIRAFNMVDRFFQNYLKLVDIDASLFFHTNGVMEWLILRVEALQNLTLF 1134
            NY AETS GVVTIRAF   +RFF+NYL LVD DA LFF +N  MEW+ILR+E LQN+TLF
Sbjct: 1074 NYAAETSLGVVTIRAFGTAERFFKNYLNLVDADAVLFFLSNAAMEWVILRIETLQNVTLF 1133

Query: 1135 TAALFLVLIPRGYVAPGLVGLSLSYAFTLTGTQVFLSRWYCYLANYIISVERIKQFMHIP 1194
            T AL L+LIP+GY+APGLVGLSLSYA TLT TQVFL+RWYC L+N IISVERIKQ+M+IP
Sbjct: 1134 TCALLLILIPKGYIAPGLVGLSLSYALTLTQTQVFLTRWYCTLSNSIISVERIKQYMNIP 1193

Query: 1195 PEPPAIVEDKRPPSSWPFKGRIELRQLKV 1223
             EPPAI++DKRPPSSWP  G I L++LK+
Sbjct: 1194 EEPPAIIDDKRPPSSWPSNGTIHLQELKI 1222
Pump for glutathione S-conjugates.
Arabidopsis thaliana (taxid: 3702)
EC: 3EC: .EC: 6EC: .EC: 3EC: .EC: 4EC: 4
>sp|Q9LYS2|AB10C_ARATH ABC transporter C family member 10 OS=Arabidopsis thaliana GN=ABCC10 PE=2 SV=2 Back     alignment and function description
>sp|Q7GB25|AB5C_ARATH ABC transporter C family member 5 OS=Arabidopsis thaliana GN=ABCC5 PE=2 SV=2 Back     alignment and function description
>sp|Q9M1C7|AB9C_ARATH ABC transporter C family member 9 OS=Arabidopsis thaliana GN=ABCC9 PE=2 SV=2 Back     alignment and function description
>sp|Q9LK64|AB3C_ARATH ABC transporter C family member 3 OS=Arabidopsis thaliana GN=ABCC3 PE=1 SV=1 Back     alignment and function description
>sp|Q8VZZ4|AB6C_ARATH ABC transporter C family member 6 OS=Arabidopsis thaliana GN=ABCC6 PE=2 SV=3 Back     alignment and function description
>sp|Q9LZJ5|AB14C_ARATH ABC transporter C family member 14 OS=Arabidopsis thaliana GN=ABCC14 PE=1 SV=1 Back     alignment and function description
>sp|Q7DM58|AB4C_ARATH ABC transporter C family member 4 OS=Arabidopsis thaliana GN=ABCC4 PE=1 SV=2 Back     alignment and function description
>sp|Q9LK62|AB7C_ARATH ABC transporter C family member 7 OS=Arabidopsis thaliana GN=ABCC7 PE=2 SV=1 Back     alignment and function description
>sp|Q7FB56|AB15C_ARATH Putative ABC transporter C family member 15 OS=Arabidopsis thaliana GN=ABCC15 PE=5 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1231
255572985 1475 multidrug resistance-associated protein 0.983 0.821 0.714 0.0
359482526 1469 PREDICTED: ABC transporter C family memb 0.989 0.829 0.705 0.0
359482528 1465 PREDICTED: ABC transporter C family memb 0.983 0.826 0.686 0.0
359482524 1462 PREDICTED: ABC transporter C family memb 0.990 0.833 0.694 0.0
358349246 1549 Multidrug resistance protein ABC transpo 0.979 0.778 0.663 0.0
356528857 1469 PREDICTED: ABC transporter C family memb 0.981 0.822 0.665 0.0
357515353 1463 ABC transporter C family member [Medicag 0.982 0.827 0.648 0.0
356522202 1951 PREDICTED: ABC transporter C family memb 0.974 0.615 0.653 0.0
356526035 1465 PREDICTED: ABC transporter C family memb 0.982 0.825 0.655 0.0
356528827 1494 PREDICTED: ABC transporter C family memb 0.979 0.807 0.635 0.0
>gi|255572985|ref|XP_002527423.1| multidrug resistance-associated protein 1, 3 (mrp1, 3), abc-transoprter, putative [Ricinus communis] gi|223533233|gb|EEF34989.1| multidrug resistance-associated protein 1, 3 (mrp1, 3), abc-transoprter, putative [Ricinus communis] Back     alignment and taxonomy information
 Score = 1782 bits (4615), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 873/1221 (71%), Positives = 1014/1221 (83%), Gaps = 10/1221 (0%)

Query: 9    GGLSWTCEGEFDLGSFCIQSTIIDVINLVFFCVFYLSLLVGSFRKNHNYGRIRRECVSIV 68
            G LSW CE + DLGS C Q  IID+INLVF  VFYL LL+GS RK+   G  RR+ +S+V
Sbjct: 16   GELSWICEEKLDLGSPCTQRIIIDIINLVFLGVFYLFLLLGSIRKHQVSGSNRRDWISVV 75

Query: 69   VSACCAVVGIAYLGYCLWNLIAKNDS--SMSWLVSTVRGLIWVSLAISLLVKRSKWIRML 126
            VS CC ++ IAYLG  LW+LIAKN S   +SWLV  VRG+IW+S+A+SLLV RS+W R+L
Sbjct: 76   VSICCTLISIAYLGVGLWDLIAKNHSFNHLSWLVYLVRGIIWISVAVSLLVTRSRWNRIL 135

Query: 127  ITLWWMSFSLLVLALNIEILARTYTINVVYILPLPVNLLLLFSAFRNFSHFTSPNREDKS 186
            +T+WW+SFSLL  ALNIEILAR  +I V+ ILP PVN LLL  A RNFSHF+S     K+
Sbjct: 136  VTVWWVSFSLLASALNIEILARANSIQVLDILPWPVNFLLLLCALRNFSHFSSQQASYKN 195

Query: 187  LSEPLLAEK--NQTELGKAGLLRKLTFSWINPLLSLGYSKPLALEDIPSLVPEDEASFAY 244
            L EPLL  K     +L  A  L  LTFSWINPLL LGYSKPL  EDIPSL+PEDEA  AY
Sbjct: 196  LFEPLLGAKEVKNQKLAHASFLSNLTFSWINPLLKLGYSKPLDDEDIPSLLPEDEADIAY 255

Query: 245  QKFAYAWDSLVRENNSNNNGNLVRKVITNVYLKENIFIAICALLRTIAVVVGPLLLYAFV 304
            QKFA+AWDSL+RENNSN+ GNLV + +  V+LKENIFI   ALLR IAV V PLLLYAFV
Sbjct: 256  QKFAHAWDSLIRENNSNDTGNLVLEAVAKVHLKENIFIGTYALLRAIAVAVLPLLLYAFV 315

Query: 305  NYSNRGEENLQEGLSIVGCLIITKVVESFTQRHCFFGSRRSGMRMRSALMVAVYQKQLKL 364
            NYSN  ++NL +GLSIVGCLI+ KVVES +QR  FF +R+SGMR+RSALMVAVYQKQL L
Sbjct: 316  NYSNLDQQNLYQGLSIVGCLILVKVVESLSQRRSFFLARQSGMRIRSALMVAVYQKQLNL 375

Query: 365  SSLGRKKHSTGEIVNYIAVDAYRMGEFPFWFHLTWSLALQLFLAIGVLFGVVGLGALPGL 424
            SSL R++HSTGE VNYIAVDAYRMGEFP+WFH TW+  LQLFL+I +LFGVVGLGA+ GL
Sbjct: 376  SSLARRRHSTGEFVNYIAVDAYRMGEFPWWFHATWAYVLQLFLSIIILFGVVGLGAVTGL 435

Query: 425  VLFLICGLLNVPFAKILQKCQSEFMIAQDERLRSTSEILNNMKIIKLQSWEEKFKSLIES 484
            V  LICGLLNVPFA+ LQKCQS+FMIAQDERLR+TSEILNNMKIIKLQSWEEKFKS IES
Sbjct: 436  VPLLICGLLNVPFARFLQKCQSKFMIAQDERLRATSEILNNMKIIKLQSWEEKFKSYIES 495

Query: 485  RREKEFKWLSEAQLRKAYGTVIYWMSPTIISSVIFLGCALTGSAPLNASTIFTVLATLRS 544
             R+ EFKWL+E+Q++K YGT++YW+SPTIISSV+F+GCAL  SAPLN+STIFTVLATLRS
Sbjct: 496  LRDTEFKWLTESQIKKTYGTILYWLSPTIISSVVFVGCALFRSAPLNSSTIFTVLATLRS 555

Query: 545  MGEPVRMIPEALSIMIQVKVSFDRINAFLLDHELNNDDVRRISLQKSDRSVKIQEGNFSW 604
            M EPVRMIPEALSI+IQVKVSFDRIN FLLD EL N+ +   S   S  S+ ++ G FSW
Sbjct: 556  MAEPVRMIPEALSILIQVKVSFDRINNFLLDDELKNESISTNSSYNSGESITVEGGKFSW 615

Query: 605  DPELAIPTLRGVNLDIKWAQKIAVCGSVGAGKSSLLYAILGEIPKISGTVNLYGSIAYVS 664
            DPEL++PTLR VNLDIK  QK AVCG VGAGKSSLLYA+LGEIPKISGTVN++GSIAYVS
Sbjct: 616  DPELSMPTLREVNLDIKRGQKFAVCGPVGAGKSSLLYAMLGEIPKISGTVNVFGSIAYVS 675

Query: 665  QTSWIQSGSIRDNILYGKPMDKARYDKAIKACALDKDINNFDHGDLTEIGQRGLNLSGGQ 724
            QTSWIQSG++RDNILYGKPMD+ +Y++AIKACALDKDIN+F+HGDLTEIGQRGLN+SGGQ
Sbjct: 676  QTSWIQSGTVRDNILYGKPMDQEKYERAIKACALDKDINSFNHGDLTEIGQRGLNMSGGQ 735

Query: 725  KQRIQLARAVYNDADIYLFDDPFSAVDAHTAATLFNECVMAALEKKTVILVTHQVEFLSE 784
            KQRIQLARAVYNDADIYL DDPFSAVDAHTAA LFN+C+M ALE KTVILVTHQV+FLS 
Sbjct: 736  KQRIQLARAVYNDADIYLLDDPFSAVDAHTAAILFNDCIMTALENKTVILVTHQVDFLSS 795

Query: 785  VDRILVLEGGQITQSGNYQELLLAGTAFEQLVNAHRDAITGLGPLDNAGQGGAEKVEKGR 844
            VD+ILV+EGGQITQSG+Y+ELL+A TAFEQLVNAH+D++T LG  D + +G + K +   
Sbjct: 796  VDQILVMEGGQITQSGSYEELLMACTAFEQLVNAHKDSVTVLGSYDKS-RGESLKAD--- 851

Query: 845  TARPEEPNGIYPRKESSEGEISVKGLT--QLTEDEEMEIGDVGWKPFMDYLNVSKGMSLL 902
              R E+ +     K++SEGEIS+KG+   QLTE+EE  IG+VGWKPF+DY+ +SKG    
Sbjct: 852  IVRQEDFSVSSHAKQNSEGEISMKGVAGVQLTEEEEKGIGNVGWKPFLDYILISKGTLFA 911

Query: 903  CLGVLAQSGFVGLQAAATYWLAYAIQIPKITSGILIGVYAGVSTASAVFVYFRSFFAAHL 962
             L  L+  GF+GLQAAATYWLAYA+QIP+I S +LIGVY  +S+ SA FVY RS+ A  L
Sbjct: 912  SLSTLSICGFIGLQAAATYWLAYAVQIPEIRSSMLIGVYTLISSLSASFVYLRSYLAVLL 971

Query: 963  GLKASKAFFSGFTNSIFKAPMLFFDSTPVGRILTRLSSDLSILDFDIPFSIVFVAASGTE 1022
            GLKASK+FFSGFTN+IFKAPMLFFDSTPVGRILTR SSDLSILDFDIPFS VF A    E
Sbjct: 972  GLKASKSFFSGFTNTIFKAPMLFFDSTPVGRILTRASSDLSILDFDIPFSYVFAAGGLVE 1031

Query: 1023 LLAIIGIMTFVTWQVLVVAIFAMVAVRFVQRYYIATARELIRINGTTKAPVMNYTAETSQ 1082
            L+  IGIM  VTWQVLV+A+ A+V  +++Q YY+A+ARELIRINGTTKAPVMNY AETS 
Sbjct: 1032 LVVTIGIMASVTWQVLVIAVLAIVGAKYIQDYYLASARELIRINGTTKAPVMNYAAETSL 1091

Query: 1083 GVVTIRAFNMVDRFFQNYLKLVDIDASLFFHTNGVMEWLILRVEALQNLTLFTAALFLVL 1142
            GVVTIRAF MV+RFFQNYLKLVD DA LFF +NG MEWLI+R EALQN+TLFTAAL LVL
Sbjct: 1092 GVVTIRAFKMVNRFFQNYLKLVDKDAVLFFLSNGAMEWLIIRTEALQNVTLFTAALLLVL 1151

Query: 1143 IPRGYVAPGLVGLSLSYAFTLTGTQVFLSRWYCYLANYIISVERIKQFMHIPPEPPAIVE 1202
            +P+G V PGL+GLSLSYA +LTGTQVF++RWYC LANY+ISVERIKQFMHIP EPPA+VE
Sbjct: 1152 LPKGVVTPGLIGLSLSYALSLTGTQVFVTRWYCNLANYVISVERIKQFMHIPSEPPAVVE 1211

Query: 1203 DKRPPSSWPFKGRIELRQLKV 1223
            D RPPSSWP +GRIEL+ LK+
Sbjct: 1212 DNRPPSSWPPEGRIELQDLKI 1232

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|359482526|ref|XP_002276212.2| PREDICTED: ABC transporter C family member 8-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|359482528|ref|XP_002276236.2| PREDICTED: ABC transporter C family member 8-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|359482524|ref|XP_002276193.2| PREDICTED: ABC transporter C family member 8-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|358349246|ref|XP_003638650.1| Multidrug resistance protein ABC transporter family [Medicago truncatula] gi|355504585|gb|AES85788.1| Multidrug resistance protein ABC transporter family [Medicago truncatula] Back     alignment and taxonomy information
>gi|356528857|ref|XP_003533014.1| PREDICTED: ABC transporter C family member 8-like [Glycine max] Back     alignment and taxonomy information
>gi|357515353|ref|XP_003627965.1| ABC transporter C family member [Medicago truncatula] gi|355521987|gb|AET02441.1| ABC transporter C family member [Medicago truncatula] Back     alignment and taxonomy information
>gi|356522202|ref|XP_003529736.1| PREDICTED: ABC transporter C family member 8-like [Glycine max] Back     alignment and taxonomy information
>gi|356526035|ref|XP_003531625.1| PREDICTED: ABC transporter C family member 8-like [Glycine max] Back     alignment and taxonomy information
>gi|356528827|ref|XP_003532999.1| PREDICTED: ABC transporter C family member 8-like [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1231
TAIR|locus:2077750 1453 ABCC10 "ATP-binding cassette C 0.911 0.772 0.397 7.1e-219
TAIR|locus:2020235 1514 ABCC5 "ATP-binding cassette C5 0.578 0.470 0.411 2.4e-212
TAIR|locus:2090039 1466 ABCC6 "ATP-binding cassette C6 0.903 0.758 0.367 2.4e-195
TAIR|locus:2090029 1514 ABCC3 "ATP-binding cassette C3 0.833 0.677 0.389 6.3e-195
TAIR|locus:2090049 1493 ABCC7 "ATP-binding cassette C7 0.827 0.682 0.373 2.8e-185
TAIR|locus:2081755 1539 ABCC14 "ATP-binding cassette C 0.598 0.478 0.351 1.1e-181
TAIR|locus:2043268 1516 ABCC4 "ATP-binding cassette C4 0.909 0.738 0.343 5.1e-177
DICTYBASE|DDB_G0284867 1593 abcC8 "ABC transporter C famil 0.607 0.469 0.312 3.3e-134
UNIPROTKB|E1C6S5 1552 ABCC2 "Uncharacterized protein 0.486 0.385 0.338 4.8e-133
MGI|MGI:102676 1528 Abcc1 "ATP-binding cassette, s 0.450 0.363 0.349 6.3e-129
TAIR|locus:2077750 ABCC10 "ATP-binding cassette C10" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 2114 (749.2 bits), Expect = 7.1e-219, P = 7.1e-219
 Identities = 464/1166 (39%), Positives = 683/1166 (58%)

Query:    85 LWNLIAKNDSS--MSWLVSTVRGLIWVSLAISLLVKRSKWIRM----LITLWWMSFSLLV 138
             +W ++ +N S   + WLV  ++G  W+ + + + V+ ++ IR     L++++   + L+ 
Sbjct:    76 IW-VLRENHSKPLILWLVILIQGFTWLFINLIICVRGTR-IRKSSLRLLSIFSFFYGLVS 133

Query:   139 LALNI-------EILARTYTINVVYIXXXXXXXXXXFSAFR----NFSHFTSP-NREDKS 186
               L++       E+  RT  ++V+ +          +  +R      S    P N  D +
Sbjct:   134 SCLSVNNAVFGDELAVRTI-LDVLLLPGSVLLLLSAYKGYRFDESGESSLYEPLNAGDSN 192

Query:   187 -LSEPLLAEKNQTELGKAGLLRKLTFSWINPLLSLGYSKPLALEDIPSLVPEDEASFAYQ 245
               SE    +   ++  KAGL   L+F W+N L+  G  K L  EDIP L  E+ A   Y 
Sbjct:   193 GFSEKADFDNRVSQFAKAGLFSTLSFWWLNSLIKRGNVKDLEEEDIPELRKEERAETCYS 252

Query:   246 KFAYAWDSLVRENNSNNNGNLVRKVITNVYLKENIFIAICALLRTIAVVVGPLLLYAFVN 305
              F        R   S+   ++++  +  V+ +E +     A ++ +AV  GPLLL AF+ 
Sbjct:   253 LFEENLIEQKRRLGSSCQPSILKVTVLCVW-RELLTSGFFAFMKIVAVSAGPLLLNAFIL 311

Query:   306 YSNRGEENLQEGLSIVGCLIITKVVESFTQRHCFFXXXXXXXXXXXALMVAVYQKQLKLS 365
              +        EGL +   L  +K++ES +QR  +F            L  A+ +KQL+L+
Sbjct:   312 VAEGNASFRYEGLVLAVLLFFSKMIESLSQRQWYFRCRIVGLRVRSLLTAAINKKQLRLN 371

Query:   366 SLGRKKHSTGEIVNYIAVDAYRMGEFPFWFHLTWSLALQXXXXXXXXXXXXXXXXXXXXX 425
             +  R  HS  EI+NY  VDAYR+GEFP+WFH  W+ + Q                     
Sbjct:   372 NSSRLIHSGSEIMNYATVDAYRIGEFPYWFHQLWTTSFQLLIALGILFHSVGVATFSALA 431

Query:   426 XXXXCGLLNVPFAKILQKCQSEFMIAQDERLRSTSEILNNMKIIKLQSWEEKFKSLIESR 485
                   L N P AK+  K QSE M +QDERL++ +E L NMK++KL +WE  FK +IE  
Sbjct:   432 VIILTVLCNAPIAKLQNKFQSELMTSQDERLKACNESLVNMKVLKLYAWESHFKKVIEKL 491

Query:   486 REKEFKWLSEAQLRKAYGTVIYWMSPTIISSVIFLGCALTGSAPLNASTIFTVLATLRSM 545
             R  E K L   Q+RKAY  V++W SP  +S+  F  C      PL AS +FT +ATLR +
Sbjct:   492 RNIELKSLKAVQMRKAYNAVLFWSSPVFVSAATFATCYFL-DIPLRASNVFTFVATLRLV 550

Query:   546 GEPVRMIPEALSIMIQVKVSFDRINAFLLDHELNNDDVRRISLQKSDRS-VKIQEGNFSW 604
              +PVRMIP+ + + IQ KV+F RI  FL   EL   + RR    + +++ + I+  +FSW
Sbjct:   551 QDPVRMIPDVIGVTIQAKVAFSRIATFLEAPELQGGERRRKQRSEGNQNAIIIKSASFSW 610

Query:   605 DPELAI-PTLRGVNLDIKWAQKIAVCGSVGAGKSSLLYAILGEIPKISGTVNLYGSIAYV 663
             + + +  P LR V+L++K+ +K+AVCG VG+GKS+LL AILGE P +SGT++ YG+IAYV
Sbjct:   611 EEKGSTKPNLRNVSLEVKFGEKVAVCGEVGSGKSTLLAAILGETPCVSGTIDFYGTIAYV 670

Query:   664 SQTSWIQSGSIRDNILYGKPMDKARYDKAIKACALDKDINNFDHGDLTEIGQRGLNLSGG 723
             SQT+WIQ+G+IRDNIL+G  MD+ RY + I+  +LDKD+     GD TEIG+RG+NLSGG
Sbjct:   671 SQTAWIQTGTIRDNILFGGVMDEHRYRETIQKSSLDKDLELLPDGDQTEIGERGVNLSGG 730

Query:   724 QKQRIQLARAVYNDADIYLFDDPFSAVDAHTAATLFNECVMAALEKKTVILVTHQVEFLS 783
             QKQRIQLARA+Y DADIYL DDPFSAVDAHTA++LF E VM AL  K V+LVTHQV+FL 
Sbjct:   731 QKQRIQLARALYQDADIYLLDDPFSAVDAHTASSLFQEYVMDALAGKAVLLVTHQVDFLP 790

Query:   784 EVDRILVLEGGQITQSGNYQELLLAGTAFEQLVNAHRDAITGLGPLDNAGQGGAEKVEKG 843
               D +L++  G+IT++  YQELL     F+ LVNAHR+              G+E+V   
Sbjct:   791 AFDSVLLMSDGEITEADTYQELLARSRDFQDLVNAHRET------------AGSERVVA- 837

Query:   844 RTARPEEPNGIYPRKESSEGEISVKGLTQLTEDEEMEIGDVGWKPFMDYLNVSKGMSLLC 903
                 P +P     R  SS+ ++ +K  ++L + EE E GD G +P++ Y+N +KG     
Sbjct:   838 -VENPTKPVKEINRVISSQSKV-LKP-SRLIKQEEREKGDTGLRPYIQYMNQNKGYIFFF 894

Query:   904 LGVLAQSGFVGLQAAATYWLAYAIQIPKITSGILIGVYAGVSTASAVFVYFRSFFAAHLG 963
             +  LAQ  F   Q     W+A  +  P++++  LI VY  +   S + +  RS     + 
Sbjct:   895 IASLAQVTFAVGQILQNSWMAANVDNPQVSTLKLILVYLLIGLCSVLCLMVRSVCVVIMC 954

Query:   964 LKASKAFFSGFTNSIFKAPMLFFDSTPVGRILTRLSSDLSILDFDIPFSIVFVAASGTEL 1023
             +K+S + FS   NS+F+APM F+DSTP+GRIL+R+SSDLSI+D D+PF ++FV AS    
Sbjct:   955 MKSSASLFSQLLNSLFRAPMSFYDSTPLGRILSRVSSDLSIVDLDVPFGLIFVVASSVNT 1014

Query:  1024 LAIIGIMTFVTWQVLVVAIFAMVAVRF-VQRYYIATARELIRINGTTKAPVMNYTAETSQ 1082
                +G++  VTWQVL V++  MV + F +Q+YY  TA+EL+RINGTT++ V N+ AE+  
Sbjct:  1015 GCSLGVLAIVTWQVLFVSV-PMVYLAFRLQKYYFQTAKELMRINGTTRSYVANHLAESVA 1073

Query:  1083 GVVTIRAFNMVDRFFQNYLKLVDIDASLFFHTNGVMEWLILRVEALQNXXXXXXXXXXVL 1142
             G +TIRAF+  +RFF+  L L+D +AS FFH+    EWLI R+E +            +L
Sbjct:  1074 GAITIRAFDEEERFFKKSLTLIDTNASPFFHSFAANEWLIQRLETVSAIVLASTAFCMIL 1133

Query:  1143 IPRGYVAPGLVGLSLSYAFTLTGTQVFLSRWYCYLANYIISVERIKQFMHIPPEPPAIVE 1202
             +P G  + G +G++LSY  +L    V+  +  CYLAN+IISVER+ Q+ H+ PE P ++E
Sbjct:  1134 LPTGTFSSGFIGMALSYGLSLNMGLVYSVQNQCYLANWIISVERLNQYTHLTPEAPEVIE 1193

Query:  1203 DKRPPSSWPFKGRIELRQLKVSLHME 1228
             + RPP +WP  GR+E+  L++    E
Sbjct:  1194 ETRPPVNWPVTGRVEISDLQIRYRRE 1219
GO:0000166 "nucleotide binding" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA
GO:0005886 "plasma membrane" evidence=ISM
GO:0006810 "transport" evidence=IEA
GO:0016021 "integral to membrane" evidence=IEA
GO:0016887 "ATPase activity" evidence=IEA
GO:0017111 "nucleoside-triphosphatase activity" evidence=IEA
GO:0042626 "ATPase activity, coupled to transmembrane movement of substances" evidence=IEA;ISS
GO:0055085 "transmembrane transport" evidence=IEA
GO:0005774 "vacuolar membrane" evidence=IDA
TAIR|locus:2020235 ABCC5 "ATP-binding cassette C5" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2090039 ABCC6 "ATP-binding cassette C6" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2090029 ABCC3 "ATP-binding cassette C3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2090049 ABCC7 "ATP-binding cassette C7" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2081755 ABCC14 "ATP-binding cassette C14" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2043268 ABCC4 "ATP-binding cassette C4" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0284867 abcC8 "ABC transporter C family protein" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
UNIPROTKB|E1C6S5 ABCC2 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
MGI|MGI:102676 Abcc1 "ATP-binding cassette, sub-family C (CFTR/MRP), member 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q8LGU1AB8C_ARATH3, ., 6, ., 3, ., 4, 40.62570.98530.8285yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.6.3LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00034196001
SubName- Full=Chromosome chr9 scaffold_7, whole genome shotgun sequence; (1456 aa)
(Vitis vinifera)
Predicted Functional Partners:
GSVIVG00002277001
SubName- Full=Chromosome undetermined scaffold_129, whole genome shotgun sequence; (129 aa)
      • 0.481
GSVIVG00002276001
SubName- Full=Chromosome undetermined scaffold_129, whole genome shotgun sequence; (81 aa)
      • 0.481

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1231
TIGR00957 1522 TIGR00957, MRP_assoc_pro, multi drug resistance-as 1e-170
PLN03130 1622 PLN03130, PLN03130, ABC transporter C family membe 1e-165
PLN03232 1495 PLN03232, PLN03232, ABC transporter C family membe 1e-149
cd03250204 cd03250, ABCC_MRP_domain1, ATP-binding cassette do 1e-107
PTZ00243 1560 PTZ00243, PTZ00243, ABC transporter; Provisional 8e-82
TIGR01271 1490 TIGR01271, CFTR_protein, cystic fibrosis transmemb 2e-76
COG1132567 COG1132, MdlB, ABC-type multidrug transport system 7e-66
cd03291282 cd03291, ABCC_CFTR1, ATP-binding cassette domain o 1e-57
cd03290218 cd03290, ABCC_SUR1_N, ATP-binding cassette domain 3e-53
COG2274709 COG2274, SunT, ABC-type bacteriocin/lantibiotic ex 3e-50
COG4988559 COG4988, CydD, ABC-type transport system involved 4e-43
cd03245220 cd03245, ABCC_bacteriocin_exporters, ATP-binding c 1e-41
COG4987573 COG4987, CydC, ABC-type transport system involved 6e-41
cd03254229 cd03254, ABCC_Glucan_exporter_like, ATP-binding ca 2e-40
cd03228171 cd03228, ABCC_MRP_Like, ATP-binding cassette domai 4e-40
PRK11174588 PRK11174, PRK11174, cysteine/glutathione ABC trans 8e-39
cd03251234 cd03251, ABCC_MsbA, ATP-binding cassette domain of 2e-38
cd03249238 cd03249, ABC_MTABC3_MDL1_MDL2, ATP-binding cassett 4e-38
cd03253236 cd03253, ABCC_ATM1_transporter, ATP-binding casset 1e-37
TIGR03375694 TIGR03375, type_I_sec_LssB, type I secretion syste 2e-37
TIGR01193708 TIGR01193, bacteriocin_ABC, ABC-type bacteriocin t 1e-36
TIGR02857529 TIGR02857, CydD, thiol reductant ABC exporter, Cyd 7e-36
PTZ00243 1560 PTZ00243, PTZ00243, ABC transporter; Provisional 5e-35
TIGR02203571 TIGR02203, MsbA_lipidA, lipid A export permease/AT 7e-34
PRK10789569 PRK10789, PRK10789, putative multidrug transporter 3e-32
cd03244221 cd03244, ABCC_MRP_domain2, ATP-binding cassette do 7e-32
TIGR01846694 TIGR01846, type_I_sec_HlyB, type I secretion syste 9e-32
TIGR02204576 TIGR02204, MsbA_rel, ABC transporter, permease/ATP 3e-31
TIGR03797686 TIGR03797, NHLM_micro_ABC2, NHLM bacteriocin syste 2e-29
cd03252237 cd03252, ABCC_Hemolysin, ATP-binding cassette doma 7e-29
TIGR01842544 TIGR01842, type_I_sec_PrtD, type I secretion syste 1e-28
COG4618580 COG4618, ArpD, ABC-type protease/lipase transport 2e-28
TIGR02868530 TIGR02868, CydC, thiol reductant ABC exporter, Cyd 4e-28
cd00267157 cd00267, ABC_ATPase, ATP-binding cassette transpor 6e-28
cd03235213 cd03235, ABC_Metallic_Cations, ATP-binding cassett 7e-28
cd03293220 cd03293, ABC_NrtD_SsuB_transporters, ATP-binding c 2e-27
cd03247178 cd03247, ABCC_cytochrome_bd, ATP-binding cassette 2e-27
COG1121254 COG1121, ZnuC, ABC-type Mn/Zn transport systems, A 3e-27
cd03248226 cd03248, ABCC_TAP, ATP-binding cassette domain of 8e-27
PRK11160574 PRK11160, PRK11160, cysteine/glutathione ABC trans 1e-26
PRK13657588 PRK13657, PRK13657, cyclic beta-1,2-glucan ABC tra 2e-26
cd03225211 cd03225, ABC_cobalt_CbiO_domain1, First domain of 2e-26
cd03246173 cd03246, ABCC_Protease_Secretion, ATP-binding cass 5e-26
COG1116248 COG1116, TauB, ABC-type nitrate/sulfonate/bicarbon 7e-26
cd03226205 cd03226, ABC_cobalt_CbiO_domain2, Second domain of 1e-25
TIGR00958711 TIGR00958, 3a01208, Conjugate Transporter-2 (CT2) 3e-25
COG1131293 COG1131, CcmA, ABC-type multidrug transport system 3e-25
COG1132 567 COG1132, MdlB, ABC-type multidrug transport system 2e-24
TIGR03796710 TIGR03796, NHLM_micro_ABC1, NHLM bacteriocin syste 2e-24
cd03259213 cd03259, ABC_Carb_Solutes_like, ATP-binding casset 5e-24
PRK11176582 PRK11176, PRK11176, lipid transporter ATP-binding/ 9e-24
cd03255218 cd03255, ABC_MJ0796_LolCDE_FtsE, ATP-binding casse 2e-23
cd03214180 cd03214, ABC_Iron-Siderophores_B12_Hemin, ATP-bind 2e-22
cd03260227 cd03260, ABC_PstB_phosphate_transporter, ATP-bindi 2e-22
COG3839338 COG3839, MalK, ABC-type sugar transport systems, A 4e-22
pfam00664274 pfam00664, ABC_membrane, ABC transporter transmemb 4e-22
cd03229178 cd03229, ABC_Class3, ATP-binding cassette domain o 5e-22
pfam00664274 pfam00664, ABC_membrane, ABC transporter transmemb 7e-22
COG1118345 COG1118, CysA, ABC-type sulfate/molybdate transpor 2e-21
TIGR01192585 TIGR01192, chvA, glucan exporter ATP-binding prote 2e-21
COG1122235 COG1122, CbiO, ABC-type cobalt transport system, A 2e-21
COG1136226 COG1136, SalX, ABC-type antimicrobial peptide tran 3e-21
TIGR01271 1490 TIGR01271, CFTR_protein, cystic fibrosis transmemb 4e-21
COG5265497 COG5265, ATM1, ABC-type transport system involved 5e-21
cd03299235 cd03299, ABC_ModC_like, ATP-binding cassette domai 6e-21
COG3842352 COG3842, PotA, ABC-type spermidine/putrescine tran 1e-20
cd03230173 cd03230, ABC_DR_subfamily_A, ATP-binding cassette 2e-20
COG1120258 COG1120, FepC, ABC-type cobalamin/Fe3+-siderophore 3e-20
COG1127263 COG1127, Ttg2A, ABC-type transport system involved 3e-20
COG1125309 COG1125, OpuBA, ABC-type proline/glycine betaine t 6e-20
cd03295242 cd03295, ABC_OpuCA_Osmoprotection, ATP-binding cas 1e-19
cd03262213 cd03262, ABC_HisP_GlnQ, ATP-binding cassette domai 1e-19
cd03301213 cd03301, ABC_MalK_N, The N-terminal ATPase domain 1e-19
cd03224222 cd03224, ABC_TM1139_LivF_branched, ATP-binding cas 2e-19
COG3638258 COG3638, COG3638, ABC-type phosphate/phosphonate t 2e-19
TIGR00968237 TIGR00968, 3a0106s01, sulfate ABC transporter, ATP 3e-19
COG1126240 COG1126, GlnQ, ABC-type polar amino acid transport 1e-18
COG0410237 COG0410, LivF, ABC-type branched-chain amino acid 1e-18
cd03369207 cd03369, ABCC_NFT1, ATP-binding cassette domain 2 1e-18
TIGR03265353 TIGR03265, PhnT2, putative 2-aminoethylphosphonate 2e-18
cd03257228 cd03257, ABC_NikE_OppD_transporters, ATP-binding c 3e-18
cd03258233 cd03258, ABC_MetN_methionine_transporter, ATP-bind 3e-18
cd03294269 cd03294, ABC_Pro_Gly_Betaine, ATP-binding cassette 5e-18
COG0488530 COG0488, Uup, ATPase components of ABC transporter 8e-18
cd03261235 cd03261, ABC_Org_Solvent_Resistant, ATP-binding ca 1e-17
PLN032321495 PLN03232, PLN03232, ABC transporter C family membe 3e-17
cd03296239 cd03296, ABC_CysA_sulfate_importer, ATP-binding ca 3e-17
cd03256241 cd03256, ABC_PhnC_transporter, ATP-binding cassett 3e-17
COG1123539 COG1123, COG1123, ATPase components of various ABC 4e-17
cd03220224 cd03220, ABC_KpsT_Wzt, ATP-binding cassette compon 5e-17
TIGR00972247 TIGR00972, 3a0107s01c2, phosphate ABC transporter, 6e-17
PRK10790592 PRK10790, PRK10790, putative multidrug transporter 6e-17
PRK14254285 PRK14254, PRK14254, phosphate ABC transporter ATP- 6e-17
COG4175386 COG4175, ProV, ABC-type proline/glycine betaine tr 7e-17
pfam00005119 pfam00005, ABC_tran, ABC transporter 1e-16
COG4525259 COG4525, TauB, ABC-type taurine transport system, 2e-16
cd03288257 cd03288, ABCC_SUR2, ATP-binding cassette domain 2 2e-16
TIGR01186363 TIGR01186, proV, glycine betaine/L-proline transpo 4e-16
TIGR02315243 TIGR02315, ABC_phnC, phosphonate ABC transporter, 4e-16
PRK11264250 PRK11264, PRK11264, putative amino-acid ABC transp 4e-16
TIGR03415382 TIGR03415, ABC_choXWV_ATP, choline ABC transporter 5e-16
COG1135339 COG1135, AbcC, ABC-type metal ion transport system 6e-16
cd03216163 cd03216, ABC_Carb_Monos_I, First domain of the ATP 6e-16
PRK09452375 PRK09452, potA, putrescine/spermidine ABC transpor 7e-16
COG4619223 COG4619, COG4619, ABC-type uncharacterized transpo 8e-16
cd03297214 cd03297, ABC_ModC_molybdenum_transporter, ATP-bind 1e-15
COG1134249 COG1134, TagH, ABC-type polysaccharide/polyol phos 1e-15
COG0488530 COG0488, Uup, ATPase components of ABC transporter 2e-15
TIGR01277213 TIGR01277, thiQ, thiamine ABC transporter, ATP-bin 3e-15
COG1129500 COG1129, MglA, ABC-type sugar transport system, AT 3e-15
TIGR01187325 TIGR01187, potA, spermidine/putrescine ABC transpo 3e-15
COG0444316 COG0444, DppD, ABC-type dipeptide/oligopeptide/nic 3e-15
COG1117253 COG1117, PstB, ABC-type phosphate transport system 4e-15
COG4555245 COG4555, NatA, ABC-type Na+ transport system, ATPa 4e-15
cd03300232 cd03300, ABC_PotA_N, ATP-binding cassette domain o 5e-15
cd03221144 cd03221, ABCF_EF-3, ATP-binding cassette domain of 5e-15
COG3840231 COG3840, ThiQ, ABC-type thiamine transport system, 6e-15
PRK14240250 PRK14240, PRK14240, phosphate transporter ATP-bind 6e-15
cd03289275 cd03289, ABCC_CFTR2, ATP-binding cassette domain 2 9e-15
COG1123539 COG1123, COG1123, ATPase components of various ABC 1e-14
PRK14236272 PRK14236, PRK14236, phosphate transporter ATP-bind 1e-14
cd03269210 cd03269, ABC_putative_ATPase, ATP-binding cassette 1e-14
cd03234226 cd03234, ABCG_White, White pigment protein homolog 1e-14
COG1119257 COG1119, ModF, ABC-type molybdenum transport syste 1e-14
TIGR03771223 TIGR03771, anch_rpt_ABC, anchored repeat-type ABC 2e-14
TIGR03258362 TIGR03258, PhnT, 2-aminoethylphosphonate ABC trans 2e-14
TIGR02211221 TIGR02211, LolD_lipo_ex, lipoprotein releasing sys 3e-14
TIGR03410230 TIGR03410, urea_trans_UrtE, urea ABC transporter, 3e-14
PRK09536402 PRK09536, btuD, corrinoid ABC transporter ATPase; 3e-14
cd03263220 cd03263, ABC_subfamily_A, ATP-binding cassette dom 3e-14
PLN031301622 PLN03130, PLN03130, ABC transporter C family membe 4e-14
cd03218232 cd03218, ABC_YhbG, ATP-binding cassette component 4e-14
PRK14274259 PRK14274, PRK14274, phosphate ABC transporter ATP- 4e-14
cd03215182 cd03215, ABC_Carb_Monos_II, Second domain of the A 5e-14
PRK14239252 PRK14239, PRK14239, phosphate transporter ATP-bind 6e-14
PRK15056272 PRK15056, PRK15056, manganese/iron transporter ATP 8e-14
PRK11231255 PRK11231, fecE, iron-dicitrate transporter ATP-bin 1e-13
COG1124252 COG1124, DppF, ABC-type dipeptide/oligopeptide/nic 1e-13
PRK10851353 PRK10851, PRK10851, sulfate/thiosulfate transporte 1e-13
COG4608268 COG4608, AppF, ABC-type oligopeptide transport sys 1e-13
PRK14255252 PRK14255, PRK14255, phosphate ABC transporter ATP- 2e-13
PRK14251251 PRK14251, PRK14251, phosphate ABC transporter ATP- 2e-13
COG4604252 COG4604, CeuD, ABC-type enterochelin transport sys 2e-13
TIGR01184230 TIGR01184, ntrCD, nitrate transport ATP-binding su 2e-13
PRK11000369 PRK11000, PRK11000, maltose/maltodextrin transport 3e-13
PRK14243264 PRK14243, PRK14243, phosphate transporter ATP-bind 3e-13
PRK11248255 PRK11248, tauB, taurine transporter ATP-binding su 3e-13
PRK14250241 PRK14250, PRK14250, phosphate ABC transporter ATP- 4e-13
PRK13632271 PRK13632, cbiO, cobalt transporter ATP-binding sub 1e-12
COG1137243 COG1137, YhbG, ABC-type (unclassified) transport s 1e-12
cd03264211 cd03264, ABC_drug_resistance_like, ABC-type multid 1e-12
PRK14244251 PRK14244, PRK14244, phosphate ABC transporter ATP- 1e-12
PRK14270251 PRK14270, PRK14270, phosphate ABC transporter ATP- 2e-12
TIGR03608206 TIGR03608, L_ocin_972_ABC, putative bacteriocin ex 2e-12
PRK09493240 PRK09493, glnQ, glutamine ABC transporter ATP-bind 2e-12
cd03298211 cd03298, ABC_ThiQ_thiamine_transporter, ATP-bindin 2e-12
COG4148352 COG4148, ModC, ABC-type molybdate transport system 3e-12
PRK14253249 PRK14253, PRK14253, phosphate ABC transporter ATP- 3e-12
PTZ002651466 PTZ00265, PTZ00265, multidrug resistance protein ( 3e-12
COG4161242 COG4161, ArtP, ABC-type arginine transport system, 4e-12
PRK11650356 PRK11650, ugpC, glycerol-3-phosphate transporter A 4e-12
PRK14273254 PRK14273, PRK14273, phosphate ABC transporter ATP- 4e-12
PRK14264305 PRK14264, PRK14264, phosphate ABC transporter ATP- 4e-12
COG4181228 COG4181, COG4181, Predicted ABC-type transport sys 6e-12
COG4178604 COG4178, COG4178, ABC-type uncharacterized transpo 7e-12
PRK11629233 PRK11629, lolD, lipoprotein transporter ATP-bindin 9e-12
COG3845501 COG3845, COG3845, ABC-type uncharacterized transpo 9e-12
COG1129500 COG1129, MglA, ABC-type sugar transport system, AT 1e-11
PRK14252265 PRK14252, PRK14252, phosphate ABC transporter ATP- 1e-11
COG1101263 COG1101, PhnK, ABC-type uncharacterized transport 1e-11
TIGR009571522 TIGR00957, MRP_assoc_pro, multi drug resistance-as 2e-11
TIGR012711490 TIGR01271, CFTR_protein, cystic fibrosis transmemb 2e-11
PRK14257329 PRK14257, PRK14257, phosphate ABC transporter ATP- 2e-11
PRK10619257 PRK10619, PRK10619, histidine/lysine/arginine/orni 2e-11
PRK14263261 PRK14263, PRK14263, phosphate ABC transporter ATP- 2e-11
COG4598256 COG4598, HisP, ABC-type histidine transport system 3e-11
cd03223166 cd03223, ABCD_peroxisomal_ALDP, ATP-binding casset 3e-11
PRK11247257 PRK11247, ssuB, aliphatic sulfonates transport ATP 3e-11
TIGR01188302 TIGR01188, drrA, daunorubicin resistance ABC trans 3e-11
PRK10070400 PRK10070, PRK10070, glycine betaine transporter AT 4e-11
PRK13536340 PRK13536, PRK13536, nodulation factor exporter sub 4e-11
COG4559259 COG4559, COG4559, ABC-type hemin transport system, 4e-11
PRK13644274 PRK13644, cbiO, cobalt transporter ATP-binding sub 4e-11
PRK14267253 PRK14267, PRK14267, phosphate ABC transporter ATP- 4e-11
PRK14249251 PRK14249, PRK14249, phosphate ABC transporter ATP- 4e-11
COG2274 709 COG2274, SunT, ABC-type bacteriocin/lantibiotic ex 6e-11
PRK13652277 PRK13652, cbiO, cobalt transporter ATP-binding sub 7e-11
PRK10535648 PRK10535, PRK10535, macrolide transporter ATP-bind 7e-11
PRK14258261 PRK14258, PRK14258, phosphate ABC transporter ATP- 7e-11
cd03213194 cd03213, ABCG_EPDR, Eye pigment and drug resistanc 8e-11
PRK14260259 PRK14260, PRK14260, phosphate ABC transporter ATP- 8e-11
PRK14266250 PRK14266, PRK14266, phosphate ABC transporter ATP- 9e-11
TIGR02982220 TIGR02982, heterocyst_DevA, ABC exporter ATP-bindi 1e-10
PRK09984262 PRK09984, PRK09984, phosphonate/organophosphate es 1e-10
PRK14259269 PRK14259, PRK14259, phosphate ABC transporter ATP- 1e-10
COG4152300 COG4152, COG4152, ABC-type uncharacterized transpo 1e-10
PRK13548258 PRK13548, hmuV, hemin importer ATP-binding subunit 1e-10
PRK11124242 PRK11124, artP, arginine transporter ATP-binding s 1e-10
COG2884223 COG2884, FtsE, Predicted ATPase involved in cell d 1e-10
TIGR03005252 TIGR03005, ectoine_ehuA, ectoine/hydroxyectoine AB 1e-10
PRK14247250 PRK14247, PRK14247, phosphate ABC transporter ATP- 1e-10
PRK13539207 PRK13539, PRK13539, cytochrome c biogenesis protei 2e-10
PRK14261253 PRK14261, PRK14261, phosphate ABC transporter ATP- 2e-10
PRK11144352 PRK11144, modC, molybdate transporter ATP-binding 2e-10
PRK14238271 PRK14238, PRK14238, phosphate transporter ATP-bind 2e-10
PRK10771232 PRK10771, thiQ, thiamine transporter ATP-binding s 3e-10
PRK14235267 PRK14235, PRK14235, phosphate transporter ATP-bind 3e-10
PRK13647274 PRK13647, cbiO, cobalt transporter ATP-binding sub 4e-10
PRK10744260 PRK10744, pstB, phosphate transporter ATP-binding 7e-10
TIGR02142354 TIGR02142, modC_ABC, molybdenum ABC transporter, A 7e-10
cd03292214 cd03292, ABC_FtsE_transporter, ATP-binding cassett 7e-10
PRK14242253 PRK14242, PRK14242, phosphate transporter ATP-bind 7e-10
TIGR03873256 TIGR03873, F420-0_ABC_ATP, proposed F420-0 ABC tra 9e-10
PRK14262250 PRK14262, PRK14262, phosphate ABC transporter ATP- 1e-09
COG0411250 COG0411, LivG, ABC-type branched-chain amino acid 1e-09
PRK14237267 PRK14237, PRK14237, phosphate transporter ATP-bind 1e-09
PRK14272252 PRK14272, PRK14272, phosphate ABC transporter ATP- 1e-09
PRK10584228 PRK10584, PRK10584, putative ABC transporter ATP-b 2e-09
PRK14265274 PRK14265, PRK14265, phosphate ABC transporter ATP- 2e-09
cd03219236 cd03219, ABC_Mj1267_LivG_branched, ATP-binding cas 2e-09
COG4172534 COG4172, COG4172, ABC-type uncharacterized transpo 2e-09
PRK13639275 PRK13639, cbiO, cobalt transporter ATP-binding sub 2e-09
PRK11153343 PRK11153, metN, DL-methionine transporter ATP-bind 2e-09
PRK09700510 PRK09700, PRK09700, D-allose transporter ATP-bindi 2e-09
PRK13635279 PRK13635, cbiO, cobalt transporter ATP-binding sub 2e-09
cd03268208 cd03268, ABC_BcrA_bacitracin_resist, ATP-binding c 2e-09
TIGR00954659 TIGR00954, 3a01203, Peroxysomal Fatty Acyl CoA Tra 3e-09
cd03217200 cd03217, ABC_FeS_Assembly, ABC-type transport syst 4e-09
TIGR01189198 TIGR01189, ccmA, heme ABC exporter, ATP-binding pr 4e-09
PRK14269246 PRK14269, PRK14269, phosphate ABC transporter ATP- 4e-09
TIGR00955617 TIGR00955, 3a01204, The Eye Pigment Precursor Tran 6e-09
COG0396251 COG0396, sufC, Cysteine desulfurase activator ATPa 6e-09
PRK14275286 PRK14275, PRK14275, phosphate ABC transporter ATP- 7e-09
cd03231201 cd03231, ABC_CcmA_heme_exporter, Cytochrome c biog 7e-09
COG4615546 COG4615, PvdE, ABC-type siderophore export system, 9e-09
TIGR03269520 TIGR03269, met_CoM_red_A2, methyl coenzyme M reduc 9e-09
PRK11432351 PRK11432, fbpC, ferric transporter ATP-binding sub 1e-08
TIGR01288303 TIGR01288, nodI, ATP-binding ABC transporter famil 1e-08
PRK13631320 PRK13631, cbiO, cobalt transporter ATP-binding sub 2e-08
cd03265220 cd03265, ABC_DrrA, Daunorubicin/doxorubicin resist 2e-08
PRK13637287 PRK13637, cbiO, cobalt transporter ATP-binding sub 2e-08
COG4133209 COG4133, CcmA, ABC-type transport system involved 2e-08
PTZ002431560 PTZ00243, PTZ00243, ABC transporter; Provisional 3e-08
PRK13642277 PRK13642, cbiO, cobalt transporter ATP-binding sub 3e-08
PRK13643288 PRK13643, cbiO, cobalt transporter ATP-binding sub 4e-08
PRK15079331 PRK15079, PRK15079, oligopeptide ABC transporter A 4e-08
TIGR02314343 TIGR02314, ABC_MetN, D-methionine ABC transporter, 5e-08
PRK14241258 PRK14241, PRK14241, phosphate transporter ATP-bind 5e-08
cd03266218 cd03266, ABC_NatA_sodium_exporter, ATP-binding cas 6e-08
TIGR02673214 TIGR02673, FtsE, cell division ATP-binding protein 7e-08
PRK14256252 PRK14256, PRK14256, phosphate ABC transporter ATP- 7e-08
PRK09700510 PRK09700, PRK09700, D-allose transporter ATP-bindi 8e-08
TIGR02769265 TIGR02769, nickel_nikE, nickel import ATP-binding 8e-08
PRK13641287 PRK13641, cbiO, cobalt transporter ATP-binding sub 8e-08
PRK15439510 PRK15439, PRK15439, autoinducer 2 ABC transporter 9e-08
COG3845501 COG3845, COG3845, ABC-type uncharacterized transpo 1e-07
PRK11831269 PRK11831, PRK11831, putative ABC transporter ATP-b 1e-07
cd03222177 cd03222, ABC_RNaseL_inhibitor, ATP-binding cassett 1e-07
cd03267236 cd03267, ABC_NatA_like, ATP-binding cassette domai 1e-07
COG1245591 COG1245, COG1245, Predicted ATPase, RNase L inhibi 1e-07
PRK13633280 PRK13633, PRK13633, cobalt transporter ATP-binding 1e-07
PRK14268258 PRK14268, PRK14268, phosphate ABC transporter ATP- 1e-07
PRK15064530 PRK15064, PRK15064, ABC transporter ATP-binding pr 2e-07
PRK13537306 PRK13537, PRK13537, nodulation ABC transporter Nod 2e-07
TIGR01166190 TIGR01166, cbiO, cobalt transport protein ATP-bind 2e-07
smart00382148 smart00382, AAA, ATPases associated with a variety 2e-07
PRK13651305 PRK13651, PRK13651, cobalt transporter ATP-binding 2e-07
TIGR02323253 TIGR02323, CP_lyasePhnK, phosphonate C-P lyase sys 2e-07
PRK13650279 PRK13650, cbiO, cobalt transporter ATP-binding sub 2e-07
COG4136213 COG4136, COG4136, ABC-type uncharacterized transpo 3e-07
TIGR02770230 TIGR02770, nickel_nikD, nickel import ATP-binding 3e-07
TIGR03522301 TIGR03522, GldA_ABC_ATP, gliding motility-associat 3e-07
COG4107258 COG4107, PhnK, ABC-type phosphonate transport syst 3e-07
PRK10908222 PRK10908, PRK10908, cell division protein FtsE; Pr 4e-07
COG4167267 COG4167, SapF, ABC-type antimicrobial peptide tran 5e-07
PLN03073718 PLN03073, PLN03073, ABC transporter F family; Prov 5e-07
PRK11607377 PRK11607, potG, putrescine transporter ATP-binding 5e-07
PRK14245250 PRK14245, PRK14245, phosphate ABC transporter ATP- 6e-07
PRK14271276 PRK14271, PRK14271, phosphate ABC transporter ATP- 6e-07
PRK13634290 PRK13634, cbiO, cobalt transporter ATP-binding sub 7e-07
COG4586325 COG4586, COG4586, ABC-type uncharacterized transpo 8e-07
PRK10247225 PRK10247, PRK10247, putative ABC transporter ATP-b 8e-07
TIGR01194555 TIGR01194, cyc_pep_trnsptr, cyclic peptide transpo 8e-07
PRK15112267 PRK15112, PRK15112, antimicrobial peptide ABC syst 9e-07
PLN03073718 PLN03073, PLN03073, ABC transporter F family; Prov 1e-06
PRK14248268 PRK14248, PRK14248, phosphate ABC transporter ATP- 1e-06
PRK13636283 PRK13636, cbiO, cobalt transporter ATP-binding sub 2e-06
cd03237246 cd03237, ABC_RNaseL_inhibitor_domain2, The ATP-bin 2e-06
TIGR01257 2272 TIGR01257, rim_protein, retinal-specific rim ABC t 2e-06
COG4172534 COG4172, COG4172, ABC-type uncharacterized transpo 3e-06
PRK10895241 PRK10895, PRK10895, lipopolysaccharide ABC transpo 3e-06
PRK14246257 PRK14246, PRK14246, phosphate ABC transporter ATP- 4e-06
TIGR01978243 TIGR01978, sufC, FeS assembly ATPase SufC 4e-06
PRK10762501 PRK10762, PRK10762, D-ribose transporter ATP bindi 5e-06
PRK13646286 PRK13646, cbiO, cobalt transporter ATP-binding sub 5e-06
PRK10982491 PRK10982, PRK10982, galactose/methyl galaxtoside t 5e-06
PRK13648269 PRK13648, cbiO, cobalt transporter ATP-binding sub 6e-06
TIGR03864236 TIGR03864, PQQ_ABC_ATP, ABC transporter, ATP-bindi 7e-06
PRK13538204 PRK13538, PRK13538, cytochrome c biogenesis protei 7e-06
COG4674249 COG4674, COG4674, Uncharacterized ABC-type transpo 9e-06
COG4138248 COG4138, BtuD, ABC-type cobalamin transport system 1e-05
COG1245591 COG1245, COG1245, Predicted ATPase, RNase L inhibi 2e-05
PRK10575265 PRK10575, PRK10575, iron-hydroxamate transporter A 2e-05
COG2401593 COG2401, COG2401, ABC-type ATPase fused to a predi 2e-05
TIGR03719552 TIGR03719, ABC_ABC_ChvD, ATP-binding cassette prot 2e-05
TIGR03411242 TIGR03411, urea_trans_UrtD, urea ABC transporter, 2e-05
PRK11022326 PRK11022, dppD, dipeptide transporter ATP-binding 2e-05
PTZ00265 1466 PTZ00265, PTZ00265, multidrug resistance protein ( 3e-05
PRK09544251 PRK09544, znuC, high-affinity zinc transporter ATP 3e-05
PRK13640282 PRK13640, cbiO, cobalt transporter ATP-binding sub 3e-05
cd03233202 cd03233, ABCG_PDR_domain1, First domain of the ple 4e-05
PRK13645289 PRK13645, cbiO, cobalt transporter ATP-binding sub 4e-05
cd03238176 cd03238, ABC_UvrA, ATP-binding cassette domain of 4e-05
PRK10522547 PRK10522, PRK10522, multidrug transporter membrane 5e-05
PRK13638271 PRK13638, cbiO, cobalt transporter ATP-binding sub 5e-05
cd03236255 cd03236, ABC_RNaseL_inhibitor_domain1, The ATP-bin 6e-05
PRK15093330 PRK15093, PRK15093, antimicrobial peptide ABC tran 6e-05
PRK10419268 PRK10419, nikE, nickel transporter ATP-binding pro 6e-05
PRK10636638 PRK10636, PRK10636, putative ABC transporter ATP-b 7e-05
COG4170330 COG4170, SapD, ABC-type antimicrobial peptide tran 8e-05
PRK10261623 PRK10261, PRK10261, glutathione transporter ATP-bi 8e-05
TIGR03269520 TIGR03269, met_CoM_red_A2, methyl coenzyme M reduc 1e-04
TIGR03719552 TIGR03719, ABC_ABC_ChvD, ATP-binding cassette prot 1e-04
PRK13409590 PRK13409, PRK13409, putative ATPase RIL; Provision 1e-04
PRK13409590 PRK13409, PRK13409, putative ATPase RIL; Provision 1e-04
PRK11288501 PRK11288, araG, L-arabinose transporter ATP-bindin 1e-04
PRK10790 592 PRK10790, PRK10790, putative multidrug transporter 2e-04
TIGR02633500 TIGR02633, xylG, D-xylose ABC transporter, ATP-bin 2e-04
TIGR02324224 TIGR02324, CP_lyasePhnL, phosphonate C-P lyase sys 2e-04
cd03227162 cd03227, ABC_Class2, ATP-binding cassette domain o 3e-04
PRK10418254 PRK10418, nikD, nickel transporter ATP-binding pro 3e-04
PRK11614237 PRK11614, livF, leucine/isoleucine/valine transpor 3e-04
PRK13547272 PRK13547, hmuV, hemin importer ATP-binding subunit 3e-04
PRK13549506 PRK13549, PRK13549, xylose transporter ATP-binding 4e-04
PRK11701258 PRK11701, phnK, phosphonate C-P lyase system prote 4e-04
TIGR02203 571 TIGR02203, MsbA_lipidA, lipid A export permease/AT 0.001
PRK11308327 PRK11308, dppF, dipeptide transporter ATP-binding 0.001
COG4778235 COG4778, PhnL, ABC-type phosphonate transport syst 0.001
PRK13540200 PRK13540, PRK13540, cytochrome c biogenesis protei 0.001
PRK13543214 PRK13543, PRK13543, cytochrome c biogenesis protei 0.001
PRK15064530 PRK15064, PRK15064, ABC transporter ATP-binding pr 0.002
PRK11288501 PRK11288, araG, L-arabinose transporter ATP-bindin 0.002
TIGR02633500 TIGR02633, xylG, D-xylose ABC transporter, ATP-bin 0.002
PLN03211659 PLN03211, PLN03211, ABC transporter G-25; Provisio 0.002
PRK11819556 PRK11819, PRK11819, putative ABC transporter ATP-b 0.002
PRK13649280 PRK13649, cbiO, cobalt transporter ATP-binding sub 0.002
TIGR01193 708 TIGR01193, bacteriocin_ABC, ABC-type bacteriocin t 0.003
PRK13546264 PRK13546, PRK13546, teichoic acids export protein 0.003
cd00882161 cd00882, Ras_like_GTPase, Rat sarcoma (Ras)-like s 0.003
>gnl|CDD|188098 TIGR00957, MRP_assoc_pro, multi drug resistance-associated protein (MRP) Back     alignment and domain information 
 Score =  545 bits (1405), Expect = e-170
 Identities = 361/1231 (29%), Positives = 597/1231 (48%), Gaps = 105/1231 (8%)

Query: 75   VVGIAYLGYCLWNLIAKNDSSMSWLVS-TVRGLIWVSLAISLLVKRSKWIR---MLITLW 130
            +V  A L Y  W        +  +LVS T+ G+  +     + ++R K ++   +++T W
Sbjct: 77   IVCWADLFYSFWERSHGRAPAPVFLVSPTLLGITMLLATFLIQLERRKGVQSSGIMLTFW 136

Query: 131  WMSF--------SLLVLALNIEILARTYTINVVYILPLPVNLLLLFSAFRNFSHFTSPNR 182
             ++         S ++LAL  + +   +     YI    V   L+ S F + S   S   
Sbjct: 137  LVALVCALAILRSKILLALKEDAIVDPFRDTTFYIYFALVLSQLVLSCFSDKSPLFSETN 196

Query: 183  EDKSLSEPLLAEKNQTELGKAGLLRKLTFSWINPLLSLGYSKPLALEDIPSLVPEDEASF 242
             D           N      A  L ++TF WI  +   GY +PL   D+ SL  ED +  
Sbjct: 197  HDP----------NPCPESSASFLSRITFWWITGMAVYGYRQPLEESDLWSLNKEDTSEM 246

Query: 243  AYQKFAYAW-------------------DSLVRENNSNNNGN------LVR--------- 268
                    W                   D    + +S  + N      +V+         
Sbjct: 247  VVPVLVENWKKECKKTRKQPVSAVYGKKDPSKPKGSSQLDANEEVEALIVKSPHKPRKPS 306

Query: 269  --KVITNVYLKENIFIAICALLRTIAVVVGPLLLYAFVNYSNRGEENLQEGLSIVGCLII 326
              KV+   +    +       +  + + +GP +L   + + N       +G    G L +
Sbjct: 307  LFKVLYKTFGPYFLMSFCFKAIHDLMMFIGPQILSLLIRFVNDPMAPDWQGYFYTGLLFV 366

Query: 327  TKVVESFTQRHCFFGSRRSGMRMRSALMVAVYQKQLKLSSLGRKKHSTGEIVNYIAVDAY 386
               +++      F     SGMR+++A+M AVY+K L +++  RK  + GEIVN ++VDA 
Sbjct: 367  CACLQTLILHQYFHICFVSGMRIKTAVMGAVYRKALVITNSARKSSTVGEIVNLMSVDAQ 426

Query: 387  RMGEFPFWFHLTWSLALQLFLAIGVLFGVVGLGALPGLVLFLICGLLNVPFAKILQKCQS 446
            R  +   + ++ WS  LQ+ LA+  L+  +G   L G+ + ++   LN   A   +  Q 
Sbjct: 427  RFMDLATYINMIWSAPLQVILALYFLWLNLGPSVLAGVAVMVLMVPLNAVMAMKTKTYQV 486

Query: 447  EFMIAQDERLRSTSEILNNMKIIKLQSWEEKFKSLIESRREKEFKWLSEAQLRKAYGTVI 506
              M ++D R++  +EILN +K++KL +WE  F   +E  R++E K L ++    A GT  
Sbjct: 487  AHMKSKDNRIKLMNEILNGIKVLKLYAWELAFLDKVEGIRQEELKVLKKSAYLHAVGTFT 546

Query: 507  YWMSPTIISSVIF-LGCALTGSAPLNASTIFTVLATLRSMGEPVRMIPEALSIMIQVKVS 565
            +  +P +++ + F +   +  +  L+A   F  LA    +  P+ ++P  +S ++Q  VS
Sbjct: 547  WVCTPFLVALITFAVYVTVDENNILDAEKAFVSLALFNILRFPLNILPMVISSIVQASVS 606

Query: 566  FDRINAFLLDHELNNDDVRRISLQKSD-RSVKIQEGNFSWDPELAIPTLRGVNLDIKWAQ 624
              R+  FL   EL  D + R +++  +  S+ +    F+W  +L  PTL G+   I    
Sbjct: 607  LKRLRIFLSHEELEPDSIERRTIKPGEGNSITVHNATFTWARDLP-PTLNGITFSIPEGA 665

Query: 625  KIAVCGSVGAGKSSLLYAILGEIPKISGTVNLYGSIAYVSQTSWIQSGSIRDNILYGKPM 684
             +AV G VG GKSSLL A+L E+ K+ G V++ GS+AYV Q +WIQ+ S+R+NIL+GK +
Sbjct: 666  LVAVVGQVGCGKSSLLSALLAEMDKVEGHVHMKGSVAYVPQQAWIQNDSLRENILFGKAL 725

Query: 685  DKARYDKAIKACALDKDINNFDHGDLTEIGQRGLNLSGGQKQRIQLARAVYNDADIYLFD 744
            ++  Y + ++ACAL  D+     GD TEIG++G+NLSGGQKQR+ LARAVY++ADIYLFD
Sbjct: 726  NEKYYQQVLEACALLPDLEILPSGDRTEIGEKGVNLSGGQKQRVSLARAVYSNADIYLFD 785

Query: 745  DPFSAVDAHTAATLFNECV--MAALEKKTVILVTHQVEFLSEVDRILVLEGGQITQSGNY 802
            DP SAVDAH    +F   +     L+ KT ILVTH + +L +VD I+V+ GG+I++ G+Y
Sbjct: 786  DPLSAVDAHVGKHIFEHVIGPEGVLKNKTRILVTHGISYLPQVDVIIVMSGGKISEMGSY 845

Query: 803  QELLLAGTAFEQLVNAHRDAITGLGPLDN--AGQGGAEK----VEKG------------- 843
            QELL    AF + +  +          D+  A   G  K    +E G             
Sbjct: 846  QELLQRDGAFAEFLRTYAPDEQQGHLEDSWTALVSGEGKEAKLIENGMLVTDVVGKQLQR 905

Query: 844  RTARPEEPNGIYPRKESSEGEISVKGLTQ----LTEDEEMEIGDVGWKPFMDYLNVSKGM 899
            + +     +G   R   S  E+      +    L E ++ + G V    + DY+      
Sbjct: 906  QLSASSSDSGDQSRHHGSSAELQKAEAKEETWKLMEADKAQTGQVELSVYWDYMKAIG-- 963

Query: 900  SLLCLGVLAQSGFVGLQAAA---TYWLAYAIQIPKITS-----GILIGVYA--GVSTASA 949
              L +  L+   FV    +A    YWL+     P +        + + VY   G+    A
Sbjct: 964  --LFITFLSIFLFVCNHVSALASNYWLSLWTDDPMVNGTQNNTSLRLSVYGALGILQGFA 1021

Query: 950  VFVYFRSFFAAHLGLKASKAFFSGFTNSIFKAPMLFFDSTPVGRILTRLSSDLSILDFDI 1009
            VF Y  S   +  G++AS+       ++  ++PM FF+ TP G ++ R S +L  +D  I
Sbjct: 1022 VFGY--SMAVSIGGIQASRVLHQDLLHNKLRSPMSFFERTPSGNLVNRFSKELDTVDSMI 1079

Query: 1010 PFSI-VFVAASGTELLAIIGIMTFVTWQVLVVAIFAMVAVRFVQRYYIATARELIRINGT 1068
            P  I +F+ +    + A+I I+       +++    ++   FVQR+Y+A++R+L R+   
Sbjct: 1080 PPVIKMFMGSLFNVIGALIVILLATPIAAVIIPPLGLLYF-FVQRFYVASSRQLKRLESV 1138

Query: 1069 TKAPVMNYTAETSQGVVTIRAFNMVDRFFQNYLKLVDIDASLFFHTNGVMEWLILRVEAL 1128
            +++PV ++  ET  GV  IRAF   +RF       VD +   ++ +     WL +R+E +
Sbjct: 1139 SRSPVYSHFNETLLGVSVIRAFEEQERFIHQSDLKVDENQKAYYPSIVANRWLAVRLECV 1198

Query: 1129 QNLTLFTAALFLVLIPRGYVAPGLVGLSLSYAFTLTGTQVFLSRWYCYLANYIISVERIK 1188
             N  +  AALF V I R  ++ GLVGLS+SY+  +T    +L R    +   I++VER+K
Sbjct: 1199 GNCIVLFAALFAV-ISRHSLSAGLVGLSVSYSLQVTFYLNWLVRMSSEMETNIVAVERLK 1257

Query: 1189 QFMHIPPEPPAIVEDKRPPSSWPFKGRIELR 1219
            ++     E P  +++  PPS WP +GR+E R
Sbjct: 1258 EYSETEKEAPWQIQETAPPSGWPPRGRVEFR 1288

This model describes multi drug resistance-associated protein (MRP) in eukaryotes. The multidrug resistance-associated protein is an integral membrane protein that causes multidrug resistance when overexpressed in mammalian cells. It belongs to ABC transporter superfamily. The protein topology and function was experimentally demonstrated by epitope tagging and immunofluorescence. Insertion of tags in the critical regions associated with drug efflux, abrogated its function. The C-terminal domain seem to highly conserved [Transport and binding proteins, Other]. Length = 1522
>gnl|CDD|215595 PLN03130, PLN03130, ABC transporter C family member; Provisional Back     alignment and domain information
>gnl|CDD|215640 PLN03232, PLN03232, ABC transporter C family member; Provisional Back     alignment and domain information
>gnl|CDD|213217 cd03250, ABCC_MRP_domain1, ATP-binding cassette domain 1 of multidrug resistance-associated protein, subfamily C Back     alignment and domain information
>gnl|CDD|240327 PTZ00243, PTZ00243, ABC transporter; Provisional Back     alignment and domain information
>gnl|CDD|233335 TIGR01271, CFTR_protein, cystic fibrosis transmembrane conductor regulator (CFTR) Back     alignment and domain information
>gnl|CDD|224055 COG1132, MdlB, ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|213258 cd03291, ABCC_CFTR1, ATP-binding cassette domain of the cystic fibrosis transmembrane regulator, subfamily C Back     alignment and domain information
>gnl|CDD|213257 cd03290, ABCC_SUR1_N, ATP-binding cassette domain of the sulfonylurea receptor, subfamily C Back     alignment and domain information
>gnl|CDD|225183 COG2274, SunT, ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|227321 COG4988, CydD, ABC-type transport system involved in cytochrome bd biosynthesis, ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|213212 cd03245, ABCC_bacteriocin_exporters, ATP-binding cassette domain of bacteriocin exporters, subfamily C Back     alignment and domain information
>gnl|CDD|227320 COG4987, CydC, ABC-type transport system involved in cytochrome bd biosynthesis, fused ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|213221 cd03254, ABCC_Glucan_exporter_like, ATP-binding cassette domain of glucan transporter and related proteins, subfamily C Back     alignment and domain information
>gnl|CDD|213195 cd03228, ABCC_MRP_Like, ATP-binding cassette domain of multidrug resistance protein-like transporters Back     alignment and domain information
>gnl|CDD|236870 PRK11174, PRK11174, cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed Back     alignment and domain information
>gnl|CDD|213218 cd03251, ABCC_MsbA, ATP-binding cassette domain of the bacterial lipid flippase and related proteins, subfamily C Back     alignment and domain information
>gnl|CDD|213216 cd03249, ABC_MTABC3_MDL1_MDL2, ATP-binding cassette domain of a mitochondrial protein MTABC3 and related proteins Back     alignment and domain information
>gnl|CDD|213220 cd03253, ABCC_ATM1_transporter, ATP-binding cassette domain of iron-sulfur clusters transporter, subfamily C Back     alignment and domain information
>gnl|CDD|234189 TIGR03375, type_I_sec_LssB, type I secretion system ATPase, LssB family Back     alignment and domain information
>gnl|CDD|130261 TIGR01193, bacteriocin_ABC, ABC-type bacteriocin transporter Back     alignment and domain information
>gnl|CDD|234033 TIGR02857, CydD, thiol reductant ABC exporter, CydD subunit Back     alignment and domain information
>gnl|CDD|240327 PTZ00243, PTZ00243, ABC transporter; Provisional Back     alignment and domain information
>gnl|CDD|131258 TIGR02203, MsbA_lipidA, lipid A export permease/ATP-binding protein MsbA Back     alignment and domain information
>gnl|CDD|182732 PRK10789, PRK10789, putative multidrug transporter membrane\ATP-binding components; Provisional Back     alignment and domain information
>gnl|CDD|213211 cd03244, ABCC_MRP_domain2, ATP-binding cassette domain 2 of multidrug resistance-associated protein Back     alignment and domain information
>gnl|CDD|233596 TIGR01846, type_I_sec_HlyB, type I secretion system ABC transporter, HlyB family Back     alignment and domain information
>gnl|CDD|131259 TIGR02204, MsbA_rel, ABC transporter, permease/ATP-binding protein Back     alignment and domain information
>gnl|CDD|234357 TIGR03797, NHLM_micro_ABC2, NHLM bacteriocin system ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|213219 cd03252, ABCC_Hemolysin, ATP-binding cassette domain of hemolysin B, subfamily C Back     alignment and domain information
>gnl|CDD|200134 TIGR01842, type_I_sec_PrtD, type I secretion system ABC transporter, PrtD family Back     alignment and domain information
>gnl|CDD|226969 COG4618, ArpD, ABC-type protease/lipase transport system, ATPase and permease components [General function prediction only] Back     alignment and domain information
>gnl|CDD|234041 TIGR02868, CydC, thiol reductant ABC exporter, CydC subunit Back     alignment and domain information
>gnl|CDD|213179 cd00267, ABC_ATPase, ATP-binding cassette transporter nucleotide-binding domain Back     alignment and domain information
>gnl|CDD|213202 cd03235, ABC_Metallic_Cations, ATP-binding cassette domain of the metal-type transporters Back     alignment and domain information
>gnl|CDD|213260 cd03293, ABC_NrtD_SsuB_transporters, ATP-binding cassette domain of the nitrate and sulfonate transporters Back     alignment and domain information
>gnl|CDD|213214 cd03247, ABCC_cytochrome_bd, ATP-binding cassette domain of CydCD, subfamily C Back     alignment and domain information
>gnl|CDD|224046 COG1121, ZnuC, ABC-type Mn/Zn transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|213215 cd03248, ABCC_TAP, ATP-binding cassette domain of the Transporter Associated with Antigen Processing, subfamily C Back     alignment and domain information
>gnl|CDD|236865 PRK11160, PRK11160, cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed Back     alignment and domain information
>gnl|CDD|184214 PRK13657, PRK13657, cyclic beta-1,2-glucan ABC transporter; Provisional Back     alignment and domain information
>gnl|CDD|213192 cd03225, ABC_cobalt_CbiO_domain1, First domain of the ATP-binding cassette component of cobalt transport system Back     alignment and domain information
>gnl|CDD|213213 cd03246, ABCC_Protease_Secretion, ATP-binding cassette domain of PrtD, subfamily C Back     alignment and domain information
>gnl|CDD|224041 COG1116, TauB, ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|213193 cd03226, ABC_cobalt_CbiO_domain2, Second domain of the ATP-binding cassette component of cobalt transport system Back     alignment and domain information
>gnl|CDD|233209 TIGR00958, 3a01208, Conjugate Transporter-2 (CT2) Family protein Back     alignment and domain information
>gnl|CDD|224054 COG1131, CcmA, ABC-type multidrug transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|224055 COG1132, MdlB, ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|163508 TIGR03796, NHLM_micro_ABC1, NHLM bacteriocin system ABC transporter, peptidase/ATP-binding protein Back     alignment and domain information
>gnl|CDD|213226 cd03259, ABC_Carb_Solutes_like, ATP-binding cassette domain of the carbohydrate and solute transporters-like Back     alignment and domain information
>gnl|CDD|183016 PRK11176, PRK11176, lipid transporter ATP-binding/permease protein; Provisional Back     alignment and domain information
>gnl|CDD|213222 cd03255, ABC_MJ0796_LolCDE_FtsE, ATP-binding cassette domain of the transporters involved in export of lipoprotein and macrolide, and cell division protein Back     alignment and domain information
>gnl|CDD|213181 cd03214, ABC_Iron-Siderophores_B12_Hemin, ATP-binding component of iron-siderophores, vitamin B12 and hemin transporters and related proteins Back     alignment and domain information
>gnl|CDD|213227 cd03260, ABC_PstB_phosphate_transporter, ATP-binding cassette domain of the phosphate transport system Back     alignment and domain information
>gnl|CDD|226359 COG3839, MalK, ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|216049 pfam00664, ABC_membrane, ABC transporter transmembrane region Back     alignment and domain information
>gnl|CDD|213196 cd03229, ABC_Class3, ATP-binding cassette domain of the binding protein-dependent transport systems Back     alignment and domain information
>gnl|CDD|216049 pfam00664, ABC_membrane, ABC transporter transmembrane region Back     alignment and domain information
>gnl|CDD|224043 COG1118, CysA, ABC-type sulfate/molybdate transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|130260 TIGR01192, chvA, glucan exporter ATP-binding protein Back     alignment and domain information
>gnl|CDD|224047 COG1122, CbiO, ABC-type cobalt transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|224059 COG1136, SalX, ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|233335 TIGR01271, CFTR_protein, cystic fibrosis transmembrane conductor regulator (CFTR) Back     alignment and domain information
>gnl|CDD|227590 COG5265, ATM1, ABC-type transport system involved in Fe-S cluster assembly, permease and ATPase components [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|213266 cd03299, ABC_ModC_like, ATP-binding cassette domain similar to the molybdate transporter Back     alignment and domain information
>gnl|CDD|226361 COG3842, PotA, ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|213197 cd03230, ABC_DR_subfamily_A, ATP-binding cassette domain of the drug resistance transporter and related proteins, subfamily A Back     alignment and domain information
>gnl|CDD|224045 COG1120, FepC, ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|224052 COG1127, Ttg2A, ABC-type transport system involved in resistance to organic solvents, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>gnl|CDD|224050 COG1125, OpuBA, ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|213262 cd03295, ABC_OpuCA_Osmoprotection, ATP-binding cassette domain of the osmoprotectant transporter Back     alignment and domain information
>gnl|CDD|213229 cd03262, ABC_HisP_GlnQ, ATP-binding cassette domain of the histidine and glutamine transporters Back     alignment and domain information
>gnl|CDD|213268 cd03301, ABC_MalK_N, The N-terminal ATPase domain of the maltose transporter, MalK Back     alignment and domain information
>gnl|CDD|213191 cd03224, ABC_TM1139_LivF_branched, ATP-binding cassette domain of branched-chain amino acid transporter Back     alignment and domain information
>gnl|CDD|226164 COG3638, COG3638, ABC-type phosphate/phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|130041 TIGR00968, 3a0106s01, sulfate ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|224051 COG1126, GlnQ, ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|223487 COG0410, LivF, ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|213269 cd03369, ABCC_NFT1, ATP-binding cassette domain 2 of NFT1, subfamily C Back     alignment and domain information
>gnl|CDD|234152 TIGR03265, PhnT2, putative 2-aminoethylphosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|213224 cd03257, ABC_NikE_OppD_transporters, ATP-binding cassette domain of nickel/oligopeptides specific transporters Back     alignment and domain information
>gnl|CDD|213225 cd03258, ABC_MetN_methionine_transporter, ATP-binding cassette domain of methionine transporter Back     alignment and domain information
>gnl|CDD|213261 cd03294, ABC_Pro_Gly_Betaine, ATP-binding cassette domain of the osmoprotectant proline/glycine betaine uptake system Back     alignment and domain information
>gnl|CDD|223562 COG0488, Uup, ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] Back     alignment and domain information
>gnl|CDD|213228 cd03261, ABC_Org_Solvent_Resistant, ATP-binding cassette transport system involved in resistant to organic solvents Back     alignment and domain information
>gnl|CDD|215640 PLN03232, PLN03232, ABC transporter C family member; Provisional Back     alignment and domain information
>gnl|CDD|213263 cd03296, ABC_CysA_sulfate_importer, ATP-binding cassette domain of the sulfate transporter Back     alignment and domain information
>gnl|CDD|213223 cd03256, ABC_PhnC_transporter, ATP-binding cassette domain of the binding protein-dependent phosphonate transport system Back     alignment and domain information
>gnl|CDD|224048 COG1123, COG1123, ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] Back     alignment and domain information
>gnl|CDD|213187 cd03220, ABC_KpsT_Wzt, ATP-binding cassette component of polysaccharide transport system Back     alignment and domain information
>gnl|CDD|188099 TIGR00972, 3a0107s01c2, phosphate ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|182733 PRK10790, PRK10790, putative multidrug transporter membrane\ATP-binding components; Provisional Back     alignment and domain information
>gnl|CDD|237649 PRK14254, PRK14254, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|226643 COG4175, ProV, ABC-type proline/glycine betaine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|215650 pfam00005, ABC_tran, ABC transporter Back     alignment and domain information
>gnl|CDD|226905 COG4525, TauB, ABC-type taurine transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|213255 cd03288, ABCC_SUR2, ATP-binding cassette domain 2 of the sulfonylurea receptor SUR Back     alignment and domain information
>gnl|CDD|130254 TIGR01186, proV, glycine betaine/L-proline transport ATP binding subunit Back     alignment and domain information
>gnl|CDD|131368 TIGR02315, ABC_phnC, phosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|183063 PRK11264, PRK11264, putative amino-acid ABC transporter ATP-binding protein YecC; Provisional Back     alignment and domain information
>gnl|CDD|188317 TIGR03415, ABC_choXWV_ATP, choline ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|224058 COG1135, AbcC, ABC-type metal ion transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|213183 cd03216, ABC_Carb_Monos_I, First domain of the ATP-binding cassette component of monosaccharide transport system Back     alignment and domain information
>gnl|CDD|236523 PRK09452, potA, putrescine/spermidine ABC transporter ATPase protein; Reviewed Back     alignment and domain information
>gnl|CDD|226970 COG4619, COG4619, ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|213264 cd03297, ABC_ModC_molybdenum_transporter, ATP-binding cassette domain of the molybdenum transport system Back     alignment and domain information
>gnl|CDD|224057 COG1134, TagH, ABC-type polysaccharide/polyol phosphate transport system, ATPase component [Carbohydrate transport and metabolism / Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|223562 COG0488, Uup, ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] Back     alignment and domain information
>gnl|CDD|130344 TIGR01277, thiQ, thiamine ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|224053 COG1129, MglA, ABC-type sugar transport system, ATPase component [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|162242 TIGR01187, potA, spermidine/putrescine ABC transporter ATP-binding subunit Back     alignment and domain information
>gnl|CDD|223521 COG0444, DppD, ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|224042 COG1117, PstB, ABC-type phosphate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|226927 COG4555, NatA, ABC-type Na+ transport system, ATPase component [Energy production and conversion / Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|213267 cd03300, ABC_PotA_N, ATP-binding cassette domain of the polyamine transporter Back     alignment and domain information
>gnl|CDD|213188 cd03221, ABCF_EF-3, ATP-binding cassette domain of elongation factor 3, subfamily F Back     alignment and domain information
>gnl|CDD|226360 COG3840, ThiQ, ABC-type thiamine transport system, ATPase component [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|184586 PRK14240, PRK14240, phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|213256 cd03289, ABCC_CFTR2, ATP-binding cassette domain 2 of CFTR,subfamily C Back     alignment and domain information
>gnl|CDD|224048 COG1123, COG1123, ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] Back     alignment and domain information
>gnl|CDD|184582 PRK14236, PRK14236, phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|213236 cd03269, ABC_putative_ATPase, ATP-binding cassette domain of an uncharacterized transporter Back     alignment and domain information
>gnl|CDD|213201 cd03234, ABCG_White, White pigment protein homolog of ABCG transporter subfamily Back     alignment and domain information
>gnl|CDD|224044 COG1119, ModF, ABC-type molybdenum transport system, ATPase component/photorepair protein PhrA [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|163483 TIGR03771, anch_rpt_ABC, anchored repeat-type ABC transporter, ATP-binding subunit Back     alignment and domain information
>gnl|CDD|132302 TIGR03258, PhnT, 2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT Back     alignment and domain information
>gnl|CDD|131266 TIGR02211, LolD_lipo_ex, lipoprotein releasing system, ATP-binding protein Back     alignment and domain information
>gnl|CDD|234199 TIGR03410, urea_trans_UrtE, urea ABC transporter, ATP-binding protein UrtE Back     alignment and domain information
>gnl|CDD|236554 PRK09536, btuD, corrinoid ABC transporter ATPase; Reviewed Back     alignment and domain information
>gnl|CDD|213230 cd03263, ABC_subfamily_A, ATP-binding cassette domain of the lipid transporters, subfamily A Back     alignment and domain information
>gnl|CDD|215595 PLN03130, PLN03130, ABC transporter C family member; Provisional Back     alignment and domain information
>gnl|CDD|213185 cd03218, ABC_YhbG, ATP-binding cassette component of YhbG transport system Back     alignment and domain information
>gnl|CDD|172762 PRK14274, PRK14274, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|213182 cd03215, ABC_Carb_Monos_II, Second domain of the ATP-binding cassette component of monosaccharide transport system Back     alignment and domain information
>gnl|CDD|184585 PRK14239, PRK14239, phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|185016 PRK15056, PRK15056, manganese/iron transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|183044 PRK11231, fecE, iron-dicitrate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|224049 COG1124, DppF, ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|182778 PRK10851, PRK10851, sulfate/thiosulfate transporter subunit; Provisional Back     alignment and domain information
>gnl|CDD|226967 COG4608, AppF, ABC-type oligopeptide transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|172743 PRK14255, PRK14255, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|172739 PRK14251, PRK14251, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|226963 COG4604, CeuD, ABC-type enterochelin transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|130252 TIGR01184, ntrCD, nitrate transport ATP-binding subunits C and D Back     alignment and domain information
>gnl|CDD|182893 PRK11000, PRK11000, maltose/maltodextrin transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|184588 PRK14243, PRK14243, phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|183056 PRK11248, tauB, taurine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|237648 PRK14250, PRK14250, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|237452 PRK13632, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|224060 COG1137, YhbG, ABC-type (unclassified) transport system, ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|213231 cd03264, ABC_drug_resistance_like, ABC-type multidrug transport system, ATPase component Back     alignment and domain information
>gnl|CDD|172732 PRK14244, PRK14244, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|184597 PRK14270, PRK14270, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|188353 TIGR03608, L_ocin_972_ABC, putative bacteriocin export ABC transporter, lactococcin 972 group Back     alignment and domain information
>gnl|CDD|181906 PRK09493, glnQ, glutamine ABC transporter ATP-binding protein; Reviewed Back     alignment and domain information
>gnl|CDD|213265 cd03298, ABC_ThiQ_thiamine_transporter, ATP-binding cassette domain of the thiamine transport system Back     alignment and domain information
>gnl|CDD|226628 COG4148, ModC, ABC-type molybdate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|172741 PRK14253, PRK14253, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|240339 PTZ00265, PTZ00265, multidrug resistance protein (mdr1); Provisional Back     alignment and domain information
>gnl|CDD|226635 COG4161, ArtP, ABC-type arginine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|236947 PRK11650, ugpC, glycerol-3-phosphate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|172761 PRK14273, PRK14273, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|184594 PRK14264, PRK14264, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|226647 COG4181, COG4181, Predicted ABC-type transport system involved in lysophospholipase L1 biosynthesis, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>gnl|CDD|226646 COG4178, COG4178, ABC-type uncharacterized transport system, permease and ATPase components [General function prediction only] Back     alignment and domain information
>gnl|CDD|183244 PRK11629, lolD, lipoprotein transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|226364 COG3845, COG3845, ABC-type uncharacterized transport systems, ATPase components [General function prediction only] Back     alignment and domain information
>gnl|CDD|224053 COG1129, MglA, ABC-type sugar transport system, ATPase component [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|172740 PRK14252, PRK14252, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|224026 COG1101, PhnK, ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|188098 TIGR00957, MRP_assoc_pro, multi drug resistance-associated protein (MRP) Back     alignment and domain information
>gnl|CDD|233335 TIGR01271, CFTR_protein, cystic fibrosis transmembrane conductor regulator (CFTR) Back     alignment and domain information
>gnl|CDD|172745 PRK14257, PRK14257, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|182592 PRK10619, PRK10619, histidine/lysine/arginine/ornithine transporter subunit; Provisional Back     alignment and domain information
>gnl|CDD|172751 PRK14263, PRK14263, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|226961 COG4598, HisP, ABC-type histidine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|213190 cd03223, ABCD_peroxisomal_ALDP, ATP-binding cassette domain of peroxisomal transporter, subfamily D Back     alignment and domain information
>gnl|CDD|183055 PRK11247, ssuB, aliphatic sulfonates transport ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|130256 TIGR01188, drrA, daunorubicin resistance ABC transporter ATP-binding subunit Back     alignment and domain information
>gnl|CDD|182221 PRK10070, PRK10070, glycine betaine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|237419 PRK13536, PRK13536, nodulation factor exporter subunit NodI; Provisional Back     alignment and domain information
>gnl|CDD|226929 COG4559, COG4559, ABC-type hemin transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|106587 PRK13644, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|184596 PRK14267, PRK14267, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|184590 PRK14249, PRK14249, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|225183 COG2274, SunT, ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|172200 PRK13652, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|182528 PRK10535, PRK10535, macrolide transporter ATP-binding /permease protein; Provisional Back     alignment and domain information
>gnl|CDD|184593 PRK14258, PRK14258, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|213180 cd03213, ABCG_EPDR, Eye pigment and drug resistance transporter subfamily G of the ATP-binding cassette superfamily Back     alignment and domain information
>gnl|CDD|172748 PRK14260, PRK14260, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|237651 PRK14266, PRK14266, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|132027 TIGR02982, heterocyst_DevA, ABC exporter ATP-binding subunit, DevA family Back     alignment and domain information
>gnl|CDD|182182 PRK09984, PRK09984, phosphonate/organophosphate ester transporter subunit; Provisional Back     alignment and domain information
>gnl|CDD|172747 PRK14259, PRK14259, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|226631 COG4152, COG4152, ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|237422 PRK13548, hmuV, hemin importer ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|182980 PRK11124, artP, arginine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|225438 COG2884, FtsE, Predicted ATPase involved in cell division [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|132050 TIGR03005, ectoine_ehuA, ectoine/hydroxyectoine ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|172735 PRK14247, PRK14247, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|237421 PRK13539, PRK13539, cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>gnl|CDD|172749 PRK14261, PRK14261, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|182993 PRK11144, modC, molybdate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|184584 PRK14238, PRK14238, phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|182716 PRK10771, thiQ, thiamine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|237645 PRK14235, PRK14235, phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|237457 PRK13647, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|182692 PRK10744, pstB, phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|131197 TIGR02142, modC_ABC, molybdenum ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|213259 cd03292, ABC_FtsE_transporter, ATP-binding cassette domain of the cell division transporter Back     alignment and domain information
>gnl|CDD|172730 PRK14242, PRK14242, phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|163585 TIGR03873, F420-0_ABC_ATP, proposed F420-0 ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|172750 PRK14262, PRK14262, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|223488 COG0411, LivG, ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|237646 PRK14237, PRK14237, phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|172760 PRK14272, PRK14272, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|182569 PRK10584, PRK10584, putative ABC transporter ATP-binding protein YbbA; Provisional Back     alignment and domain information
>gnl|CDD|237650 PRK14265, PRK14265, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|213186 cd03219, ABC_Mj1267_LivG_branched, ATP-binding cassette component of branched chain amino acids transport system Back     alignment and domain information
>gnl|CDD|226641 COG4172, COG4172, ABC-type uncharacterized transport system, duplicated ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|184199 PRK13639, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|236863 PRK11153, metN, DL-methionine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|182036 PRK09700, PRK09700, D-allose transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|184195 PRK13635, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|213235 cd03268, ABC_BcrA_bacitracin_resist, ATP-binding cassette domain of the bacitracin-resistance transporter Back     alignment and domain information
>gnl|CDD|233206 TIGR00954, 3a01203, Peroxysomal Fatty Acyl CoA Transporter (FAT) Family protei Back     alignment and domain information
>gnl|CDD|213184 cd03217, ABC_FeS_Assembly, ABC-type transport system involved in Fe-S cluster assembly, ATPase component Back     alignment and domain information
>gnl|CDD|233305 TIGR01189, ccmA, heme ABC exporter, ATP-binding protein CcmA Back     alignment and domain information
>gnl|CDD|172757 PRK14269, PRK14269, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|233207 TIGR00955, 3a01204, The Eye Pigment Precursor Transporter (EPP) Family protein Back     alignment and domain information
>gnl|CDD|223473 COG0396, sufC, Cysteine desulfurase activator ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|237652 PRK14275, PRK14275, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|213198 cd03231, ABC_CcmA_heme_exporter, Cytochrome c biogenesis ATP-binding export protein Back     alignment and domain information
>gnl|CDD|226968 COG4615, PvdE, ABC-type siderophore export system, fused ATPase and permease components [Secondary metabolites biosynthesis, transport, and catabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|132313 TIGR03269, met_CoM_red_A2, methyl coenzyme M reductase system, component A2 Back     alignment and domain information
>gnl|CDD|183133 PRK11432, fbpC, ferric transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|130355 TIGR01288, nodI, ATP-binding ABC transporter family nodulation protein NodI Back     alignment and domain information
>gnl|CDD|237451 PRK13631, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|213232 cd03265, ABC_DrrA, Daunorubicin/doxorubicin resistance ATP-binding protein Back     alignment and domain information
>gnl|CDD|237455 PRK13637, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|226617 COG4133, CcmA, ABC-type transport system involved in cytochrome c biogenesis, ATPase component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|240327 PTZ00243, PTZ00243, ABC transporter; Provisional Back     alignment and domain information
>gnl|CDD|184202 PRK13642, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|184203 PRK13643, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|185037 PRK15079, PRK15079, oligopeptide ABC transporter ATP-binding protein OppF; Provisional Back     alignment and domain information
>gnl|CDD|131367 TIGR02314, ABC_MetN, D-methionine ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|184587 PRK14241, PRK14241, phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|213233 cd03266, ABC_NatA_sodium_exporter, ATP-binding cassette domain of the Na+ transporter Back     alignment and domain information
>gnl|CDD|131721 TIGR02673, FtsE, cell division ATP-binding protein FtsE Back     alignment and domain information
>gnl|CDD|172744 PRK14256, PRK14256, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|182036 PRK09700, PRK09700, D-allose transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|131816 TIGR02769, nickel_nikE, nickel import ATP-binding protein NikE Back     alignment and domain information
>gnl|CDD|237456 PRK13641, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|185336 PRK15439, PRK15439, autoinducer 2 ABC transporter ATP-binding protein LsrA; Provisional Back     alignment and domain information
>gnl|CDD|226364 COG3845, COG3845, ABC-type uncharacterized transport systems, ATPase components [General function prediction only] Back     alignment and domain information
>gnl|CDD|236997 PRK11831, PRK11831, putative ABC transporter ATP-binding protein YrbF; Provisional Back     alignment and domain information
>gnl|CDD|213189 cd03222, ABC_RNaseL_inhibitor, ATP-binding cassette domain of RNase L inhibitor Back     alignment and domain information
>gnl|CDD|213234 cd03267, ABC_NatA_like, ATP-binding cassette domain of an uncharacterized transporter similar in sequence to NatA Back     alignment and domain information
>gnl|CDD|224166 COG1245, COG1245, Predicted ATPase, RNase L inhibitor (RLI) homolog [General function prediction only] Back     alignment and domain information
>gnl|CDD|237453 PRK13633, PRK13633, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|172756 PRK14268, PRK14268, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|237894 PRK15064, PRK15064, ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|237420 PRK13537, PRK13537, nodulation ABC transporter NodI; Provisional Back     alignment and domain information
>gnl|CDD|130234 TIGR01166, cbiO, cobalt transport protein ATP-binding subunit Back     alignment and domain information
>gnl|CDD|214640 smart00382, AAA, ATPases associated with a variety of cellular activities Back     alignment and domain information
>gnl|CDD|184210 PRK13651, PRK13651, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|188208 TIGR02323, CP_lyasePhnK, phosphonate C-P lyase system protein PhnK Back     alignment and domain information
>gnl|CDD|184209 PRK13650, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|226620 COG4136, COG4136, ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|131817 TIGR02770, nickel_nikD, nickel import ATP-binding protein NikD Back     alignment and domain information
>gnl|CDD|132561 TIGR03522, GldA_ABC_ATP, gliding motility-associated ABC transporter ATP-binding subunit GldA Back     alignment and domain information
>gnl|CDD|226592 COG4107, PhnK, ABC-type phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|182829 PRK10908, PRK10908, cell division protein FtsE; Provisional Back     alignment and domain information
>gnl|CDD|226637 COG4167, SapF, ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|215558 PLN03073, PLN03073, ABC transporter F family; Provisional Back     alignment and domain information
>gnl|CDD|183226 PRK11607, potG, putrescine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|172733 PRK14245, PRK14245, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|172759 PRK14271, PRK14271, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|237454 PRK13634, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|226952 COG4586, COG4586, ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|182331 PRK10247, PRK10247, putative ABC transporter ATP-binding protein YbbL; Provisional Back     alignment and domain information
>gnl|CDD|130262 TIGR01194, cyc_pep_trnsptr, cyclic peptide transporter Back     alignment and domain information
>gnl|CDD|185067 PRK15112, PRK15112, antimicrobial peptide ABC system ATP-binding protein SapF; Provisional Back     alignment and domain information
>gnl|CDD|215558 PLN03073, PLN03073, ABC transporter F family; Provisional Back     alignment and domain information
>gnl|CDD|237647 PRK14248, PRK14248, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|184196 PRK13636, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|213204 cd03237, ABC_RNaseL_inhibitor_domain2, The ATP-binding cassette domain 2 of RNase L inhibitor Back     alignment and domain information
>gnl|CDD|130324 TIGR01257, rim_protein, retinal-specific rim ABC transporter Back     alignment and domain information
>gnl|CDD|226641 COG4172, COG4172, ABC-type uncharacterized transport system, duplicated ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|182817 PRK10895, PRK10895, lipopolysaccharide ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|172734 PRK14246, PRK14246, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|233665 TIGR01978, sufC, FeS assembly ATPase SufC Back     alignment and domain information
>gnl|CDD|236755 PRK10762, PRK10762, D-ribose transporter ATP binding protein; Provisional Back     alignment and domain information
>gnl|CDD|184205 PRK13646, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|182880 PRK10982, PRK10982, galactose/methyl galaxtoside transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|184207 PRK13648, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|188394 TIGR03864, PQQ_ABC_ATP, ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system Back     alignment and domain information
>gnl|CDD|184125 PRK13538, PRK13538, cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>gnl|CDD|227019 COG4674, COG4674, Uncharacterized ABC-type transport system, ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|226622 COG4138, BtuD, ABC-type cobalamin transport system, ATPase component [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|224166 COG1245, COG1245, Predicted ATPase, RNase L inhibitor (RLI) homolog [General function prediction only] Back     alignment and domain information
>gnl|CDD|182561 PRK10575, PRK10575, iron-hydroxamate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|225265 COG2401, COG2401, ABC-type ATPase fused to a predicted acetyltransferase domain [General function prediction only] Back     alignment and domain information
>gnl|CDD|163431 TIGR03719, ABC_ABC_ChvD, ATP-binding cassette protein, ChvD family Back     alignment and domain information
>gnl|CDD|234200 TIGR03411, urea_trans_UrtD, urea ABC transporter, ATP-binding protein UrtD Back     alignment and domain information
>gnl|CDD|182906 PRK11022, dppD, dipeptide transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|240339 PTZ00265, PTZ00265, multidrug resistance protein (mdr1); Provisional Back     alignment and domain information
>gnl|CDD|181939 PRK09544, znuC, high-affinity zinc transporter ATPase; Reviewed Back     alignment and domain information
>gnl|CDD|184200 PRK13640, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|213200 cd03233, ABCG_PDR_domain1, First domain of the pleiotropic drug resistance-like subfamily G of ATP-binding cassette transporters Back     alignment and domain information
>gnl|CDD|184204 PRK13645, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|213205 cd03238, ABC_UvrA, ATP-binding cassette domain of the excision repair protein UvrA Back     alignment and domain information
>gnl|CDD|236707 PRK10522, PRK10522, multidrug transporter membrane component/ATP-binding component; Provisional Back     alignment and domain information
>gnl|CDD|184198 PRK13638, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|213203 cd03236, ABC_RNaseL_inhibitor_domain1, The ATP-binding cassette domain 1 of RNase L inhibitor Back     alignment and domain information
>gnl|CDD|185049 PRK15093, PRK15093, antimicrobial peptide ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|236689 PRK10419, nikE, nickel transporter ATP-binding protein NikE; Provisional Back     alignment and domain information
>gnl|CDD|236729 PRK10636, PRK10636, putative ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|226639 COG4170, SapD, ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|182342 PRK10261, PRK10261, glutathione transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|132313 TIGR03269, met_CoM_red_A2, methyl coenzyme M reductase system, component A2 Back     alignment and domain information
>gnl|CDD|163431 TIGR03719, ABC_ABC_ChvD, ATP-binding cassette protein, ChvD family Back     alignment and domain information
>gnl|CDD|184037 PRK13409, PRK13409, putative ATPase RIL; Provisional Back     alignment and domain information
>gnl|CDD|184037 PRK13409, PRK13409, putative ATPase RIL; Provisional Back     alignment and domain information
>gnl|CDD|183077 PRK11288, araG, L-arabinose transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|182733 PRK10790, PRK10790, putative multidrug transporter membrane\ATP-binding components; Provisional Back     alignment and domain information
>gnl|CDD|131681 TIGR02633, xylG, D-xylose ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|131377 TIGR02324, CP_lyasePhnL, phosphonate C-P lyase system protein PhnL Back     alignment and domain information
>gnl|CDD|213194 cd03227, ABC_Class2, ATP-binding cassette domain of non-transporter proteins Back     alignment and domain information
>gnl|CDD|236688 PRK10418, nikD, nickel transporter ATP-binding protein NikD; Provisional Back     alignment and domain information
>gnl|CDD|183231 PRK11614, livF, leucine/isoleucine/valine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|184132 PRK13547, hmuV, hemin importer ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|184134 PRK13549, PRK13549, xylose transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|183280 PRK11701, phnK, phosphonate C-P lyase system protein PhnK; Provisional Back     alignment and domain information
>gnl|CDD|131258 TIGR02203, MsbA_lipidA, lipid A export permease/ATP-binding protein MsbA Back     alignment and domain information
>gnl|CDD|236898 PRK11308, dppF, dipeptide transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|227118 COG4778, PhnL, ABC-type phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|184127 PRK13540, PRK13540, cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>gnl|CDD|184129 PRK13543, PRK13543, cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>gnl|CDD|237894 PRK15064, PRK15064, ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|183077 PRK11288, araG, L-arabinose transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|131681 TIGR02633, xylG, D-xylose ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|215634 PLN03211, PLN03211, ABC transporter G-25; Provisional Back     alignment and domain information
>gnl|CDD|236992 PRK11819, PRK11819, putative ABC transporter ATP-binding protein; Reviewed Back     alignment and domain information
>gnl|CDD|184208 PRK13649, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|130261 TIGR01193, bacteriocin_ABC, ABC-type bacteriocin transporter Back     alignment and domain information
>gnl|CDD|184131 PRK13546, PRK13546, teichoic acids export protein ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|206648 cd00882, Ras_like_GTPase, Rat sarcoma (Ras)-like superfamily of small guanosine triphosphatases (GTPases) Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 1231
KOG0054 1381 consensus Multidrug resistance-associated protein/ 100.0
PLN03130 1622 ABC transporter C family member; Provisional 100.0
PLN03232 1495 ABC transporter C family member; Provisional 100.0
TIGR00957 1522 MRP_assoc_pro multi drug resistance-associated pro 100.0
TIGR01271 1490 CFTR_protein cystic fibrosis transmembrane conduct 100.0
PTZ00243 1560 ABC transporter; Provisional 100.0
KOG0055 1228 consensus Multidrug/pheromone exporter, ABC superf 100.0
PTZ00265 1466 multidrug resistance protein (mdr1); Provisional 100.0
KOG0058716 consensus Peptide exporter, ABC superfamily [Intra 100.0
PRK11174588 cysteine/glutathione ABC transporter membrane/ATP- 100.0
COG2274709 SunT ABC-type bacteriocin/lantibiotic exporters, c 100.0
KOG00551228 consensus Multidrug/pheromone exporter, ABC superf 100.0
TIGR03797686 NHPM_micro_ABC2 NHPM bacteriocin system ABC transp 100.0
TIGR00958711 3a01208 Conjugate Transporter-2 (CT2) Family prote 100.0
TIGR03796710 NHPM_micro_ABC1 NHPM bacteriocin system ABC transp 100.0
TIGR03375694 type_I_sec_LssB type I secretion system ATPase, Ls 100.0
TIGR01193708 bacteriocin_ABC ABC-type bacteriocin transporter. 100.0
COG1132567 MdlB ABC-type multidrug transport system, ATPase a 100.0
PRK11176582 lipid transporter ATP-binding/permease protein; Pr 100.0
PRK10790592 putative multidrug transporter membrane\ATP-bindin 100.0
PRK11160574 cysteine/glutathione ABC transporter membrane/ATP- 100.0
COG4988559 CydD ABC-type transport system involved in cytochr 100.0
TIGR02203571 MsbA_lipidA lipid A export permease/ATP-binding pr 100.0
TIGR02204576 MsbA_rel ABC transporter, permease/ATP-binding pro 100.0
TIGR01846694 type_I_sec_HlyB type I secretion system ABC transp 100.0
PRK13657588 cyclic beta-1,2-glucan ABC transporter; Provisiona 100.0
PTZ002651466 multidrug resistance protein (mdr1); Provisional 100.0
TIGR02868529 CydC thiol reductant ABC exporter, CydC subunit. T 100.0
PRK10789569 putative multidrug transporter membrane\ATP-bindin 100.0
TIGR01192585 chvA glucan exporter ATP-binding protein. This mod 100.0
KOG0056790 consensus Heavy metal exporter HMT1, ABC superfami 100.0
COG4987573 CydC ABC-type transport system involved in cytochr 100.0
KOG0057591 consensus Mitochondrial Fe/S cluster exporter, ABC 100.0
TIGR009571522 MRP_assoc_pro multi drug resistance-associated pro 100.0
TIGR01842544 type_I_sec_PrtD type I secretion system ABC transp 100.0
TIGR02857529 CydD thiol reductant ABC exporter, CydD subunit. U 100.0
PLN031301622 ABC transporter C family member; Provisional 100.0
PLN032321495 ABC transporter C family member; Provisional 100.0
PTZ002431560 ABC transporter; Provisional 100.0
COG4618580 ArpD ABC-type protease/lipase transport system, AT 100.0
TIGR012711490 CFTR_protein cystic fibrosis transmembrane conduct 100.0
TIGR01194555 cyc_pep_trnsptr cyclic peptide transporter. This m 100.0
COG5265497 ATM1 ABC-type transport system involved in Fe-S cl 100.0
KOG00541381 consensus Multidrug resistance-associated protein/ 100.0
PRK10522547 multidrug transporter membrane component/ATP-bindi 100.0
TIGR00954659 3a01203 Peroxysomal Fatty Acyl CoA Transporter (FA 100.0
PRK14257329 phosphate ABC transporter ATP-binding protein; Pro 100.0
cd03289275 ABCC_CFTR2 The CFTR subfamily domain 2. The cystic 100.0
COG1126240 GlnQ ABC-type polar amino acid transport system, A 100.0
cd03252237 ABCC_Hemolysin The ABC-transporter hemolysin B is 100.0
cd03291282 ABCC_CFTR1 The CFTR subfamily domain 1. The cystic 100.0
cd03288257 ABCC_SUR2 The SUR domain 2. The sulfonylurea recep 100.0
cd03250204 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C. 100.0
COG1135339 AbcC ABC-type metal ion transport system, ATPase c 100.0
COG1116248 TauB ABC-type nitrate/sulfonate/bicarbonate transp 100.0
cd03251234 ABCC_MsbA MsbA is an essential ABC transporter, cl 100.0
cd03254229 ABCC_Glucan_exporter_like Glucan exporter ATP-bind 100.0
cd03253236 ABCC_ATM1_transporter ATM1 is an ABC transporter t 100.0
COG1125309 OpuBA ABC-type proline/glycine betaine transport s 100.0
cd03249238 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) 100.0
cd03244221 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C. 100.0
COG1117253 PstB ABC-type phosphate transport system, ATPase c 100.0
COG3840231 ThiQ ABC-type thiamine transport system, ATPase co 100.0
COG1120258 FepC ABC-type cobalamin/Fe3+-siderophores transpor 100.0
COG3839338 MalK ABC-type sugar transport systems, ATPase comp 100.0
cd03245220 ABCC_bacteriocin_exporters ABC-type bacteriocin ex 100.0
COG1121254 ZnuC ABC-type Mn/Zn transport systems, ATPase comp 100.0
PRK13631320 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
COG1136226 SalX ABC-type antimicrobial peptide transport syst 100.0
TIGR02314343 ABC_MetN D-methionine ABC transporter, ATP-binding 100.0
COG1127263 Ttg2A ABC-type transport system involved in resist 100.0
COG3842352 PotA ABC-type spermidine/putrescine transport syst 100.0
PRK11650356 ugpC glycerol-3-phosphate transporter ATP-binding 100.0
COG1122235 CbiO ABC-type cobalt transport system, ATPase comp 100.0
cd03261235 ABC_Org_Solvent_Resistant ABC (ATP-binding cassett 100.0
COG1118345 CysA ABC-type sulfate/molybdate transport systems, 100.0
COG4615546 PvdE ABC-type siderophore export system, fused ATP 100.0
TIGR01186363 proV glycine betaine/L-proline transport ATP bindi 100.0
PRK13650279 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
cd03290218 ABCC_SUR1_N The SUR domain 1. The sulfonylurea rec 100.0
COG1124252 DppF ABC-type dipeptide/oligopeptide/nickel transp 100.0
COG4178604 ABC-type uncharacterized transport system, permeas 100.0
cd03248226 ABCC_TAP TAP, the Transporter Associated with Anti 100.0
cd03260227 ABC_PstB_phosphate_transporter Phosphate uptake is 100.0
PRK11432351 fbpC ferric transporter ATP-binding subunit; Provi 100.0
PRK13637287 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
cd03369207 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-ty 100.0
PRK13634290 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK13643288 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK14269246 phosphate ABC transporter ATP-binding protein; Pro 100.0
cd03296239 ABC_CysA_sulfate_importer Part of the ABC transpor 100.0
PRK09452375 potA putrescine/spermidine ABC transporter ATPase 100.0
PRK13647274 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
TIGR00972247 3a0107s01c2 phosphate ABC transporter, ATP-binding 100.0
PRK13635279 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK14242253 phosphate transporter ATP-binding protein; Provisi 100.0
TIGR03265353 PhnT2 putative 2-aminoethylphosphonate ABC transpo 100.0
PRK13646286 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
cd03219236 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC trans 100.0
PRK14273254 phosphate ABC transporter ATP-binding protein; Pro 100.0
cd03263220 ABC_subfamily_A The ABCA subfamily mediates the tr 100.0
PRK10851353 sulfate/thiosulfate transporter subunit; Provision 100.0
TIGR03258362 PhnT 2-aminoethylphosphonate ABC transport system, 100.0
TIGR00960216 3a0501s02 Type II (General) Secretory Pathway (IIS 100.0
cd03226205 ABC_cobalt_CbiO_domain2 Domain II of the ABC compo 100.0
PRK11000369 maltose/maltodextrin transporter ATP-binding prote 100.0
cd03259213 ABC_Carb_Solutes_like ABC Carbohydrate and Solute 100.0
PRK10744260 pstB phosphate transporter ATP-binding protein; Pr 100.0
PRK11153343 metN DL-methionine transporter ATP-binding subunit 100.0
PRK14250241 phosphate ABC transporter ATP-binding protein; Pro 100.0
COG3638258 ABC-type phosphate/phosphonate transport system, A 100.0
PRK13651305 cobalt transporter ATP-binding subunit; Provisiona 100.0
cd03293220 ABC_NrtD_SsuB_transporters NrtD and SsuB are the A 100.0
cd03255218 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of 100.0
PRK14235267 phosphate transporter ATP-binding protein; Provisi 100.0
cd03256241 ABC_PhnC_transporter ABC-type phosphate/phosphonat 100.0
PRK13636283 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
TIGR02315243 ABC_phnC phosphonate ABC transporter, ATP-binding 100.0
cd03294269 ABC_Pro_Gly_Bertaine This family comprises the gly 100.0
cd03258233 ABC_MetN_methionine_transporter MetN (also known a 100.0
TIGR03864236 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, 100.0
cd03265220 ABC_DrrA DrrA is the ATP-binding protein component 100.0
PRK13642277 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
cd03224222 ABC_TM1139_LivF_branched LivF (TM1139) is part of 100.0
PRK13644274 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK14237267 phosphate transporter ATP-binding protein; Provisi 100.0
PRK11629233 lolD lipoprotein transporter ATP-binding subunit; 100.0
PRK13633280 cobalt transporter ATP-binding subunit; Provisiona 100.0
cd03268208 ABC_BcrA_bacitracin_resist The BcrA subfamily repr 100.0
PRK13640282 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK14239252 phosphate transporter ATP-binding protein; Provisi 100.0
PRK14274259 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK14245250 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK13632271 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK11607377 potG putrescine transporter ATP-binding subunit; P 100.0
PRK14251251 phosphate ABC transporter ATP-binding protein; Pro 100.0
cd03247178 ABCC_cytochrome_bd The CYD subfamily implicated in 100.0
cd03266218 ABC_NatA_sodium_exporter NatA is the ATPase compon 100.0
cd03301213 ABC_MalK_N The N-terminal ATPase domain of the mal 100.0
PRK14268258 phosphate ABC transporter ATP-binding protein; Pro 100.0
cd03295242 ABC_OpuCA_Osmoprotection OpuCA is a the ATP bindin 100.0
COG2884223 FtsE Predicted ATPase involved in cell division [C 100.0
PRK14248268 phosphate ABC transporter ATP-binding protein; Pro 100.0
cd03235213 ABC_Metallic_Cations ABC component of the metal-ty 100.0
PRK14236272 phosphate transporter ATP-binding protein; Provisi 100.0
cd03264211 ABC_drug_resistance_like ABC-type multidrug transp 100.0
PRK13645289 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK14240250 phosphate transporter ATP-binding protein; Provisi 100.0
TIGR03411242 urea_trans_UrtD urea ABC transporter, ATP-binding 100.0
PRK11247257 ssuB aliphatic sulfonates transport ATP-binding su 100.0
cd03218232 ABC_YhbG The ABC transporters belonging to the Yhb 100.0
PRK13648269 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK13649280 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
TIGR02211221 LolD_lipo_ex lipoprotein releasing system, ATP-bin 100.0
PRK13641287 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK09493240 glnQ glutamine ABC transporter ATP-binding protein 100.0
PRK14244251 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK10619257 histidine/lysine/arginine/ornithine transporter su 100.0
PRK14270251 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK13652277 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK14249251 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK09536402 btuD corrinoid ABC transporter ATPase; Reviewed 100.0
PRK14238271 phosphate transporter ATP-binding protein; Provisi 100.0
PRK13537306 nodulation ABC transporter NodI; Provisional 100.0
cd03298211 ABC_ThiQ_thiamine_transporter ABC-type thiamine tr 100.0
PRK14259269 phosphate ABC transporter ATP-binding protein; Pro 100.0
cd03292214 ABC_FtsE_transporter FtsE is a hydrophilic nucleot 100.0
PRK14267253 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK11124242 artP arginine transporter ATP-binding subunit; Pro 100.0
cd03269210 ABC_putative_ATPase This subfamily is involved in 100.0
TIGR03415382 ABC_choXWV_ATP choline ABC transporter, ATP-bindin 100.0
PRK14247250 phosphate ABC transporter ATP-binding protein; Pro 100.0
TIGR03410230 urea_trans_UrtE urea ABC transporter, ATP-binding 100.0
PRK10070400 glycine betaine transporter ATP-binding subunit; P 100.0
TIGR02769265 nickel_nikE nickel import ATP-binding protein NikE 100.0
PRK10771232 thiQ thiamine transporter ATP-binding subunit; Pro 100.0
TIGR03005252 ectoine_ehuA ectoine/hydroxyectoine ABC transporte 100.0
PRK14253249 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK15079331 oligopeptide ABC transporter ATP-binding protein O 100.0
PRK10247225 putative ABC transporter ATP-binding protein YbbL; 100.0
PRK10575265 iron-hydroxamate transporter ATP-binding subunit; 100.0
PRK14243264 phosphate transporter ATP-binding protein; Provisi 100.0
PRK14261253 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK11300255 livG leucine/isoleucine/valine transporter ATP-bin 100.0
PRK13639275 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK14262250 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK11831269 putative ABC transporter ATP-binding protein YrbF; 100.0
PRK11264250 putative amino-acid ABC transporter ATP-binding pr 100.0
PRK11231255 fecE iron-dicitrate transporter ATP-binding subuni 100.0
PRK10584228 putative ABC transporter ATP-binding protein YbbA; 100.0
TIGR01288303 nodI ATP-binding ABC transporter family nodulation 100.0
PRK14271276 phosphate ABC transporter ATP-binding protein; Pro 100.0
cd03223166 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cass 100.0
PRK14252265 phosphate ABC transporter ATP-binding protein; Pro 100.0
TIGR02673214 FtsE cell division ATP-binding protein FtsE. This 100.0
PRK13638271 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
cd03225211 ABC_cobalt_CbiO_domain1 Domain I of the ABC compon 100.0
PRK14254285 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK14256252 phosphate ABC transporter ATP-binding protein; Pro 100.0
TIGR00968237 3a0106s01 sulfate ABC transporter, ATP-binding pro 100.0
PRK11614237 livF leucine/isoleucine/valine transporter ATP-bin 100.0
cd03300232 ABC_PotA_N PotA is an ABC-type transporter and the 100.0
cd03257228 ABC_NikE_OppD_transporters The ABC transporter sub 100.0
PRK10253265 iron-enterobactin transporter ATP-binding protein; 100.0
PRK14266250 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK14264305 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK13536340 nodulation factor exporter subunit NodI; Provision 100.0
PRK09984262 phosphonate/organophosphate ester transporter subu 100.0
TIGR03873256 F420-0_ABC_ATP proposed F420-0 ABC transporter, AT 100.0
PRK14263261 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK13548258 hmuV hemin importer ATP-binding subunit; Provision 100.0
TIGR03522301 GldA_ABC_ATP gliding motility-associated ABC trans 100.0
PRK10895241 lipopolysaccharide ABC transporter ATP-binding pro 100.0
TIGR01277213 thiQ thiamine ABC transporter, ATP-binding protein 100.0
PRK14275286 phosphate ABC transporter ATP-binding protein; Pro 100.0
cd03299235 ABC_ModC_like Archeal protein closely related to M 100.0
PRK10908222 cell division protein FtsE; Provisional 100.0
PRK11308327 dppF dipeptide transporter ATP-binding subunit; Pr 100.0
TIGR01978243 sufC FeS assembly ATPase SufC. SufC is part of the 100.0
cd03246173 ABCC_Protease_Secretion This family represents the 100.0
PRK14260259 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK11144352 modC molybdate transporter ATP-binding protein; Pr 100.0
TIGR03740223 galliderm_ABC gallidermin-class lantibiotic protec 100.0
cd03262213 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP- 100.0
PRK10418254 nikD nickel transporter ATP-binding protein NikD; 100.0
PRK11248255 tauB taurine transporter ATP-binding subunit; Prov 100.0
PRK09544251 znuC high-affinity zinc transporter ATPase; Review 100.0
PRK14272252 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK15112267 antimicrobial peptide ABC system ATP-binding prote 100.0
PRK14255252 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK14265274 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK14241258 phosphate transporter ATP-binding protein; Provisi 100.0
TIGR01188302 drrA daunorubicin resistance ABC transporter ATP-b 100.0
PRK11022326 dppD dipeptide transporter ATP-binding subunit; Pr 100.0
PRK11701258 phnK phosphonate C-P lyase system protein PhnK; Pr 100.0
COG1131293 CcmA ABC-type multidrug transport system, ATPase c 100.0
TIGR02982220 heterocyst_DevA ABC exporter ATP-binding subunit, 100.0
PRK09473330 oppD oligopeptide transporter ATP-binding componen 100.0
cd03234226 ABCG_White The White subfamily represents ABC tran 100.0
PRK14246257 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK10419268 nikE nickel transporter ATP-binding protein NikE; 100.0
PRK15093330 antimicrobial peptide ABC transporter ATP-binding 100.0
PRK13547272 hmuV hemin importer ATP-binding subunit; Provision 100.0
PRK14258261 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK15056272 manganese/iron transporter ATP-binding protein; Pr 100.0
PRK13546264 teichoic acids export protein ATP-binding subunit; 100.0
cd03233202 ABC_PDR_domain1 The pleiotropic drug resistance (P 100.0
TIGR02142354 modC_ABC molybdenum ABC transporter, ATP-binding p 100.0
COG0410237 LivF ABC-type branched-chain amino acid transport 100.0
cd03213194 ABCG_EPDR ABCG transporters are involved in eye pi 100.0
cd03230173 ABC_DR_subfamily_A This family of ATP-binding prot 100.0
cd03232192 ABC_PDR_domain2 The pleiotropic drug resistance-li 100.0
cd03297214 ABC_ModC_molybdenum_transporter ModC is an ABC-typ 100.0
cd03228171 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein 100.0
PRK13545549 tagH teichoic acids export protein ATP-binding sub 100.0
TIGR02323253 CP_lyasePhnK phosphonate C-P lyase system protein 100.0
COG4175386 ProV ABC-type proline/glycine betaine transport sy 100.0
cd03229178 ABC_Class3 This class is comprised of all BPD (Bin 100.0
TIGR02770230 nickel_nikD nickel import ATP-binding protein NikD 100.0
cd03215182 ABC_Carb_Monos_II This family represents domain II 100.0
TIGR01184230 ntrCD nitrate transport ATP-binding subunits C and 100.0
CHL00131252 ycf16 sulfate ABC transporter protein; Validated 100.0
TIGR00955617 3a01204 The Eye Pigment Precursor Transporter (EPP 100.0
TIGR03608206 L_ocin_972_ABC putative bacteriocin export ABC tra 100.0
PRK15439510 autoinducer 2 ABC transporter ATP-binding protein 100.0
PRK09580248 sufC cysteine desulfurase ATPase component; Review 100.0
cd03217200 ABC_FeS_Assembly ABC-type transport system involve 100.0
cd03220224 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transpo 100.0
PRK03695248 vitamin B12-transporter ATPase; Provisional 100.0
COG4619223 ABC-type uncharacterized transport system, ATPase 100.0
PRK10261623 glutathione transporter ATP-binding protein; Provi 100.0
PRK13549506 xylose transporter ATP-binding subunit; Provisiona 100.0
KOG0060659 consensus Long-chain acyl-CoA transporter, ABC sup 100.0
cd03267236 ABC_NatA_like Similar in sequence to NatA, this is 100.0
PRK10261623 glutathione transporter ATP-binding protein; Provi 100.0
PLN03211659 ABC transporter G-25; Provisional 100.0
COG4555245 NatA ABC-type Na+ transport system, ATPase compone 100.0
PRK09700510 D-allose transporter ATP-binding protein; Provisio 100.0
PRK13540200 cytochrome c biogenesis protein CcmA; Provisional 100.0
PRK10762501 D-ribose transporter ATP binding protein; Provisio 100.0
COG1123539 ATPase components of various ABC-type transport sy 100.0
cd03231201 ABC_CcmA_heme_exporter CcmA, the ATP-binding compo 100.0
PRK13543214 cytochrome c biogenesis protein CcmA; Provisional 100.0
cd03214180 ABC_Iron-Siderophores_B12_Hemin ABC transporters, 100.0
PRK10982491 galactose/methyl galaxtoside transporter ATP-bindi 100.0
PRK13539207 cytochrome c biogenesis protein CcmA; Provisional 100.0
PRK11288501 araG L-arabinose transporter ATP-binding protein; 100.0
PRK13538204 cytochrome c biogenesis protein CcmA; Provisional 100.0
cd03216163 ABC_Carb_Monos_I This family represents the domain 100.0
PRK13541195 cytochrome c biogenesis protein CcmA; Provisional 100.0
cd03237246 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 o 100.0
TIGR02633500 xylG D-xylose ABC transporter, ATP-binding protein 100.0
TIGR03771223 anch_rpt_ABC anchored repeat-type ABC transporter, 100.0
TIGR03269520 met_CoM_red_A2 methyl coenzyme M reductase system, 100.0
COG1137243 YhbG ABC-type (unclassified) transport system, ATP 100.0
TIGR02324224 CP_lyasePhnL phosphonate C-P lyase system protein 100.0
PRK10938490 putative molybdenum transport ATP-binding protein 100.0
PRK15134529 microcin C ABC transporter ATP-binding protein Yej 100.0
PRK15134529 microcin C ABC transporter ATP-binding protein Yej 100.0
TIGR03269520 met_CoM_red_A2 methyl coenzyme M reductase system, 100.0
PRK11819556 putative ABC transporter ATP-binding protein; Revi 100.0
TIGR01189198 ccmA heme ABC exporter, ATP-binding protein CcmA. 100.0
TIGR03719552 ABC_ABC_ChvD ATP-binding cassette protein, ChvD fa 100.0
COG4181228 Predicted ABC-type transport system involved in ly 100.0
PRK13549506 xylose transporter ATP-binding subunit; Provisiona 100.0
PRK15064530 ABC transporter ATP-binding protein; Provisional 100.0
COG4525259 TauB ABC-type taurine transport system, ATPase com 100.0
COG1123539 ATPase components of various ABC-type transport sy 100.0
PRK15177213 Vi polysaccharide export ATP-binding protein VexC; 100.0
COG4559259 ABC-type hemin transport system, ATPase component 100.0
PRK15064530 ABC transporter ATP-binding protein; Provisional 100.0
COG4148352 ModC ABC-type molybdate transport system, ATPase c 100.0
COG4598256 HisP ABC-type histidine transport system, ATPase c 100.0
COG0444316 DppD ABC-type dipeptide/oligopeptide/nickel transp 100.0
TIGR01166190 cbiO cobalt transport protein ATP-binding subunit. 100.0
TIGR01257 2272 rim_protein retinal-specific rim ABC transporter. 100.0
cd03221144 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is 100.0
PRK10535648 macrolide transporter ATP-binding /permease protei 100.0
COG0411250 LivG ABC-type branched-chain amino acid transport 99.98
TIGR009561394 3a01205 Pleiotropic Drug Resistance (PDR) Family p 99.98
COG4161242 ArtP ABC-type arginine transport system, ATPase co 99.98
COG4608268 AppF ABC-type oligopeptide transport system, ATPas 99.98
TIGR01187325 potA spermidine/putrescine ABC transporter ATP-bin 99.98
TIGR012572272 rim_protein retinal-specific rim ABC transporter. 99.98
PRK09700510 D-allose transporter ATP-binding protein; Provisio 99.98
TIGR02633500 xylG D-xylose ABC transporter, ATP-binding protein 99.98
COG1129500 MglA ABC-type sugar transport system, ATPase compo 99.97
PRK10762501 D-ribose transporter ATP binding protein; Provisio 99.97
PRK11288501 araG L-arabinose transporter ATP-binding protein; 99.97
COG4172534 ABC-type uncharacterized transport system, duplica 99.97
PRK11819556 putative ABC transporter ATP-binding protein; Revi 99.97
TIGR03719552 ABC_ABC_ChvD ATP-binding cassette protein, ChvD fa 99.97
PLN03073718 ABC transporter F family; Provisional 99.97
TIGR00956 1394 3a01205 Pleiotropic Drug Resistance (PDR) Family p 99.97
cd03236255 ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 o 99.97
cd03222177 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibi 99.97
PRK10636638 putative ABC transporter ATP-binding protein; Prov 99.97
PRK15439510 autoinducer 2 ABC transporter ATP-binding protein 99.97
COG4604252 CeuD ABC-type enterochelin transport system, ATPas 99.97
PRK10938490 putative molybdenum transport ATP-binding protein 99.97
PRK13409590 putative ATPase RIL; Provisional 99.97
cd03238176 ABC_UvrA The excision repair protein UvrA; Nucleot 99.97
PRK11147635 ABC transporter ATPase component; Reviewed 99.97
PRK10636638 putative ABC transporter ATP-binding protein; Prov 99.97
PRK10982491 galactose/methyl galaxtoside transporter ATP-bindi 99.97
COG3845501 ABC-type uncharacterized transport systems, ATPase 99.97
PLN031401470 ABC transporter G family member; Provisional 99.97
PRK11147635 ABC transporter ATPase component; Reviewed 99.97
COG1134249 TagH ABC-type polysaccharide/polyol phosphate tran 99.96
cd00267157 ABC_ATPase ABC (ATP-binding cassette) transporter 99.96
COG4136213 ABC-type uncharacterized transport system, ATPase 99.96
COG1101263 PhnK ABC-type uncharacterized transport system, AT 99.96
COG0488530 Uup ATPase components of ABC transporters with dup 99.96
COG4167267 SapF ABC-type antimicrobial peptide transport syst 99.96
COG4152300 ABC-type uncharacterized transport system, ATPase 99.96
PLN03140 1470 ABC transporter G family member; Provisional 99.96
PRK13409590 putative ATPase RIL; Provisional 99.96
COG1119257 ModF ABC-type molybdenum transport system, ATPase 99.95
KOG0061613 consensus Transporter, ABC superfamily (Breast can 99.95
COG4172534 ABC-type uncharacterized transport system, duplica 99.95
PLN03073718 ABC transporter F family; Provisional 99.95
cd03270226 ABC_UvrA_I The excision repair protein UvrA domain 99.95
COG4674249 Uncharacterized ABC-type transport system, ATPase 99.95
PF00005137 ABC_tran: ABC transporter This structure is on hol 99.95
KOG0064728 consensus Peroxisomal long-chain acyl-CoA transpor 99.94
COG0488530 Uup ATPase components of ABC transporters with dup 99.94
cd03271261 ABC_UvrA_II The excision repair protein UvrA domai 99.94
COG0396251 sufC Cysteine desulfurase activator ATPase [Posttr 99.93
COG4133209 CcmA ABC-type transport system involved in cytochr 99.92
COG4586325 ABC-type uncharacterized transport system, ATPase 99.92
COG4107258 PhnK ABC-type phosphonate transport system, ATPase 99.92
cd03278197 ABC_SMC_barmotin Barmotin is a tight junction-asso 99.92
cd03272243 ABC_SMC3_euk Eukaryotic SMC3 proteins; SMC protein 99.9
cd03279213 ABC_sbcCD SbcCD and other Mre11/Rad50 (MR) complex 99.9
COG4778235 PhnL ABC-type phosphonate transport system, ATPase 99.89
KOG0059885 consensus Lipid exporter ABCA1 and related protein 99.89
KOG0058 716 consensus Peptide exporter, ABC superfamily [Intra 99.89
PRK00349943 uvrA excinuclease ABC subunit A; Reviewed 99.89
cd03240204 ABC_Rad50 The catalytic domains of Rad50 are simil 99.89
KOG0927614 consensus Predicted transporter (ABC superfamily) 99.88
cd03273251 ABC_SMC2_euk Eukaryotic SMC2 proteins; SMC protein 99.87
TIGR00958 711 3a01208 Conjugate Transporter-2 (CT2) Family prote 99.87
cd03275247 ABC_SMC1_euk Eukaryotic SMC1 proteins; SMC protein 99.87
PRK00635 1809 excinuclease ABC subunit A; Provisional 99.86
TIGR00630924 uvra excinuclease ABC, A subunit. This family is b 99.86
cd03274212 ABC_SMC4_euk Eukaryotic SMC4 proteins; SMC protein 99.85
KOG00651391 consensus Pleiotropic drug resistance proteins (PD 99.85
COG1129500 MglA ABC-type sugar transport system, ATPase compo 99.85
TIGR02868 529 CydC thiol reductant ABC exporter, CydC subunit. T 99.84
TIGR01193 708 bacteriocin_ABC ABC-type bacteriocin transporter. 99.83
PRK10790 592 putative multidrug transporter membrane\ATP-bindin 99.83
TIGR02203 571 MsbA_lipidA lipid A export permease/ATP-binding pr 99.83
cd03239178 ABC_SMC_head The structural maintenance of chromos 99.83
PF00664275 ABC_membrane: ABC transporter transmembrane region 99.82
KOG0927614 consensus Predicted transporter (ABC superfamily) 99.81
TIGR03796 710 NHPM_micro_ABC1 NHPM bacteriocin system ABC transp 99.81
cd03276198 ABC_SMC6_euk Eukaryotic SMC6 proteins; SMC protein 99.81
COG4138248 BtuD ABC-type cobalamin transport system, ATPase c 99.8
KOG0066807 consensus eIF2-interacting protein ABC50 (ABC supe 99.8
TIGR02857 529 CydD thiol reductant ABC exporter, CydD subunit. U 99.8
COG3845501 ABC-type uncharacterized transport systems, ATPase 99.8
TIGR01846 694 type_I_sec_HlyB type I secretion system ABC transp 99.8
TIGR03797 686 NHPM_micro_ABC2 NHPM bacteriocin system ABC transp 99.79
TIGR02204 576 MsbA_rel ABC transporter, permease/ATP-binding pro 99.79
KOG0062582 consensus ATPase component of ABC transporters wit 99.79
PRK11174 588 cysteine/glutathione ABC transporter membrane/ATP- 99.79
TIGR03375 694 type_I_sec_LssB type I secretion system ATPase, Ls 99.78
PRK11160 574 cysteine/glutathione ABC transporter membrane/ATP- 99.78
PRK11176 582 lipid transporter ATP-binding/permease protein; Pr 99.78
KOG0062582 consensus ATPase component of ABC transporters wit 99.78
TIGR01192 585 chvA glucan exporter ATP-binding protein. This mod 99.78
COG2274 709 SunT ABC-type bacteriocin/lantibiotic exporters, c 99.77
TIGR01194 555 cyc_pep_trnsptr cyclic peptide transporter. This m 99.77
COG1245591 Predicted ATPase, RNase L inhibitor (RLI) homolog 99.77
PRK13657 588 cyclic beta-1,2-glucan ABC transporter; Provisiona 99.76
PRK10789 569 putative multidrug transporter membrane\ATP-bindin 99.75
COG1132 567 MdlB ABC-type multidrug transport system, ATPase a 99.75
PF00664275 ABC_membrane: ABC transporter transmembrane region 99.75
cd03280200 ABC_MutS2 MutS2 homologs in bacteria and eukaryote 99.74
cd03277213 ABC_SMC5_euk Eukaryotic SMC5 proteins; SMC protein 99.73
cd01128249 rho_factor Transcription termination factor rho is 99.72
KOG2355291 consensus Predicted ABC-type transport, ATPase com 99.72
COG0178935 UvrA Excinuclease ATPase subunit [DNA replication, 99.72
PRK006351809 excinuclease ABC subunit A; Provisional 99.71
KOG0065 1391 consensus Pleiotropic drug resistance proteins (PD 99.7
cd03241276 ABC_RecN RecN ATPase involved in DNA repair; ABC ( 99.69
PRK10522 547 multidrug transporter membrane component/ATP-bindi 99.68
COG2401593 ABC-type ATPase fused to a predicted acetyltransfe 99.68
cd03227162 ABC_Class2 ABC-type Class 2 contains systems invol 99.67
TIGR01842 544 type_I_sec_PrtD type I secretion system ABC transp 99.64
COG1245591 Predicted ATPase, RNase L inhibitor (RLI) homolog 99.64
TIGR00954 659 3a01203 Peroxysomal Fatty Acyl CoA Transporter (FA 99.62
cd03285222 ABC_MSH2_euk MutS2 homolog in eukaryotes. The MutS 99.59
cd03242270 ABC_RecF RecF is a recombinational DNA repair ATPa 99.59
COG4170330 SapD ABC-type antimicrobial peptide transport syst 99.58
cd03243202 ABC_MutS_homologs The MutS protein initiates DNA m 99.55
cd03283199 ABC_MutS-like MutS-like homolog in eukaryotes. The 99.53
TIGR00630924 uvra excinuclease ABC, A subunit. This family is b 99.53
PRK00349943 uvrA excinuclease ABC subunit A; Reviewed 99.52
cd03282204 ABC_MSH4_euk MutS4 homolog in eukaryotes. The MutS 99.43
PF02463220 SMC_N: RecF/RecN/SMC N terminal domain; InterPro: 99.41
TIGR006061311 rad50 rad50. This family is based on the phylogeno 99.4
KOG0066807 consensus eIF2-interacting protein ABC50 (ABC supe 99.38
cd00820107 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPC 99.38
cd03284216 ABC_MutS1 MutS1 homolog in eukaryotes. The MutS pr 99.36
TIGR02858270 spore_III_AA stage III sporulation protein AA. Mem 99.32
KOG0063592 consensus RNAse L inhibitor, ABC superfamily [RNA 99.3
COG4987 573 CydC ABC-type transport system involved in cytochr 99.28
PRK00064361 recF recombination protein F; Reviewed 99.28
PHA02562562 46 endonuclease subunit; Provisional 99.25
COG4988 559 CydD ABC-type transport system involved in cytochr 99.23
cd03281213 ABC_MSH5_euk MutS5 homolog in eukaryotes. The MutS 99.2
TIGR01069771 mutS2 MutS2 family protein. Function of MutS2 is u 99.19
smart00534185 MUTSac ATPase domain of DNA mismatch repair MUTS f 99.18
KOG0056 790 consensus Heavy metal exporter HMT1, ABC superfami 99.09
PRK13695174 putative NTPase; Provisional 99.06
cd03287222 ABC_MSH3_euk MutS3 homolog in eukaryotes. The MutS 99.06
TIGR00634563 recN DNA repair protein RecN. All proteins in this 99.04
PRK10869553 recombination and repair protein; Provisional 99.0
PRK07721438 fliI flagellum-specific ATP synthase; Validated 98.99
PRK00409782 recombination and DNA strand exchange inhibitor pr 98.98
KOG0063592 consensus RNAse L inhibitor, ABC superfamily [RNA 98.94
PTZ00132215 GTP-binding nuclear protein Ran; Provisional 98.93
COG0178935 UvrA Excinuclease ATPase subunit [DNA replication, 98.85
PRK08533230 flagellar accessory protein FlaH; Reviewed 98.84
TIGR02788308 VirB11 P-type DNA transfer ATPase VirB11. The VirB 98.78
COG4615 546 PvdE ABC-type siderophore export system, fused ATP 98.77
cd01124187 KaiC KaiC is a circadian clock protein primarily f 98.77
PRK01156895 chromosome segregation protein; Provisional 98.76
PRK13830818 conjugal transfer protein TrbE; Provisional 98.68
PRK03918880 chromosome segregation protein; Provisional 98.68
cd03286218 ABC_MSH6_euk MutS6 homolog in eukaryotes. The MutS 98.66
cd01131198 PilT Pilus retraction ATPase PilT. PilT is a nucle 98.64
TIGR006181042 sbcc exonuclease SbcC. This family is based on the 98.63
PRK06793432 fliI flagellum-specific ATP synthase; Validated 98.61
COG5265 497 ATM1 ABC-type transport system involved in Fe-S cl 98.6
smart00382148 AAA ATPases associated with a variety of cellular 98.59
TIGR021681179 SMC_prok_B chromosome segregation protein SMC, com 98.59
cd01120165 RecA-like_NTPases RecA-like NTPases. This family i 98.58
TIGR03238504 dnd_assoc_3 dnd system-associated protein 3. cereu 98.52
PF13304303 AAA_21: AAA domain; PDB: 3QKS_B 1US8_B 1F2U_B 1F2T 98.48
TIGR00767415 rho transcription termination factor Rho. Members 98.46
PRK06067234 flagellar accessory protein FlaH; Validated 98.44
TIGR021691164 SMC_prok_A chromosome segregation protein SMC, pri 98.42
KOG0057 591 consensus Mitochondrial Fe/S cluster exporter, ABC 98.39
PF09818448 ABC_ATPase: Predicted ATPase of the ABC class; Int 98.36
PRK102461047 exonuclease subunit SbcC; Provisional 98.33
PRK02224880 chromosome segregation protein; Provisional 98.31
TIGR01420343 pilT_fam pilus retraction protein PilT. This model 98.3
TIGR00101199 ureG urease accessory protein UreG. This model rep 98.29
COG3910233 Predicted ATPase [General function prediction only 98.19
PRK06995484 flhF flagellar biosynthesis regulator FlhF; Valida 98.17
cd02023198 UMPK Uridine monophosphate kinase (UMPK, EC 2.7.1. 98.15
TIGR00611365 recf recF protein. All proteins in this family for 98.15
cd01125239 repA Hexameric Replicative Helicase RepA. RepA is 98.14
PRK01889356 GTPase RsgA; Reviewed 98.13
PF13748237 ABC_membrane_3: ABC transporter transmembrane regi 98.11
cd01130186 VirB11-like_ATPase Type IV secretory pathway compo 98.04
PRK11098409 microcin B17 transporter; Reviewed 98.03
PRK14079349 recF recombination protein F; Provisional 98.01
>KOG0054 consensus Multidrug resistance-associated protein/mitoxantrone resistance protein, ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information 
Probab=100.00  E-value=9.5e-218  Score=2042.96  Aligned_cols=1024  Identities=42%  Similarity=0.686  Sum_probs=937.4

Q ss_pred             CCCCccCCh--hHHHHHHhHHHHHHhhccCCCCCCCCCCCCccCcHHHHHHHHHHHHHHHHHhhcCCCCCchHHHHHHHH
Q 000905          197 QTELGKAGL--LRKLTFSWINPLLSLGYSKPLALEDIPSLVPEDEASFAYQKFAYAWDSLVRENNSNNNGNLVRKVITNV  274 (1231)
Q Consensus       197 ~~p~~~a~~--~s~~~f~W~~pl~~~g~~~~L~~~Dl~~l~~~~~~~~~~~~f~~~w~~~~~~~~~~~~~~~l~~~l~~~  274 (1231)
                      ++|.+.++.  +|++||||++|++++|||++|+.+|+|+++++|+++.+.++|++.|+++.++.   +++|+++++++++
T Consensus       122 ~~~~~~~~~~~~S~~~f~W~~~l~~~g~k~~L~~~Dl~~l~~~d~s~~l~~~~~~~w~~~~~~~---~~~psl~~al~~~  198 (1381)
T KOG0054|consen  122 PNPLPEASAGFLSRLTFSWMTPLLRKGYKKPLELKDLWSLSPEDSSETLVKRLESLWEKELGRS---GKKPSLLRALLRT  198 (1381)
T ss_pred             CCcccccchhHHHHHHHHHHHHHHHhhccCCCChhhcccCChhhhhhHHHHHHHHHHHHHhccc---cCCcHHHHHHHHH
Confidence            344445555  99999999999999999999999999999999999999999999999886432   2578999999999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhccCCCccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q 000905          275 YLKENIFIAICALLRTIAVVVGPLLLYAFVNYSNRGEENLQEGLSIVGCLIITKVVESFTQRHCFFGSRRSGMRMRSALM  354 (1231)
Q Consensus       275 ~~~~~~~~~~~~l~~~~~~~~~P~ll~~li~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~r~~L~  354 (1231)
                      |++++++.+++.++.+...+++|++++.+++|.++++.+.+.|+.++++++++.++++++.++|++..+++|+|+|+++.
T Consensus       199 f~~~~~~~~~~~~~~~~~~~~~P~lL~~li~~~~~~~~~~~~g~~~a~~lf~~~~l~~l~~~~~~~~~~~~g~r~R~al~  278 (1381)
T KOG0054|consen  199 FGRTFLLSGIFLFLRDLAGFVGPLLLKKLILFFSEKRLPLNNGYLLAVLLFLASLLQSLLLHQYFFVSFRVGMRLRSALI  278 (1381)
T ss_pred             HHHHHHHHHHHHHHHHHHccccHHHHHHHHHHhcCCCcccchhHHHHHHHHHHHHHHHHHHhHHHHHHHhhhhhHHHHHH
Confidence            99999999999999999999999999999999987766778899999999999999999999999999999999999999


Q ss_pred             HHHHHHHHcCCcccCCCCCHHHHHHHHHHHHHHHhchHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q 000905          355 VAVYQKQLKLSSLGRKKHSTGEIVNYIAVDAYRMGEFPFWFHLTWSLALQLFLAIGVLFGVVGLGALPGLVLFLICGLLN  434 (1231)
Q Consensus       355 ~~i~~K~l~l~~~~~~~~~~G~iinl~s~D~~~i~~~~~~~~~~~~~~~~i~~~~~~L~~~lg~~~l~gl~~~~~~~~~~  434 (1231)
                      ++||+|+|+++...++++++|+++|+|++|+++++++..++|.+|.+|+|+++++++||..+|+++++|++++++++|++
T Consensus       279 ~~IY~K~L~ls~~~~~~~t~G~ivNlms~D~~ri~~~~~~~h~~w~~Plqi~~~l~lLy~~LG~sa~~G~~~~il~~p~n  358 (1381)
T KOG0054|consen  279 SAIYRKALRLSNSARGETTVGEIVNLMSVDAQRLSDAACFLHLLWSAPLQIILALYLLYGLLGPSALAGVAVMVLLIPLN  358 (1381)
T ss_pred             HHHHHhhhcCchhhccCCCcchhhhhhhhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhChHHHHHHHHHHHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhHHHHHHhchHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q 000905          435 VPFAKILQKCQSEFMIAQDERLRSTSEILNNMKIIKLQSWEEKFKSLIESRREKEFKWLSEAQLRKAYGTVIYWMSPTII  514 (1231)
Q Consensus       435 ~~~~~~~~~~~~~~~~~~d~r~~~~~E~L~gir~IK~~~~E~~f~~~i~~~r~~e~~~l~~~~~~~~~~~~~~~~~~~~~  514 (1231)
                      .+++++++++|++.|+.+|+|++.++|+|+|||+||+|+||+.|.+++++.|++|++++++..+..++..+.++++|.++
T Consensus       359 ~~~a~~~~~~q~~~m~~~D~Rik~~nEiL~~IkviK~yaWE~~F~~~I~~~R~~El~~lrk~~~~~~~~~~~~~~~p~lv  438 (1381)
T KOG0054|consen  359 SFLAKKIAKFQKRLMKRKDERIKLMNEILNGIKVIKLYAWEKPFLKKIEDLRQKELKLLRKSAYLSALNSFLNFFSPVLV  438 (1381)
T ss_pred             HHHHHHHHHHHHHHhhhhhHHHHHHHHHHhhhHhhhhHhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHhCCCCCcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhcccCCCCchhhhccccCCCCc
Q 000905          515 SSVIFLGCALTGSAPLNASTIFTVLATLRSMGEPVRMIPEALSIMIQVKVSFDRINAFLLDHELNNDDVRRISLQKSDRS  594 (1231)
Q Consensus       515 ~~v~~~~~~l~~~~~lt~~~~f~~l~~~~~l~~pl~~l~~~i~~~~~a~vs~~Ri~~fl~~~e~~~~~~~~~~~~~~~~~  594 (1231)
                      ++++|++|++..++.+|+..+|+++++|+.++.|+.++|+.++.+.|+.||++|+++||..+|.+++...+.+.++.+.+
T Consensus       439 ~~~tF~~~v~~~~~~lt~~~aF~slalfniLr~pl~~~P~~i~~~vqa~VS~~Ri~~fl~~~e~~~~~~~~~~~~~~~~~  518 (1381)
T KOG0054|consen  439 SVVTFVVFVLLLGNLLTASTAFTSLALFNILRFPLFMLPSVISQLVQAKVSLKRLKEFLLSEELDPDSVERSPDEAGENA  518 (1381)
T ss_pred             HHHHHHHHhhccCccccHhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhcCcccCccccccCCCCCCCce
Confidence            99999999954347899999999999999999999999999999999999999999999998887654433233445668


Q ss_pred             EEEEeeeEeeCCCCCCCceeeEEEEeeCCeEEEEECcCCCChHHHHHHHhCCCcCCCcEEEEcCeEEEEeCCCcCCCCCH
Q 000905          595 VKIQEGNFSWDPELAIPTLRGVNLDIKWAQKIAVCGSVGAGKSSLLYAILGEIPKISGTVNLYGSIAYVSQTSWIQSGSI  674 (1231)
Q Consensus       595 I~~~~~sf~y~~~~~~~~L~~inl~i~~Ge~vaIvG~sGSGKSTLl~~Llg~~~~~~G~I~v~g~iayv~Q~~~lf~~TI  674 (1231)
                      |+++|++|+|+++++.++|+||||+||+|+++||||++||||||||++|+||+++.+|++.++|++|||||+||||||||
T Consensus       519 i~i~~~sfsW~~~~~~~tL~dIn~~i~~G~lvaVvG~vGsGKSSLL~AiLGEm~~~sG~v~v~gsiaYv~Q~pWI~ngTv  598 (1381)
T KOG0054|consen  519 IEIKNGSFSWDSESPEPTLKDINFEIKKGQLVAVVGPVGSGKSSLLSAILGEMPKLSGSVAVNGSVAYVPQQPWIQNGTV  598 (1381)
T ss_pred             EEEeeeeEecCCCCCcccccceeEEecCCCEEEEECCCCCCHHHHHHHHhcCcccccceEEEcCeEEEeccccHhhCCcH
Confidence            99999999999865667999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHhcCCCCCHHHHHHHHHHhcchHHHhcCCCCCcccccCCCCcCChHHHHHHHHHHHHhcCCCEEEEeCCCCCCCHHH
Q 000905          675 RDNILYGKPMDKARYDKAIKACALDKDINNFDHGDLTEIGQRGLNLSGGQKQRIQLARAVYNDADIYLFDDPFSAVDAHT  754 (1231)
Q Consensus       675 reNI~fg~~~~~~~~~~vl~~~~L~~di~~lp~G~~T~IGe~G~~LSGGQkQRIaLARAly~~~~IllLDep~SalD~~t  754 (1231)
                      ||||+||+|||+++|++|+++|+|++|++.||+||+|+|||||+||||||||||+||||+|+|+||||||||+||||+||
T Consensus       599 reNILFG~~~d~~rY~~Vi~aC~L~~Dle~Lp~GD~TeIGErGinLSGGQKqRIsLARAVY~~adIYLLDDplSAVDahv  678 (1381)
T KOG0054|consen  599 RENILFGSPYDEERYDKVIKACALKKDLEILPFGDLTEIGERGINLSGGQKQRISLARAVYQDADIYLLDDPLSAVDAHV  678 (1381)
T ss_pred             HHhhhcCccccHHHHHHHHHHccCHhHHhhcCCCCcceecCCccCCcHhHHHHHHHHHHHhccCCEEEEcCcchhhhHhh
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHhcCCcEEEEEccCcchhhccCeEEEEeCCeEeEecChHHHHhcCchHHHHHHHhhhhhccCCCCCCCCC
Q 000905          755 AATLFNECVMAALEKKTVILVTHQVEFLSEVDRILVLEGGQITQSGNYQELLLAGTAFEQLVNAHRDAITGLGPLDNAGQ  834 (1231)
Q Consensus       755 ~~~i~~~~i~~~l~~kTvIlvTH~l~~l~~aD~Iivl~~G~I~~~Gt~~eL~~~~~~~~~l~~~~~~~~~~~~~~~~~~~  834 (1231)
                      ++|||++|+++.+++||||+|||+++++++||+|++|+||+|.++|+|+||+++++.|.++..+........  .+....
T Consensus       679 g~~if~~ci~~~L~~KT~ILVTHql~~L~~ad~Iivl~~G~I~~~Gty~el~~~~~~~~~l~~~~~~~~~~~--~~~~~~  756 (1381)
T KOG0054|consen  679 GKHIFEECIRGLLRGKTVILVTHQLQFLPHADQIIVLKDGKIVESGTYEELLKSGGDFAELAHEEESEQEEE--ASEKDL  756 (1381)
T ss_pred             hHHHHHHHHHhhhcCCEEEEEeCchhhhhhCCEEEEecCCeEecccCHHHHHhcchhHHHHhhccchhhccc--cccccc
Confidence            999999999999999999999999999999999999999999999999999999999998843322111110  000000


Q ss_pred             CCccccccccCCCCCCCCCCCCCCCCCcc-ccccccccccchHHHhhcCCCChHHHHHHHHhccchhHHHHHHHHHHHHH
Q 000905          835 GGAEKVEKGRTARPEEPNGIYPRKESSEG-EISVKGLTQLTEDEEMEIGDVGWKPFMDYLNVSKGMSLLCLGVLAQSGFV  913 (1231)
Q Consensus       835 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~l~~~E~~~~G~V~~~vy~~Y~~~~~g~~~~~~~~~~~~~~~  913 (1231)
                      ...+.      ....+.+.....+...+. ...++...+++++|+++.|+|+|++|++|+++++|+..+++.++++++.+
T Consensus       757 ~~~~~------~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ee~~~G~v~~~vY~~Y~~a~~g~~~~~~~~~~~v~~~  830 (1381)
T KOG0054|consen  757 ESGES------SRESESRSLESLSSEEEKSKDEKEEEDKLVQEEERETGKVSWSVYKKYIKAAGGFLLVLLILLLFVLTQ  830 (1381)
T ss_pred             ccccc------ccchhhhhhhhhcccccccccccchhhHHHHHHHHhcCEeeHHHHHHHHHhcccHHHHHHHHHHHHHHH
Confidence            00000      000000000000000000 00111235677889999999999999999998788888877888899999


Q ss_pred             HHHHHHHHHHHhhhcCCC------CCchHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhcCcccccc
Q 000905          914 GLQAAATYWLAYAIQIPK------ITSGILIGVYAGVSTASAVFVYFRSFFAAHLGLKASKAFFSGFTNSIFKAPMLFFD  987 (1231)
Q Consensus       914 ~~~~~~~~wl~~~~~~~~------~~~~~~l~vy~~l~~~~~~~~~~~~~~~~~~~~~as~~lh~~~l~~vlrapm~FFD  987 (1231)
                      ++.++++|||++|++.+.      .+..+|+++|++++++++++.+++++.+..+|++||++||++|+++|+||||+|||
T Consensus       831 ~~~~~~~~WLs~W~~~~~~~~~~~~~~~~~~~vY~~l~~~~~~~~~~rs~~~~~~~l~aS~~Lh~~ml~~Ilrapm~FFd  910 (1381)
T KOG0054|consen  831 VLQIASNYWLSYWTDDGEDNGTTTVSTSFYLGVYALLGVASSLLTLLRSFLFAKGGLKASRKLHDKLLNSILRAPMSFFD  910 (1381)
T ss_pred             HHHHHHHHHHHHhcCCcccccccCCCcchHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhCcchhcC
Confidence            999999999999997642      35678999999999999999999999999999999999999999999999999999


Q ss_pred             ccCccchhhhhcCccccccCCcHHHHHHHHHHHHHHHHHHHHHHhhhHHHHHHHHHHHHHHHHHHHHHHhhhHHHHHHhh
Q 000905          988 STPVGRILTRLSSDLSILDFDIPFSIVFVAASGTELLAIIGIMTFVTWQVLVVAIFAMVAVRFVQRYYIATARELIRING 1067 (1231)
Q Consensus       988 ~tP~GrIlNRfS~D~~~iD~~lp~~l~~~~~~~~~~l~~i~vi~~~~~~~~~~~ipl~~~~~~~~~~Y~~tsRelkRl~s 1067 (1231)
                      +||+||||||||||++.||..+|..+.+++.++++++++++++++++|+++++++|+.++|+++|+||+++||||||||+
T Consensus       911 tTP~GRILNRFSkD~~~vD~~Lp~~~~~~~~~~~~~l~~~~vi~~~~P~fli~~~pl~v~~~~~~~~Y~~tsReLkRLes  990 (1381)
T KOG0054|consen  911 TTPTGRILNRFSKDIDTVDVLLPFTLEFFLQSLLNVLGILVVISYVTPWFLIAIIPLGVIYYFVQRYYLATSRELKRLES  990 (1381)
T ss_pred             CCCccchhhhcccchHHHHHhhHHHHHHHHHHHHHHHHHHHHhhHHhHHHHHHHHHHHHHHHHHHHHHHHHhHHHHHhhh
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             cccchHHHHHHHhhcCcchhhccccHHHHHHHHHHHhhhhhchHHHHHHHhHHHHHHHHHHHHHHHHHHHHHHHHhcCCC
Q 000905         1068 TTKAPVMNYTAETSQGVVTIRAFNMVDRFFQNYLKLVDIDASLFFHTNGVMEWLILRVEALQNLTLFTAALFLVLIPRGY 1147 (1231)
Q Consensus      1068 ~srSPi~s~f~Etl~Gl~tIRAf~~~~~f~~~~~~~lD~~~~~~~~~~~~~rWl~~rl~~i~~~~~~~~a~~~v~~~~~~ 1147 (1231)
                      ++|||+|+||+||++|++||||||+|++|+++|++++|.|++++|+..++|||+++|+|++|+++++++|+++++...+.
T Consensus       991 itRSPi~sh~~Etl~GlsTIRAf~~~~rf~~~~~~~~D~~~~~~f~~~~a~RWla~Rle~ig~~~v~~~al~~vl~~~~~ 1070 (1381)
T KOG0054|consen  991 ITRSPIYSHFSETLQGLSTIRAFGKEERFIQENDELIDENSRAFFLSISANRWLAVRLELLGNLVVLIAALFAVLLPSGL 1070 (1381)
T ss_pred             cccchHHHhHHHHhcCcceeeeccccHHHHHHHHHHhhhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccCCC
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999988765444


Q ss_pred             cChhHHHHHHHHHHHHHHHHHHHHHHHHHHhhhchhHHHHHhhhcCCCCCCCCCCCCCCCCCCCCCCeEEEEeEEEEecC
Q 000905         1148 VAPGLVGLSLSYAFTLTGTQVFLSRWYCYLANYIISVERIKQFMHIPPEPPAIVEDKRPPSSWPFKGRIELRQLKVSLHM 1227 (1231)
Q Consensus      1148 ~~~g~~Gl~lsyal~l~~~l~~~vr~~~~lE~~m~SvERi~eY~~l~~E~~~~~~~~~pp~~WP~~G~I~f~~v~~rYr~ 1227 (1231)
                      .+||.+||++|||+++|++++|+||+++++|++|+|||||.||+++|+|+|+.+++.+||++||++|+|+|+||++||||
T Consensus      1071 ~~~g~vGLslsyal~lt~~l~~~vR~~~elEn~m~SVERv~eY~~~~~E~p~~~~~~~pp~~WP~~G~I~f~~~~~RYrp 1150 (1381)
T KOG0054|consen 1071 ISPGLVGLSLSYALQLTGLLQWLVRQSSELENNMVSVERVLEYTDIPSEAPLEIEESRPPPSWPSKGEIEFEDLSLRYRP 1150 (1381)
T ss_pred             CCcchHHHHHHHHHHHHHHHHHHHHHHHHHHhcchhhhHHHHHhcCCCCCCCCCcCCCCCCCCCCCCeEEEEEeEEEeCC
Confidence            88999999999999999999999999999999999999999999999999998887779999999999999999999999


Q ss_pred             CCCC
Q 000905         1228 ELIY 1231 (1231)
Q Consensus      1228 ~l~~ 1231 (1231)
                      ++|.
T Consensus      1151 ~lp~ 1154 (1381)
T KOG0054|consen 1151 NLPL 1154 (1381)
T ss_pred             CCcc
Confidence            9984

>PLN03130 ABC transporter C family member; Provisional Back     alignment and domain information
>PLN03232 ABC transporter C family member; Provisional Back     alignment and domain information
>TIGR00957 MRP_assoc_pro multi drug resistance-associated protein (MRP) Back     alignment and domain information
>TIGR01271 CFTR_protein cystic fibrosis transmembrane conductor regulator (CFTR) Back     alignment and domain information
>PTZ00243 ABC transporter; Provisional Back     alignment and domain information
>KOG0055 consensus Multidrug/pheromone exporter, ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PTZ00265 multidrug resistance protein (mdr1); Provisional Back     alignment and domain information
>KOG0058 consensus Peptide exporter, ABC superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK11174 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed Back     alignment and domain information
>COG2274 SunT ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain [Defense mechanisms] Back     alignment and domain information
>KOG0055 consensus Multidrug/pheromone exporter, ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>TIGR03797 NHPM_micro_ABC2 NHPM bacteriocin system ABC transporter, ATP-binding protein Back     alignment and domain information
>TIGR00958 3a01208 Conjugate Transporter-2 (CT2) Family protein Back     alignment and domain information
>TIGR03796 NHPM_micro_ABC1 NHPM bacteriocin system ABC transporter, peptidase/ATP-binding protein Back     alignment and domain information
>TIGR03375 type_I_sec_LssB type I secretion system ATPase, LssB family Back     alignment and domain information
>TIGR01193 bacteriocin_ABC ABC-type bacteriocin transporter Back     alignment and domain information
>COG1132 MdlB ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms] Back     alignment and domain information
>PRK11176 lipid transporter ATP-binding/permease protein; Provisional Back     alignment and domain information
>PRK10790 putative multidrug transporter membrane\ATP-binding components; Provisional Back     alignment and domain information
>PRK11160 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed Back     alignment and domain information
>COG4988 CydD ABC-type transport system involved in cytochrome bd biosynthesis, ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02203 MsbA_lipidA lipid A export permease/ATP-binding protein MsbA Back     alignment and domain information
>TIGR02204 MsbA_rel ABC transporter, permease/ATP-binding protein Back     alignment and domain information
>TIGR01846 type_I_sec_HlyB type I secretion system ABC transporter, HlyB family Back     alignment and domain information
>PRK13657 cyclic beta-1,2-glucan ABC transporter; Provisional Back     alignment and domain information
>PTZ00265 multidrug resistance protein (mdr1); Provisional Back     alignment and domain information
>TIGR02868 CydC thiol reductant ABC exporter, CydC subunit Back     alignment and domain information
>PRK10789 putative multidrug transporter membrane\ATP-binding components; Provisional Back     alignment and domain information
>TIGR01192 chvA glucan exporter ATP-binding protein Back     alignment and domain information
>KOG0056 consensus Heavy metal exporter HMT1, ABC superfamily [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG4987 CydC ABC-type transport system involved in cytochrome bd biosynthesis, fused ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0057 consensus Mitochondrial Fe/S cluster exporter, ABC superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>TIGR00957 MRP_assoc_pro multi drug resistance-associated protein (MRP) Back     alignment and domain information
>TIGR01842 type_I_sec_PrtD type I secretion system ABC transporter, PrtD family Back     alignment and domain information
>TIGR02857 CydD thiol reductant ABC exporter, CydD subunit Back     alignment and domain information
>PLN03130 ABC transporter C family member; Provisional Back     alignment and domain information
>PLN03232 ABC transporter C family member; Provisional Back     alignment and domain information
>PTZ00243 ABC transporter; Provisional Back     alignment and domain information
>COG4618 ArpD ABC-type protease/lipase transport system, ATPase and permease components [General function prediction only] Back     alignment and domain information
>TIGR01271 CFTR_protein cystic fibrosis transmembrane conductor regulator (CFTR) Back     alignment and domain information
>TIGR01194 cyc_pep_trnsptr cyclic peptide transporter Back     alignment and domain information
>COG5265 ATM1 ABC-type transport system involved in Fe-S cluster assembly, permease and ATPase components [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0054 consensus Multidrug resistance-associated protein/mitoxantrone resistance protein, ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK10522 multidrug transporter membrane component/ATP-binding component; Provisional Back     alignment and domain information
>TIGR00954 3a01203 Peroxysomal Fatty Acyl CoA Transporter (FAT) Family protei Back     alignment and domain information
>PRK14257 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03289 ABCC_CFTR2 The CFTR subfamily domain 2 Back     alignment and domain information
>COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>cd03252 ABCC_Hemolysin The ABC-transporter hemolysin B is a central component of the secretion machinery that translocates the toxin, hemolysin A, in a Sec-independent fashion across both membranes of E Back     alignment and domain information
>cd03291 ABCC_CFTR1 The CFTR subfamily domain 1 Back     alignment and domain information
>cd03288 ABCC_SUR2 The SUR domain 2 Back     alignment and domain information
>cd03250 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C Back     alignment and domain information
>COG1135 AbcC ABC-type metal ion transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG1116 TauB ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd03251 ABCC_MsbA MsbA is an essential ABC transporter, closely related to eukaryotic MDR proteins Back     alignment and domain information
>cd03254 ABCC_Glucan_exporter_like Glucan exporter ATP-binding protein Back     alignment and domain information
>cd03253 ABCC_ATM1_transporter ATM1 is an ABC transporter that is expressed in the mitochondria Back     alignment and domain information
>COG1125 OpuBA ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>cd03249 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) is a mitochondrial ATP-binding cassette protein involved in iron homeostasis and one of four ABC transporters expressed in the mitochondrial inner membrane, the other three being MDL1(ABC7), MDL2, and ATM1 Back     alignment and domain information
>cd03244 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C Back     alignment and domain information
>COG1117 PstB ABC-type phosphate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG3840 ThiQ ABC-type thiamine transport system, ATPase component [Coenzyme metabolism] Back     alignment and domain information
>COG1120 FepC ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>COG3839 MalK ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd03245 ABCC_bacteriocin_exporters ABC-type bacteriocin exporters Back     alignment and domain information
>COG1121 ZnuC ABC-type Mn/Zn transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK13631 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG1136 SalX ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>TIGR02314 ABC_MetN D-methionine ABC transporter, ATP-binding protein Back     alignment and domain information
>COG1127 Ttg2A ABC-type transport system involved in resistance to organic solvents, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>COG3842 PotA ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>PRK11650 ugpC glycerol-3-phosphate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG1122 CbiO ABC-type cobalt transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd03261 ABC_Org_Solvent_Resistant ABC (ATP-binding cassette) transport system involved in resistant to organic solvents; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>COG1118 CysA ABC-type sulfate/molybdate transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG4615 PvdE ABC-type siderophore export system, fused ATPase and permease components [Secondary metabolites biosynthesis, transport, and catabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR01186 proV glycine betaine/L-proline transport ATP binding subunit Back     alignment and domain information
>PRK13650 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03290 ABCC_SUR1_N The SUR domain 1 Back     alignment and domain information
>COG1124 DppF ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>COG4178 ABC-type uncharacterized transport system, permease and ATPase components [General function prediction only] Back     alignment and domain information
>cd03248 ABCC_TAP TAP, the Transporter Associated with Antigen Processing; TAP is essential for peptide delivery from the cytosol into the lumen of the endoplasmic reticulum (ER), where these peptides are loaded on major histocompatibility complex (MHC) I molecules Back     alignment and domain information
>cd03260 ABC_PstB_phosphate_transporter Phosphate uptake is of fundamental importance in the cell physiology of bacteria because phosphate is required as a nutrient Back     alignment and domain information
>PRK11432 fbpC ferric transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13637 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03369 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-type transporter 1) Back     alignment and domain information
>PRK13634 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13643 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14269 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03296 ABC_CysA_sulfate_importer Part of the ABC transporter complex cysAWTP involved in sulfate import Back     alignment and domain information
>PRK09452 potA putrescine/spermidine ABC transporter ATPase protein; Reviewed Back     alignment and domain information
>PRK13647 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR00972 3a0107s01c2 phosphate ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK13635 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14242 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR03265 PhnT2 putative 2-aminoethylphosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK13646 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03219 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC transporter subfamily is involved in the transport of the hydrophobic amino acids leucine, isoleucine and valine Back     alignment and domain information
>PRK14273 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03263 ABC_subfamily_A The ABCA subfamily mediates the transport of a variety of lipid compounds Back     alignment and domain information
>PRK10851 sulfate/thiosulfate transporter subunit; Provisional Back     alignment and domain information
>TIGR03258 PhnT 2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT Back     alignment and domain information
>TIGR00960 3a0501s02 Type II (General) Secretory Pathway (IISP) Family protein Back     alignment and domain information
>cd03226 ABC_cobalt_CbiO_domain2 Domain II of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota Back     alignment and domain information
>PRK11000 maltose/maltodextrin transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03259 ABC_Carb_Solutes_like ABC Carbohydrate and Solute Transporters-like subgroup Back     alignment and domain information
>PRK10744 pstB phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11153 metN DL-methionine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14250 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG3638 ABC-type phosphate/phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK13651 cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03293 ABC_NrtD_SsuB_transporters NrtD and SsuB are the ATP-binding subunits of the bacterial ABC-type nitrate and sulfonate transport systems, respectively Back     alignment and domain information
>cd03255 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of liporoteins from the cytoplasmic membrane (LolCDE) Back     alignment and domain information
>PRK14235 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03256 ABC_PhnC_transporter ABC-type phosphate/phosphonate transport system Back     alignment and domain information
>PRK13636 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR02315 ABC_phnC phosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>cd03294 ABC_Pro_Gly_Bertaine This family comprises the glycine betaine/L-proline ATP binding subunit in bacteria and its equivalents in archaea Back     alignment and domain information
>cd03258 ABC_MetN_methionine_transporter MetN (also known as YusC) is an ABC-type transporter encoded by metN of the metNPQ operon in Bacillus subtilis that is involved in methionine transport Back     alignment and domain information
>TIGR03864 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system Back     alignment and domain information
>cd03265 ABC_DrrA DrrA is the ATP-binding protein component of a bacterial exporter complex that confers resistance to the antibiotics daunorubicin and doxorubicin Back     alignment and domain information
>PRK13642 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03224 ABC_TM1139_LivF_branched LivF (TM1139) is part of the LIV-I bacterial ABC-type two-component transport system that imports neutral, branched-chain amino acids Back     alignment and domain information
>PRK13644 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14237 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11629 lolD lipoprotein transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13633 cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03268 ABC_BcrA_bacitracin_resist The BcrA subfamily represents ABC transporters involved in peptide antibiotic resistance Back     alignment and domain information
>PRK13640 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14239 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14274 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14245 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13632 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11607 potG putrescine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14251 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03247 ABCC_cytochrome_bd The CYD subfamily implicated in cytochrome bd biogenesis Back     alignment and domain information
>cd03266 ABC_NatA_sodium_exporter NatA is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled proton or K+ uptake Back     alignment and domain information
>cd03301 ABC_MalK_N The N-terminal ATPase domain of the maltose transporter, MalK Back     alignment and domain information
>PRK14268 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03295 ABC_OpuCA_Osmoprotection OpuCA is a the ATP binding component of a bacterial solute transporter that serves a protective role to cells growing in a hyperosmolar environment Back     alignment and domain information
>COG2884 FtsE Predicted ATPase involved in cell division [Cell division and chromosome partitioning] Back     alignment and domain information
>PRK14248 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03235 ABC_Metallic_Cations ABC component of the metal-type transporters Back     alignment and domain information
>PRK14236 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03264 ABC_drug_resistance_like ABC-type multidrug transport system, ATPase component Back     alignment and domain information
>PRK13645 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14240 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR03411 urea_trans_UrtD urea ABC transporter, ATP-binding protein UrtD Back     alignment and domain information
>PRK11247 ssuB aliphatic sulfonates transport ATP-binding subunit; Provisional Back     alignment and domain information
>cd03218 ABC_YhbG The ABC transporters belonging to the YhbG family are similar to members of the Mj1267_LivG family, which is involved in the transport of branched-chain amino acids Back     alignment and domain information
>PRK13648 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13649 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR02211 LolD_lipo_ex lipoprotein releasing system, ATP-binding protein Back     alignment and domain information
>PRK13641 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK09493 glnQ glutamine ABC transporter ATP-binding protein; Reviewed Back     alignment and domain information
>PRK14244 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10619 histidine/lysine/arginine/ornithine transporter subunit; Provisional Back     alignment and domain information
>PRK14270 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13652 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14249 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK09536 btuD corrinoid ABC transporter ATPase; Reviewed Back     alignment and domain information
>PRK14238 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13537 nodulation ABC transporter NodI; Provisional Back     alignment and domain information
>cd03298 ABC_ThiQ_thiamine_transporter ABC-type thiamine tranport system; part of the binding-protein-dependent transport system tbpA-thiPQ for thiamine and TPP Back     alignment and domain information
>PRK14259 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03292 ABC_FtsE_transporter FtsE is a hydrophilic nucleotide-binding protein that binds FtsX to form a heterodimeric ATP-binding cassette (ABC)-type transporter that associates with the bacterial inner membrane Back     alignment and domain information
>PRK14267 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11124 artP arginine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03269 ABC_putative_ATPase This subfamily is involved in drug resistance, nodulation, lipid transport, and bacteriocin and lantibiotic immunity Back     alignment and domain information
>TIGR03415 ABC_choXWV_ATP choline ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK14247 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR03410 urea_trans_UrtE urea ABC transporter, ATP-binding protein UrtE Back     alignment and domain information
>PRK10070 glycine betaine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR02769 nickel_nikE nickel import ATP-binding protein NikE Back     alignment and domain information
>PRK10771 thiQ thiamine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR03005 ectoine_ehuA ectoine/hydroxyectoine ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK14253 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK15079 oligopeptide ABC transporter ATP-binding protein OppF; Provisional Back     alignment and domain information
>PRK10247 putative ABC transporter ATP-binding protein YbbL; Provisional Back     alignment and domain information
>PRK10575 iron-hydroxamate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14243 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14261 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11300 livG leucine/isoleucine/valine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13639 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14262 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11831 putative ABC transporter ATP-binding protein YrbF; Provisional Back     alignment and domain information
>PRK11264 putative amino-acid ABC transporter ATP-binding protein YecC; Provisional Back     alignment and domain information
>PRK11231 fecE iron-dicitrate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK10584 putative ABC transporter ATP-binding protein YbbA; Provisional Back     alignment and domain information
>TIGR01288 nodI ATP-binding ABC transporter family nodulation protein NodI Back     alignment and domain information
>PRK14271 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03223 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette transporter (Pat) is involved in the import of very long-chain fatty acids (VLCFA) into the peroxisome Back     alignment and domain information
>PRK14252 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR02673 FtsE cell division ATP-binding protein FtsE Back     alignment and domain information
>PRK13638 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03225 ABC_cobalt_CbiO_domain1 Domain I of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota Back     alignment and domain information
>PRK14254 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14256 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR00968 3a0106s01 sulfate ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK11614 livF leucine/isoleucine/valine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03300 ABC_PotA_N PotA is an ABC-type transporter and the ATPase component of the spermidine/putrescine-preferential uptake system consisting of PotA, -B, -C, and -D Back     alignment and domain information
>cd03257 ABC_NikE_OppD_transporters The ABC transporter subfamily specific for the transport of dipeptides, oligopeptides (OppD), and nickel (NikDE) Back     alignment and domain information
>PRK10253 iron-enterobactin transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14266 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14264 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13536 nodulation factor exporter subunit NodI; Provisional Back     alignment and domain information
>PRK09984 phosphonate/organophosphate ester transporter subunit; Provisional Back     alignment and domain information
>TIGR03873 F420-0_ABC_ATP proposed F420-0 ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK14263 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13548 hmuV hemin importer ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR03522 GldA_ABC_ATP gliding motility-associated ABC transporter ATP-binding subunit GldA Back     alignment and domain information
>PRK10895 lipopolysaccharide ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR01277 thiQ thiamine ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK14275 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03299 ABC_ModC_like Archeal protein closely related to ModC Back     alignment and domain information
>PRK10908 cell division protein FtsE; Provisional Back     alignment and domain information
>PRK11308 dppF dipeptide transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR01978 sufC FeS assembly ATPase SufC Back     alignment and domain information
>cd03246 ABCC_Protease_Secretion This family represents the ABC component of the protease secretion system PrtD, a 60-kDa integral membrane protein sharing 37% identity with HlyB, the ABC component of the alpha-hemolysin secretion pathway, in the C-terminal domain Back     alignment and domain information
>PRK14260 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11144 modC molybdate transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR03740 galliderm_ABC gallidermin-class lantibiotic protection ABC transporter, ATP-binding subunit Back     alignment and domain information
>cd03262 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP-binding components of the bacterial periplasmic histidine and glutamine permeases, repectively Back     alignment and domain information
>PRK10418 nikD nickel transporter ATP-binding protein NikD; Provisional Back     alignment and domain information
>PRK11248 tauB taurine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK09544 znuC high-affinity zinc transporter ATPase; Reviewed Back     alignment and domain information
>PRK14272 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK15112 antimicrobial peptide ABC system ATP-binding protein SapF; Provisional Back     alignment and domain information
>PRK14255 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14265 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14241 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR01188 drrA daunorubicin resistance ABC transporter ATP-binding subunit Back     alignment and domain information
>PRK11022 dppD dipeptide transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11701 phnK phosphonate C-P lyase system protein PhnK; Provisional Back     alignment and domain information
>COG1131 CcmA ABC-type multidrug transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>TIGR02982 heterocyst_DevA ABC exporter ATP-binding subunit, DevA family Back     alignment and domain information
>PRK09473 oppD oligopeptide transporter ATP-binding component; Provisional Back     alignment and domain information
>cd03234 ABCG_White The White subfamily represents ABC transporters homologous to the Drosophila white gene, which acts as a dimeric importer for eye pigment precursors Back     alignment and domain information
>PRK14246 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10419 nikE nickel transporter ATP-binding protein NikE; Provisional Back     alignment and domain information
>PRK15093 antimicrobial peptide ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13547 hmuV hemin importer ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14258 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK15056 manganese/iron transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13546 teichoic acids export protein ATP-binding subunit; Provisional Back     alignment and domain information
>cd03233 ABC_PDR_domain1 The pleiotropic drug resistance (PDR) family of ATP-binding cassette (ABC) transporters Back     alignment and domain information
>TIGR02142 modC_ABC molybdenum ABC transporter, ATP-binding protein Back     alignment and domain information
>COG0410 LivF ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>cd03213 ABCG_EPDR ABCG transporters are involved in eye pigment (EP) precursor transport, regulation of lipid-trafficking mechanisms, and pleiotropic drug resistance (DR) Back     alignment and domain information
>cd03230 ABC_DR_subfamily_A This family of ATP-binding proteins belongs to a multisubunit transporter involved in drug resistance (BcrA and DrrA), nodulation, lipid transport, and lantibiotic immunity Back     alignment and domain information
>cd03232 ABC_PDR_domain2 The pleiotropic drug resistance-like (PDR) family of ATP-binding cassette (ABC) transporters Back     alignment and domain information
>cd03297 ABC_ModC_molybdenum_transporter ModC is an ABC-type transporter and the ATPase component of a molybdate transport system that also includes the periplasmic binding protein ModA and the membrane protein ModB Back     alignment and domain information
>cd03228 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-like transporters are involved in drug, peptide, and lipid export Back     alignment and domain information
>PRK13545 tagH teichoic acids export protein ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR02323 CP_lyasePhnK phosphonate C-P lyase system protein PhnK Back     alignment and domain information
>COG4175 ProV ABC-type proline/glycine betaine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>cd03229 ABC_Class3 This class is comprised of all BPD (Binding Protein Dependent) systems that are largely represented in archaea and eubacteria and are primarily involved in scavenging solutes from the environment Back     alignment and domain information
>TIGR02770 nickel_nikD nickel import ATP-binding protein NikD Back     alignment and domain information
>cd03215 ABC_Carb_Monos_II This family represents domain II of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information
>TIGR01184 ntrCD nitrate transport ATP-binding subunits C and D Back     alignment and domain information
>CHL00131 ycf16 sulfate ABC transporter protein; Validated Back     alignment and domain information
>TIGR00955 3a01204 The Eye Pigment Precursor Transporter (EPP) Family protein Back     alignment and domain information
>TIGR03608 L_ocin_972_ABC putative bacteriocin export ABC transporter, lactococcin 972 group Back     alignment and domain information
>PRK15439 autoinducer 2 ABC transporter ATP-binding protein LsrA; Provisional Back     alignment and domain information
>PRK09580 sufC cysteine desulfurase ATPase component; Reviewed Back     alignment and domain information
>cd03217 ABC_FeS_Assembly ABC-type transport system involved in Fe-S cluster assembly, ATPase component Back     alignment and domain information
>cd03220 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transporter subfamily is involved in extracellular polysaccharide export Back     alignment and domain information
>PRK03695 vitamin B12-transporter ATPase; Provisional Back     alignment and domain information
>COG4619 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>PRK10261 glutathione transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13549 xylose transporter ATP-binding subunit; Provisional Back     alignment and domain information
>KOG0060 consensus Long-chain acyl-CoA transporter, ABC superfamily (involved in peroxisome organization and biogenesis) [Lipid transport and metabolism; General function prediction only] Back     alignment and domain information
>cd03267 ABC_NatA_like Similar in sequence to NatA, this is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled to proton or K+ uptake Back     alignment and domain information
>PRK10261 glutathione transporter ATP-binding protein; Provisional Back     alignment and domain information
>PLN03211 ABC transporter G-25; Provisional Back     alignment and domain information
>COG4555 NatA ABC-type Na+ transport system, ATPase component [Energy production and conversion / Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK09700 D-allose transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13540 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>PRK10762 D-ribose transporter ATP binding protein; Provisional Back     alignment and domain information
>COG1123 ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] Back     alignment and domain information
>cd03231 ABC_CcmA_heme_exporter CcmA, the ATP-binding component of the bacterial CcmAB transporter Back     alignment and domain information
>PRK13543 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>cd03214 ABC_Iron-Siderophores_B12_Hemin ABC transporters, involved in the uptake of siderophores, heme, and vitamin B12, are widely conserved in bacteria and archaea Back     alignment and domain information
>PRK10982 galactose/methyl galaxtoside transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13539 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>PRK11288 araG L-arabinose transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13538 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>cd03216 ABC_Carb_Monos_I This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information
>PRK13541 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>cd03237 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 of RNase L inhibitor Back     alignment and domain information
>TIGR02633 xylG D-xylose ABC transporter, ATP-binding protein Back     alignment and domain information
>TIGR03771 anch_rpt_ABC anchored repeat-type ABC transporter, ATP-binding subunit Back     alignment and domain information
>TIGR03269 met_CoM_red_A2 methyl coenzyme M reductase system, component A2 Back     alignment and domain information
>COG1137 YhbG ABC-type (unclassified) transport system, ATPase component [General function prediction only] Back     alignment and domain information
>TIGR02324 CP_lyasePhnL phosphonate C-P lyase system protein PhnL Back     alignment and domain information
>PRK10938 putative molybdenum transport ATP-binding protein ModF; Provisional Back     alignment and domain information
>PRK15134 microcin C ABC transporter ATP-binding protein YejF; Provisional Back     alignment and domain information
>PRK15134 microcin C ABC transporter ATP-binding protein YejF; Provisional Back     alignment and domain information
>TIGR03269 met_CoM_red_A2 methyl coenzyme M reductase system, component A2 Back     alignment and domain information
>PRK11819 putative ABC transporter ATP-binding protein; Reviewed Back     alignment and domain information
>TIGR01189 ccmA heme ABC exporter, ATP-binding protein CcmA Back     alignment and domain information
>TIGR03719 ABC_ABC_ChvD ATP-binding cassette protein, ChvD family Back     alignment and domain information
>COG4181 Predicted ABC-type transport system involved in lysophospholipase L1 biosynthesis, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PRK13549 xylose transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK15064 ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG4525 TauB ABC-type taurine transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG1123 ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] Back     alignment and domain information
>PRK15177 Vi polysaccharide export ATP-binding protein VexC; Provisional Back     alignment and domain information
>COG4559 ABC-type hemin transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK15064 ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG4148 ModC ABC-type molybdate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG4598 HisP ABC-type histidine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>COG0444 DppD ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR01166 cbiO cobalt transport protein ATP-binding subunit Back     alignment and domain information
>TIGR01257 rim_protein retinal-specific rim ABC transporter Back     alignment and domain information
>cd03221 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth Back     alignment and domain information
>PRK10535 macrolide transporter ATP-binding /permease protein; Provisional Back     alignment and domain information
>COG0411 LivG ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR00956 3a01205 Pleiotropic Drug Resistance (PDR) Family protein Back     alignment and domain information
>COG4161 ArtP ABC-type arginine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>COG4608 AppF ABC-type oligopeptide transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR01187 potA spermidine/putrescine ABC transporter ATP-binding subunit Back     alignment and domain information
>TIGR01257 rim_protein retinal-specific rim ABC transporter Back     alignment and domain information
>PRK09700 D-allose transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR02633 xylG D-xylose ABC transporter, ATP-binding protein Back     alignment and domain information
>COG1129 MglA ABC-type sugar transport system, ATPase component [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK10762 D-ribose transporter ATP binding protein; Provisional Back     alignment and domain information
>PRK11288 araG L-arabinose transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG4172 ABC-type uncharacterized transport system, duplicated ATPase component [General function prediction only] Back     alignment and domain information
>PRK11819 putative ABC transporter ATP-binding protein; Reviewed Back     alignment and domain information
>TIGR03719 ABC_ABC_ChvD ATP-binding cassette protein, ChvD family Back     alignment and domain information
>PLN03073 ABC transporter F family; Provisional Back     alignment and domain information
>TIGR00956 3a01205 Pleiotropic Drug Resistance (PDR) Family protein Back     alignment and domain information
>cd03236 ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 of RNase L inhibitor Back     alignment and domain information
>cd03222 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor (RLI) is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids Back     alignment and domain information
>PRK10636 putative ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK15439 autoinducer 2 ABC transporter ATP-binding protein LsrA; Provisional Back     alignment and domain information
>COG4604 CeuD ABC-type enterochelin transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK10938 putative molybdenum transport ATP-binding protein ModF; Provisional Back     alignment and domain information
>PRK13409 putative ATPase RIL; Provisional Back     alignment and domain information
>cd03238 ABC_UvrA The excision repair protein UvrA; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion Back     alignment and domain information
>PRK11147 ABC transporter ATPase component; Reviewed Back     alignment and domain information
>PRK10636 putative ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10982 galactose/methyl galaxtoside transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG3845 ABC-type uncharacterized transport systems, ATPase components [General function prediction only] Back     alignment and domain information
>PLN03140 ABC transporter G family member; Provisional Back     alignment and domain information
>PRK11147 ABC transporter ATPase component; Reviewed Back     alignment and domain information
>COG1134 TagH ABC-type polysaccharide/polyol phosphate transport system, ATPase component [Carbohydrate transport and metabolism / Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>cd00267 ABC_ATPase ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>COG4136 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>COG1101 PhnK ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>COG0488 Uup ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] Back     alignment and domain information
>COG4167 SapF ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>COG4152 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>PLN03140 ABC transporter G family member; Provisional Back     alignment and domain information
>PRK13409 putative ATPase RIL; Provisional Back     alignment and domain information
>COG1119 ModF ABC-type molybdenum transport system, ATPase component/photorepair protein PhrA [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG0061 consensus Transporter, ABC superfamily (Breast cancer resistance protein) [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>COG4172 ABC-type uncharacterized transport system, duplicated ATPase component [General function prediction only] Back     alignment and domain information
>PLN03073 ABC transporter F family; Provisional Back     alignment and domain information
>cd03270 ABC_UvrA_I The excision repair protein UvrA domain I; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion Back     alignment and domain information
>COG4674 Uncharacterized ABC-type transport system, ATPase component [General function prediction only] Back     alignment and domain information
>PF00005 ABC_tran: ABC transporter This structure is on hold until Dec 1999; InterPro: IPR003439 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energise diverse biological systems Back     alignment and domain information
>KOG0064 consensus Peroxisomal long-chain acyl-CoA transporter, ABC superfamily [Lipid transport and metabolism] Back     alignment and domain information
>COG0488 Uup ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] Back     alignment and domain information
>cd03271 ABC_UvrA_II The excision repair protein UvrA domain II; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion Back     alignment and domain information
>COG0396 sufC Cysteine desulfurase activator ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG4133 CcmA ABC-type transport system involved in cytochrome c biogenesis, ATPase component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG4586 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>COG4107 PhnK ABC-type phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd03278 ABC_SMC_barmotin Barmotin is a tight junction-associated protein expressed in rat epithelial cells which is thought to have an important regulatory role in tight junction barrier function Back     alignment and domain information
>cd03272 ABC_SMC3_euk Eukaryotic SMC3 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains Back     alignment and domain information
>cd03279 ABC_sbcCD SbcCD and other Mre11/Rad50 (MR) complexes are implicated in the metabolism of DNA ends Back     alignment and domain information
>COG4778 PhnL ABC-type phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG0059 consensus Lipid exporter ABCA1 and related proteins, ABC superfamily [Lipid transport and metabolism; General function prediction only] Back     alignment and domain information
>KOG0058 consensus Peptide exporter, ABC superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK00349 uvrA excinuclease ABC subunit A; Reviewed Back     alignment and domain information
>cd03240 ABC_Rad50 The catalytic domains of Rad50 are similar to the ATP-binding cassette of ABC transporters, but are not associated with membrane-spanning domains Back     alignment and domain information
>KOG0927 consensus Predicted transporter (ABC superfamily) [General function prediction only] Back     alignment and domain information
>cd03273 ABC_SMC2_euk Eukaryotic SMC2 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains Back     alignment and domain information
>TIGR00958 3a01208 Conjugate Transporter-2 (CT2) Family protein Back     alignment and domain information
>cd03275 ABC_SMC1_euk Eukaryotic SMC1 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains Back     alignment and domain information
>PRK00635 excinuclease ABC subunit A; Provisional Back     alignment and domain information
>TIGR00630 uvra excinuclease ABC, A subunit Back     alignment and domain information
>cd03274 ABC_SMC4_euk Eukaryotic SMC4 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains Back     alignment and domain information
>KOG0065 consensus Pleiotropic drug resistance proteins (PDR1-15), ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>COG1129 MglA ABC-type sugar transport system, ATPase component [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR02868 CydC thiol reductant ABC exporter, CydC subunit Back     alignment and domain information
>TIGR01193 bacteriocin_ABC ABC-type bacteriocin transporter Back     alignment and domain information
>PRK10790 putative multidrug transporter membrane\ATP-binding components; Provisional Back     alignment and domain information
>TIGR02203 MsbA_lipidA lipid A export permease/ATP-binding protein MsbA Back     alignment and domain information
>cd03239 ABC_SMC_head The structural maintenance of chromosomes (SMC) proteins are essential for successful chromosome transmission during replication and segregation of the genome in all organisms Back     alignment and domain information
>PF00664 ABC_membrane: ABC transporter transmembrane region; InterPro: IPR001140 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energise diverse biological systems Back     alignment and domain information
>KOG0927 consensus Predicted transporter (ABC superfamily) [General function prediction only] Back     alignment and domain information
>TIGR03796 NHPM_micro_ABC1 NHPM bacteriocin system ABC transporter, peptidase/ATP-binding protein Back     alignment and domain information
>cd03276 ABC_SMC6_euk Eukaryotic SMC6 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains Back     alignment and domain information
>COG4138 BtuD ABC-type cobalamin transport system, ATPase component [Coenzyme metabolism] Back     alignment and domain information
>KOG0066 consensus eIF2-interacting protein ABC50 (ABC superfamily) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR02857 CydD thiol reductant ABC exporter, CydD subunit Back     alignment and domain information
>COG3845 ABC-type uncharacterized transport systems, ATPase components [General function prediction only] Back     alignment and domain information
>TIGR01846 type_I_sec_HlyB type I secretion system ABC transporter, HlyB family Back     alignment and domain information
>TIGR03797 NHPM_micro_ABC2 NHPM bacteriocin system ABC transporter, ATP-binding protein Back     alignment and domain information
>TIGR02204 MsbA_rel ABC transporter, permease/ATP-binding protein Back     alignment and domain information
>KOG0062 consensus ATPase component of ABC transporters with duplicated ATPase domains/Translation elongation factor EF-3b [Amino acid transport and metabolism; Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK11174 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed Back     alignment and domain information
>TIGR03375 type_I_sec_LssB type I secretion system ATPase, LssB family Back     alignment and domain information
>PRK11160 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed Back     alignment and domain information
>PRK11176 lipid transporter ATP-binding/permease protein; Provisional Back     alignment and domain information
>KOG0062 consensus ATPase component of ABC transporters with duplicated ATPase domains/Translation elongation factor EF-3b [Amino acid transport and metabolism; Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR01192 chvA glucan exporter ATP-binding protein Back     alignment and domain information
>COG2274 SunT ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain [Defense mechanisms] Back     alignment and domain information
>TIGR01194 cyc_pep_trnsptr cyclic peptide transporter Back     alignment and domain information
>COG1245 Predicted ATPase, RNase L inhibitor (RLI) homolog [General function prediction only] Back     alignment and domain information
>PRK13657 cyclic beta-1,2-glucan ABC transporter; Provisional Back     alignment and domain information
>PRK10789 putative multidrug transporter membrane\ATP-binding components; Provisional Back     alignment and domain information
>COG1132 MdlB ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms] Back     alignment and domain information
>PF00664 ABC_membrane: ABC transporter transmembrane region; InterPro: IPR001140 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energise diverse biological systems Back     alignment and domain information
>cd03280 ABC_MutS2 MutS2 homologs in bacteria and eukaryotes Back     alignment and domain information
>cd03277 ABC_SMC5_euk Eukaryotic SMC5 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains Back     alignment and domain information
>cd01128 rho_factor Transcription termination factor rho is a bacterial ATP-dependent RNA/DNA helicase Back     alignment and domain information
>KOG2355 consensus Predicted ABC-type transport, ATPase component/CCR4 associated factor [General function prediction only; Transcription] Back     alignment and domain information
>COG0178 UvrA Excinuclease ATPase subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK00635 excinuclease ABC subunit A; Provisional Back     alignment and domain information
>KOG0065 consensus Pleiotropic drug resistance proteins (PDR1-15), ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>cd03241 ABC_RecN RecN ATPase involved in DNA repair; ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds including sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>PRK10522 multidrug transporter membrane component/ATP-binding component; Provisional Back     alignment and domain information
>COG2401 ABC-type ATPase fused to a predicted acetyltransferase domain [General function prediction only] Back     alignment and domain information
>cd03227 ABC_Class2 ABC-type Class 2 contains systems involved in cellular processes other than transport Back     alignment and domain information
>TIGR01842 type_I_sec_PrtD type I secretion system ABC transporter, PrtD family Back     alignment and domain information
>COG1245 Predicted ATPase, RNase L inhibitor (RLI) homolog [General function prediction only] Back     alignment and domain information
>TIGR00954 3a01203 Peroxysomal Fatty Acyl CoA Transporter (FAT) Family protei Back     alignment and domain information
>cd03285 ABC_MSH2_euk MutS2 homolog in eukaryotes Back     alignment and domain information
>cd03242 ABC_RecF RecF is a recombinational DNA repair ATPase that maintains replication in the presence of DNA damage Back     alignment and domain information
>COG4170 SapD ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>cd03243 ABC_MutS_homologs The MutS protein initiates DNA mismatch repair by recognizing mispaired and unpaired bases embedded in duplex DNA and activating endo- and exonucleases to remove the mismatch Back     alignment and domain information
>cd03283 ABC_MutS-like MutS-like homolog in eukaryotes Back     alignment and domain information
>TIGR00630 uvra excinuclease ABC, A subunit Back     alignment and domain information
>PRK00349 uvrA excinuclease ABC subunit A; Reviewed Back     alignment and domain information
>cd03282 ABC_MSH4_euk MutS4 homolog in eukaryotes Back     alignment and domain information
>PF02463 SMC_N: RecF/RecN/SMC N terminal domain; InterPro: IPR003395 This domain is found at the N terminus of structural maintenance of chromosomes (SMC) proteins, which function together with other proteins in a range of chromosomal transactions, including chromosome condensation, sister-chromatid cohesion, recombination, DNA repair and epigenetic silencing of gene expression [] Back     alignment and domain information
>TIGR00606 rad50 rad50 Back     alignment and domain information
>KOG0066 consensus eIF2-interacting protein ABC50 (ABC superfamily) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd00820 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPCK), a critical gluconeogenic enzyme, catalyzes the first committed step in the diversion of tricarboxylic acid cycle intermediates toward gluconeogenesis Back     alignment and domain information
>cd03284 ABC_MutS1 MutS1 homolog in eukaryotes Back     alignment and domain information
>TIGR02858 spore_III_AA stage III sporulation protein AA Back     alignment and domain information
>KOG0063 consensus RNAse L inhibitor, ABC superfamily [RNA processing and modification] Back     alignment and domain information
>COG4987 CydC ABC-type transport system involved in cytochrome bd biosynthesis, fused ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK00064 recF recombination protein F; Reviewed Back     alignment and domain information
>PHA02562 46 endonuclease subunit; Provisional Back     alignment and domain information
>COG4988 CydD ABC-type transport system involved in cytochrome bd biosynthesis, ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd03281 ABC_MSH5_euk MutS5 homolog in eukaryotes Back     alignment and domain information
>TIGR01069 mutS2 MutS2 family protein Back     alignment and domain information
>smart00534 MUTSac ATPase domain of DNA mismatch repair MUTS family Back     alignment and domain information
>KOG0056 consensus Heavy metal exporter HMT1, ABC superfamily [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK13695 putative NTPase; Provisional Back     alignment and domain information
>cd03287 ABC_MSH3_euk MutS3 homolog in eukaryotes Back     alignment and domain information
>TIGR00634 recN DNA repair protein RecN Back     alignment and domain information
>PRK10869 recombination and repair protein; Provisional Back     alignment and domain information
>PRK07721 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>PRK00409 recombination and DNA strand exchange inhibitor protein; Reviewed Back     alignment and domain information
>KOG0063 consensus RNAse L inhibitor, ABC superfamily [RNA processing and modification] Back     alignment and domain information
>PTZ00132 GTP-binding nuclear protein Ran; Provisional Back     alignment and domain information
>COG0178 UvrA Excinuclease ATPase subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK08533 flagellar accessory protein FlaH; Reviewed Back     alignment and domain information
>TIGR02788 VirB11 P-type DNA transfer ATPase VirB11 Back     alignment and domain information
>COG4615 PvdE ABC-type siderophore export system, fused ATPase and permease components [Secondary metabolites biosynthesis, transport, and catabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs Back     alignment and domain information
>PRK01156 chromosome segregation protein; Provisional Back     alignment and domain information
>PRK13830 conjugal transfer protein TrbE; Provisional Back     alignment and domain information
>PRK03918 chromosome segregation protein; Provisional Back     alignment and domain information
>cd03286 ABC_MSH6_euk MutS6 homolog in eukaryotes Back     alignment and domain information
>cd01131 PilT Pilus retraction ATPase PilT Back     alignment and domain information
>TIGR00618 sbcc exonuclease SbcC Back     alignment and domain information
>PRK06793 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>COG5265 ATM1 ABC-type transport system involved in Fe-S cluster assembly, permease and ATPase components [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00382 AAA ATPases associated with a variety of cellular activities Back     alignment and domain information
>TIGR02168 SMC_prok_B chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>cd01120 RecA-like_NTPases RecA-like NTPases Back     alignment and domain information
>TIGR03238 dnd_assoc_3 dnd system-associated protein 3 Back     alignment and domain information
>PF13304 AAA_21: AAA domain; PDB: 3QKS_B 1US8_B 1F2U_B 1F2T_B 3QKT_A 1II8_B 3QKR_B 3QKU_A Back     alignment and domain information
>TIGR00767 rho transcription termination factor Rho Back     alignment and domain information
>PRK06067 flagellar accessory protein FlaH; Validated Back     alignment and domain information
>TIGR02169 SMC_prok_A chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>KOG0057 consensus Mitochondrial Fe/S cluster exporter, ABC superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF09818 ABC_ATPase: Predicted ATPase of the ABC class; InterPro: IPR019195 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energise diverse biological systems Back     alignment and domain information
>PRK10246 exonuclease subunit SbcC; Provisional Back     alignment and domain information
>PRK02224 chromosome segregation protein; Provisional Back     alignment and domain information
>TIGR01420 pilT_fam pilus retraction protein PilT Back     alignment and domain information
>TIGR00101 ureG urease accessory protein UreG Back     alignment and domain information
>COG3910 Predicted ATPase [General function prediction only] Back     alignment and domain information
>PRK06995 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>cd02023 UMPK Uridine monophosphate kinase (UMPK, EC 2 Back     alignment and domain information
>TIGR00611 recf recF protein Back     alignment and domain information
>cd01125 repA Hexameric Replicative Helicase RepA Back     alignment and domain information
>PRK01889 GTPase RsgA; Reviewed Back     alignment and domain information
>PF13748 ABC_membrane_3: ABC transporter transmembrane region Back     alignment and domain information
>cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases Back     alignment and domain information
>PRK11098 microcin B17 transporter; Reviewed Back     alignment and domain information
>PRK14079 recF recombination protein F; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1231
2cbz_A237 Structure Of The Human Multidrug Resistance Protein 4e-57
1q3h_A286 Mouse Cftr Nbd1 With Amp.Pnp Length = 286 7e-46
1r0z_A286 Phosphorylated Cystic Fibrosis Transmembrane Conduc 2e-45
1xf9_A283 Structure Of Nbd1 From Murine Cftr- F508s Mutant Le 2e-45
1xmi_A291 Crystal Structure Of Human F508a Nbd1 Domain With A 2e-45
1xfa_A283 Structure Of Nbd1 From Murine Cftr- F508r Mutant Le 2e-45
2pze_A229 Minimal Human Cftr First Nucleotide Binding Domain 8e-45
2pzg_A241 Minimal Human Cftr First Nucleotide Binding Domain 9e-45
2bbs_A290 Human Deltaf508 Nbd1 With Three Solubilizing Mutati 2e-44
2bbt_A290 Human Deltaf508 Nbd1 With Two Solublizing Mutations 3e-44
3si7_A285 The Crystal Structure Of The Nbd1 Domain Of The Mou 4e-44
2bbo_A291 Human Nbd1 With Phe508 Length = 291 2e-43
2pzf_A228 Minimal Human Cftr First Nucleotide Binding Domain 5e-43
1xmj_A290 Crystal Structure Of Human Deltaf508 Human Nbd1 Dom 1e-41
4f4c_A 1321 The Crystal Structure Of The Multi-Drug Transporter 2e-31
2hyd_A578 Multidrug Abc Transporter Sav1866 Length = 578 5e-28
3b5y_A582 Crystal Structure Of Msba From Salmonella Typhimuri 1e-24
3b5w_A582 Crystal Structure Of Eschericia Coli Msba Length = 2e-24
3g60_A1284 Structure Of P-Glycoprotein Reveals A Molecular Bas 9e-23
3g5u_A1284 Structure Of P-Glycoprotein Reveals A Molecular Bas 1e-22
3b5x_A582 Crystal Structure Of Msba From Vibrio Cholerae Leng 1e-22
4ayt_A595 Structure Of The Human Mitochondrial Abc Transporte 7e-22
4ayt_A 595 Structure Of The Human Mitochondrial Abc Transporte 8e-04
4ayw_A619 Structure Of The Human Mitochondrial Abc Transporte 9e-22
4ayw_A 619 Structure Of The Human Mitochondrial Abc Transporte 5e-04
3qf4_B598 Crystal Structure Of A Heterodimeric Abc Transporte 6e-21
2ghi_A260 Crystal Structure Of Plasmodium Yoelii Multidrug Re 6e-20
3b5j_A243 Crystal Structures Of The S504a Mutant Of An Isolat 2e-19
3nh6_A306 Nucleotide Binding Domain Of Human Abcb6 (Apo Struc 2e-19
1mt0_A241 Atp-Binding Domain Of Haemolysin B From Escherichia 2e-19
2ff7_A247 The Abc-Atpase Of The Abc-Transporter Hlyb In The A 2e-19
2pmk_A243 Crystal Structures Of An Isolated Abc-Atpase In Com 3e-19
2ffb_A247 The Crystal Structure Of The Hlyb-Nbd E631q Mutant 4e-19
1mv5_A243 Crystal Structure Of Lmra Atp-Binding Domain Length 7e-19
3qf4_A587 Crystal Structure Of A Heterodimeric Abc Transporte 2e-18
1xef_A241 Crystal Structure Of The AtpMG2+ BOUND COMPOSITE DI 4e-18
2ffa_A247 Crystal Structure Of Abc-Atpase H662a Of The Abc-Tr 4e-18
1jj7_A260 Crystal Structure Of The C-Terminal Atpase Domain O 9e-18
2ixf_A271 Crystal Structure Of The Atpase Domain Of Tap1 With 7e-16
2ixe_A271 Crystal Structure Of The Atpase Domain Of Tap1 With 4e-15
1z47_A355 Structure Of The Atpase Subunit Cysa Of The Putativ 4e-14
3d31_A348 Modbc From Methanosarcina Acetivorans Length = 348 7e-14
2ixg_A271 Crystal Structure Of The Atpase Domain Of Tap1 With 1e-13
2nq2_C253 An Inward-Facing Conformation Of A Putative Metal-C 3e-13
2it1_A362 Structure Of Ph0203 Protein From Pyrococcus Horikos 6e-13
4hlu_D268 Structure Of The Ecfa-a' Heterodimer Bound To Adp L 2e-12
3c41_J242 Abc Protein Artp In Complex With Amp-PnpMG2+ Length 3e-12
2olj_A263 Abc Protein Artp In Complex With AdpMG2+ Length = 2 3e-12
1q1b_A381 Crystal Structure Of E. Coli Malk In The Nucleotide 1e-11
1q12_A381 Crystal Structure Of The Atp-bound E. Coli Malk Len 1e-11
2r6g_A381 The Crystal Structure Of The E. Coli Maltose Transp 2e-11
1vci_A373 Crystal Structure Of The Atp-binding Cassette Of Mu 8e-11
1v43_A372 Crystal Structure Of Atpase Subunit Of Abc Sugar Tr 1e-10
4hlu_A268 Structure Of The Ecfa-a' Heterodimer Bound To Adp L 2e-10
2yz2_A266 Crystal Structure Of The Abc Transporter In The Cob 2e-10
1b0u_A262 Atp-Binding Subunit Of The Histidine Permease From 2e-10
2yyz_A359 Crystal Structure Of Sugar Abc Transporter, Atp-Bin 7e-10
2onk_A240 Abc Transporter Modbc In Complex With Its Binding P 5e-09
2d62_A375 Crystal Structure Of Multiple Sugar Binding Transpo 5e-09
1l2t_A235 Dimeric Structure Of Mj0796, A Bacterial Abc Transp 6e-09
3gd7_A390 Crystal Structure Of Human Nbd2 Complexed With N6- 7e-09
1oxs_C353 Crystal Structure Of Glcv, The Abc-Atpase Of The Gl 1e-08
3gfo_A275 Structure Of Cbio1 From Clostridium Perfringens: Pa 2e-08
1g29_1372 Malk Length = 372 2e-08
3tif_A235 Dimeric Structure Of A Post-Hydrolysis State Of The 2e-08
3fvq_A359 Crystal Structure Of The Nucleotide Binding Domain 6e-08
1oxx_K353 Crystal Structure Of Glcv, The Abc-Atpase Of The Gl 7e-08
2ihy_A279 Structure Of The Staphylococcus Aureus Putative Atp 8e-08
1f3o_A235 Crystal Structure Of Mj0796 Atp-Binding Cassette Le 2e-07
1yqt_A538 Rnase-L Inhibitor Length = 538 3e-07
1yqt_A538 Rnase-L Inhibitor Length = 538 5e-05
1g6h_A257 Crystal Structure Of The Adp Conformation Of Mj1267 3e-07
2pcj_A224 Crystal Structure Of Abc Transporter (Aq_297) From 3e-07
1gaj_A257 Crystal Structure Of A Nucleotide-Free Atp-Binding 4e-07
2iwh_A986 Structure Of Yeast Elongation Factor 3 In Complex W 7e-07
1g9x_A257 Characterization Of The Twinning Structure Of Mj126 7e-07
3j15_B593 Model Of Ribosome-Bound Archaeal Pelota And Abce1 L 1e-06
3bk7_A607 Structure Of The Complete Abce1RNAASE-L Inhibitor P 1e-06
2iw3_A986 Elongation Factor 3 In Complex With Adp Length = 98 1e-06
2ix8_A976 Model For Eef3 Bound To An 80s Ribosome Length = 97 1e-06
3dhw_C343 Crystal Structure Of Methionine Importer Metni Leng 2e-06
4g1u_C266 X-Ray Structure Of The Bacterial Heme Transporter H 3e-06
3tui_C366 Inward Facing Conformations Of The Metni Methionine 5e-06
3tuj_C366 Inward Facing Conformations Of The Metni Methionine 1e-05
4fwi_B334 Crystal Structure Of The Nucleotide-binding Domain 2e-05
1vpl_A256 Crystal Structure Of Abc Transporter Atp-binding Pr 2e-05
2pjz_A263 The Crystal Structure Of Putative Cobalt Transport 1e-04
3ux8_A670 Crystal Structure Of Uvra Length = 670 2e-04
3uwx_A972 Crystal Structure Of Uvra-Uvrb Complex Length = 972 2e-04
2r6f_A972 Crystal Structure Of Bacillus Stearothermophilus Uv 3e-04
1ji0_A240 Crystal Structure Analysis Of The Abc Transporter F 3e-04
1sgw_A214 Putative Abc Transporter (Atp-Binding Protein) From 6e-04
>pdb|2CBZ|A Chain A, Structure Of The Human Multidrug Resistance Protein 1 Nucleotide Binding Domain 1 Length = 237 Back     alignment and structure 
Iteration: 1

 Score =  220 bits (560), Expect = 4e-57,   Method: Compositional matrix adjust.
 Identities = 111/231 (48%), Positives = 153/231 (66%), Gaps = 9/231 (3%)
Query: 594 SVKIQEGNFSW---DPELAIPTLRGVNLDIKWAQKIAVCGSVGAGKSSLLYAILGEIPKI 650
           S+ ++   F+W   DP    PTL G+   I     +AV G VG GKSSLL A+L E+ K+
Sbjct: 3   SITVRNATFTWARSDP----PTLNGITFSIPEGALVAVVGQVGCGKSSLLSALLAEMDKV 58
Query: 651 SGTVNLYGSIAYVSQTSWIQSGSIRDNILYGKPMDKARYDKAIKACALDKDINNFDHGDL 710
            G V + GS+AYV Q +WIQ+ S+R+NIL+G  +++  Y   I+ACAL  D+     GD 
Sbjct: 59  EGHVAIKGSVAYVPQQAWIQNDSLRENILFGCQLEEPYYRSVIQACALLPDLEILPSGDR 118
Query: 711 TEIGQRGLNLSGGQKQRIQLARAVYNDADIYLFDDPFSAVDAHTAATLFNECV--MAALE 768
           TEIG++G+NLSGGQKQR+ LARAVY++ADIYLFDDP SAVDAH    +F   +     L+
Sbjct: 119 TEIGEKGVNLSGGQKQRVSLARAVYSNADIYLFDDPLSAVDAHVGKHIFENVIGPKGMLK 178
Query: 769 KKTVILVTHQVEFLSEVDRILVLEGGQITQSGNYQELLLAGTAFEQLVNAH 819
            KT ILVTH + +L +VD I+V+ GG+I++ G+YQELL    AF + +  +
Sbjct: 179 NKTRILVTHSMSYLPQVDVIIVMSGGKISEMGSYQELLARDGAFAEFLRTY 229
>pdb|1Q3H|A Chain A, Mouse Cftr Nbd1 With Amp.Pnp Length = 286 Back     alignment and structure
>pdb|1R0Z|A Chain A, Phosphorylated Cystic Fibrosis Transmembrane Conductance Regulator (Cftr) Nucleotide-Binding Domain One (Nbd1) With Atp Length = 286 Back     alignment and structure
>pdb|1XF9|A Chain A, Structure Of Nbd1 From Murine Cftr- F508s Mutant Length = 283 Back     alignment and structure
>pdb|1XMI|A Chain A, Crystal Structure Of Human F508a Nbd1 Domain With Atp Length = 291 Back     alignment and structure
>pdb|1XFA|A Chain A, Structure Of Nbd1 From Murine Cftr- F508r Mutant Length = 283 Back     alignment and structure
>pdb|2PZE|A Chain A, Minimal Human Cftr First Nucleotide Binding Domain As A Head-To-Tail Dimer Length = 229 Back     alignment and structure
>pdb|2PZG|A Chain A, Minimal Human Cftr First Nucleotide Binding Domain As A Monomer Length = 241 Back     alignment and structure
>pdb|2BBS|A Chain A, Human Deltaf508 Nbd1 With Three Solubilizing Mutations Length = 290 Back     alignment and structure
>pdb|2BBT|A Chain A, Human Deltaf508 Nbd1 With Two Solublizing Mutations. Length = 290 Back     alignment and structure
>pdb|3SI7|A Chain A, The Crystal Structure Of The Nbd1 Domain Of The Mouse Cftr Protein, Deltaf508 Mutant Length = 285 Back     alignment and structure
>pdb|2BBO|A Chain A, Human Nbd1 With Phe508 Length = 291 Back     alignment and structure
>pdb|2PZF|A Chain A, Minimal Human Cftr First Nucleotide Binding Domain As A Head-To-Tail Dimer With Delta F508 Length = 228 Back     alignment and structure
>pdb|1XMJ|A Chain A, Crystal Structure Of Human Deltaf508 Human Nbd1 Domain With Atp Length = 290 Back     alignment and structure
>pdb|4F4C|A Chain A, The Crystal Structure Of The Multi-Drug Transporter Length = 1321 Back     alignment and structure
>pdb|2HYD|A Chain A, Multidrug Abc Transporter Sav1866 Length = 578 Back     alignment and structure
>pdb|3B5Y|A Chain A, Crystal Structure Of Msba From Salmonella Typhimurium With Amppnp Length = 582 Back     alignment and structure
>pdb|3B5W|A Chain A, Crystal Structure Of Eschericia Coli Msba Length = 582 Back     alignment and structure
>pdb|3G60|A Chain A, Structure Of P-Glycoprotein Reveals A Molecular Basis For Poly-Specific Drug Binding Length = 1284 Back     alignment and structure
>pdb|3G5U|A Chain A, Structure Of P-Glycoprotein Reveals A Molecular Basis For Poly-Specific Drug Binding Length = 1284 Back     alignment and structure
>pdb|3B5X|A Chain A, Crystal Structure Of Msba From Vibrio Cholerae Length = 582 Back     alignment and structure
>pdb|4AYT|A Chain A, Structure Of The Human Mitochondrial Abc Transporter, Abcb10 Length = 595 Back     alignment and structure
>pdb|4AYT|A Chain A, Structure Of The Human Mitochondrial Abc Transporter, Abcb10 Length = 595 Back     alignment and structure
>pdb|4AYW|A Chain A, Structure Of The Human Mitochondrial Abc Transporter, Abcb10 (plate Form) Length = 619 Back     alignment and structure
>pdb|4AYW|A Chain A, Structure Of The Human Mitochondrial Abc Transporter, Abcb10 (plate Form) Length = 619 Back     alignment and structure
>pdb|3QF4|B Chain B, Crystal Structure Of A Heterodimeric Abc Transporter In Its Inward- Facing Conformation Length = 598 Back     alignment and structure
>pdb|2GHI|A Chain A, Crystal Structure Of Plasmodium Yoelii Multidrug Resistance Protein 2 Length = 260 Back     alignment and structure
>pdb|3B5J|A Chain A, Crystal Structures Of The S504a Mutant Of An Isolated Abc-atpase In Complex With Tnp-adp Length = 243 Back     alignment and structure
>pdb|3NH6|A Chain A, Nucleotide Binding Domain Of Human Abcb6 (Apo Structure) Length = 306 Back     alignment and structure
>pdb|1MT0|A Chain A, Atp-Binding Domain Of Haemolysin B From Escherichia Coli Length = 241 Back     alignment and structure
>pdb|2FF7|A Chain A, The Abc-Atpase Of The Abc-Transporter Hlyb In The Adp Bound State Length = 247 Back     alignment and structure
>pdb|2PMK|A Chain A, Crystal Structures Of An Isolated Abc-Atpase In Complex With Tnp-Adp Length = 243 Back     alignment and structure
>pdb|2FFB|A Chain A, The Crystal Structure Of The Hlyb-Nbd E631q Mutant In Complex With Adp Length = 247 Back     alignment and structure
>pdb|1MV5|A Chain A, Crystal Structure Of Lmra Atp-Binding Domain Length = 243 Back     alignment and structure
>pdb|3QF4|A Chain A, Crystal Structure Of A Heterodimeric Abc Transporter In Its Inward- Facing Conformation Length = 587 Back     alignment and structure
>pdb|1XEF|A Chain A, Crystal Structure Of The AtpMG2+ BOUND COMPOSITE DIMER OF HLYB-Nbd Length = 241 Back     alignment and structure
>pdb|2FFA|A Chain A, Crystal Structure Of Abc-Atpase H662a Of The Abc-Transporter Hlyb In Complex With Adp Length = 247 Back     alignment and structure
>pdb|1JJ7|A Chain A, Crystal Structure Of The C-Terminal Atpase Domain Of Human Tap1 Length = 260 Back     alignment and structure
>pdb|2IXF|A Chain A, Crystal Structure Of The Atpase Domain Of Tap1 With Atp (D645q, Q678h Mutant) Length = 271 Back     alignment and structure
>pdb|2IXE|A Chain A, Crystal Structure Of The Atpase Domain Of Tap1 With Atp (d645n Mutant) Length = 271 Back     alignment and structure
>pdb|1Z47|A Chain A, Structure Of The Atpase Subunit Cysa Of The Putative Sulfate Atp-Binding Cassette (Abc) Transporter From Alicyclobacillus Acidocaldarius Length = 355 Back     alignment and structure
>pdb|3D31|A Chain A, Modbc From Methanosarcina Acetivorans Length = 348 Back     alignment and structure
>pdb|2IXG|A Chain A, Crystal Structure Of The Atpase Domain Of Tap1 With Atp (S621a, G622v, D645n Mutant) Length = 271 Back     alignment and structure
>pdb|2NQ2|C Chain C, An Inward-Facing Conformation Of A Putative Metal-Chelate Type Abc Transporter. Length = 253 Back     alignment and structure
>pdb|2IT1|A Chain A, Structure Of Ph0203 Protein From Pyrococcus Horikoshii Length = 362 Back     alignment and structure
>pdb|4HLU|D Chain D, Structure Of The Ecfa-a' Heterodimer Bound To Adp Length = 268 Back     alignment and structure
>pdb|3C41|J Chain J, Abc Protein Artp In Complex With Amp-PnpMG2+ Length = 242 Back     alignment and structure
>pdb|2OLJ|A Chain A, Abc Protein Artp In Complex With AdpMG2+ Length = 263 Back     alignment and structure
>pdb|1Q1B|A Chain A, Crystal Structure Of E. Coli Malk In The Nucleotide-Free Form Length = 381 Back     alignment and structure
>pdb|1Q12|A Chain A, Crystal Structure Of The Atp-bound E. Coli Malk Length = 381 Back     alignment and structure
>pdb|2R6G|A Chain A, The Crystal Structure Of The E. Coli Maltose Transporter Length = 381 Back     alignment and structure
>pdb|1VCI|A Chain A, Crystal Structure Of The Atp-binding Cassette Of Multisugar Transporter From Pyrococcus Horikoshii Ot3 Complexed With Atp Length = 373 Back     alignment and structure
>pdb|1V43|A Chain A, Crystal Structure Of Atpase Subunit Of Abc Sugar Transporter Length = 372 Back     alignment and structure
>pdb|4HLU|A Chain A, Structure Of The Ecfa-a' Heterodimer Bound To Adp Length = 268 Back     alignment and structure
>pdb|2YZ2|A Chain A, Crystal Structure Of The Abc Transporter In The Cobalt Transport System Length = 266 Back     alignment and structure
>pdb|1B0U|A Chain A, Atp-Binding Subunit Of The Histidine Permease From Salmonella Typhimurium Length = 262 Back     alignment and structure
>pdb|2YYZ|A Chain A, Crystal Structure Of Sugar Abc Transporter, Atp-Binding Protein Length = 359 Back     alignment and structure
>pdb|2ONK|A Chain A, Abc Transporter Modbc In Complex With Its Binding Protein Moda Length = 240 Back     alignment and structure
>pdb|2D62|A Chain A, Crystal Structure Of Multiple Sugar Binding Transport Atp- Binding Protein Length = 375 Back     alignment and structure
>pdb|1L2T|A Chain A, Dimeric Structure Of Mj0796, A Bacterial Abc Transporter Cassette Length = 235 Back     alignment and structure
>pdb|3GD7|A Chain A, Crystal Structure Of Human Nbd2 Complexed With N6- Phenylethyl-Atp (P-Atp) Length = 390 Back     alignment and structure
>pdb|1OXS|C Chain C, Crystal Structure Of Glcv, The Abc-Atpase Of The Glucose Abc Transporter From Sulfolobus Solfataricus Length = 353 Back     alignment and structure
>pdb|3GFO|A Chain A, Structure Of Cbio1 From Clostridium Perfringens: Part Of The Abc Transporter Complex Cbionq Length = 275 Back     alignment and structure
>pdb|1G29|1 Chain 1, Malk Length = 372 Back     alignment and structure
>pdb|3TIF|A Chain A, Dimeric Structure Of A Post-Hydrolysis State Of The Atp-Binding Cassette Mj0796 Bound To Adp And Pi Length = 235 Back     alignment and structure
>pdb|3FVQ|A Chain A, Crystal Structure Of The Nucleotide Binding Domain Fbpc Complexed With Atp Length = 359 Back     alignment and structure
>pdb|1OXX|K Chain K, Crystal Structure Of Glcv, The Abc-Atpase Of The Glucose Abc Transporter From Sulfolobus Solfataricus Length = 353 Back     alignment and structure
>pdb|2IHY|A Chain A, Structure Of The Staphylococcus Aureus Putative Atpase Subunit Of An Atp-Binding Cassette (Abc) Transporter Length = 279 Back     alignment and structure
>pdb|1F3O|A Chain A, Crystal Structure Of Mj0796 Atp-Binding Cassette Length = 235 Back     alignment and structure
>pdb|1YQT|A Chain A, Rnase-L Inhibitor Length = 538 Back     alignment and structure
>pdb|1YQT|A Chain A, Rnase-L Inhibitor Length = 538 Back     alignment and structure
>pdb|1G6H|A Chain A, Crystal Structure Of The Adp Conformation Of Mj1267, An Atp- Binding Cassette Of An Abc Transporter Length = 257 Back     alignment and structure
>pdb|2PCJ|A Chain A, Crystal Structure Of Abc Transporter (Aq_297) From Aquifex Aeolicus Vf5 Length = 224 Back     alignment and structure
>pdb|1GAJ|A Chain A, Crystal Structure Of A Nucleotide-Free Atp-Binding Cassette From An Abc Transporter Length = 257 Back     alignment and structure
>pdb|2IWH|A Chain A, Structure Of Yeast Elongation Factor 3 In Complex With Adpnp Length = 986 Back     alignment and structure
>pdb|1G9X|A Chain A, Characterization Of The Twinning Structure Of Mj1267, An Atp-Binding Cassette Of An Abc Transporter Length = 257 Back     alignment and structure
>pdb|3J15|B Chain B, Model Of Ribosome-Bound Archaeal Pelota And Abce1 Length = 593 Back     alignment and structure
>pdb|3BK7|A Chain A, Structure Of The Complete Abce1RNAASE-L Inhibitor Protein From Pyrococcus Abysii Length = 607 Back     alignment and structure
>pdb|2IW3|A Chain A, Elongation Factor 3 In Complex With Adp Length = 986 Back     alignment and structure
>pdb|2IX8|A Chain A, Model For Eef3 Bound To An 80s Ribosome Length = 976 Back     alignment and structure
>pdb|3DHW|C Chain C, Crystal Structure Of Methionine Importer Metni Length = 343 Back     alignment and structure
>pdb|4G1U|C Chain C, X-Ray Structure Of The Bacterial Heme Transporter Hmuuv From Yersinia Pestis Length = 266 Back     alignment and structure
>pdb|3TUI|C Chain C, Inward Facing Conformations Of The Metni Methionine Abc Transporter: Cy5 Native Crystal Form Length = 366 Back     alignment and structure
>pdb|3TUJ|C Chain C, Inward Facing Conformations Of The Metni Methionine Abc Transporter: Dm Crystal Form Length = 366 Back     alignment and structure
>pdb|4FWI|B Chain B, Crystal Structure Of The Nucleotide-binding Domain Of A Dipeptide Abc Transporter Length = 334 Back     alignment and structure
>pdb|1VPL|A Chain A, Crystal Structure Of Abc Transporter Atp-binding Protein (tm0544) From Thermotoga Maritima At 2.10 A Resolution Length = 256 Back     alignment and structure
>pdb|2PJZ|A Chain A, The Crystal Structure Of Putative Cobalt Transport Atp- Binding Protein (cbio-2), St1066 Length = 263 Back     alignment and structure
>pdb|3UX8|A Chain A, Crystal Structure Of Uvra Length = 670 Back     alignment and structure
>pdb|3UWX|A Chain A, Crystal Structure Of Uvra-Uvrb Complex Length = 972 Back     alignment and structure
>pdb|2R6F|A Chain A, Crystal Structure Of Bacillus Stearothermophilus Uvra Length = 972 Back     alignment and structure
>pdb|1JI0|A Chain A, Crystal Structure Analysis Of The Abc Transporter From Thermotoga Maritima Length = 240 Back     alignment and structure
>pdb|1SGW|A Chain A, Putative Abc Transporter (Atp-Binding Protein) From Pyrococcus Furiosus Pfu-867808-001 Length = 214 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1231
2bbs_A290 Cystic fibrosis transmembrane conductance regulato 1e-133
2pze_A229 Cystic fibrosis transmembrane conductance regulat; 1e-128
2cbz_A237 Multidrug resistance-associated protein 1; ABC pro 1e-128
3g5u_A 1284 MCG1178, multidrug resistance protein 1A; P-glycop 5e-53
3g5u_A1284 MCG1178, multidrug resistance protein 1A; P-glycop 9e-45
3g5u_A 1284 MCG1178, multidrug resistance protein 1A; P-glycop 1e-05
3b5x_A582 Lipid A export ATP-binding/permease protein MSBA; 3e-51
3b5x_A 582 Lipid A export ATP-binding/permease protein MSBA; 5e-14
3b60_A582 Lipid A export ATP-binding/permease protein MSBA; 6e-51
3b60_A 582 Lipid A export ATP-binding/permease protein MSBA; 2e-15
4a82_A578 Cystic fibrosis transmembrane conductance regulat; 2e-48
4a82_A 578 Cystic fibrosis transmembrane conductance regulat; 1e-14
3qf4_A587 ABC transporter, ATP-binding protein; multidrug tr 8e-43
2yl4_A595 ATP-binding cassette SUB-family B member 10, mitoc 2e-42
2yl4_A 595 ATP-binding cassette SUB-family B member 10, mitoc 3e-12
2ghi_A260 Transport protein; multidrug resistance protein, M 9e-42
1mv5_A243 LMRA, multidrug resistance ABC transporter ATP-bin 1e-41
3nh6_A306 ATP-binding cassette SUB-family B member 6, mitoc; 1e-39
2ff7_A247 Alpha-hemolysin translocation ATP-binding protein 1e-38
2ixe_A271 Antigen peptide transporter 1; ABC ATPase, hydrola 3e-38
3qf4_B598 Uncharacterized ABC transporter ATP-binding prote 6e-38
3qf4_B 598 Uncharacterized ABC transporter ATP-binding prote 3e-12
2ihy_A279 ABC transporter, ATP-binding protein; ATPase, ABC 9e-29
2pjz_A263 Hypothetical protein ST1066; ATP binding protein, 2e-28
3gd7_A390 Fusion complex of cystic fibrosis transmembrane co 1e-27
2nq2_C253 Hypothetical ABC transporter ATP-binding protein H 3e-27
3j16_B608 RLI1P; ribosome recycling, translation, eukarya, r 2e-24
3j16_B608 RLI1P; ribosome recycling, translation, eukarya, r 7e-18
1sgw_A214 Putative ABC transporter; structural genomics, P p 1e-22
3ozx_A538 RNAse L inhibitor; ATP binding cassette protein, h 5e-22
3ozx_A538 RNAse L inhibitor; ATP binding cassette protein, h 9e-18
3bk7_A607 ABC transporter ATP-binding protein; ABC ATPase, i 8e-22
3bk7_A607 ABC transporter ATP-binding protein; ABC ATPase, i 8e-18
1yqt_A538 RNAse L inhibitor; ATP-binding cassette, ribosome 1e-21
1yqt_A538 RNAse L inhibitor; ATP-binding cassette, ribosome 4e-16
2yz2_A266 Putative ABC transporter ATP-binding protein TM_0; 2e-18
2iw3_A986 Elongation factor 3A; acetylation, ATP-binding, pr 1e-17
2iw3_A986 Elongation factor 3A; acetylation, ATP-binding, pr 6e-11
2iw3_A986 Elongation factor 3A; acetylation, ATP-binding, pr 2e-07
3gfo_A275 Cobalt import ATP-binding protein CBIO 1; structur 1e-17
2onk_A240 Molybdate/tungstate ABC transporter, ATP-binding p 3e-17
2qi9_C249 Vitamin B12 import ATP-binding protein BTUD; inner 4e-17
3fvq_A359 Fe(3+) IONS import ATP-binding protein FBPC; nucle 5e-17
2pcj_A224 ABC transporter, lipoprotein-releasing system ATP- 3e-16
1oxx_K353 GLCV, glucose, ABC transporter, ATP binding protei 9e-16
1z47_A355 CYSA, putative ABC-transporter ATP-binding protein 5e-15
3tui_C366 Methionine import ATP-binding protein METN; ABC-tr 1e-14
3tif_A235 Uncharacterized ABC transporter ATP-binding prote; 1e-14
3d31_A348 Sulfate/molybdate ABC transporter, ATP-binding pro 1e-14
1vpl_A256 ABC transporter, ATP-binding protein; TM0544, stru 4e-14
2it1_A362 362AA long hypothetical maltose/maltodextrin trans 2e-13
1b0u_A262 Histidine permease; ABC transporter, transport pro 9e-13
2yyz_A359 Sugar ABC transporter, ATP-binding protein; sugar 1e-12
1g29_1372 MALK, maltose transport protein MALK; ATPase, acti 2e-12
1v43_A372 Sugar-binding transport ATP-binding protein; ATPas 2e-12
2olj_A263 Amino acid ABC transporter; ABC domain, ATPase, hy 7e-12
3rlf_A381 Maltose/maltodextrin import ATP-binding protein M; 5e-10
1ji0_A240 ABC transporter; ATP binding protein, structural g 8e-10
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-08
1vt4_I1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-05
3qkt_A339 DNA double-strand break repair RAD50 ATPase; RECA- 1e-07
3lvg_D190 LCB, clathrin light chain B; SELF assembly, coated 3e-05
1f2t_B148 RAD50 ABC-ATPase; DNA double-strand break repair, 5e-05
1g6h_A257 High-affinity branched-chain amino acid transport 6e-04
>2bbs_A Cystic fibrosis transmembrane conductance regulator; ATP binding cassette, transport protein; HET: ATP; 2.05A {Homo sapiens} PDB: 2bbt_A* 1xmi_A* 1xmj_A* 2bbo_A* 3si7_A* 1r0w_A 1q3h_A 1r0x_A* 1r0y_A* 1r0z_A* 1r10_A* 1xf9_A* 1xfa_A* Length = 290 Back     alignment and structure
 Score =  406 bits (1046), Expect = e-133
 Identities = 96/259 (37%), Positives = 137/259 (52%), Gaps = 1/259 (0%)

Query: 561 QVKVSFDRINAFLLDHELNNDDVRRISLQKSDRSVKIQEGNFSWDPELAIPTLRGVNLDI 620
             +V  + + AF  +      +  + +      S      +FS    L  P L+ +N  I
Sbjct: 2   TTEVVMENVTAFWEEGFGELFEKAKQNNNNRKTSNGDDSLSFSNFSLLGTPVLKDINFKI 61

Query: 621 KWAQKIAVCGSVGAGKSSLLYAILGEIPKISGTVNLYGSIAYVSQTSWIQSGSIRDNILY 680
           +  Q +AV GS GAGK+SLL  I+GE+    G +   G I++ SQ SWI  G+I++NI+ 
Sbjct: 62  ERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGRISFCSQNSWIMPGTIKENII- 120

Query: 681 GKPMDKARYDKAIKACALDKDINNFDHGDLTEIGQRGLNLSGGQKQRIQLARAVYNDADI 740
           G   D+ RY   IKAC L++DI+ F   D   +G+ G+ LSGGQ+ RI LARAVY DAD+
Sbjct: 121 GVSYDEYRYRSVIKACQLEEDISKFAEKDNIVLGEGGITLSGGQRARISLARAVYKDADL 180

Query: 741 YLFDDPFSAVDAHTAATLFNECVMAALEKKTVILVTHQVEFLSEVDRILVLEGGQITQSG 800
           YL D PF  +D  T   +F  CV   +  KT ILVT ++E L + D+IL+L  G     G
Sbjct: 181 YLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSKMEHLKKADKILILHEGSSYFYG 240

Query: 801 NYQELLLAGTAFEQLVNAH 819
            + EL      F   +   
Sbjct: 241 TFSELQNLRPDFSSKLMGC 259
>2pze_A Cystic fibrosis transmembrane conductance regulat; NBD, ABC transporter, CFTR, hydrolase; HET: ATP; 1.70A {Homo sapiens} PDB: 2pzg_A* 2pzf_A* 1ckx_A 1cky_A 1ckw_A 1ckz_A Length = 229 Back     alignment and structure
>2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens} Length = 237 Back     alignment and structure
>3g5u_A MCG1178, multidrug resistance protein 1A; P-glycoprotein, PGP, cyclic peptide, membrane protein; 3.80A {Mus musculus} PDB: 3g61_A* 3g60_A* Length = 1284 Back     alignment and structure
>3g5u_A MCG1178, multidrug resistance protein 1A; P-glycoprotein, PGP, cyclic peptide, membrane protein; 3.80A {Mus musculus} PDB: 3g61_A* 3g60_A* Length = 1284 Back     alignment and structure
>3g5u_A MCG1178, multidrug resistance protein 1A; P-glycoprotein, PGP, cyclic peptide, membrane protein; 3.80A {Mus musculus} PDB: 3g61_A* 3g60_A* Length = 1284 Back     alignment and structure
>3b5x_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; 5.50A {Vibrio cholerae} Length = 582 Back     alignment and structure
>3b5x_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; 5.50A {Vibrio cholerae} Length = 582 Back     alignment and structure
>3b60_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; HET: ANP; 3.70A {Salmonella typhimurium} SCOP: c.37.1.12 f.37.1.1 PDB: 3b5y_A* 3b5z_A* 3b5w_A Length = 582 Back     alignment and structure
>3b60_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; HET: ANP; 3.70A {Salmonella typhimurium} SCOP: c.37.1.12 f.37.1.1 PDB: 3b5y_A* 3b5z_A* 3b5w_A Length = 582 Back     alignment and structure
>4a82_A Cystic fibrosis transmembrane conductance regulat; CFTR, ION channel, transport protein, casse protein; 2.00A {Homo sapiens} PDB: 2onj_A* 2hyd_A Length = 578 Back     alignment and structure
>4a82_A Cystic fibrosis transmembrane conductance regulat; CFTR, ION channel, transport protein, casse protein; 2.00A {Homo sapiens} PDB: 2onj_A* 2hyd_A Length = 578 Back     alignment and structure
>3qf4_A ABC transporter, ATP-binding protein; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} Length = 587 Back     alignment and structure
>2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str} Length = 260 Back     alignment and structure
>1mv5_A LMRA, multidrug resistance ABC transporter ATP-binding and permease protein; asymmetric dimer, tetramer, P-glycoprotein; HET: ATP ADP; 3.10A {Lactococcus lactis} SCOP: c.37.1.12 Length = 243 Back     alignment and structure
>3nh6_A ATP-binding cassette SUB-family B member 6, mitoc; ABC-transporter, ABCB6, nucleotide binding domain, heme BIOS transport protein; 2.00A {Homo sapiens} PDB: 3nh9_A* 3nha_A* 3nhb_A* Length = 306 Back     alignment and structure
>2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A* Length = 247 Back     alignment and structure
>2ixe_A Antigen peptide transporter 1; ABC ATPase, hydrolase; HET: ATP; 2.0A {Rattus norvegicus} PDB: 2ixg_A* 2ixf_A* 1jj7_A* Length = 271 Back     alignment and structure
>3qf4_B Uncharacterized ABC transporter ATP-binding prote TM_0288; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} Length = 598 Back     alignment and structure
>3qf4_B Uncharacterized ABC transporter ATP-binding prote TM_0288; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} Length = 598 Back     alignment and structure
>2ihy_A ABC transporter, ATP-binding protein; ATPase, ABC cassette, hydrolase; HET: MSE; 1.90A {Staphylococcus aureus} Length = 279 Back     alignment and structure
>2pjz_A Hypothetical protein ST1066; ATP binding protein, structural genomics, NPPSFA; 1.90A {Sulfolobus tokodaii} Length = 263 Back     alignment and structure
>3gd7_A Fusion complex of cystic fibrosis transmembrane conductance regulator, residues 1193-1427...; CFTR, ABC transporter, nucleotide binding domain, NBD; HET: B44; 2.70A {Homo sapiens} Length = 390 Back     alignment and structure
>2nq2_C Hypothetical ABC transporter ATP-binding protein HI1470; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae} Length = 253 Back     alignment and structure
>3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; NMR {Saccharomyces cerevisiae} Length = 608 Back     alignment and structure
>3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; NMR {Saccharomyces cerevisiae} Length = 608 Back     alignment and structure
>1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12 Length = 214 Back     alignment and structure
>3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} Length = 538 Back     alignment and structure
>3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} Length = 538 Back     alignment and structure
>3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* Length = 607 Back     alignment and structure
>3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* Length = 607 Back     alignment and structure
>1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} Length = 538 Back     alignment and structure
>1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} Length = 538 Back     alignment and structure
>2yz2_A Putative ABC transporter ATP-binding protein TM_0; cobalt transport, TM02 hydrolase, inner membrane, membrane, nucleotide-binding; 2.30A {Thermotoga maritima} Length = 266 Back     alignment and structure
>2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A Length = 986 Back     alignment and structure
>2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A Length = 986 Back     alignment and structure
>2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A Length = 986 Back     alignment and structure
>3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124} Length = 275 Back     alignment and structure
>2onk_A Molybdate/tungstate ABC transporter, ATP-binding protein; membrane protein; 3.10A {Archaeoglobus fulgidus} SCOP: c.37.1.12 Length = 240 Back     alignment and structure
>2qi9_C Vitamin B12 import ATP-binding protein BTUD; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_C* 4dbl_C Length = 249 Back     alignment and structure
>3fvq_A Fe(3+) IONS import ATP-binding protein FBPC; nucleotide binding domain, ABC motor domain, ferric iron transport, cell inner membrane; HET: ATP; 1.90A {Neisseria gonorrhoeae} Length = 359 Back     alignment and structure
>2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein; structural genomics; 1.70A {Aquifex aeolicus} PDB: 2pcl_A Length = 224 Back     alignment and structure
>1oxx_K GLCV, glucose, ABC transporter, ATP binding protein; ABC-ATPase, ATP-binding cassette, ATPase, transport protein; 1.45A {Sulfolobus solfataricus} SCOP: b.40.6.3 c.37.1.12 PDB: 1oxs_C 1oxt_A 1oxu_A* 1oxv_A* Length = 353 Back     alignment and structure
>1z47_A CYSA, putative ABC-transporter ATP-binding protein; alpha/beta motif, beta sandwich, ligand binding protein; 1.90A {Alicyclobacillus acidocaldarius} Length = 355 Back     alignment and structure
>3tui_C Methionine import ATP-binding protein METN; ABC-transporter, type I ABC type importer, methionine uptake transporter, membrane protein; HET: ADP; 2.90A {Escherichia coli} PDB: 3tuj_C 3tuz_C* 3dhw_C Length = 366 Back     alignment and structure
>3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A* Length = 235 Back     alignment and structure
>3d31_A Sulfate/molybdate ABC transporter, ATP-binding protein; ATP-binding, nucleotide-binding, membrane, transmembrane, transport protein; 3.00A {Methanosarcina acetivorans} SCOP: b.40.6.3 c.37.1.12 Length = 348 Back     alignment and structure
>1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12 Length = 256 Back     alignment and structure
>2it1_A 362AA long hypothetical maltose/maltodextrin transport ATP-binding protein; structural genomics, NPPSFA; 1.94A {Pyrococcus horikoshii} Length = 362 Back     alignment and structure
>1b0u_A Histidine permease; ABC transporter, transport protein; HET: ATP; 1.50A {Salmonella typhimurium} SCOP: c.37.1.12 Length = 262 Back     alignment and structure
>2yyz_A Sugar ABC transporter, ATP-binding protein; sugar transport, alpha and beta proteins (A/B) TM0421, structural genomics, NPPSFA; 2.11A {Thermotoga maritima} Length = 359 Back     alignment and structure
>1g29_1 MALK, maltose transport protein MALK; ATPase, active transport, maltose uptake and regulation, sugar binding protein; 1.90A {Thermococcus litoralis} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 2d62_A Length = 372 Back     alignment and structure
>1v43_A Sugar-binding transport ATP-binding protein; ATPase, active transport, sugar uptake and regulation, transport protein; 2.20A {Pyrococcus horikoshii} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 1vci_A* Length = 372 Back     alignment and structure
>2olj_A Amino acid ABC transporter; ABC domain, ATPase, hydrolase; HET: ADP; 2.05A {Geobacillus stearothermophilus} PDB: 2olk_A* 2ouk_A 2q0h_A* 3c4j_A* 3c41_J* Length = 263 Back     alignment and structure
>3rlf_A Maltose/maltodextrin import ATP-binding protein M; integral membrane protein, ATPase, ABC transporter, membrane transmembrane; HET: UMQ MAL PGV ANP; 2.20A {Escherichia coli} PDB: 1q1e_A 1q12_A* 2awo_A* 3fh6_A 3puv_A* 3puw_A* 3pux_A* 3puy_A* 3puz_A* 3pv0_A* 2awn_A* 2r6g_A* 1q1b_A Length = 381 Back     alignment and structure
>1ji0_A ABC transporter; ATP binding protein, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: ATP; 2.00A {Thermotoga maritima} SCOP: c.37.1.12 Length = 240 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3qkt_A DNA double-strand break repair RAD50 ATPase; RECA-like fold, coiled-coils, ATP binding, DNA bindi MRE11, replication; HET: DNA ANP; 1.90A {Pyrococcus furiosus} PDB: 3qku_A* 1ii8_A 3qks_B* 3qkr_B* 1ii8_B Length = 339 Back     alignment and structure
>3lvg_D LCB, clathrin light chain B; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} Length = 190 Back     alignment and structure
>1f2t_B RAD50 ABC-ATPase; DNA double-strand break repair, replication; 1.60A {Pyrococcus furiosus} SCOP: c.37.1.12 PDB: 1f2u_B* 1us8_B* Length = 148 Back     alignment and structure
>1g6h_A High-affinity branched-chain amino acid transport ATP-binding protein; beta-core domain; HET: ADP; 1.60A {Methanocaldococcus jannaschii} SCOP: c.37.1.12 PDB: 1gaj_A 1g9x_A* Length = 257 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

No hit with probability above 80.00

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 1231
d1r0wa_281 c.37.1.12 (A:) Cystic fibrosis transmembrane condu 3e-65
d2hyda1255 c.37.1.12 (A:324-578) Putative multidrug export AT 2e-59
d3b60a1253 c.37.1.12 (A:329-581) Multidrug resistance ABC tra 8e-57
d1jj7a_251 c.37.1.12 (A:) Peptide transporter Tap1, C-termina 2e-53
d2pmka1241 c.37.1.12 (A:467-707) Haemolysin B ATP-binding pro 7e-50
d1mv5a_242 c.37.1.12 (A:) Multidrug resistance ABC transporte 7e-50
d1v43a3239 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N 1e-29
d1l2ta_230 c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jann 6e-29
d1ji0a_240 c.37.1.12 (A:) Branched chain aminoacid ABC transp 1e-28
d1g6ha_254 c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jann 5e-28
d3dhwc1240 c.37.1.12 (C:1-240) Methionine import ATP-binding 4e-27
d1b0ua_258 c.37.1.12 (A:) ATP-binding subunit of the histidin 1e-26
d2awna2232 c.37.1.12 (A:4-235) Maltose transport protein MalK 7e-26
d1g2912240 c.37.1.12 (1:1-240) Maltose transport protein MalK 8e-26
d1vpla_238 c.37.1.12 (A:) Putative ABC transporter TM0544 {Th 1e-25
d1l7vc_231 c.37.1.12 (C:) ABC transporter involved in vitamin 6e-25
d1sgwa_200 c.37.1.12 (A:) Putative ABC transporter PF0895 {Py 7e-25
d3d31a2229 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transpor 8e-25
d1oxxk2242 c.37.1.12 (K:1-242) Glucose transport protein GlcV 9e-24
d2onka1240 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP 4e-21
d1ye8a1178 c.37.1.11 (A:1-178) Hypothetical kinase-like prote 7e-16
g1f2t.1292 c.37.1.12 (A:,B:) Rad50 {Archaeon Pyrococcus furio 7e-09
g1ii8.1369 c.37.1.12 (A:,B:) Rad50 {Archaeon Pyrococcus furio 3e-08
d3b60a2319 f.37.1.1 (A:10-328) Multidrug resistance ABC trans 8e-07
d2hyda2323 f.37.1.1 (A:1-323) Putative multidrug export ATP-b 2e-04
d1w1wa_427 c.37.1.12 (A:) Smc head domain {Baker's yeast (Sac 0.002
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 281 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: ABC transporter ATPase domain-like
domain: Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain
species: Mouse (Mus musculus) [TaxId: 10090]

 Score =  220 bits (561), Expect = 3e-65
 Identities = 95/262 (36%), Positives = 143/262 (54%), Gaps = 7/262 (2%)

Query: 558 IMIQVKVSFDRINAFLLDHELNNDDVRRISLQKSDRSVKIQEGNFSWDPELAIPTLRGVN 617
           IM  V   ++     LL+    ++  R+ S  +++ S      +         P L+ +N
Sbjct: 4   IMENVTAFWEEGFGELLEKVQQSNGDRKHSSDENNVSFS----HLCLVGN---PVLKNIN 56

Query: 618 LDIKWAQKIAVCGSVGAGKSSLLYAILGEIPKISGTVNLYGSIAYVSQTSWIQSGSIRDN 677
           L+I+  + +A+ GS G+GK+SLL  ILGE+    G +   G +++ SQ SWI  G+I++N
Sbjct: 57  LNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSGRVSFCSQFSWIMPGTIKEN 116

Query: 678 ILYGKPMDKARYDKAIKACALDKDINNFDHGDLTEIGQRGLNLSGGQKQRIQLARAVYND 737
           I++G   D+ RY   +KAC L +DI  F   D T +G+ G+ LSGGQ+ RI LARAVY D
Sbjct: 117 IIFGVSYDEYRYKSVVKACQLQQDITKFAEQDNTVLGEGGVTLSGGQRARISLARAVYKD 176

Query: 738 ADIYLFDDPFSAVDAHTAATLFNECVMAALEKKTVILVTHQVEFLSEVDRILVLEGGQIT 797
           AD+YL D PF  +D  T   +F  CV   +  KT ILVT ++E L + D+IL+L  G   
Sbjct: 177 ADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTSKMEHLRKADKILILHQGSSY 236

Query: 798 QSGNYQELLLAGTAFEQLVNAH 819
             G + EL      F   +  +
Sbjct: 237 FYGTFSELQSLRPDFSSKLMGY 258
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Length = 255 Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Length = 253 Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Length = 251 Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Length = 241 Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Length = 242 Back     information, alignment and structure
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Length = 239 Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 230 Back     information, alignment and structure
>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Length = 240 Back     information, alignment and structure
>d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 254 Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Length = 240 Back     information, alignment and structure
>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Length = 258 Back     information, alignment and structure
>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 232 Back     information, alignment and structure
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Length = 240 Back     information, alignment and structure
>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Length = 238 Back     information, alignment and structure
>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} Length = 231 Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Length = 200 Back     information, alignment and structure
>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Length = 229 Back     information, alignment and structure
>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Length = 242 Back     information, alignment and structure
>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Length = 240 Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Length = 178 Back     information, alignment and structure
>d3b60a2 f.37.1.1 (A:10-328) Multidrug resistance ABC transporter MsbA, N-terminal domain {Salmonella typhimurium [TaxId: 90371]} Length = 319 Back     information, alignment and structure
>d2hyda2 f.37.1.1 (A:1-323) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Length = 323 Back     information, alignment and structure
>d1w1wa_ c.37.1.12 (A:) Smc head domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 427 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query1231
d2hyda1255 Putative multidrug export ATP-binding/permease pro 100.0
d2pmka1241 Haemolysin B ATP-binding protein {Escherichia coli 100.0
d3b60a1253 Multidrug resistance ABC transporter MsbA, C-termi 100.0
d1jj7a_251 Peptide transporter Tap1, C-terminal ABC domain {H 100.0
d1mv5a_242 Multidrug resistance ABC transporter LmrA, C-termi 100.0
d1r0wa_281 Cystic fibrosis transmembrane conductance regulato 100.0
d2awna2232 Maltose transport protein MalK, N-terminal domain 100.0
d1v43a3239 Hypothetical protein PH0022, N-terminal domain {Py 100.0
d1oxxk2242 Glucose transport protein GlcV, N-terminal domain 100.0
d1g2912240 Maltose transport protein MalK, N-terminal domain 100.0
d3d31a2229 Sulfate/molybdate ABC transporter, ATP-binding pro 100.0
d3dhwc1240 Methionine import ATP-binding protein MetN {Escher 100.0
d1l2ta_230 MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 100.0
d1b0ua_258 ATP-binding subunit of the histidine permease {Sal 100.0
d1ji0a_240 Branched chain aminoacid ABC transporter {Thermoto 100.0
d1g6ha_254 MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 100.0
d1vpla_238 Putative ABC transporter TM0544 {Thermotoga mariti 100.0
d2onka1240 Molybdate/tungstate import ATP-binding protein Wtp 100.0
d1l7vc_231 ABC transporter involved in vitamin B12 uptake, Bt 99.97
d1sgwa_200 Putative ABC transporter PF0895 {Pyrococcus furios 99.96
d3b60a2319 Multidrug resistance ABC transporter MsbA, N-termi 99.92
d2hyda2323 Putative multidrug export ATP-binding/permease pro 99.89
d3b60a2319 Multidrug resistance ABC transporter MsbA, N-termi 99.89
d2hyda2323 Putative multidrug export ATP-binding/permease pro 99.84
g1f2t.1292 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 99.57
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 99.16
d1e69a_308 Smc head domain {Thermotoga maritima [TaxId: 2336] 98.62
g1ii8.1369 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 98.6
g1xew.1329 Smc head domain {Pyrococcus furiosus [TaxId: 2261] 98.44
d1w1wa_427 Smc head domain {Baker's yeast (Saccharomyces cere 98.1
d2gj8a1161 Probable tRNA modification GTPase TrmE (MnmE), G d 97.01
d1p9ra_401 Extracellular secretion NTPase EpsE {Vibrio choler 96.7
d1ewqa2224 DNA repair protein MutS, the C-terminal domain {Th 96.37
d1tf7a2242 Circadian clock protein KaiC {Synechococcus sp. st 96.04
d1wb9a2234 DNA repair protein MutS, the C-terminal domain {Es 96.0
d1u0la2225 Probable GTPase EngC (YjeQ), C-terminal domain {Th 95.86
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 95.54
d1cr2a_277 Gene 4 protein (g4p, DNA primase), helicase domain 95.41
d1mkya2186 Probable GTPase Der, N-terminal and middle domains 94.87
d1g6oa_323 Hexameric traffic ATPase, HP0525 {Helicobacter pyl 94.76
d1t9ha2231 Probable GTPase EngC (YjeQ), C-terminal domain {Ba 94.71
d1nlfa_274 Hexameric replicative helicase repA {Escherichia c 94.69
g1ii8.1369 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 94.69
d1znwa1182 Guanylate kinase {Mycobacterium tuberculosis [TaxI 94.62
d1r7ra3265 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 94.44
d1pzna2254 DNA repair protein Rad51, catalytic domain {Archae 94.34
d1ixza_247 AAA domain of cell division protein FtsH {Thermus 94.14
d2i3ba1189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 94.13
d1yj5a2172 5' polynucleotide kinase-3' phosphatase, C-termina 94.09
d1s96a_205 Guanylate kinase {Escherichia coli [TaxId: 562]} 94.04
d1zp6a1176 Hypothetical protein Atu3015 {Agrobacterium tumefa 93.72
d1w1wa_427 Smc head domain {Baker's yeast (Saccharomyces cere 93.58
d1tf7a1242 Circadian clock protein KaiC {Synechococcus sp. st 93.51
d1sq5a_308 Pantothenate kinase PanK {Escherichia coli [TaxId: 93.4
d1svia_195 Probable GTPase EngB {Bacillus subtilis [TaxId: 14 93.27
d1np6a_170 Molybdopterin-guanine dinucleotide biosynthesis pr 93.16
d1tq4a_400 Interferon-inducible GTPase {Mouse (Mus musculus) 93.03
d1lv7a_256 AAA domain of cell division protein FtsH {Escheric 92.89
d1y63a_174 Probable kinase LmjF30.1890 {Leishmania major [Tax 92.56
d1xjca_165 Molybdopterin-guanine dinucleotide biosynthesis pr 92.35
d1kgda_178 Guanylate kinase-like domain of Cask {Human (Homo 92.31
d1h65a_257 Chloroplast protein translocon GTPase Toc34 {Garde 92.1
d1d2na_246 Hexamerization domain of N-ethylmalemide-sensitive 91.98
d1knqa_171 Gluconate kinase {Escherichia coli [TaxId: 562]} 91.93
d1m8pa3183 ATP sulfurylase C-terminal domain {Fungus (Penicil 91.92
d1rz3a_198 Hypothetical protein rbstp0775 {Bacillus stearothe 91.88
d1lw7a2192 Transcriptional regulator NadR, ribosylnicotinamid 91.7
d2bdta1176 Hypothetical protein BH3686 {Bacillus halodurans [ 91.28
d1l8qa2213 Chromosomal replication initiation factor DnaA {Aq 91.26
d1szpa2251 DNA repair protein Rad51, catalytic domain {Baker' 91.16
d1yrba1244 ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss 91.1
d1uj2a_213 Uridine-cytidine kinase 2 {Human (Homo sapiens) [T 91.08
d1n0wa_242 DNA repair protein Rad51, catalytic domain {Human 91.04
d1mkya1171 Probable GTPase Der, N-terminal and middle domains 90.96
d1qhxa_178 Chloramphenicol phosphotransferase {Streptomyces v 90.84
d1wf3a1178 GTPase Era, N-terminal domain {Thermus thermophilu 90.75
d1khta_190 Adenylate kinase {Archaeon Methanococcus voltae [T 90.72
d1wb1a4179 Elongation factor SelB, N-terminal domain {Methano 90.68
d2cxxa1184 GTP-binding protein engB {Pyrococcus horikoshii [T 90.41
d1gkya_186 Guanylate kinase {Baker's yeast (Saccharomyces cer 90.01
d1f6ba_186 SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 89.95
d1ak2a1190 Adenylate kinase {Cow (Bos taurus), mitochondrial 89.8
d1jwyb_306 Dynamin G domain {Dictyostelium discoideum [TaxId: 89.61
d1v5wa_258 Meiotic recombination protein DMC1/LIM15 homolog { 89.54
d1p5zb_241 Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 89.53
d2vp4a1197 Deoxyribonucleoside kinase {Fruit fly (Drosophila 89.38
d1nrjb_209 Signal recognition particle receptor beta-subunit 89.32
d1udxa2180 Obg GTP-binding protein middle domain {Thermus the 89.29
d1nn5a_209 Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 89.28
d1rkba_173 Adenylate kinase {Human (Homo sapiens), isoenzyme 89.1
d1qf9a_194 UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 89.03
d1lvga_190 Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 88.94
d4tmka_210 Thymidylate kinase {Escherichia coli [TaxId: 562]} 88.91
d1gvnb_273 Plasmid maintenance system epsilon/zeta, toxin zet 88.81
d2akab1299 Dynamin G domain {Rat (Rattus norvegicus) [TaxId: 88.79
d1x6va3195 Adenosine-5'phosphosulfate kinase (APS kinase) {Hu 88.78
d1egaa1179 GTPase Era, N-terminal domain {Escherichia coli [T 88.67
d1lnza2185 Obg GTP-binding protein middle domain {Bacillus su 88.65
d1sxje2252 Replication factor C5 {Baker's yeast (Saccharomyce 88.51
d2p67a1327 LAO/AO transport system kinase ArgK {Escherichia c 88.47
d1tmka_214 Thymidylate kinase {Baker's yeast (Saccharomyces c 88.35
d1ksha_165 ADP-ribosylation factor {Mouse (Mus musculus), ARL 88.25
d1upta_169 ADP-ribosylation factor {Human (Homo sapiens), ARL 87.99
d1m7ga_208 Adenosine-5'phosphosulfate kinase (APS kinase) {Fu 87.72
d1r8sa_160 ADP-ribosylation factor {Human (Homo sapiens), ARF 87.65
d1kaga_169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 87.48
d1puia_188 Probable GTPase EngB {Escherichia coli [TaxId: 562 87.35
d1zj6a1177 ADP-ribosylation factor {Human (Homo sapiens), ARL 86.78
d2fh5b1207 Signal recognition particle receptor beta-subunit 86.57
d1qhla_222 Cell division protein MukB {Escherichia coli [TaxI 86.54
d1bifa1213 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata 86.38
d2qtvb1166 SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta 86.22
d1jjva_205 Dephospho-CoA kinase {Haemophilus influenzae [TaxI 86.2
d1g7sa4227 Initiation factor IF2/eIF5b, N-terminal (G) domain 86.18
d2erxa1171 di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 86.12
d2i1qa2258 DNA repair protein Rad51, catalytic domain {Archae 85.84
d1xp8a1268 RecA protein, ATPase-domain {Deinococcus radiodura 85.76
d1ukza_196 Uridylate kinase {Baker's yeast (Saccharomyces cer 85.7
d1odfa_286 Hypothetical protein Ygr205W {Baker's yeast (Sacch 85.63
d1knxa2177 HPr kinase HprK C-terminal domain {Mycoplasma pneu 85.63
d3adka_194 Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} 85.6
d2fnaa2283 Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ 85.12
d1uf9a_191 Dephospho-CoA kinase {Thermus thermophilus [TaxId: 85.06
d1nksa_194 Adenylate kinase {Archaeon Sulfolobus acidocaldari 84.77
d1kk1a3195 Initiation factor eIF2 gamma subunit, N-terminal ( 84.7
d1q3ta_223 CMP kinase {Streptococcus pneumoniae [TaxId: 1313] 84.59
d2qm8a1323 Metallochaperone MeaB {Methylobacterium extorquens 84.0
d1a7ja_288 Phosphoribulokinase {Rhodobacter sphaeroides [TaxI 83.86
d2erya1171 r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 83.84
d1fzqa_176 ADP-ribosylation factor {Mouse (Mus musculus), ARL 83.61
d1u94a1263 RecA protein, ATPase-domain {Escherichia coli [Tax 83.57
d1ky3a_175 Rab-related protein ypt7p {Baker's yeast (Saccharo 83.55
d3raba_169 Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} 83.53
d1sxja2253 Replication factor C1 {Baker's yeast (Saccharomyce 83.53
d1zaka1189 Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} 83.51
d2f9la1175 Rab11b {Human (Homo sapiens) [TaxId: 9606]} 83.34
d1gsia_208 Thymidylate kinase {Mycobacterium tuberculosis [Ta 83.23
d1kkma_176 HPr kinase HprK C-terminal domain {Lactobacillus c 82.98
d1htwa_158 Hypothetical protein HI0065 {Haemophilus influenza 82.65
d1zina1182 Adenylate kinase {Bacillus stearothermophilus [Tax 82.59
d2qn6a3205 Initiation factor eIF2 gamma subunit, N-terminal ( 82.36
d1vg8a_184 Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} 82.24
d1viaa_161 Shikimate kinase (AroK) {Campylobacter jejuni [Tax 82.22
d1kaoa_167 Rap2a {Human (Homo sapiens) [TaxId: 9606]} 82.01
d1z06a1165 Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} 81.94
d1e6ca_170 Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax 81.92
d2gjsa1168 Rad {Human (Homo sapiens) [TaxId: 9606]} 81.91
d1vhta_208 Dephospho-CoA kinase {Escherichia coli [TaxId: 562 81.89
d1in4a2238 Holliday junction helicase RuvB {Thermotoga mariti 81.89
d1teva_194 UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] 81.79
d2g3ya1172 GTP-binding protein GEM {Human (Homo sapiens) [Tax 81.79
d2atva1168 Ras-like estrogen-regulated growth inhibitor, RERG 81.78
d2f7sa1186 Rab27b {Human (Homo sapiens) [TaxId: 9606]} 81.67
d2a5ja1173 Rab2b {Human (Homo sapiens) [TaxId: 9606]} 81.51
d1xzpa2160 TrmE GTPase domain {Thermotoga maritima [TaxId: 23 81.37
d1xtqa1167 GTP-binding protein RheB {Human (Homo sapiens) [Ta 81.26
d2ocpa1241 Deoxyguanosine kinase {Human (Homo sapiens) [TaxId 81.25
d1s3ga1182 Adenylate kinase {Bacillus globisporus [TaxId: 145 81.23
d1z2aa1164 Rab23 {Mouse (Mus musculus) [TaxId: 10090]} 81.22
d1ctqa_166 cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 81.22
d1f5na2277 Interferon-induced guanylate-binding protein 1 (GB 81.21
d2c78a3204 Elongation factor Tu (EF-Tu), N-terminal (G) domai 81.11
d1ckea_225 CMP kinase {Escherichia coli [TaxId: 562]} 81.08
d1okkd2207 GTPase domain of the signal recognition particle r 80.85
d1g16a_166 Rab-related protein Sec4 {Baker's yeast (Saccharom 80.65
d1svma_362 Papillomavirus large T antigen helicase domain {Si 80.65
d1ko7a2169 HPr kinase HprK C-terminal domain {Staphylococcus 80.46
d1p6xa_333 Thymidine kinase {Equine herpesvirus type 4 [TaxId 80.44
d1ofha_309 HslU {Haemophilus influenzae [TaxId: 727]} 80.43
d2iyva1165 Shikimate kinase (AroK) {Mycobacterium tuberculosi 80.34
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: ABC transporter ATPase domain-like
domain: Putative multidrug export ATP-binding/permease protein SAV1866
species: Staphylococcus aureus [TaxId: 1280]

Probab=100.00  E-value=0  Score=445.55  Aligned_cols=226  Identities=30%  Similarity=0.515  Sum_probs=214.3

Q ss_pred             CCCCEEEEEEEEEECCCCCCCCEEEEEEEEECCEEEEEECCCCCCHHHHHHHHHCCCCCCCCEEEECC------------
Q ss_conf             99848998326861799987710348888508809999776888958899998298758885899849------------
Q 000905          591 SDRSVKIQEGNFSWDPELAIPTLRGVNLDIKWAQKIAVCGSVGAGKSSLLYAILGEIPKISGTVNLYG------------  658 (1231)
Q Consensus       591 ~~~~i~~~n~sf~w~~~~~~~~L~~inl~i~~G~lvaIvG~~GSGKSTLl~allGe~~~~~G~V~v~g------------  658 (1231)
                      ..+.|+++|++|+|+++ ..++|+|+||++++|+.++|+|++|||||||+++|+|.+++.+|+|.++|            
T Consensus        13 ~~g~I~~~nvsf~Y~~~-~~~vL~~isl~i~~Ge~vaivG~sGsGKSTLl~ll~gl~~p~~G~I~i~g~~i~~~~~~~lr   91 (255)
T d2hyda1          13 KQGRIDIDHVSFQYNDN-EAPILKDINLSIEKGETVAFVGMSGGGKSTLINLIPRFYDVTSGQILIDGHNIKDFLTGSLR   91 (255)
T ss_dssp             CSCCEEEEEEEECSCSS-SCCSEEEEEEEECTTCEEEEECSTTSSHHHHHTTTTTSSCCSEEEEEETTEEGGGSCHHHHH
T ss_pred             CCCEEEEEEEEEEECCC-CCCCEECEEEEECCCCEEEEECCCCCCHHHHHHHHHHCCCCCCCCCCCCCEECCCCCHHHHH
T ss_conf             78879999889995999-97606443899839989999889998099999999712786300015399875307888863


Q ss_pred             -EEEEEECCCCCCCCCHHHHHHCCCC-CCHHHHHHHHHHHCCHHHHHCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHC
Q ss_conf             -1999807886898898899713999-99999999999814458881188999630267887689079999999999823
Q 000905          659 -SIAYVSQTSWIQSGSIRDNILYGKP-MDKARYDKAIKACALDKDINNFDHGDLTEIGQRGLNLSGGQKQRIQLARAVYN  736 (1231)
Q Consensus       659 -~iayv~Q~pwi~n~TIreNIlfg~~-~d~~~y~~vl~ac~L~~dl~~Lp~Gd~T~IGe~G~nLSGGQKqRIsLARAly~  736 (1231)
                       .++||+|+|++|++||||||+||.+ .+++++.++++.|++.++++.||+|++|.+||+|.+|||||||||+||||+|+
T Consensus        92 ~~i~~v~Q~~~lf~~Ti~eNi~~g~~~~~~~~~~~al~~~~l~~~i~~lp~gl~t~i~~~g~~LSgGq~QRi~iARal~~  171 (255)
T d2hyda1          92 NQIGLVQQDNILFSDTVKENILLGRPTATDEEVVEAAKMANAHDFIMNLPQGYDTEVGERGVKLSGGQKQRLSIARIFLN  171 (255)
T ss_dssp             HTEEEECSSCCCCSSBHHHHHGGGCSSCCHHHHHHHHHHTTCHHHHHTSTTGGGCBCCGGGTTSCHHHHHHHHHHHHHHH
T ss_pred             HEEEEEECCCCCCCCCHHHHHHCCCCCCCHHHHHHHHHHHCCHHHHHHCCCCCCCHHCCCCCCCCHHHHHHHHHHHHHHC
T ss_conf             41456510156899879999851586799999999999969799997362420103338889849999999999999855


Q ss_pred             CCCEEEEECCCCCCCHHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHCCCEEEEEECCEEEEECCHHHHHHCCCHHHHHH
Q ss_conf             99899980778888999899999999978239968999826943120148699992983857048689986171699999
Q 000905          737 DADIYLFDDPFSAVDAHTAATLFNECVMAALEKKTVILVTHQVEFLSEVDRILVLEGGQITQSGNYQELLLAGTAFEQLV  816 (1231)
Q Consensus       737 ~adI~LLDDplSAlDa~~~~~If~~~i~~~l~~kTvIlvTH~l~~l~~aD~Iivl~~G~I~~~G~~~eL~~~~~~~~~l~  816 (1231)
                      +|+|++||||||+||+++++.|++ .+....+++|+|+|||+++.++.||+|++|++|+|++.|+|+||+++++.|++++
T Consensus       172 ~p~ililDEpts~LD~~t~~~i~~-~l~~l~~~~TvI~itH~~~~~~~~D~ii~l~~G~iv~~G~~~eLl~~~~~y~~l~  250 (255)
T d2hyda1         172 NPPILILDEATSALDLESESIIQE-ALDVLSKDRTTLIVAHRLSTITHADKIVVIENGHIVETGTHRELIAKQGAYEHLY  250 (255)
T ss_dssp             CCSEEEEESTTTTCCHHHHHHHHH-HHHHHTTTSEEEEECSSGGGTTTCSEEEEEETTEEEEEECHHHHHHTTSHHHHHH
T ss_pred             CCCEEEEECCCCCCCHHHHHHHHH-HHHHHHCCCEEEEEECCHHHHHHCCEEEEEECCEEEEECCHHHHHHCCCHHHHHH
T ss_conf             998999837654479779999999-9998753888999968999998599999998999999889999986884999999


Q ss_pred             HH
Q ss_conf             98
Q 000905          817 NA  818 (1231)
Q Consensus       817 ~~  818 (1231)
                      +.
T Consensus       251 ~~  252 (255)
T d2hyda1         251 SI  252 (255)
T ss_dssp             TT
T ss_pred             HH
T ss_conf             97
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Back     information, alignment and structure
>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Back     information, alignment and structure
>d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d3b60a2 f.37.1.1 (A:10-328) Multidrug resistance ABC transporter MsbA, N-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2hyda2 f.37.1.1 (A:1-323) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d3b60a2 f.37.1.1 (A:10-328) Multidrug resistance ABC transporter MsbA, N-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2hyda2 f.37.1.1 (A:1-323) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1e69a_ c.37.1.12 (A:) Smc head domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1w1wa_ c.37.1.12 (A:) Smc head domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1ewqa2 c.37.1.12 (A:542-765) DNA repair protein MutS, the C-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1wb9a2 c.37.1.12 (A:567-800) DNA repair protein MutS, the C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} Back     information, alignment and structure
>d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1w1wa_ c.37.1.12 (A:) Smc head domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tq4a_ c.37.1.8 (A:) Interferon-inducible GTPase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1wb1a4 c.37.1.8 (A:1-179) Elongation factor SelB, N-terminal domain {Methanococcus maripaludis [TaxId: 39152]} Back     information, alignment and structure
>d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} Back     information, alignment and structure
>d1jwyb_ c.37.1.8 (B:) Dynamin G domain {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p5zb_ c.37.1.1 (B:) Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d2akab1 c.37.1.8 (B:6-304) Dynamin G domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tmka_ c.37.1.1 (A:) Thymidylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} Back     information, alignment and structure
>d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} Back     information, alignment and structure
>d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} Back     information, alignment and structure
>d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1qhla_ c.37.1.12 (A:) Cell division protein MukB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1jjva_ c.37.1.1 (A:) Dephospho-CoA kinase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1g7sa4 c.37.1.8 (A:1-227) Initiation factor IF2/eIF5b, N-terminal (G) domain {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1knxa2 c.91.1.2 (A:133-309) HPr kinase HprK C-terminal domain {Mycoplasma pneumoniae [TaxId: 2104]} Back     information, alignment and structure
>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d1kk1a3 c.37.1.8 (A:6-200) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Archaeon Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} Back     information, alignment and structure
>d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1kkma_ c.91.1.2 (A:) HPr kinase HprK C-terminal domain {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d1htwa_ c.37.1.18 (A:) Hypothetical protein HI0065 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2qn6a3 c.37.1.8 (A:2-206) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vhta_ c.37.1.1 (A:) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ocpa1 c.37.1.1 (A:37-277) Deoxyguanosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} Back     information, alignment and structure
>d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f5na2 c.37.1.8 (A:7-283) Interferon-induced guanylate-binding protein 1 (GBP1), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c78a3 c.37.1.8 (A:9-212) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Back     information, alignment and structure
>d1ko7a2 c.91.1.2 (A:130-298) HPr kinase HprK C-terminal domain {Staphylococcus xylosus [TaxId: 1288]} Back     information, alignment and structure
>d1p6xa_ c.37.1.1 (A:) Thymidine kinase {Equine herpesvirus type 4 [TaxId: 10331]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure