Citrus Sinensis ID: 000923

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------1000------1010------1020------1030------1040------1050------1060------1070------1080------1090------1100------1110------1120------1130------1140------1150------1160------1170------1180------1190------1200------1210------1220--
MGRKKPSVRDEANLPAVAQGGGKSKKKAVVIDDDEYSIGTELTEEPQEEEAVNNNKKKKGKKGNQKNLQAEDDDSKGEEGEENDAEAIVFTGKKKSKGKKNGGNNALSKSAFELLEGADKDDDDDDSGDKLSKGKYVSLASKGKTKEGLKKGWNKSGSLFAAAAFDAVDGGSESEVIDDDHSVEESDDDDDDVVEKSKKGGKKKSGTTGFSASAFDLLDDEDEDVREDKDEEDEPVIFTDKKKKSKKSGKNSSTFDLLVNENDDVKEDKDEDDEPITFTDKKKKSNKGGRMRSSAFDLLENEDEDDDEKKDKDEEDEPIIFTDKKKKTKSSKKTVSSFSEVLLDEENVVEDAPVLSDVSGAVDTKQQSGDSSIVESDDFKVNKGEVVAQTSKNKKKKKEKEKPRSERTAQEEDDLEKILAELGQGPAPQEEKVQVQPPEPVAPPDAADEKVGEEEKEESAASKKKKKKKEKEKEKKAAAAAAAEDKQQGKSEAVETKKNDGKSKGPEKKMSKQVREMQEALARRKEAEERKKREEEERLRKEEEERKRLEELERQAEEADSEPEPLVKKEIKSAIPSPRDAAEKPAVAVKKAIPEQPLKSQDAVTRKKEPAAKSKEPEVDATPKQAEENLRSPICCIMGHVDTGKTKLLDCIRGTNVQEGEAGGITQQIGATYFPAENIRERTRELKANATLKVPGLLVIDTPGHESFTNLRSRGSGLCDIAILVVDIMHGLEPQTIESLNLLKMRNTEFIVALNKVDRLYGWKTCRNAPIVKAIKQQNTDVQNEFNMRLVQIVTQLKEQGMNTELYYKNKDRGETFNIVPTSAISGEGIPDLLLLLVQWTQKTMVEKLTFRNELQCTVLEVKVIEGHGTTIDVVLVNGVLHEGDQIVVCGLQGPIVTTIRALLTPHPMKELRVKGTYLHHKQIKAAQGIKITAQGLEHAIAGTGLYVVGPDDDLEDVKEEAMEDMKSVMSRIDKSGEGVCVQASTLGSLEALLEFLKSDAVKIPVSGISIGPVHKKDVMRASVMLEKKKEYATILAFDVKVTPEARELAEELGVKIFIADIIYHLFDQFTAYINNLKEEKKREAADEAVFPCVLKILPNCVFNKKDPIVLGVDVVEGIAKVGTPICIPQRDFIDIGRIASIENNHKPVDTAKKGQKAAIKIAGSNSEEQQKMFGRHFDIEDELVSHISRKSIDVLKANYRDDLSMDEWRLLVKLKNLFKIQ
ccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHccccccccccccccccccccccccccccccccccccccccccccccHHHcccccccccccccccccccccccccccHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHcccccHHcccHHHHHHHHHHccccHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHcccccccccccHHcHHccccccccccHHHHHHHHHcccccccccccccccccccccccccEEEEcccccccccccHHHHHccccccccccHHHHccccEEEccHHHHHHHHHHHcccccccccEEEEccccHHHHHHHHHcccccccEEEEEEEccccccHHHHHHHHHHHHccccEEEEEEccccccccccccccHHHHHHHcccHHHHHHHHHHHHHHHHHHHHcccccccccccccccccEEEEEccccccccHHHHHHHHHHHHHHHHHHcccccccccEEEEEEEEcccccEEEEEEEEccEEccccEEEEcccccccEEEEccccccccccccccccccccccccccccccEEEEcccccccccccEEEccccccHHHHHHHHHHHHHHHHHccccccccEEEEcccHHHHHHHHHHHccccccccEEEEEcccccHHHHHHHHHcccccccccEEEEEcccccHHHHHHHHHHcccEEEcccHHHHHHHHHHHHHHHHHHHHHHHcccEEEcEEEEEcccccccccccEEEEEEEEEEEEEEcccEEEEccccEEEEEEEEHHHccccccccccccEEEEEEEcccccccccccccccccccEEEEEccHHHHHHHHHHHHccccHHHHHHHHHHHHHHccc
ccccccccccHHccccccccccccccEEEEEEccccEEcEEccccccccccccccccccccccccccccHcccccccccccccccccEEEcccccccccccccccHHHHcHEEEcccccccccccccccccccccccEEEEcccEEccccccccccccccHHHHcccccccccccccccccccccccccccccEccccccccccccccccccccEEEEccccHHHcccccHccccEEEEcccHcccccccccccccccccccccccccccccccccEEcccccccccccccEEEHHHEEEcccccccHHHHcccccccEEEEHHHHccccccEEEEcccccccccccccccccccHHHHccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHcccccHHccHHHHHHHHHHHHHHccHHHccHHHHHHHHHHHHHccHHHHHHHccccccccccccccHHcccHHHcHHHHHHHHHHHHHHHHHccccccHHHcHccccccccccccccHHHHHHHccccccHHHHHHcccccccHHHHHHHcHccHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHccccccccccccEEEEEccccccHHHHHHHHHHccccccccccccEEEcEEEEccHHHHHHHHHHHccccccccEEEEEccccHHHHHHHHHccccccEEEEEEEEccccccHHHHHHHHHHHHccccEEEEEEccccccccccccccHHHHHHHHHcHHHHHHHHHcHHHHHHHHHHccccHHHHHHcccccccEEEEEEEccccccHHHHHHHHHHHHHHHHHHHcccccccEEEEEEEEEccccccEEEEEEEccEEccccEEEEEcccccEEEEEEEEcccccccEEEEcccHcccEEEEcccccEEEEccccccccccEEEEEccHHHHHHHHHHHHHHHHHHHHccccccccEEEEEccHHHHHHHHHHccccccEEEEEEcccccccHHHHHHHHHHHHHccccEEEEEEEccccHHHHHHHHHccccEEHHHHHHHHHHHHHHHHHHHccHHHHHHHcccEcccEEEEcccEEEcccccEEEEEEEEcEEEEccccEEEEcccEEEEEEEHHHHHccccHHHHHcccEEEEEEEcccccccccccccccccccEEEEEEHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHccc
mgrkkpsvrdeanlpavaqgggkskkkavvidddeysigtelteepqeeeavnnnkkkkgkkgnqknlqaedddskgeegeendAEAIVFTGkkkskgkknggnnalSKSAFELLegadkddddddsgdklskgkyvslaskgktkeglkkgwnksGSLFAAAAfdavdggsesevidddhsveesddddddVVEKskkggkkksgttgfsasafdllddededvredkdeedepviftdkkkkskksgknsstFDLLVnenddvkedkdeddepitftdkkkksnkggrmrssafdllenededddekkdkdeedepiiftdkkkktksskKTVSSFSEVLldeenvvedapvlsdvsgavdtkqqsgdssivesddfkvnkgevVAQTSKnkkkkkekekprsertaqEEDDLEKILAElgqgpapqeekvqvqppepvappdaadekvgeeeKEESAASKKKKKKKEKEKEKKAAAAAAAEDKQQGKSEAVETkkndgkskgpekkMSKQVREMQEALARRKEAEERKKREEEERLRKEEEERKRLEELERQAeeadsepeplvKKEIKsaipsprdaaekPAVAVkkaipeqplksqdavtrkkepaakskepevdatpkqaeenlrspiccimghvdtgktklldcirgtnvqegeaggitqqigatyfpaenIRERTRELKAnatlkvpgllvidtpghesftnlrsrgsglcdiAILVVDImhglepqtiESLNLLKMRNTEFIVALNKVDRlygwktcrnapIVKAIKQQNTDVQNEFNMRLVQIVTQLKEQGMNtelyyknkdrgetfnivptsaisgegIPDLLLLLVQWTQKTMVEKLTFRNELQCTVLEVKVIEGHGTTIDVVLVNgvlhegdqivvcglqgpiVTTIRALltphpmkelrvkgtYLHHKQIKAAQGIKITAQGLEHaiagtglyvvgpdddledVKEEAMEDMKSVMSRIDksgegvcvqASTLGSLEALLEFLKsdavkipvsgisigpvhkKDVMRASVMLEKKKEYATILAFDVKVTPEARELAEELGVKIFIADIIYHLFDQFTAYINNLKEEKkreaadeavFPCVLkilpncvfnkkdpivlGVDVVEGIakvgtpicipqrdfidigriasiennhkpvdtaKKGQKAAIKIAGSNSEEQQKMFGRHFDIEDELVSHISRKSIDVLKANYRDDLSMDEWRLLVKLKNLFKIQ
mgrkkpsvrdeanlpavaqgggkskkkavviDDDEYSigtelteepqeeeavnnnkkkkgkkgnqknlqaedddskgeegeendaeaivftgkkkskgkknggnnalSKSAFELLEGadkddddddsgdklskgkyvslaskgktkeglkkgWNKSGSLFAAAAFDAVDGGSEsevidddhsveesddddddvvekskkggkkksgttgfsasafdllddededvredkdeedepviftdkkkkskksgknsstfdllvnenddvkedkdeddepitftdkkkksnkggrmrssafdllenededddekkdkdeedepiiftdkkkktksskktvssfsevlldeenvvedapvlsdvsgavdtkqqsgdssivesddfkvnkgevvaqtsknkkkkkekekprsertaqeedDLEKILAELGQGPapqeekvqvqppepvAPPDAAdekvgeeekeesaaskkkkkkkekeKEKKAAAaaaaedkqqgkseavetkkndgkskgpekkmskqVREMQEALARrkeaeerkkreeeerlrkeeeerkrleelerqaeeadsepeplvkkeiksaipsprdaaEKPAVAVKkaipeqplksqdavtrkkepaakskepevdatpkqaeenlrspiCCIMGHVDTGKTKLLDCIRGTNvqegeaggitqqigatyFPAENIRERTRELKanatlkvpgllvidtpGHESFTNLRSRGSGLCDIAILVVDIMHGLEPQTIESLNLLKMRNTEFIVALNKVDRLYGWKTCRNAPIVKAIKQQNTDVQNEFNMRLVQIVTQLKEQGMNTELyyknkdrgetFNIVPTSAISGEGIPDLLLLLVQWTQKTMVEKLTFRNELQCTVLEVKVIEGHGTTIDVVLVNGVLHEGDQIVVCGLQGPIVTTIRALLTPHPMKELRVKGTYLHHKQIKAAQGIKITAQGLEHAIAGTGLYVVGPDDDLEDVKEEAMEDMKSVMSRIDKSGEGVCVQASTLGSLEALLEFLKSDAvkipvsgisigpvhkkdVMRASVMLEKKKEYATILAFDVKVTPEARELAEELGVKIFIADIIYHLFDQFTAYINNLKEEKKREAADEAVFPCVLKILPNCVFNKKDPIVLGVDVVEGIAkvgtpicipqrdFIDIGRIASIEnnhkpvdtakkgQKAAIKIAGSNSEEQQKMFGRHFDIEDELVSHISRKSIDVLKAnyrddlsmdEWRLLVKLKNLFKIQ
MGRKKPSVRDEANLPAVAQGGGKSKKKAVVIDDDEYSIGTelteepqeeeAVnnnkkkkgkkgnqknLQAedddskgeegeendAEAIVFTgkkkskgkknggnnalsksAFELLEGAdkddddddsgdklskgkYVSLASKGKTKEGLKKGWNKSGSLfaaaafdavdggsesevidddhsveesddddddvvekskkggkkksgTTGFSASAFdllddededvredkdeedePVIFTDkkkkskksgknssTFDLLvnenddvkedkdeddePITFTDKKKKSNKGGRMRSSAFDLLenededddekkdkdeedePIIFTDkkkktksskktvssfsevlldeenvvedAPVLSDVSGAVDTKQQSGDSSIVESDDFKVNKGEVVAQTSknkkkkkekekPRSERTAQEEDDLEKILAELGQGpapqeekvqvqppepvappdaadekvgeeekeesaaskkkkkkkekekekkaaaaaaaedkqqgkSEAVETKKNDGKSKGPEKKMSKQVREMQealarrkeaeerkkreeeerlrkeeeerkrleelerqaeeaDSEPEPLVKKEIKSAIPSPRDaaekpavavkkaipeQPLKSQDAVTRkkepaakskepeVDATPKQAEENLRSPICCIMGHVDTGKTKLLDCIRGTNVQEGEAGGITQQIGATYFPAENIRERTRELKANATLKVPGLLVIDTPGHESFTNLRSRGSGLCDIAILVVDIMHGLEPQTIESLNLLKMRNTEFIVALNKVDRLYGWKTCRNAPIVKAIKQQNTDVQNEFNMRLVQIVTQLKEQGMNTELYYKNKDRGETFNIVPTSAISGEGIPDLLLLLVQWTQKTMVEKLTFRNELQCTVLEVKVIEGHGTTIDVVLVNGVLHEGDQIVVCGLQGPIVTTIRALLTPHPMKELRVKGTYLHHKQIKAAQGIKITAQGLEHAIAGTGLYVVGPDDDLEDVKEEAMEDMKSVMSRIDKSGEGVCVQASTLGSLEALLEFLKSDAVKIPVSGISIGPVHKKDVMRASVMLEKKKEYATILAFDVKVTPEARELAEELGVKIFIADIIYHLFDQFTAYINNLkeekkreaadeaVFPCVLKILPNCVFNKKDPIVLGVDVVEGIAKVGTPICIPQRDFIDIGRIASIENNHKPVDTakkgqkaaikiagSNSEEQQKMFGRHFDIEDELVSHISRKSIDVLKANYRDDLSMDEWRLLVKLKNLFKIQ
**************************************************************************************************************************************************************LFAAAAF***********************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************PICCIMGHVDTGKTKLLDCIRGTNVQEGEAGGITQQIGATYFPAENIRERTRELKANATLKVPGLLVIDTPGHESFTNLRSRGSGLCDIAILVVDIMHGLEPQTIESLNLLKMRNTEFIVALNKVDRLYGWKTCRNAPIVKAIKQQNTDVQNEFNMRLVQIVTQLKEQGMNTELYYKNKDRGETFNIVPTSAISGEGIPDLLLLLVQWTQKTMVEKLTFRNELQCTVLEVKVIEGHGTTIDVVLVNGVLHEGDQIVVCGLQGPIVTTIRALLTPHPMKELRVKGTYLHHKQIKAAQGIKITAQGLEHAIAGTGLYVVGP***************************GVCVQASTLGSLEALLEFLKSDAVKIPVSGISIGPVHKKDVMRASVMLEKKKEYATILAFDVKVTPEARELAEELGVKIFIADIIYHLFDQFTAYINNLKEEKKREAADEAVFPCVLKILPNCVFNKKDPIVLGVDVVEGIAKVGTPICIPQRDFIDIGRIASIE*******************************GRHFDIEDELVSHISRKSIDVLKANYRDDLSMDEWRLLVKLKNLFK**
*************************************I************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************AVTRKKEP***********************ICCIMGHVDTGKTKLLDCIRGTNVQEGEAGGITQQIGATYFPAENIRERTRELKANATLKVPGLLVIDTPGHESFTNLRSRGSGLCDIAILVVDIMHGLEPQTIESLNLLKMRNTEFIVALNKVDRLYGWKTCRNAP************QNEFNMRLVQIVTQLKEQGMNTELYYKNKDRGETFNIVPTSAISGEGIPDLLLLLVQWTQKTMVEKLTFRNELQCTVLEVKVIEGHGTTIDVVLVNGVLHEGDQIVVCGLQGPIVTTIRALLTPHPMKE**************AAQGIKITAQGLEHAIAGTGLYVVGPDDDLEDVKEEA************KSGEGVCVQASTLGSLEALLEFLKSDAVKIPVSGISIGPVHKKDVMRASVMLEKKKEYATILAFDVKVTPEARELAEELGVKIFIADIIYHLFDQFTAYINNLKEEKKREAADEAVFPCVLKILPNCVFNKKDPIVLGVDVVEGIAKVGTPICIPQRDFIDIGRIASIENNHKPVDTAKKGQKAAIKIAGSNSEEQQKMFGRHFDIEDELVSHISRKSIDVLKANYRDDLSMDEWRLLVKLKNLFKIQ
**********EANLPAV**********AVVIDDDEYSIGTEL******************************************AEAIVFTGK*********GNNALSKSAFELLEGA***********KLSKGKYVSLASKGKTKEGLKKGWNKSGSLFAAAAFDAV***************************************TGFSASAFDLLDDED***********EPVIFT*************STFDLLVNENDD**********PITFT************RSSAFDLLE**************EDEPIIFTD**************FSEVLLDEENVVEDAPVLSDVSG**************ESDDFKVNKGEVV**************************DLEKILAELGQGP*********************************************************************************************************************************************KKEIKSA*************AVKKAIPEQP****************************AEENLRSPICCIMGHVDTGKTKLLDCIRGTNVQEGEAGGITQQIGATYFPAENIRERTRELKANATLKVPGLLVIDTPGHESFTNLRSRGSGLCDIAILVVDIMHGLEPQTIESLNLLKMRNTEFIVALNKVDRLYGWKTCRNAPIVKAIKQQNTDVQNEFNMRLVQIVTQLKEQGMNTELYYKNKDRGETFNIVPTSAISGEGIPDLLLLLVQWTQKTMVEKLTFRNELQCTVLEVKVIEGHGTTIDVVLVNGVLHEGDQIVVCGLQGPIVTTIRALLTPHPMKELRVKGTYLHHKQIKAAQGIKITAQGLEHAIAGTGLYVVGPDDDLEDVKEEAMEDMKSVMSRIDKSGEGVCVQASTLGSLEALLEFLKSDAVKIPVSGISIGPVHKKDVMRASVMLEKKKEYATILAFDVKVTPEARELAEELGVKIFIADIIYHLFDQFTAYINNLKEEKKREAADEAVFPCVLKILPNCVFNKKDPIVLGVDVVEGIAKVGTPICIPQRDFIDIGRIASIENNHKPVD********AIKIAGSNSEEQQKMFGRHFDIEDELVSHISRKSIDVLKANYRDDLSMDEWRLLVKLKNLFKIQ
************************KKKAVVIDDDEYSIGTELTE******************************************AIV*****************L*K**************************YVSLASKGKTKE*******************************************************************F****DEDED*RE*KD***EP*IFTD*************************************************RMRSSAFDLLENEDE*********EEDEPIIFTDKKKKTK**KKT*S*******************************************************************************************************************************************************************************************************************************************************************QPLKSQDAVTRKKEPAAKSKEPEVD******EENLRSPICCIMGHVDTGKTKLLDCIRGTNVQEGEAGGITQQIGATYFPAENIRERTRELKANATLKVPGLLVIDTPGHESFTNLRSRGSGLCDIAILVVDIMHGLEPQTIESLNLLKMRNTEFIVALNKVDRLYGWKTCRNAPIVKAIKQQNTDVQNEFNMRLVQIVTQLKEQGMNTELYYKNKDRGETFNIVPTSAISGEGIPDLLLLLVQWTQKTMVEKLTFRNELQCTVLEVKVIEGHGTTIDVVLVNGVLHEGDQIVVCGLQGPIVTTIRALLTPHPMKELRVKGTYLHHKQIKAAQGIKITAQGLEHAIAGTGLYVVGPDDDLEDVKEEAMEDMKSVMSRIDKSGEGVCVQASTLGSLEALLEFLKSDAVKIPVSGISIGPVHKKDVMRASVMLEKKKEYATILAFDVKVTPEARELAEELGVKIFIADIIYHLFDQFTAYINNLKEEKKREAADEAVFPCVLKILPNCVFNKKDPIVLGVDVVEGIAKVGTPICIPQRDFIDIGRIASIENNHKPVDTAKKGQKAAIKIAGSNSEEQQKMFGRHFDIEDELVSHISRKSIDVLKANYRDDLSMDEWRLLVKLKNLFKIQ
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGRKKPSVRDEANLPAVAQGGGKSKKKAVVIDDDEYSIGTELTEEPQEEEAVNNNKKKKGKKGNQKNLQAEDDDSKGEEGEENDAEAIVFTGKKKSKGKKNGGNNALSKSAFELLEGADKDDDDDDSGDKLSKGKYVSLASKGKTKEGLKKGWNKSGSLFAAAAFDAVDGGSESEVIDDDHSVEESDDDDDDVVEKSKKGGKKKSGTTGFSASAFDLLDDEDEDVREDKDEEDEPVIFTDKKKKSKKSGKNSSTFDLLVNENDDVKEDKDEDDEPITFTDKKKKSNKGGRMRSSAFDLLENEDEDDDEKKDKDEEDEPIIFTDKKKKTKSSKKTVSSFSEVLLDEENVVEDAPVLSDVSGAVDTKQQSGDSSIVESDDFKVNKGEVVAQTSKNKKKKKEKEKPRSERTAQEEDDLEKILAELGQGPAPQEEKVQVQPPEPVAPPDAADEKVGxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxGKSEAVETKKNDGKSKGPEKKxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxPEPLVKKEIKSAIPSPRDAAEKPAVAVKKAIPEQPLKSQDAVTRKKEPAAKSKEPEVDATPKQAEENLRSPICCIMGHVDTGKTKLLDCIRGTNVQEGEAGGITQQIGATYFPAENIRERTRELKANATLKVPGLLVIDTPGHESFTNLRSRGSGLCDIAILVVDIMHGLEPQTIESLNLLKMRNTEFIVALNKVDRLYGWKTCRNAPIVKAIKQQNTDVQNEFNMRLVQIVTQLKEQGMNTELYYKNKDRGETFNIVPTSAISGEGIPDLLLLLVQWTQKTMVEKLTFRNELQCTVLEVKVIEGHGTTIDVVLVNGVLHEGDQIVVCGLQGPIVTTIRALLTPHPMKELRVKGTYLHHKQIKAAQGIKITAQGLEHAIAGTGLYVVGPDDDLEDVKEEAMEDMKSVMSRIDKSGEGVCVQASTLGSLEALLEFLKSDAVKIPVSGISIGPVHKKDVMRASVMLEKKKEYATILAFDVKVTPEARELAEELGVKIFIADIIYHLFDQFTAYINNLKEEKKREAADEAVFPCVLKILPNCVFNKKDPIVLGVDVVEGIAKVGTPICIPQRDFIDIGRIASIENNHKPVDTAKKGQKAAIKIAGSNSEEQQKMFGRHFDIEDELVSHISRKSIDVLKANYRDDLSMDEWRLLVKLKNLFKIQ
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query1222 2.2.26 [Sep-21-2011]
Q102511079 Eukaryotic translation in yes no 0.504 0.570 0.584 0.0
O608411220 Eukaryotic translation in yes no 0.483 0.484 0.550 0.0
P397301002 Eukaryotic translation in yes no 0.482 0.588 0.558 0.0
Q05D441216 Eukaryotic translation in yes no 0.483 0.486 0.550 0.0
B2GUV71216 Eukaryotic translation in yes no 0.483 0.486 0.550 0.0
Q5RDE11220 Eukaryotic translation in yes no 0.483 0.484 0.536 0.0
Q54XP61045 Eukaryotic translation in yes no 0.490 0.573 0.516 0.0
A8A8D3609 Probable translation init yes no 0.464 0.932 0.410 1e-122
A3DMS0606 Probable translation init yes no 0.468 0.945 0.406 1e-119
Q9Y9B3617 Probable translation init yes no 0.469 0.930 0.396 1e-113
>sp|Q10251|IF2P_SCHPO Eukaryotic translation initiation factor 5B OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC56F8.03 PE=1 SV=1 Back     alignment and function desciption
 Score =  747 bits (1929), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 372/636 (58%), Positives = 477/636 (75%), Gaps = 20/636 (3%)

Query: 602  DAVTRKKEPAAKSKEPEVDATPKQA-------EENLRSPICCIMGHVDTGKTKLLDCIRG 654
            DAV    +    SK  +VD  P+ A       E +LRSPICCI+GHVDTGKTKLLD +R 
Sbjct: 447  DAVEHSIKDKEDSKTDKVDDIPQAAPAESNVSESDLRSPICCILGHVDTGKTKLLDNLRR 506

Query: 655  TNVQEGEAGGITQQIGATYFPAENIRERTRELKANATLK--VPGLLVIDTPGHESFTNLR 712
            +NVQEGEAGGITQQIGATYFP E+I+++T+ +     L+  +PGLL+IDTPGHESFTNLR
Sbjct: 507  SNVQEGEAGGITQQIGATYFPIESIKQKTKVVNKKGKLQYNIPGLLIIDTPGHESFTNLR 566

Query: 713  SRGSGLCDIAILVVDIMHGLEPQTIESLNLLKMRNTEFIVALNKVDRLYGWKTCRNAPIV 772
            SRG+ LC+IAILV+DIMHGLEPQTIES+ LL+ + T F+VALNKVDRLYGW + ++  I 
Sbjct: 567  SRGTSLCNIAILVIDIMHGLEPQTIESIRLLRDQKTPFVVALNKVDRLYGWHSIKDNAIQ 626

Query: 773  KAIKQQNTDVQNEFNMRLVQIVTQLKEQGMNTELYYKNKDRGETFNIVPTSAISGEGIPD 832
             ++ +Q   +Q EF  R+  I+ QL EQG+N  LY++NK+ G   ++VPTSA SGEG+PD
Sbjct: 627  DSLSKQKKAIQREFRDRVESIILQLNEQGLNAALYFENKNLGRYVSLVPTSAQSGEGVPD 686

Query: 833  LLLLLVQWTQKTMVEKLTFRNELQCTVLEVKVIEGHGTTIDVVLVNGVLHEGDQIVVCGL 892
            L+ LL+  TQ  M +++ +   L+CTVLEVKVIEG G TIDV+L NGVLHEGD+IV+CG+
Sbjct: 687  LVALLISLTQTRMSDRIKYITTLECTVLEVKVIEGLGATIDVILSNGVLHEGDRIVLCGM 746

Query: 893  QGPIVTTIRALLTPHPMKELRVKGTYLHHKQIKAAQGIKITAQGLEHAIAGTGLYVVGPD 952
             GPI+TT+RALLTP P+KE+RVK  Y+HHK+IKAA G+KI A  LE A+AG+ L VVGPD
Sbjct: 747  GGPIITTVRALLTPQPLKEMRVKSAYVHHKEIKAAMGVKICANDLEKAVAGSRLLVVGPD 806

Query: 953  DDLEDVKEEAMEDMKSVMSRIDKSGEGVCVQASTLGSLEALLEFLKSDAVKIPVSGISIG 1012
            DD ED+ EE MED+++++ RID SG GV VQASTLGSLEALLEFLK   +KIPV+ ++IG
Sbjct: 807  DDEEDLAEEIMEDLENLLGRIDTSGIGVSVQASTLGSLEALLEFLKQ--MKIPVASVNIG 864

Query: 1013 PVHKKDVMRASVMLEKKKEYATILAFDVKVTPEARELAEELGVKIFIADIIYHLFDQFTA 1072
            PV+KKDVMR + MLEK KEYA +L FDVKV  +A +LAE+LGVKIF A++IYHLFD FTA
Sbjct: 865  PVYKKDVMRCATMLEKAKEYALMLCFDVKVDRDAEDLAEQLGVKIFSANVIYHLFDAFTA 924

Query: 1073 YINNLKEEKKREAADEAVFPCVLKILPNCVFNKKDPIVLGVDVVEGIAKVGTPIC----I 1128
            +   + E+K+ E++D AVFPCVLK +    FNK+DPI+LGVDVVEG+ ++ TPI     +
Sbjct: 925  HQKKILEQKREESSDVAVFPCVLKTV--AAFNKRDPIILGVDVVEGVLRINTPIVAVKQL 982

Query: 1129 PQRD--FIDIGRIASIENNHKPVDTAKKGQKAAIKIAGSNSEEQQKMFGRHFDIEDELVS 1186
            P  +   I++GR+AS+E NHKPVD  KKGQ  A       S   Q +FGR     D L S
Sbjct: 983  PNGEPQIIELGRVASLEMNHKPVDKVKKGQAGAGVAMKLESSGSQILFGRQVTESDALYS 1042

Query: 1187 HISRKSIDVLK-ANYRDDLSMDEWRLLVKLKNLFKI 1221
            HI+R+SID LK   +RD++S DEW+L+++LK LF I
Sbjct: 1043 HITRQSIDSLKDPAFRDEVSRDEWQLIIQLKKLFGI 1078
Function in general translation initiation by promoting the binding of the formylmethionine-tRNA to ribosomes. Seems to function along with eIF-2.
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (taxid: 284812)
>sp|O60841|IF2P_HUMAN Eukaryotic translation initiation factor 5B OS=Homo sapiens GN=EIF5B PE=1 SV=4 Back     alignment and function description
>sp|P39730|IF2P_YEAST Eukaryotic translation initiation factor 5B OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FUN12 PE=1 SV=2 Back     alignment and function description
>sp|Q05D44|IF2P_MOUSE Eukaryotic translation initiation factor 5B OS=Mus musculus GN=Eif5b PE=1 SV=2 Back     alignment and function description
>sp|B2GUV7|IF2P_RAT Eukaryotic translation initiation factor 5B OS=Rattus norvegicus GN=Eif5b PE=1 SV=1 Back     alignment and function description
>sp|Q5RDE1|IF2P_PONAB Eukaryotic translation initiation factor 5B OS=Pongo abelii GN=EIF5B PE=2 SV=2 Back     alignment and function description
>sp|Q54XP6|IF2P_DICDI Eukaryotic translation initiation factor 5B OS=Dictyostelium discoideum GN=eif5b PE=3 SV=1 Back     alignment and function description
>sp|A8A8D3|IF2P_IGNH4 Probable translation initiation factor IF-2 OS=Ignicoccus hospitalis (strain KIN4/I / DSM 18386 / JCM 14125) GN=infB PE=3 SV=1 Back     alignment and function description
>sp|A3DMS0|IF2P_STAMF Probable translation initiation factor IF-2 OS=Staphylothermus marinus (strain ATCC 43588 / DSM 3639 / F1) GN=infB PE=3 SV=1 Back     alignment and function description
>sp|Q9Y9B3|IF2P_AERPE Probable translation initiation factor IF-2 OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=infB PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1222
359493041 1393 PREDICTED: uncharacterized protein LOC10 0.545 0.478 0.845 0.0
356576051 1355 PREDICTED: uncharacterized protein LOC10 0.534 0.481 0.835 0.0
356535804 1344 PREDICTED: eukaryotic translation initia 0.533 0.485 0.835 0.0
224120424 1331 predicted protein [Populus trichocarpa] 0.539 0.495 0.815 0.0
449443744 1370 PREDICTED: uncharacterized protein LOC10 0.543 0.484 0.820 0.0
449475431 1370 PREDICTED: LOW QUALITY PROTEIN: uncharac 0.543 0.484 0.818 0.0
357443693 1438 Eukaryotic translation initiation factor 0.542 0.461 0.813 0.0
23452071861 translation initiation factor [Pisum sat 0.543 0.771 0.807 0.0
61438961280 putative translation initiation factor I 0.539 0.514 0.809 0.0
425632751294 translation initiation factor eIF-5B [Ar 0.540 0.510 0.796 0.0
>gi|359493041|ref|XP_002267014.2| PREDICTED: uncharacterized protein LOC100242745 [Vitis vinifera] Back     alignment and taxonomy information
 Score = 1216 bits (3146), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 574/679 (84%), Positives = 621/679 (91%), Gaps = 13/679 (1%)

Query: 557  EEADSEPEPLVKKEIK-SAIPSPRD-----AAEKPAVAVKKAIPEQPLKSQDAVTRKKE- 609
            EEADSE EP+V+KE K +A+P+ R+     AA K ++  K A+P QP+K+QD  + K + 
Sbjct: 715  EEADSETEPVVRKETKVAALPASRNVGVTTAAAKTSIVPKTAVPTQPIKTQDVRSEKSQI 774

Query: 610  ------PAAKSKEPEVDATPKQAEENLRSPICCIMGHVDTGKTKLLDCIRGTNVQEGEAG 663
                   + K   P  DA+P+  EENLRSPICCIMGHVDTGKTKLLDCIRGTNVQEGEAG
Sbjct: 775  EIEVTNKSRKKAAPSSDASPQGTEENLRSPICCIMGHVDTGKTKLLDCIRGTNVQEGEAG 834

Query: 664  GITQQIGATYFPAENIRERTRELKANATLKVPGLLVIDTPGHESFTNLRSRGSGLCDIAI 723
            GITQQIGATYFPAENIRERT+ELKA+A LKVPGLLVIDTPGHESFTNLRSRGSGLCDIAI
Sbjct: 835  GITQQIGATYFPAENIRERTKELKADANLKVPGLLVIDTPGHESFTNLRSRGSGLCDIAI 894

Query: 724  LVVDIMHGLEPQTIESLNLLKMRNTEFIVALNKVDRLYGWKTCRNAPIVKAIKQQNTDVQ 783
            LVVDIMHGLEPQTIESLNLLKMRNTEFIVALNKVDRLYGWK CRN+PI KA+KQQ+ DVQ
Sbjct: 895  LVVDIMHGLEPQTIESLNLLKMRNTEFIVALNKVDRLYGWKVCRNSPIQKAMKQQSKDVQ 954

Query: 784  NEFNMRLVQIVTQLKEQGMNTELYYKNKDRGETFNIVPTSAISGEGIPDLLLLLVQWTQK 843
            NEFNMRL QI+TQ KEQG+NTELYYKNK+ GETF+IVPTSAISGEGIPDLLLLLV WTQK
Sbjct: 955  NEFNMRLTQIITQFKEQGLNTELYYKNKEMGETFSIVPTSAISGEGIPDLLLLLVHWTQK 1014

Query: 844  TMVEKLTFRNELQCTVLEVKVIEGHGTTIDVVLVNGVLHEGDQIVVCGLQGPIVTTIRAL 903
            TMVEKLT+ +E+QCTVLEVKV+EGHGTTIDVVLVNGVLHEGDQIVVCG+QGPIV TIRAL
Sbjct: 1015 TMVEKLTYSSEVQCTVLEVKVVEGHGTTIDVVLVNGVLHEGDQIVVCGMQGPIVATIRAL 1074

Query: 904  LTPHPMKELRVKGTYLHHKQIKAAQGIKITAQGLEHAIAGTGLYVVGPDDDLEDVKEEAM 963
            LTPHPMKELRVKGTYLHHKQIKAAQGIKITAQGLEHAIAGTGLYVVGPDDDLED+KE AM
Sbjct: 1075 LTPHPMKELRVKGTYLHHKQIKAAQGIKITAQGLEHAIAGTGLYVVGPDDDLEDIKEAAM 1134

Query: 964  EDMKSVMSRIDKSGEGVCVQASTLGSLEALLEFLKSDAVKIPVSGISIGPVHKKDVMRAS 1023
            EDMKSV+SRIDKSGEGV VQASTLGSLEALLEFLKS AV IPVSGI IGPVHKKDVM+AS
Sbjct: 1135 EDMKSVLSRIDKSGEGVYVQASTLGSLEALLEFLKSPAVSIPVSGIGIGPVHKKDVMKAS 1194

Query: 1024 VMLEKKKEYATILAFDVKVTPEARELAEELGVKIFIADIIYHLFDQFTAYINNLKEEKKR 1083
            VMLEKKKEYATILAFDVKVTPEARELA+++GVKIFIADIIYHLFDQF AYI+NLKEEKKR
Sbjct: 1195 VMLEKKKEYATILAFDVKVTPEARELADDMGVKIFIADIIYHLFDQFKAYIDNLKEEKKR 1254

Query: 1084 EAADEAVFPCVLKILPNCVFNKKDPIVLGVDVVEGIAKVGTPICIPQRDFIDIGRIASIE 1143
            EAADEAVFPCVLKI+PNC+FNKKDPIVLGVDV+EGIAKVGTPICIPQRDFIDIGRIASIE
Sbjct: 1255 EAADEAVFPCVLKIMPNCIFNKKDPIVLGVDVLEGIAKVGTPICIPQRDFIDIGRIASIE 1314

Query: 1144 NNHKPVDTAKKGQKAAIKIAGSNSEEQQKMFGRHFDIEDELVSHISRKSIDVLKANYRDD 1203
            NNHKPVD AKKGQ+ AIKI  +N EEQQKMFGRHF++EDELVSHISRKSID LKANYRDD
Sbjct: 1315 NNHKPVDIAKKGQRVAIKITSTNPEEQQKMFGRHFEMEDELVSHISRKSIDTLKANYRDD 1374

Query: 1204 LSMDEWRLLVKLKNLFKIQ 1222
            LS+DEW+L+VKLK LFKIQ
Sbjct: 1375 LSLDEWKLVVKLKTLFKIQ 1393

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|356576051|ref|XP_003556148.1| PREDICTED: uncharacterized protein LOC100814875 [Glycine max] Back     alignment and taxonomy information
>gi|356535804|ref|XP_003536433.1| PREDICTED: eukaryotic translation initiation factor 5B-like [Glycine max] Back     alignment and taxonomy information
>gi|224120424|ref|XP_002318326.1| predicted protein [Populus trichocarpa] gi|222858999|gb|EEE96546.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|449443744|ref|XP_004139637.1| PREDICTED: uncharacterized protein LOC101204360 [Cucumis sativus] Back     alignment and taxonomy information
>gi|449475431|ref|XP_004154455.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized LOC101204360 [Cucumis sativus] Back     alignment and taxonomy information
>gi|357443693|ref|XP_003592124.1| Eukaryotic translation initiation factor 5B [Medicago truncatula] gi|355481172|gb|AES62375.1| Eukaryotic translation initiation factor 5B [Medicago truncatula] Back     alignment and taxonomy information
>gi|23452071|gb|AAN32916.1| translation initiation factor [Pisum sativum] Back     alignment and taxonomy information
>gi|6143896|gb|AAF04442.1|AC010718_11 putative translation initiation factor IF-2; 73082-68138 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|42563275|ref|NP_177807.3| translation initiation factor eIF-5B [Arabidopsis thaliana] gi|332197770|gb|AEE35891.1| translation initiation factor eIF-5B [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1222
TAIR|locus:20301161294 AT1G76810 [Arabidopsis thalian 0.541 0.511 0.758 2.1e-297
TAIR|locus:20301261166 AT1G76820 [Arabidopsis thalian 0.488 0.512 0.795 1.6e-276
TAIR|locus:20300411191 AT1G76720 "AT1G76720" [Arabido 0.514 0.528 0.719 2.9e-261
TAIR|locus:21995621092 AT1G21160 "AT1G21160" [Arabido 0.541 0.606 0.639 4.2e-242
POMBASE|SPAC56F8.031079 SPAC56F8.03 "translation initi 0.506 0.573 0.565 1.4e-189
ASPGD|ASPL00000173181072 AN4038 [Emericella nidulans (t 0.486 0.555 0.577 1.3e-180
FB|FBgn00262591144 eIF5B "eIF5B" [Drosophila mela 0.490 0.523 0.548 4.9e-179
TAIR|locus:2042097480 AT2G27700 [Arabidopsis thalian 0.365 0.931 0.748 5.1e-177
UNIPROTKB|F1N6Y71220 EIF5B "Uncharacterized protein 0.483 0.484 0.526 1.5e-171
UNIPROTKB|J9P5041219 EIF5B "Uncharacterized protein 0.483 0.484 0.526 2.4e-171
TAIR|locus:2030116 AT1G76810 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 2599 (920.0 bits), Expect = 2.1e-297, Sum P(5) = 2.1e-297
 Identities = 513/676 (75%), Positives = 569/676 (84%)

Query:   560 DSEPEPLVKKEIKSAIPSPRDXXXXXXXXXXX-XXXXQPL----KS----QDAV-TRXXX 609
             + E +P+VKKE+K AI    D                +PL    K+    +DA  T+   
Sbjct:   620 EEEAQPVVKKELKDAISKAHDSEPEAEKPTAKPAGTGKPLIAAVKATPEVEDATRTKRAT 679

Query:   610 XXXXXXXXXVDATPKQA---EENLRSPICCIMGHVDTGKTKLLDCIRGTNVQEGEAGGIT 666
                          P ++   EENLRSPICCIMGHVDTGKTKLLDCIRGTNVQEGEAGGIT
Sbjct:   680 RAKDASKKGKGLAPSESIEGEENLRSPICCIMGHVDTGKTKLLDCIRGTNVQEGEAGGIT 739

Query:   667 QQIGATYFPAENIRERTRELKANATLKVPGLLVIDTPGHESFTNLRSRGSGLCDIAILVV 726
             QQIGATYFPAENIRERT+ELKA+A LKVPGLLVIDTPGHESFTNLRSRGS LCD+AILVV
Sbjct:   740 QQIGATYFPAENIRERTKELKADAKLKVPGLLVIDTPGHESFTNLRSRGSSLCDLAILVV 799

Query:   727 DIMHGLEPQTIESLNLLKMRNTEFIVALNKVDRLYGWKTCRNAPIVKAIKQQNTDVQNEF 786
             DIMHGLEPQTIESLNLL+MRNTEFIVALNKVDRLYGWKTC+NAPIVKA+KQQN DV NEF
Sbjct:   800 DIMHGLEPQTIESLNLLRMRNTEFIVALNKVDRLYGWKTCKNAPIVKAMKQQNKDVINEF 859

Query:   787 NMRLVQIVTQLKEQGMNTELYYKNKDRGETFNIVPTSAISGEGIPDLLLLLVQWTQKTMV 846
             N+RL  I+ + +EQG+NTELYYKNKD G+TF+IVPTSAISGEG+PDLLL LVQW QKTMV
Sbjct:   860 NLRLKNIINEFQEQGLNTELYYKNKDMGDTFSIVPTSAISGEGVPDLLLWLVQWAQKTMV 919

Query:   847 EKLTFRNELQCTVLEVKVIEGHGTTIDVVLVNGVLHEGDQIVVCGLQGPIVTTIRALLTP 906
             EKLT+ +E+QCTVLEVKVIEGHGTTIDVVLVNG LHEGDQIVVCGLQGPIVTTIRALLTP
Sbjct:   920 EKLTYVDEVQCTVLEVKVIEGHGTTIDVVLVNGELHEGDQIVVCGLQGPIVTTIRALLTP 979

Query:   907 HPMKELRVKGTYLHHKQIKAAQGIKITAQGLEHAIAGTGLYVVGPDDDLEDVKEEAMEDM 966
             HPMKELRVKGTYLH+K+IKAAQGIKITAQGLEHAIAGT L+VVGPDDD+E +KE AMEDM
Sbjct:   980 HPMKELRVKGTYLHYKEIKAAQGIKITAQGLEHAIAGTALHVVGPDDDIEAIKESAMEDM 1039

Query:   967 KSVMSRIDKSGEGVCVQASTLGSLEALLEFLKSDAVKIPVSGISIGPVHKKDVMRASVML 1026
             +SV+SRIDKSGEGV VQASTLGSLEALLE+LKS AVKIPVSGI IGPVHKKDVM+A VML
Sbjct:  1040 ESVLSRIDKSGEGVYVQASTLGSLEALLEYLKSPAVKIPVSGIGIGPVHKKDVMKAGVML 1099

Query:  1027 EKKKEYATILAFDVKVTPEARELAEELGVKIFIADIIYHLFDQFTAYINNLXXXXXXXXX 1086
             E+KKEYATILAFDVKVT EARELA+E+GVKIF ADIIYHLFD F AYI N+         
Sbjct:  1100 ERKKEYATILAFDVKVTTEARELADEMGVKIFCADIIYHLFDLFKAYIENIKEEKKKESA 1159

Query:  1087 XXXVFPCVLKILPNCVFNKKDPIVLGVDVVEGIAKVGTPICIPQRDFIDIGRIASIENNH 1146
                VFPCVL+ILPNCVFNKKDPIVLGVDV+EGI K+GTPIC+P R+FIDIGRIASIENNH
Sbjct:  1160 DEAVFPCVLQILPNCVFNKKDPIVLGVDVIEGILKIGTPICVPGREFIDIGRIASIENNH 1219

Query:  1147 KPVDTXXXXXXXXXXXXXSNSEEQQKMFGRHFDIEDELVSHISRKSIDVLKANYRDDLSM 1206
             KPVD              SN+EEQ KMFGRHFD+EDELVSHISR+SID+LK+NYRD+LS+
Sbjct:  1220 KPVDYAKKGNKVAIKIVGSNAEEQ-KMFGRHFDMEDELVSHISRRSIDILKSNYRDELSL 1278

Query:  1207 DEWRLLVKLKNLFKIQ 1222
             +EW+L+VKLKN+FKIQ
Sbjct:  1279 EEWKLVVKLKNIFKIQ 1294
GO:0003924 "GTPase activity" evidence=IEA
GO:0005525 "GTP binding" evidence=IEA
GO:0005737 "cytoplasm" evidence=ISM
GO:0008135 "translation factor activity, nucleic acid binding" evidence=ISS
GO:0005886 "plasma membrane" evidence=IDA
GO:0005829 "cytosol" evidence=RCA
TAIR|locus:2030126 AT1G76820 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2030041 AT1G76720 "AT1G76720" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2199562 AT1G21160 "AT1G21160" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
POMBASE|SPAC56F8.03 SPAC56F8.03 "translation initiation factor IF2 (predicted)" [Schizosaccharomyces pombe (taxid:4896)] Back     alignment and assigned GO terms
ASPGD|ASPL0000017318 AN4038 [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms
FB|FBgn0026259 eIF5B "eIF5B" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
TAIR|locus:2042097 AT2G27700 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|F1N6Y7 EIF5B "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|J9P504 EIF5B "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00002292001
SubName- Full=Chromosome undetermined scaffold_129, whole genome shotgun sequence; (797 aa)
(Vitis vinifera)
Predicted Functional Partners:
GSVIVG00021667001
SubName- Full=Chromosome chr8 scaffold_23, whole genome shotgun sequence; (168 aa)
•  •  • 0.949
GSVIVG00021307001
SubName- Full=Chromosome chr8 scaffold_23, whole genome shotgun sequence; (586 aa)
  ••• • 0.938
GSVIVG00025456001
SubName- Full=Chromosome chr8 scaffold_34, whole genome shotgun sequence; (65 aa)
•    •• 0.930
GSVIVG00038765001
SubName- Full=Chromosome chr2 scaffold_97, whole genome shotgun sequence; (65 aa)
•    •• 0.917
Ndpk
RecName- Full=Nucleoside diphosphate kinase; EC=2.7.4.6; (148 aa)
•     • 0.887
GSVIVG00018373001
SubName- Full=Chromosome chr13 scaffold_17, whole genome shotgun sequence; (142 aa)
•  •  • 0.883
GSVIVG00016877001
SubName- Full=Chromosome chr11 scaffold_13, whole genome shotgun sequence; (144 aa)
•  •  • 0.851
GSVIVG00015309001
SubName- Full=Chromosome chr18 scaffold_1, whole genome shotgun sequence; (363 aa)
   •••• 0.848
GSVIVG00001176001
SubName- Full=Chromosome chr2 scaffold_113, whole genome shotgun sequence; (605 aa)
   •• • 0.840
GSVIVG00019030001
SubName- Full=Chromosome chr15 scaffold_19, whole genome shotgun sequence; (103 aa)
   • •• 0.834

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1222
PRK04004586 PRK04004, PRK04004, translation initiation factor 0.0
TIGR00491590 TIGR00491, aIF-2, translation initiation factor aI 1e-147
COG0532509 COG0532, InfB, Translation initiation factor 2 (IF 1e-141
PRK148451049 PRK14845, PRK14845, translation initiation factor 1e-132
cd01887169 cd01887, IF2_eIF5B, Initiation Factor 2 (IF2)/ euk 2e-81
PRK05306746 PRK05306, infB, translation initiation factor IF-2 4e-54
cd03703110 cd03703, aeIF5B_II, aeIF5B_II: This family represe 6e-54
TIGR00487587 TIGR00487, IF-2, translation initiation factor IF- 1e-43
pfam00009184 pfam00009, GTP_EFTU, Elongation factor Tu GTP bind 4e-40
CHL00189742 CHL00189, infB, translation initiation factor 2; P 1e-39
cd00881183 cd00881, GTP_translation_factor, GTP translation f 3e-27
pfam11987109 pfam11987, IF-2, Translation-initiation factor 2 6e-22
cd0370195 cd03701, IF2_IF5B_II, IF2_IF5B_II: This family rep 1e-21
TIGR00475581 TIGR00475, selB, selenocysteine-specific elongatio 5e-15
cd04171170 cd04171, SelB, SelB, the dedicated elongation fact 6e-14
PTZ001212084 PTZ00121, PTZ00121, MAEBL; Provisional 4e-13
PRK10512614 PRK10512, PRK10512, selenocysteinyl-tRNA-specific 3e-12
PTZ001212084 PTZ00121, PTZ00121, MAEBL; Provisional 6e-12
cd01890179 cd01890, LepA, LepA also known as Elongation Facto 1e-11
PTZ001212084 PTZ00121, PTZ00121, MAEBL; Provisional 2e-11
PTZ001212084 PTZ00121, PTZ00121, MAEBL; Provisional 2e-11
PTZ001212084 PTZ00121, PTZ00121, MAEBL; Provisional 1e-10
COG0480697 COG0480, FusA, Translation elongation factors (GTP 1e-10
cd01885218 cd01885, EF2, Elongation Factor 2 (EF2) in archaea 3e-10
COG3276447 COG3276, SelB, Selenocysteine-specific translation 3e-10
cd01889192 cd01889, SelB_euk, SelB, the dedicated elongation 3e-10
TIGR00231162 TIGR00231, small_GTP, small GTP-binding protein do 4e-10
PTZ001212084 PTZ00121, PTZ00121, MAEBL; Provisional 5e-10
TIGR02794346 TIGR02794, tolA_full, TolA protein 6e-09
TIGR01393595 TIGR01393, lepA, GTP-binding protein LepA 2e-08
cd04167213 cd04167, Snu114p, Snu114p, a spliceosome protein, 2e-08
COG0481603 COG0481, LepA, Membrane GTPase LepA [Cell envelope 4e-08
PRK09510387 PRK09510, tolA, cell envelope integrity inner memb 2e-07
cd04169268 cd04169, RF3, Release Factor 3 (RF3) protein invol 3e-07
COG2895431 COG2895, CysN, GTPases - Sulfate adenylate transfe 4e-07
COG5256428 COG5256, TEF1, Translation elongation factor EF-1a 5e-07
TIGR02794346 TIGR02794, tolA_full, TolA protein 8e-07
pfam05793528 pfam05793, TFIIF_alpha, Transcription initiation f 1e-06
cd04166209 cd04166, CysN_ATPS, CysN, together with protein Cy 1e-06
TIGR02034406 TIGR02034, CysN, sulfate adenylyltransferase, larg 1e-06
PRK09510387 PRK09510, tolA, cell envelope integrity inner memb 2e-06
pfam04502321 pfam04502, DUF572, Family of unknown function (DUF 2e-06
cd00882161 cd00882, Ras_like_GTPase, Rat sarcoma (Ras)-like s 2e-06
COG52714600 COG5271, MDN1, AAA ATPase containing von Willebran 2e-06
pfam05793528 pfam05793, TFIIF_alpha, Transcription initiation f 3e-06
COG3064387 COG3064, TolA, Membrane protein involved in colici 3e-06
cd0134283 cd01342, Translation_Factor_II_like, Translation_F 3e-06
pfam10243506 pfam10243, MIP-T3, Microtubule-binding protein MIP 3e-06
cd04163168 cd04163, Era, E 3e-06
cd01886270 cd01886, EF-G, Elongation factor G (EF-G) family i 3e-06
COG4108528 COG4108, PrfC, Peptide chain release factor RF-3 [ 4e-06
cd01891194 cd01891, TypA_BipA, Tyrosine phosphorylated protei 4e-06
PRK05035695 PRK05035, PRK05035, electron transport complex pro 4e-06
COG3064387 COG3064, TolA, Membrane protein involved in colici 5e-06
pfam10243506 pfam10243, MIP-T3, Microtubule-binding protein MIP 6e-06
PRK09510387 PRK09510, tolA, cell envelope integrity inner memb 7e-06
PRK05124474 PRK05124, cysN, sulfate adenylyltransferase subuni 7e-06
TIGR009271096 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger 9e-06
TIGR009271096 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger 1e-05
PRK13351687 PRK13351, PRK13351, elongation factor G; Reviewed 1e-05
COG3064387 COG3064, TolA, Membrane protein involved in colici 2e-05
PRK05035695 PRK05035, PRK05035, electron transport complex pro 2e-05
TIGR00503527 TIGR00503, prfC, peptide chain release factor 3 2e-05
PRK07735430 PRK07735, PRK07735, NADH dehydrogenase subunit C; 2e-05
PRK00741526 PRK00741, prfC, peptide chain release factor 3; Pr 2e-05
cd01876170 cd01876, YihA_EngB, YihA (EngB) GTPase family 3e-05
PRK00089292 PRK00089, era, GTPase Era; Reviewed 3e-05
PRK05901509 PRK05901, PRK05901, RNA polymerase sigma factor; P 4e-05
PRK05433600 PRK05433, PRK05433, GTP-binding protein LepA; Prov 5e-05
PRK05035695 PRK05035, PRK05035, electron transport complex pro 6e-05
PLN032371465 PLN03237, PLN03237, DNA topoisomerase 2; Provision 6e-05
cd01884195 cd01884, EF_Tu, Elongation Factor Tu (EF-Tu) GTP-b 7e-05
TIGR00484689 TIGR00484, EF-G, translation elongation factor EF- 7e-05
PRK05035695 PRK05035, PRK05035, electron transport complex pro 8e-05
PRK149001052 PRK14900, valS, valyl-tRNA synthetase; Provisional 8e-05
PTZ001081388 PTZ00108, PTZ00108, DNA topoisomerase 2-like prote 9e-05
TIGR03680406 TIGR03680, eif2g_arch, translation initiation fact 9e-05
COG3064387 COG3064, TolA, Membrane protein involved in colici 1e-04
cd04168237 cd04168, TetM_like, Tet(M)-like family includes Te 1e-04
PRK05506632 PRK05506, PRK05506, bifunctional sulfate adenylylt 1e-04
COG5258527 COG5258, GTPBP1, GTPase [General function predicti 1e-04
PRK12740668 PRK12740, PRK12740, elongation factor G; Reviewed 1e-04
TIGR03918391 TIGR03918, GTP_HydF, [FeFe] hydrogenase H-cluster 1e-04
TIGR02794346 TIGR02794, tolA_full, TolA protein 2e-04
pfam10243506 pfam10243, MIP-T3, Microtubule-binding protein MIP 2e-04
pfam10243506 pfam10243, MIP-T3, Microtubule-binding protein MIP 2e-04
PTZ001081388 PTZ00108, PTZ00108, DNA topoisomerase 2-like prote 2e-04
pfam04006613 pfam04006, Mpp10, Mpp10 protein 2e-04
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 2e-04
COG1217603 COG1217, TypA, Predicted membrane GTPase involved 2e-04
PRK108111068 PRK10811, rne, ribonuclease E; Reviewed 2e-04
PHA03321694 PHA03321, PHA03321, tegument protein VP11/12; Prov 2e-04
pfam05793528 pfam05793, TFIIF_alpha, Transcription initiation f 3e-04
PTZ001081388 PTZ00108, PTZ00108, DNA topoisomerase 2-like prote 3e-04
TIGR01394594 TIGR01394, TypA_BipA, GTP-binding protein TypA/Bip 3e-04
pfam0314470 pfam03144, GTP_EFTU_D2, Elongation factor Tu domai 3e-04
PRK12704520 PRK12704, PRK12704, phosphodiesterase; Provisional 3e-04
COG11961163 COG1196, Smc, Chromosome segregation ATPases [Cell 4e-04
TIGR00490 720 TIGR00490, aEF-2, translation elongation factor aE 4e-04
pfam05764238 pfam05764, YL1, YL1 nuclear protein 5e-04
PRK09510387 PRK09510, tolA, cell envelope integrity inner memb 6e-04
PTZ001212084 PTZ00121, PTZ00121, MAEBL; Provisional 7e-04
pfam05672171 pfam05672, MAP7, MAP7 (E-MAP-115) family 8e-04
pfam05262489 pfam05262, Borrelia_P83, Borrelia P83/100 protein 9e-04
PRK09510387 PRK09510, tolA, cell envelope integrity inner memb 0.001
COG3064387 COG3064, TolA, Membrane protein involved in colici 0.001
PTZ001081388 PTZ00108, PTZ00108, DNA topoisomerase 2-like prote 0.001
pfam03154979 pfam03154, Atrophin-1, Atrophin-1 family 0.001
pfam12569516 pfam12569, NARP1, NMDA receptor-regulated protein 0.001
PRK13808333 PRK13808, PRK13808, adenylate kinase; Provisional 0.001
pfam02841297 pfam02841, GBP_C, Guanylate-binding protein, C-ter 0.001
pfam02029431 pfam02029, Caldesmon, Caldesmon 0.001
pfam02463 1162 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain 0.001
PRK10218607 PRK10218, PRK10218, GTP-binding protein; Provision 0.001
pfam05793528 pfam05793, TFIIF_alpha, Transcription initiation f 0.002
COG3064387 COG3064, TolA, Membrane protein involved in colici 0.002
PRK05035695 PRK05035, PRK05035, electron transport complex pro 0.002
pfam05262489 pfam05262, Borrelia_P83, Borrelia P83/100 protein 0.002
pfam05262489 pfam05262, Borrelia_P83, Borrelia P83/100 protein 0.002
pfam024631162 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain 0.002
TIGR03319514 TIGR03319, RNase_Y, ribonuclease Y 0.002
pfam09756189 pfam09756, DDRGK, DDRGK domain 0.002
pfam04514363 pfam04514, BTV_NS2, Bluetongue virus non-structura 0.002
PRK05703424 PRK05703, flhF, flagellar biosynthesis regulator F 0.002
cd0369683 cd03696, selB_II, selB_II: this subfamily represen 0.002
COG51921077 COG5192, BMS1, GTP-binding protein required for 40 0.002
PRK12317425 PRK12317, PRK12317, elongation factor 1-alpha; Rev 0.002
COG1317234 COG1317, FliH, Flagellar biosynthesis/type III sec 0.002
pfam07111739 pfam07111, HCR, Alpha helical coiled-coil rod prot 0.002
PRK05901509 PRK05901, PRK05901, RNA polymerase sigma factor; P 0.003
pfam04147809 pfam04147, Nop14, Nop14-like family 0.003
pfam07767387 pfam07767, Nop53, Nop53 (60S ribosomal biogenesis) 0.003
TIGR021681179 TIGR02168, SMC_prok_B, chromosome segregation prot 0.003
PRK12678672 PRK12678, PRK12678, transcription termination fact 0.003
pfam07946322 pfam07946, DUF1682, Protein of unknown function (D 0.003
pfam10243506 pfam10243, MIP-T3, Microtubule-binding protein MIP 0.004
COG0810244 COG0810, TonB, Periplasmic protein TonB, links inn 0.004
TIGR03779410 TIGR03779, Bac_Flav_CT_M, Bacteroides conjugative 0.004
pfam13904261 pfam13904, DUF4207, Domain of unknown function (DU 0.004
>gnl|CDD|235195 PRK04004, PRK04004, translation initiation factor IF-2; Validated Back     alignment and domain information 
 Score =  596 bits (1539), Expect = 0.0
 Identities = 265/587 (45%), Positives = 366/587 (62%), Gaps = 19/587 (3%)

Query: 627  EENLRSPICCIMGHVDTGKTKLLDCIRGTNVQEGEAGGITQQIGATYFPAENIRERTREL 686
            E+ LR PI  ++GHVD GKT LLD IRGT V   EAGGITQ IGAT  P + I +    L
Sbjct: 1    EKKLRQPIVVVLGHVDHGKTTLLDKIRGTAVAAKEAGGITQHIGATEVPIDVIEKIAGPL 60

Query: 687  K--ANATLKVPGLLVIDTPGHESFTNLRSRGSGLCDIAILVVDIMHGLEPQTIESLNLLK 744
            K      LK+PGLL IDTPGHE+FTNLR RG  L DIAILVVDI  G +PQTIE++N+LK
Sbjct: 61   KKPLPIKLKIPGLLFIDTPGHEAFTNLRKRGGALADIAILVVDINEGFQPQTIEAINILK 120

Query: 745  MRNTEFIVALNKVDRLYGWKTCRNAPIVKAIKQQNTDVQNEFNMRLVQIVTQLKEQGMNT 804
             R T F+VA NK+DR+ GWK+  +AP +++I++Q+  VQ E   +L +++ QL E G + 
Sbjct: 121  RRKTPFVVAANKIDRIPGWKSTEDAPFLESIEKQSQRVQQELEEKLYELIGQLSELGFSA 180

Query: 805  ELYYKNKDRGETFNIVPTSAISGEGIPDLLLLLVQWTQKTMVEKLTFRNE--LQCTVLEV 862
            + + + KD  +T  IVP SA +GEGIPDLL++L    Q+ + E+L    E   + TVLEV
Sbjct: 181  DRFDRVKDFTKTVAIVPVSAKTGEGIPDLLMVLAGLAQRYLEERLKIDVEGPGKGTVLEV 240

Query: 863  KVIEGHGTTIDVVLVNGVLHEGDQIVVCGLQGPIVTTIRALLTPHPMKELR-VKGTYLHH 921
            K   G GTTIDV+L +G L +GD IVV G  GPIVT +RALL P P+ E+R  +  +   
Sbjct: 241  KEERGLGTTIDVILYDGTLRKGDTIVVGGKDGPIVTKVRALLKPRPLDEMRDPEDKFKPV 300

Query: 922  KQIKAAQGIKITAQGLEHAIAGTGLYVVGPDDDLEDVKEEAMEDMKSVMSRIDKSGEGVC 981
             ++ AA G+KI+A  LE A+AG+ L VV  D+D+E+VKEE  E+++ +  RI+   EGV 
Sbjct: 301  DEVVAAAGVKISAPDLEDALAGSPLRVV-RDEDVEEVKEEVEEEIEEI--RIETDEEGVV 357

Query: 982  VQASTLGSLEALLEFLKSDAVKIPVSGISIGPVHKKDVMRASVMLEKKKEYATILAFDVK 1041
            V+A TLGSLEAL+  L+ +   IP+    +G + K+DV+ AS + EK   Y  ILAF+VK
Sbjct: 358  VKADTLGSLEALVNELREE--GIPIRKADVGDISKRDVIEASTVAEKDPLYGVILAFNVK 415

Query: 1042 VTPEARELAEELGVKIFIADIIYHLFDQFTAYINNLKEEKKREAADEAVFPCVLKILPNC 1101
            V P+A E AE+  VKIF  D+IY L + +  ++   KE +K +  ++ V P  ++ILP  
Sbjct: 416  VLPDAEEEAEKSDVKIFTGDVIYQLIEDYEKWVKEQKEAEKEKILEKIVRPAKIRILPGY 475

Query: 1102 VFNKKDPIVLGVDVVEGIAKVGTPICIPQRDFIDIGRIASIENNHKPVDTAKKGQKAAIK 1161
            VF + DP ++GV+V+ G  K G P+   + D   +G I  I++  + V  AK G + AI 
Sbjct: 476  VFRQSDPAIVGVEVLGGTIKPGVPLI--KEDGKRVGTIKQIQDQGENVKEAKAGMEVAIS 533

Query: 1162 IAGSNSEEQQKMFGRHFDIEDELVSHISRKSIDVLKANYRDDLSMDE 1208
            I G          GR     D L   I  +   +L+   +D+LS DE
Sbjct: 534  IDG-------PTVGRQIKEGDILYVDIPEEHAKILEQELKDELSDDE 573

Length = 586
>gnl|CDD|129582 TIGR00491, aIF-2, translation initiation factor aIF-2/yIF-2 Back     alignment and domain information
>gnl|CDD|223606 COG0532, InfB, Translation initiation factor 2 (IF-2; GTPase) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|237833 PRK14845, PRK14845, translation initiation factor IF-2; Provisional Back     alignment and domain information
>gnl|CDD|206674 cd01887, IF2_eIF5B, Initiation Factor 2 (IF2)/ eukaryotic Initiation Factor 5B (eIF5B) family Back     alignment and domain information
>gnl|CDD|235401 PRK05306, infB, translation initiation factor IF-2; Validated Back     alignment and domain information
>gnl|CDD|239674 cd03703, aeIF5B_II, aeIF5B_II: This family represents the domain II of archeal and eukaryotic aeIF5B Back     alignment and domain information
>gnl|CDD|232995 TIGR00487, IF-2, translation initiation factor IF-2 Back     alignment and domain information
>gnl|CDD|215653 pfam00009, GTP_EFTU, Elongation factor Tu GTP binding domain Back     alignment and domain information
>gnl|CDD|177089 CHL00189, infB, translation initiation factor 2; Provisional Back     alignment and domain information
>gnl|CDD|206647 cd00881, GTP_translation_factor, GTP translation factor family primarily contains translation initiation, elongation and release factors Back     alignment and domain information
>gnl|CDD|221359 pfam11987, IF-2, Translation-initiation factor 2 Back     alignment and domain information
>gnl|CDD|239672 cd03701, IF2_IF5B_II, IF2_IF5B_II: This family represents the domain II of prokaryotic Initiation Factor 2 (IF2) and its archeal and eukaryotic homologue aeIF5B Back     alignment and domain information
>gnl|CDD|129567 TIGR00475, selB, selenocysteine-specific elongation factor SelB Back     alignment and domain information
>gnl|CDD|206734 cd04171, SelB, SelB, the dedicated elongation factor for delivery of selenocysteinyl-tRNA to the ribosome Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|182508 PRK10512, PRK10512, selenocysteinyl-tRNA-specific translation factor; Provisional Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|206677 cd01890, LepA, LepA also known as Elongation Factor 4 (EF4) Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|223556 COG0480, FusA, Translation elongation factors (GTPases) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|206672 cd01885, EF2, Elongation Factor 2 (EF2) in archaea and eukarya Back     alignment and domain information
>gnl|CDD|225815 COG3276, SelB, Selenocysteine-specific translation elongation factor [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|206676 cd01889, SelB_euk, SelB, the dedicated elongation factor for delivery of selenocysteinyl-tRNA to the ribosome Back     alignment and domain information
>gnl|CDD|232886 TIGR00231, small_GTP, small GTP-binding protein domain Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|234017 TIGR02794, tolA_full, TolA protein Back     alignment and domain information
>gnl|CDD|130460 TIGR01393, lepA, GTP-binding protein LepA Back     alignment and domain information
>gnl|CDD|206730 cd04167, Snu114p, Snu114p, a spliceosome protein, is a GTPase Back     alignment and domain information
>gnl|CDD|223557 COG0481, LepA, Membrane GTPase LepA [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|236545 PRK09510, tolA, cell envelope integrity inner membrane protein TolA; Provisional Back     alignment and domain information
>gnl|CDD|206732 cd04169, RF3, Release Factor 3 (RF3) protein involved in the terminal step of translocation in bacteria Back     alignment and domain information
>gnl|CDD|225448 COG2895, CysN, GTPases - Sulfate adenylate transferase subunit 1 [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|227581 COG5256, TEF1, Translation elongation factor EF-1alpha (GTPase) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|234017 TIGR02794, tolA_full, TolA protein Back     alignment and domain information
>gnl|CDD|218752 pfam05793, TFIIF_alpha, Transcription initiation factor IIF, alpha subunit (TFIIF-alpha) Back     alignment and domain information
>gnl|CDD|206729 cd04166, CysN_ATPS, CysN, together with protein CysD, forms the ATP sulfurylase (ATPS) complex Back     alignment and domain information
>gnl|CDD|213679 TIGR02034, CysN, sulfate adenylyltransferase, large subunit Back     alignment and domain information
>gnl|CDD|236545 PRK09510, tolA, cell envelope integrity inner membrane protein TolA; Provisional Back     alignment and domain information
>gnl|CDD|218115 pfam04502, DUF572, Family of unknown function (DUF572) Back     alignment and domain information
>gnl|CDD|206648 cd00882, Ras_like_GTPase, Rat sarcoma (Ras)-like superfamily of small guanosine triphosphatases (GTPases) Back     alignment and domain information
>gnl|CDD|227596 COG5271, MDN1, AAA ATPase containing von Willebrand factor type A (vWA) domain [General function prediction only] Back     alignment and domain information
>gnl|CDD|218752 pfam05793, TFIIF_alpha, Transcription initiation factor IIF, alpha subunit (TFIIF-alpha) Back     alignment and domain information
>gnl|CDD|225606 COG3064, TolA, Membrane protein involved in colicin uptake [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|238652 cd01342, Translation_Factor_II_like, Translation_Factor_II_like: Elongation factor Tu (EF-Tu) domain II-like proteins Back     alignment and domain information
>gnl|CDD|220648 pfam10243, MIP-T3, Microtubule-binding protein MIP-T3 Back     alignment and domain information
>gnl|CDD|206726 cd04163, Era, E Back     alignment and domain information
>gnl|CDD|206673 cd01886, EF-G, Elongation factor G (EF-G) family involved in both the elongation and ribosome recycling phases of protein synthesis Back     alignment and domain information
>gnl|CDD|226593 COG4108, PrfC, Peptide chain release factor RF-3 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|206678 cd01891, TypA_BipA, Tyrosine phosphorylated protein A (TypA)/BipA family belongs to ribosome-binding GTPases Back     alignment and domain information
>gnl|CDD|235334 PRK05035, PRK05035, electron transport complex protein RnfC; Provisional Back     alignment and domain information
>gnl|CDD|225606 COG3064, TolA, Membrane protein involved in colicin uptake [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|220648 pfam10243, MIP-T3, Microtubule-binding protein MIP-T3 Back     alignment and domain information
>gnl|CDD|236545 PRK09510, tolA, cell envelope integrity inner membrane protein TolA; Provisional Back     alignment and domain information
>gnl|CDD|235349 PRK05124, cysN, sulfate adenylyltransferase subunit 1; Provisional Back     alignment and domain information
>gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger Back     alignment and domain information
>gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger Back     alignment and domain information
>gnl|CDD|237358 PRK13351, PRK13351, elongation factor G; Reviewed Back     alignment and domain information
>gnl|CDD|225606 COG3064, TolA, Membrane protein involved in colicin uptake [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|235334 PRK05035, PRK05035, electron transport complex protein RnfC; Provisional Back     alignment and domain information
>gnl|CDD|129594 TIGR00503, prfC, peptide chain release factor 3 Back     alignment and domain information
>gnl|CDD|236081 PRK07735, PRK07735, NADH dehydrogenase subunit C; Validated Back     alignment and domain information
>gnl|CDD|179105 PRK00741, prfC, peptide chain release factor 3; Provisional Back     alignment and domain information
>gnl|CDD|206665 cd01876, YihA_EngB, YihA (EngB) GTPase family Back     alignment and domain information
>gnl|CDD|234624 PRK00089, era, GTPase Era; Reviewed Back     alignment and domain information
>gnl|CDD|235640 PRK05901, PRK05901, RNA polymerase sigma factor; Provisional Back     alignment and domain information
>gnl|CDD|235462 PRK05433, PRK05433, GTP-binding protein LepA; Provisional Back     alignment and domain information
>gnl|CDD|235334 PRK05035, PRK05035, electron transport complex protein RnfC; Provisional Back     alignment and domain information
>gnl|CDD|215641 PLN03237, PLN03237, DNA topoisomerase 2; Provisional Back     alignment and domain information
>gnl|CDD|206671 cd01884, EF_Tu, Elongation Factor Tu (EF-Tu) GTP-binding proteins Back     alignment and domain information
>gnl|CDD|129575 TIGR00484, EF-G, translation elongation factor EF-G Back     alignment and domain information
>gnl|CDD|235334 PRK05035, PRK05035, electron transport complex protein RnfC; Provisional Back     alignment and domain information
>gnl|CDD|237855 PRK14900, valS, valyl-tRNA synthetase; Provisional Back     alignment and domain information
>gnl|CDD|240271 PTZ00108, PTZ00108, DNA topoisomerase 2-like protein; Provisional Back     alignment and domain information
>gnl|CDD|211860 TIGR03680, eif2g_arch, translation initiation factor 2 subunit gamma Back     alignment and domain information
>gnl|CDD|225606 COG3064, TolA, Membrane protein involved in colicin uptake [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|206731 cd04168, TetM_like, Tet(M)-like family includes Tet(M), Tet(O), Tet(W), and OtrA, containing tetracycline resistant proteins Back     alignment and domain information
>gnl|CDD|180120 PRK05506, PRK05506, bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Provisional Back     alignment and domain information
>gnl|CDD|227583 COG5258, GTPBP1, GTPase [General function prediction only] Back     alignment and domain information
>gnl|CDD|237186 PRK12740, PRK12740, elongation factor G; Reviewed Back     alignment and domain information
>gnl|CDD|234395 TIGR03918, GTP_HydF, [FeFe] hydrogenase H-cluster maturation GTPase HydF Back     alignment and domain information
>gnl|CDD|234017 TIGR02794, tolA_full, TolA protein Back     alignment and domain information
>gnl|CDD|220648 pfam10243, MIP-T3, Microtubule-binding protein MIP-T3 Back     alignment and domain information
>gnl|CDD|220648 pfam10243, MIP-T3, Microtubule-binding protein MIP-T3 Back     alignment and domain information
>gnl|CDD|240271 PTZ00108, PTZ00108, DNA topoisomerase 2-like protein; Provisional Back     alignment and domain information
>gnl|CDD|217840 pfam04006, Mpp10, Mpp10 protein Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|224138 COG1217, TypA, Predicted membrane GTPase involved in stress response [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|236766 PRK10811, rne, ribonuclease E; Reviewed Back     alignment and domain information
>gnl|CDD|223041 PHA03321, PHA03321, tegument protein VP11/12; Provisional Back     alignment and domain information
>gnl|CDD|218752 pfam05793, TFIIF_alpha, Transcription initiation factor IIF, alpha subunit (TFIIF-alpha) Back     alignment and domain information
>gnl|CDD|240271 PTZ00108, PTZ00108, DNA topoisomerase 2-like protein; Provisional Back     alignment and domain information
>gnl|CDD|233394 TIGR01394, TypA_BipA, GTP-binding protein TypA/BipA Back     alignment and domain information
>gnl|CDD|217388 pfam03144, GTP_EFTU_D2, Elongation factor Tu domain 2 Back     alignment and domain information
>gnl|CDD|237177 PRK12704, PRK12704, phosphodiesterase; Provisional Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|129581 TIGR00490, aEF-2, translation elongation factor aEF-2 Back     alignment and domain information
>gnl|CDD|218737 pfam05764, YL1, YL1 nuclear protein Back     alignment and domain information
>gnl|CDD|236545 PRK09510, tolA, cell envelope integrity inner membrane protein TolA; Provisional Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|218684 pfam05672, MAP7, MAP7 (E-MAP-115) family Back     alignment and domain information
>gnl|CDD|114011 pfam05262, Borrelia_P83, Borrelia P83/100 protein Back     alignment and domain information
>gnl|CDD|236545 PRK09510, tolA, cell envelope integrity inner membrane protein TolA; Provisional Back     alignment and domain information
>gnl|CDD|225606 COG3064, TolA, Membrane protein involved in colicin uptake [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|240271 PTZ00108, PTZ00108, DNA topoisomerase 2-like protein; Provisional Back     alignment and domain information
>gnl|CDD|217393 pfam03154, Atrophin-1, Atrophin-1 family Back     alignment and domain information
>gnl|CDD|221641 pfam12569, NARP1, NMDA receptor-regulated protein 1 Back     alignment and domain information
>gnl|CDD|172341 PRK13808, PRK13808, adenylate kinase; Provisional Back     alignment and domain information
>gnl|CDD|202427 pfam02841, GBP_C, Guanylate-binding protein, C-terminal domain Back     alignment and domain information
>gnl|CDD|202096 pfam02029, Caldesmon, Caldesmon Back     alignment and domain information
>gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain Back     alignment and domain information
>gnl|CDD|104396 PRK10218, PRK10218, GTP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|218752 pfam05793, TFIIF_alpha, Transcription initiation factor IIF, alpha subunit (TFIIF-alpha) Back     alignment and domain information
>gnl|CDD|225606 COG3064, TolA, Membrane protein involved in colicin uptake [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|235334 PRK05035, PRK05035, electron transport complex protein RnfC; Provisional Back     alignment and domain information
>gnl|CDD|114011 pfam05262, Borrelia_P83, Borrelia P83/100 protein Back     alignment and domain information
>gnl|CDD|114011 pfam05262, Borrelia_P83, Borrelia P83/100 protein Back     alignment and domain information
>gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain Back     alignment and domain information
>gnl|CDD|188306 TIGR03319, RNase_Y, ribonuclease Y Back     alignment and domain information
>gnl|CDD|220383 pfam09756, DDRGK, DDRGK domain Back     alignment and domain information
>gnl|CDD|113290 pfam04514, BTV_NS2, Bluetongue virus non-structural protein NS2 Back     alignment and domain information
>gnl|CDD|235570 PRK05703, flhF, flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>gnl|CDD|239667 cd03696, selB_II, selB_II: this subfamily represents the domain of elongation factor SelB, homologous to domain II of EF-Tu Back     alignment and domain information
>gnl|CDD|227519 COG5192, BMS1, GTP-binding protein required for 40S ribosome biogenesis [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|237055 PRK12317, PRK12317, elongation factor 1-alpha; Reviewed Back     alignment and domain information
>gnl|CDD|224236 COG1317, FliH, Flagellar biosynthesis/type III secretory pathway protein [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>gnl|CDD|148617 pfam07111, HCR, Alpha helical coiled-coil rod protein (HCR) Back     alignment and domain information
>gnl|CDD|235640 PRK05901, PRK05901, RNA polymerase sigma factor; Provisional Back     alignment and domain information
>gnl|CDD|217927 pfam04147, Nop14, Nop14-like family Back     alignment and domain information
>gnl|CDD|219563 pfam07767, Nop53, Nop53 (60S ribosomal biogenesis) Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|237171 PRK12678, PRK12678, transcription termination factor Rho; Provisional Back     alignment and domain information
>gnl|CDD|219655 pfam07946, DUF1682, Protein of unknown function (DUF1682) Back     alignment and domain information
>gnl|CDD|220648 pfam10243, MIP-T3, Microtubule-binding protein MIP-T3 Back     alignment and domain information
>gnl|CDD|223880 COG0810, TonB, Periplasmic protein TonB, links inner and outer membranes [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|234352 TIGR03779, Bac_Flav_CT_M, Bacteroides conjugative transposon TraM protein Back     alignment and domain information
>gnl|CDD|222447 pfam13904, DUF4207, Domain of unknown function (DUF4207) Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 1222
KOG11441064 consensus Translation initiation factor 5B (eIF-5B 100.0
TIGR00491590 aIF-2 translation initiation factor aIF-2/yIF-2. T 100.0
PRK04004586 translation initiation factor IF-2; Validated 100.0
PRK148451049 translation initiation factor IF-2; Provisional 100.0
COG0532509 InfB Translation initiation factor 2 (IF-2; GTPase 100.0
KOG1145683 consensus Mitochondrial translation initiation fac 100.0
TIGR00487587 IF-2 translation initiation factor IF-2. This mode 100.0
PRK05306787 infB translation initiation factor IF-2; Validated 100.0
CHL00189742 infB translation initiation factor 2; Provisional 100.0
COG5256428 TEF1 Translation elongation factor EF-1alpha (GTPa 99.97
PTZ00141446 elongation factor 1- alpha; Provisional 99.97
KOG0462650 consensus Elongation factor-type GTP-binding prote 99.97
PRK10512614 selenocysteinyl-tRNA-specific translation factor; 99.97
PRK12736394 elongation factor Tu; Reviewed 99.97
TIGR01394594 TypA_BipA GTP-binding protein TypA/BipA. This bact 99.97
PLN00043447 elongation factor 1-alpha; Provisional 99.97
TIGR00475581 selB selenocysteine-specific elongation factor Sel 99.96
COG0050394 TufB GTPases - translation elongation factors [Tra 99.96
KOG0460449 consensus Mitochondrial translation elongation fac 99.96
PLN03127447 Elongation factor Tu; Provisional 99.96
COG0480697 FusA Translation elongation factors (GTPases) [Tra 99.96
PLN03126478 Elongation factor Tu; Provisional 99.96
PRK12735396 elongation factor Tu; Reviewed 99.96
PTZ00327460 eukaryotic translation initiation factor 2 gamma s 99.96
CHL00071409 tufA elongation factor Tu 99.96
PRK00049396 elongation factor Tu; Reviewed 99.96
TIGR00485394 EF-Tu translation elongation factor TU. This align 99.96
PRK10218607 GTP-binding protein; Provisional 99.96
COG1217603 TypA Predicted membrane GTPase involved in stress 99.96
COG0481603 LepA Membrane GTPase LepA [Cell envelope biogenesi 99.96
PRK12317425 elongation factor 1-alpha; Reviewed 99.96
COG3276447 SelB Selenocysteine-specific translation elongatio 99.95
TIGR00483426 EF-1_alpha translation elongation factor EF-1 alph 99.95
PRK00741526 prfC peptide chain release factor 3; Provisional 99.95
PRK05433600 GTP-binding protein LepA; Provisional 99.95
PRK12739691 elongation factor G; Reviewed 99.95
KOG0465721 consensus Mitochondrial elongation factor [Transla 99.94
TIGR02034406 CysN sulfate adenylyltransferase, large subunit. H 99.94
TIGR01393595 lepA GTP-binding protein LepA. LepA (GUF1 in Sacca 99.94
PRK00007693 elongation factor G; Reviewed 99.94
TIGR00484689 EF-G translation elongation factor EF-G. After pep 99.94
PRK13351687 elongation factor G; Reviewed 99.94
TIGR03680406 eif2g_arch translation initiation factor 2 subunit 99.94
PRK05124474 cysN sulfate adenylyltransferase subunit 1; Provis 99.93
COG5258527 GTPBP1 GTPase [General function prediction only] 99.93
TIGR00503527 prfC peptide chain release factor 3. This translat 99.93
COG2895431 CysN GTPases - Sulfate adenylate transferase subun 99.93
PRK07560731 elongation factor EF-2; Reviewed 99.93
PRK04000411 translation initiation factor IF-2 subunit gamma; 99.93
KOG0458603 consensus Elongation factor 1 alpha [Translation, 99.93
PF00009188 GTP_EFTU: Elongation factor Tu GTP binding domain; 99.92
PRK05506632 bifunctional sulfate adenylyltransferase subunit 1 99.92
PRK12740668 elongation factor G; Reviewed 99.92
KOG0461522 consensus Selenocysteine-specific elongation facto 99.9
COG4108528 PrfC Peptide chain release factor RF-3 [Translatio 99.9
TIGR00490720 aEF-2 translation elongation factor aEF-2. This mo 99.9
PLN00116 843 translation elongation factor EF-2 subunit; Provis 99.9
COG5257415 GCD11 Translation initiation factor 2, gamma subun 99.89
cd01884195 EF_Tu EF-Tu subfamily. This subfamily includes ort 99.89
KOG0464753 consensus Elongation factor G [Translation, riboso 99.88
cd01886270 EF-G Elongation factor G (EF-G) subfamily. Translo 99.88
PTZ00416 836 elongation factor 2; Provisional 99.88
KOG0463641 consensus GTP-binding protein GP-1 [General functi 99.87
cd04168237 TetM_like Tet(M)-like subfamily. Tet(M), Tet(O), T 99.87
KOG0459501 consensus Polypeptide release factor 3 [Translatio 99.86
cd04169267 RF3 RF3 subfamily. Peptide chain release factor 3 99.85
PF11987108 IF-2: Translation-initiation factor 2; InterPro: I 99.85
cd01887168 IF2_eIF5B IF2/eIF5B (initiation factors 2/ eukaryo 99.85
cd01888203 eIF2_gamma eIF2-gamma (gamma subunit of initiation 99.84
KOG1143591 consensus Predicted translation elongation factor 99.83
cd04166208 CysN_ATPS CysN_ATPS subfamily. CysN, together with 99.83
cd01889192 SelB_euk SelB subfamily. SelB is an elongation fac 99.83
cd04165224 GTPBP1_like GTPBP1-like. Mammalian GTP binding pro 99.83
cd01883219 EF1_alpha Eukaryotic elongation factor 1 (EF1) alp 99.83
cd04171164 SelB SelB subfamily. SelB is an elongation factor 99.82
cd01885222 EF2 EF2 (for archaea and eukarya). Translocation r 99.81
cd04170268 EF-G_bact Elongation factor G (EF-G) subfamily. Tr 99.81
cd01890179 LepA LepA subfamily. LepA belongs to the GTPase fa 99.81
cd01891194 TypA_BipA TypA (tyrosine phosphorylated protein A) 99.79
COG1159298 Era GTPase [General function prediction only] 99.78
cd00881189 GTP_translation_factor GTP translation factor fami 99.78
cd03703110 aeIF5B_II aeIF5B_II: This family represents the do 99.76
PRK15494339 era GTPase Era; Provisional 99.76
TIGR00436270 era GTP-binding protein Era. Era is an essential G 99.75
cd04167213 Snu114p Snu114p subfamily. Snu114p is one of sever 99.75
PRK00089292 era GTPase Era; Reviewed 99.74
PF02421156 FeoB_N: Ferrous iron transport protein B; InterPro 99.73
cd04124161 RabL2 RabL2 subfamily. RabL2 (Rab-like2) subfamily 99.72
cd01894157 EngA1 EngA1 subfamily. This CD represents the firs 99.72
cd01864165 Rab19 Rab19 subfamily. Rab19 proteins are associat 99.71
TIGR03594429 GTPase_EngA ribosome-associated GTPase EngA. EngA 99.71
TIGR03598179 GTPase_YsxC ribosome biogenesis GTP-binding protei 99.7
KOG0466466 consensus Translation initiation factor 2, gamma s 99.7
COG1160444 Predicted GTPases [General function prediction onl 99.7
PRK00093435 GTP-binding protein Der; Reviewed 99.7
cd04113161 Rab4 Rab4 subfamily. Rab4 has been implicated in n 99.69
cd01861161 Rab6 Rab6 subfamily. Rab6 is involved in microtubu 99.69
cd01897168 NOG NOG1 is a nucleolar GTP-binding protein presen 99.69
cd04106162 Rab23_lke Rab23-like subfamily. Rab23 is a member 99.68
cd04154173 Arl2 Arl2 subfamily. Arl2 (Arf-like 2) GTPases are 99.68
cd01862172 Rab7 Rab7 subfamily. Rab7 is a small Rab GTPase th 99.68
cd04160167 Arfrp1 Arfrp1 subfamily. Arfrp1 (Arf-related prote 99.68
cd04145164 M_R_Ras_like M-Ras/R-Ras-like subfamily. This subf 99.68
PRK03003472 GTP-binding protein Der; Reviewed 99.67
cd01895174 EngA2 EngA2 subfamily. This CD represents the seco 99.67
cd04119168 RJL RJL (RabJ-Like) subfamily. RJLs are found in m 99.67
smart00175164 RAB Rab subfamily of small GTPases. Rab GTPases ar 99.67
cd04114169 Rab30 Rab30 subfamily. Rab30 appears to be associa 99.67
KOG0469 842 consensus Elongation factor 2 [Translation, riboso 99.67
cd04107201 Rab32_Rab38 Rab38/Rab32 subfamily. Rab32 and Rab38 99.67
cd01867167 Rab8_Rab10_Rab13_like Rab8/Sec4/Ypt2. Rab8/Sec4/Yp 99.66
cd04151158 Arl1 Arl1 subfamily. Arl1 (Arf-like 1) localizes t 99.66
cd01866168 Rab2 Rab2 subfamily. Rab2 is localized on cis-Golg 99.66
COG1160444 Predicted GTPases [General function prediction onl 99.66
cd01879158 FeoB Ferrous iron transport protein B (FeoB) subfa 99.66
PRK03003472 GTP-binding protein Der; Reviewed 99.66
cd04138162 H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily. H-Ras, 99.66
cd04122166 Rab14 Rab14 subfamily. Rab14 GTPases are localized 99.66
cd04152183 Arl4_Arl7 Arl4/Arl7 subfamily. Arl4 (Arf-like 4) i 99.66
cd01869166 Rab1_Ypt1 Rab1/Ypt1 subfamily. Rab1 is found in ev 99.66
TIGR03594429 GTPase_EngA ribosome-associated GTPase EngA. EngA 99.66
smart00173164 RAS Ras subfamily of RAS small GTPases. Similar in 99.65
PRK04213201 GTP-binding protein; Provisional 99.65
cd04120202 Rab12 Rab12 subfamily. Rab12 was first identified 99.65
cd01860163 Rab5_related Rab5-related subfamily. This subfamil 99.65
KOG0467 887 consensus Translation elongation factor 2/ribosome 99.65
cd01898170 Obg Obg subfamily. The Obg nucleotide binding prot 99.65
PTZ00369189 Ras-like protein; Provisional 99.65
cd01865165 Rab3 Rab3 subfamily. The Rab3 subfamily contains R 99.65
cd04157162 Arl6 Arl6 subfamily. Arl6 (Arf-like 6) forms a sub 99.64
cd04127180 Rab27A Rab27a subfamily. The Rab27a subfamily cons 99.64
cd04126220 Rab20 Rab20 subfamily. Rab20 is one of several Rab 99.64
cd04141172 Rit_Rin_Ric Rit/Rin/Ric subfamily. Rit (Ras-like p 99.64
cd01863161 Rab18 Rab18 subfamily. Mammalian Rab18 is implicat 99.64
cd00877166 Ran Ran (Ras-related nuclear proteins) /TC4 subfam 99.64
cd04116170 Rab9 Rab9 subfamily. Rab9 is found in late endosom 99.64
PLN03071219 GTP-binding nuclear protein Ran; Provisional 99.64
cd01868165 Rab11_like Rab11-like. Rab11a, Rab11b, and Rab25 a 99.64
cd04112191 Rab26 Rab26 subfamily. First identified in rat pan 99.64
cd04136163 Rap_like Rap-like subfamily. The Rap subfamily con 99.64
cd04175164 Rap1 Rap1 subgroup. The Rap1 subgroup is part of t 99.64
cd04132187 Rho4_like Rho4-like subfamily. Rho4 is a GTPase th 99.63
cd00878158 Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-lik 99.63
cd04110199 Rab35 Rab35 subfamily. Rab35 is one of several Rab 99.63
cd04140165 ARHI_like ARHI subfamily. ARHI (A Ras homolog memb 99.63
cd04156160 ARLTS1 ARLTS1 subfamily. ARLTS1 (Arf-like tumor su 99.63
cd04153174 Arl5_Arl8 Arl5/Arl8 subfamily. Arl5 (Arf-like 5) a 99.63
TIGR00231161 small_GTP small GTP-binding protein domain. This m 99.63
cd04115170 Rab33B_Rab33A Rab33B/Rab33A subfamily. Rab33B is u 99.62
cd00879190 Sar1 Sar1 subfamily. Sar1 is an essential componen 99.62
PRK00093435 GTP-binding protein Der; Reviewed 99.62
cd04144190 Ras2 Ras2 subfamily. The Ras2 subfamily, found exc 99.62
cd04149168 Arf6 Arf6 subfamily. Arf6 (ADP ribosylation factor 99.62
cd04159159 Arl10_like Arl10-like subfamily. Arl9/Arl10 was id 99.62
COG0218200 Predicted GTPase [General function prediction only 99.62
PRK00454196 engB GTP-binding protein YsxC; Reviewed 99.62
cd04123162 Rab21 Rab21 subfamily. The localization and functi 99.62
cd00154159 Rab Rab family. Rab GTPases form the largest famil 99.62
cd01878204 HflX HflX subfamily. A distinct conserved domain w 99.62
cd01874175 Cdc42 Cdc42 subfamily. Cdc42 is an essential GTPas 99.62
PF1457881 GTP_EFTU_D4: Elongation factor Tu domain 4; PDB: 1 99.62
cd04150159 Arf1_5_like Arf1-Arf5-like subfamily. This subfami 99.62
cd04163168 Era Era subfamily. Era (E. coli Ras-like protein) 99.62
cd04121189 Rab40 Rab40 subfamily. This subfamily contains Rab 99.61
cd01893166 Miro1 Miro1 subfamily. Miro (mitochondrial Rho) pr 99.61
cd04109215 Rab28 Rab28 subfamily. First identified in maize, 99.61
PRK15467158 ethanolamine utilization protein EutP; Provisional 99.61
cd04164157 trmE TrmE (MnmE, ThdF, MSS1) is a 3-domain protein 99.61
cd04139164 RalA_RalB RalA/RalB subfamily. The Ral (Ras-like) 99.61
smart00178184 SAR Sar1p-like members of the Ras-family of small 99.61
cd04108170 Rab36_Rab34 Rab34/Rab36 subfamily. Rab34, found pr 99.61
cd04176163 Rap2 Rap2 subgroup. The Rap2 subgroup is part of t 99.61
cd04134189 Rho3 Rho3 subfamily. Rho3 is a member of the Rho f 99.61
smart00177175 ARF ARF-like small GTPases; ARF, ADP-ribosylation 99.61
PLN00223181 ADP-ribosylation factor; Provisional 99.6
PRK09518712 bifunctional cytidylate kinase/GTPase Der; Reviewe 99.6
cd04135174 Tc10 TC10 subfamily. TC10 is a Rho family protein 99.6
cd01875191 RhoG RhoG subfamily. RhoG is a GTPase with high se 99.6
PRK09518712 bifunctional cytidylate kinase/GTPase Der; Reviewe 99.6
PLN03110216 Rab GTPase; Provisional 99.6
KOG0084205 consensus GTPase Rab1/YPT1, small G protein superf 99.6
PLN03118211 Rab family protein; Provisional 99.6
cd04158169 ARD1 ARD1 subfamily. ARD1 (ADP-ribosylation factor 99.6
KOG1423379 consensus Ras-like GTPase ERA [Cell cycle control, 99.6
KOG0092200 consensus GTPase Rab5/YPT51 and related small G pr 99.59
TIGR03156351 GTP_HflX GTP-binding protein HflX. This protein fa 99.59
cd04147198 Ras_dva Ras-dva subfamily. Ras-dva (Ras - dorsal-v 99.59
TIGR02528142 EutP ethanolamine utilization protein, EutP. This 99.59
cd04143247 Rhes_like Rhes_like subfamily. This subfamily incl 99.59
cd04101164 RabL4 RabL4 (Rab-like4) subfamily. RabL4s are nove 99.59
PTZ00133182 ADP-ribosylation factor; Provisional 99.59
cd04118193 Rab24 Rab24 subfamily. Rab24 is distinct from othe 99.59
smart00174174 RHO Rho (Ras homology) subfamily of Ras-like small 99.59
cd04128182 Spg1 Spg1p. Spg1p (septum-promoting GTPase) was fi 99.59
cd04155173 Arl3 Arl3 subfamily. Arl3 (Arf-like 3) is an Arf f 99.59
cd01871174 Rac1_like Rac1-like subfamily. The Rac1-like subfa 99.59
smart00176200 RAN Ran (Ras-related nuclear proteins) /TC4 subfam 99.58
cd01870175 RhoA_like RhoA-like subfamily. The RhoA subfamily 99.58
cd04125188 RabA_like RabA-like subfamily. RabA was first iden 99.58
cd04117161 Rab15 Rab15 subfamily. Rab15 colocalizes with the 99.58
PLN03108210 Rab family protein; Provisional 99.58
cd04177168 RSR1 RSR1 subgroup. RSR1/Bud1p is a member of the 99.58
cd04142198 RRP22 RRP22 subfamily. RRP22 (Ras-related protein 99.58
cd00880163 Era_like Era (E. coli Ras-like protein)-like. This 99.58
cd04133176 Rop_like Rop subfamily. The Rop (Rho-related prote 99.57
cd00157171 Rho Rho (Ras homology) family. Members of the Rho 99.57
cd04111211 Rab39 Rab39 subfamily. Found in eukaryotes, Rab39 99.57
cd04161167 Arl2l1_Arl13_like Arl2l1/Arl13 subfamily. Arl2l1 ( 99.57
cd04137180 RheB Rheb (Ras Homolog Enriched in Brain) subfamil 99.57
cd04162164 Arl9_Arfrp2_like Arl9/Arfrp2-like subfamily. Arl9 99.57
KOG0094221 consensus GTPase Rab6/YPT6/Ryh1, small G protein s 99.56
PRK12299335 obgE GTPase CgtA; Reviewed 99.56
cd04146165 RERG_RasL11_like RERG/RasL11-like subfamily. RERG 99.56
COG2229187 Predicted GTPase [General function prediction only 99.56
PRK11058426 GTPase HflX; Provisional 99.55
cd04172182 Rnd3_RhoE_Rho8 Rnd3/RhoE/Rho8 subfamily. Rnd3/RhoE 99.55
cd00876160 Ras Ras family. The Ras family of the Ras superfam 99.55
PRK09554 772 feoB ferrous iron transport protein B; Reviewed 99.55
cd04174232 Rnd1_Rho6 Rnd1/Rho6 subfamily. Rnd1/Rho6 is a memb 99.55
TIGR02729329 Obg_CgtA Obg family GTPase CgtA. This model descri 99.55
PRK12298390 obgE GTPase CgtA; Reviewed 99.55
cd04131178 Rnd Rnd subfamily. The Rnd subfamily contains Rnd1 99.55
cd01892169 Miro2 Miro2 subfamily. Miro (mitochondrial Rho) pr 99.55
cd01881176 Obg_like The Obg-like subfamily consists of five w 99.55
PRK05291449 trmE tRNA modification GTPase TrmE; Reviewed 99.55
KOG0098216 consensus GTPase Rab2, small G protein superfamily 99.54
PRK12296500 obgE GTPase CgtA; Reviewed 99.54
KOG0394210 consensus Ras-related GTPase [General function pre 99.54
KOG1532366 consensus GTPase XAB1, interacts with DNA repair p 99.54
cd04130173 Wrch_1 Wrch-1 subfamily. Wrch-1 (Wnt-1 responsive 99.53
cd01876170 YihA_EngB The YihA (EngB) subfamily. This subfamil 99.53
KOG0078207 consensus GTP-binding protein SEC4, small G protei 99.52
PRK12297424 obgE GTPase CgtA; Reviewed 99.52
PF10662143 PduV-EutP: Ethanolamine utilisation - propanediol 99.51
cd04105203 SR_beta Signal recognition particle receptor, beta 99.51
cd04148221 RGK RGK subfamily. The RGK (Rem, Rem2, Rad, Gem/Ki 99.5
cd04173222 Rnd2_Rho7 Rnd2/Rho7 subfamily. Rnd2/Rho7 is a memb 99.5
KOG0468 971 consensus U5 snRNP-specific protein [Translation, 99.49
TIGR00450442 mnmE_trmE_thdF tRNA modification GTPase TrmE. TrmE 99.49
PF00025175 Arf: ADP-ribosylation factor family The prints ent 99.49
PTZ00132215 GTP-binding nuclear protein Ran; Provisional 99.46
cd00882157 Ras_like_GTPase Ras-like GTPase superfamily. The R 99.46
cd04129187 Rho2 Rho2 subfamily. Rho2 is a fungal GTPase that 99.45
PF00071162 Ras: Ras family; InterPro: IPR001806 Small GTPases 99.45
TIGR00437591 feoB ferrous iron transporter FeoB. FeoB (773 amin 99.44
KOG0080209 consensus GTPase Rab18, small G protein superfamil 99.43
KOG0095213 consensus GTPase Rab30, small G protein superfamil 99.42
COG0486454 ThdF Predicted GTPase [General function prediction 99.42
COG0370 653 FeoB Fe2+ transport system protein B [Inorganic io 99.41
cd04103158 Centaurin_gamma Centaurin gamma. The centaurins (a 99.4
KOG0093193 consensus GTPase Rab3, small G protein superfamily 99.4
KOG0087222 consensus GTPase Rab11/YPT3, small G protein super 99.39
KOG0086214 consensus GTPase Rab4, small G protein superfamily 99.39
cd0369284 mtIF2_IVc mtIF2_IVc: this family represents the C2 99.39
cd01896233 DRG The developmentally regulated GTP-binding prot 99.38
cd01873195 RhoBTB RhoBTB subfamily. Members of the RhoBTB sub 99.37
KOG0079198 consensus GTP-binding protein H-ray, small G prote 99.36
cd04104197 p47_IIGP_like p47 (47-kDa) family. The p47 GTPase 99.34
PRK09866741 hypothetical protein; Provisional 99.32
PF01926116 MMR_HSR1: 50S ribosome-binding GTPase; InterPro: I 99.31
COG1084346 Predicted GTPase [General function prediction only 99.3
COG5192 1077 BMS1 GTP-binding protein required for 40S ribosome 99.3
cd01882225 BMS1 Bms1. Bms1 is an essential, evolutionarily co 99.3
KOG0075186 consensus GTP-binding ADP-ribosylation factor-like 99.3
COG1100219 GTPase SAR1 and related small G proteins [General 99.29
COG2262411 HflX GTPases [General function prediction only] 99.27
KOG0088218 consensus GTPase Rab21, small G protein superfamil 99.25
KOG0073185 consensus GTP-binding ADP-ribosylation factor-like 99.25
KOG1489366 consensus Predicted GTP-binding protein (ODN super 99.24
cd04102202 RabL3 RabL3 (Rab-like3) subfamily. RabL3s are nove 99.24
COG3596296 Predicted GTPase [General function prediction only 99.23
KOG0070181 consensus GTP-binding ADP-ribosylation factor Arf1 99.21
KOG0081219 consensus GTPase Rab27, small G protein superfamil 99.2
COG0536369 Obg Predicted GTPase [General function prediction 99.2
cd01852196 AIG1 AIG1 (avrRpt2-induced gene 1). This represent 99.2
KOG0091213 consensus GTPase Rab39, small G protein superfamil 99.19
PLN00023334 GTP-binding protein; Provisional 99.19
PRK13768253 GTPase; Provisional 99.19
KOG0097215 consensus GTPase Rab14, small G protein superfamil 99.18
KOG0395196 consensus Ras-related GTPase [General function pre 99.14
COG1163365 DRG Predicted GTPase [General function prediction 99.13
KOG0076197 consensus GTP-binding ADP-ribosylation factor-like 99.13
cd01850276 CDC_Septin CDC/Septin. Septins are a conserved fam 99.13
PF08477119 Miro: Miro-like protein; InterPro: IPR013684 Mitoc 99.12
KOG1191531 consensus Mitochondrial GTPase [Translation, ribos 99.09
cd01899318 Ygr210 Ygr210 subfamily. Ygr210 is a member of Obg 99.09
PTZ00099176 rab6; Provisional 99.08
PF09439181 SRPRB: Signal recognition particle receptor beta s 99.07
PF03029238 ATP_bind_1: Conserved hypothetical ATP binding pro 99.05
KOG0083192 consensus GTPase Rab26/Rab37, small G protein supe 99.01
PRK09435332 membrane ATPase/protein kinase; Provisional 99.0
KOG0393198 consensus Ras-related small GTPase, Rho type [Gene 98.98
KOG0090238 consensus Signal recognition particle receptor, be 98.98
KOG0072182 consensus GTP-binding ADP-ribosylation factor-like 98.98
KOG4252246 consensus GTP-binding protein [Signal transduction 98.98
PRK09602396 translation-associated GTPase; Reviewed 98.93
COG4917148 EutP Ethanolamine utilization protein [Amino acid 98.92
KOG0071180 consensus GTP-binding ADP-ribosylation factor Arf6 98.9
smart00053240 DYNc Dynamin, GTPase. Large GTPases that mediate v 98.89
KOG1490620 consensus GTP-binding protein CRFG/NOG1 (ODN super 98.89
TIGR00073207 hypB hydrogenase accessory protein HypB. HypB is i 98.87
PF05049376 IIGP: Interferon-inducible GTPase (IIGP); InterPro 98.86
KOG0410410 consensus Predicted GTP binding protein [General f 98.82
KOG0074185 consensus GTP-binding ADP-ribosylation factor-like 98.8
TIGR00750300 lao LAO/AO transport system ATPase. Mutations have 98.79
KOG2486320 consensus Predicted GTPase [General function predi 98.77
PTZ00258390 GTP-binding protein; Provisional 98.75
cd0370295 IF2_mtIF2_II This family represents the domain II 98.75
cd01853249 Toc34_like Toc34-like (Translocon at the Outer-env 98.74
PF00350168 Dynamin_N: Dynamin family; InterPro: IPR001401 Mem 98.74
TIGR00101199 ureG urease accessory protein UreG. This model rep 98.68
KOG0077193 consensus Vesicle coat complex COPII, GTPase subun 98.67
PF04670232 Gtr1_RagA: Gtr1/RagA G protein conserved region; I 98.66
cd0370195 IF2_IF5B_II IF2_IF5B_II: This family represents th 98.63
TIGR02836492 spore_IV_A stage IV sporulation protein A. A compa 98.62
TIGR00991313 3a0901s02IAP34 GTP-binding protein (Chloroplast En 98.57
PF03308266 ArgK: ArgK protein; InterPro: IPR005129 Bacterial 98.56
COG0378202 HypB Ni2+-binding GTPase involved in regulation of 98.56
COG1703323 ArgK Putative periplasmic protein kinase ArgK and 98.56
PRK10463290 hydrogenase nickel incorporation protein HypB; Pro 98.52
KOG0066807 consensus eIF2-interacting protein ABC50 (ABC supe 98.49
KOG1954532 consensus Endocytosis/signaling protein EHD1 [Sign 98.46
PF04548212 AIG1: AIG1 family; InterPro: IPR006703 This entry 98.43
KOG1707625 consensus Predicted Ras related/Rac-GTP binding pr 98.42
KOG0052391 consensus Translation elongation factor EF-1 alpha 98.42
KOG0096216 consensus GTPase Ran/TC4/GSP1 (nuclear protein tra 98.4
KOG3883198 consensus Ras family small GTPase [Signal transduc 98.37
PF00735281 Septin: Septin; InterPro: IPR000038 Septins consti 98.37
cd01859156 MJ1464 MJ1464. This family represents archaeal GTP 98.35
COG0012372 Predicted GTPase, probable translation factor [Tra 98.26
cd01900274 YchF YchF subfamily. YchF is a member of the Obg f 98.25
PRK09601364 GTP-binding protein YchF; Reviewed 98.2
PRK14722374 flhF flagellar biosynthesis regulator FlhF; Provis 98.17
KOG1144 1064 consensus Translation initiation factor 5B (eIF-5B 98.17
KOG4423229 consensus GTP-binding protein-like, RAS superfamil 98.15
COG5019373 CDC3 Septin family protein [Cell division and chro 98.13
cd01858157 NGP_1 NGP-1. Autoantigen NGP-1 (Nucleolar G-protei 98.12
PRK14974336 cell division protein FtsY; Provisional 98.09
TIGR00993763 3a0901s04IAP86 chloroplast protein import componen 98.06
cd01855190 YqeH YqeH. YqeH is an essential GTP-binding protei 98.06
KOG1486364 consensus GTP-binding protein DRG2 (ODN superfamil 98.05
TIGR00157245 ribosome small subunit-dependent GTPase A. The Aqu 98.05
cd01856171 YlqF YlqF. Proteins of the YlqF family contain all 98.04
KOG1487358 consensus GTP-binding protein DRG1 (ODN superfamil 98.01
KOG1673205 consensus Ras GTPases [General function prediction 98.0
cd01849155 YlqF_related_GTPase YlqF-related GTPases. These pr 97.98
TIGR03596276 GTPase_YlqF ribosome biogenesis GTP-binding protei 97.97
PRK10416318 signal recognition particle-docking protein FtsY; 97.94
TIGR00064272 ftsY signal recognition particle-docking protein F 97.92
KOG2655366 consensus Septin family protein (P-loop GTPase) [C 97.91
TIGR01425429 SRP54_euk signal recognition particle protein SRP5 97.9
cd01858157 NGP_1 NGP-1. Autoantigen NGP-1 (Nucleolar G-protei 97.89
PRK12289352 GTPase RsgA; Reviewed 97.88
cd04178172 Nucleostemin_like Nucleostemin-like. Nucleostemin 97.87
PRK09563287 rbgA GTPase YlqF; Reviewed 97.81
cd03112158 CobW_like The function of this protein family is u 97.81
cd01857141 HSR1_MMR1 HSR1/MMR1. Human HSR1, is localized to t 97.8
cd0369085 Tet_II Tet_II: This subfamily represents domain II 97.75
PRK12727559 flagellar biosynthesis regulator FlhF; Provisional 97.72
PRK11889436 flhF flagellar biosynthesis regulator FlhF; Provis 97.72
PRK00771437 signal recognition particle protein Srp54; Provisi 97.7
PF00448196 SRP54: SRP54-type protein, GTPase domain; InterPro 97.69
cd0369391 EF1_alpha_II EF1_alpha_II: this family represents 97.68
KOG3905473 consensus Dynein light intermediate chain [Cell mo 97.67
cd01857141 HSR1_MMR1 HSR1/MMR1. Human HSR1, is localized to t 97.67
KOG1547336 consensus Septin CDC10 and related P-loop GTPases 97.66
cd0369683 selB_II selB_II: this subfamily represents the dom 97.66
cd01849155 YlqF_related_GTPase YlqF-related GTPases. These pr 97.65
PF03193161 DUF258: Protein of unknown function, DUF258; Inter 97.64
cd0369186 BipA_TypA_II BipA_TypA_II: domain II of BipA (also 97.64
PRK12726407 flagellar biosynthesis regulator FlhF; Provisional 97.63
PRK12288347 GTPase RsgA; Reviewed 97.63
KOG0448749 consensus Mitofusin 1 GTPase, involved in mitochon 97.62
cd01855190 YqeH YqeH. YqeH is an essential GTP-binding protei 97.6
cd01851224 GBP Guanylate-binding protein (GBP), N-terminal do 97.59
PRK00098298 GTPase RsgA; Reviewed 97.56
PRK09563287 rbgA GTPase YlqF; Reviewed 97.56
PF05783472 DLIC: Dynein light intermediate chain (DLIC); Inte 97.54
cd00066317 G-alpha G protein alpha subunit. The alpha subunit 97.54
COG0523323 Putative GTPases (G3E family) [General function pr 97.53
PRK12724432 flagellar biosynthesis regulator FlhF; Provisional 97.51
TIGR03596276 GTPase_YlqF ribosome biogenesis GTP-binding protei 97.51
cd0409283 mtEFG2_II_like mtEFG2_C: C-terminus of mitochondri 97.5
KOG3886295 consensus GTP-binding protein [Signal transduction 97.46
TIGR00092368 GTP-binding protein YchF. This predicted GTP-bindi 97.46
cd01856171 YlqF YlqF. Proteins of the YlqF family contain all 97.45
cd03115173 SRP The signal recognition particle (SRP) mediates 97.44
cd0408883 EFG_mtEFG_II EFG_mtEFG_II: this subfamily represen 97.43
PRK12723388 flagellar biosynthesis regulator FlhF; Provisional 97.42
PRK14721420 flhF flagellar biosynthesis regulator FlhF; Provis 97.41
cd0368985 RF3_II RF3_II: this subfamily represents the domai 97.4
COG1161322 Predicted GTPases [General function prediction onl 97.37
cd03114148 ArgK-like The function of this protein family is u 97.36
TIGR03597360 GTPase_YqeH ribosome biogenesis GTPase YqeH. This 97.35
cd01854287 YjeQ_engC YjeQ/EngC. YjeQ (YloQ in Bacillus subtil 97.35
TIGR03597360 GTPase_YqeH ribosome biogenesis GTPase YqeH. This 97.33
PRK01889356 GTPase RsgA; Reviewed 97.31
PRK10867433 signal recognition particle protein; Provisional 97.31
PRK06995484 flhF flagellar biosynthesis regulator FlhF; Valida 97.3
PRK06731270 flhF flagellar biosynthesis regulator FlhF; Valida 97.3
PRK12288347 GTPase RsgA; Reviewed 97.29
cd0369883 eRF3_II_like eRF3_II_like: domain similar to domai 97.28
PRK05703424 flhF flagellar biosynthesis regulator FlhF; Valida 97.28
cd0369787 EFTU_II EFTU_II: Elongation factor Tu domain II. E 97.27
TIGR03348 1169 VI_IcmF type VI secretion protein IcmF. Members of 97.26
cd0369391 EF1_alpha_II EF1_alpha_II: this family represents 97.26
TIGR00959428 ffh signal recognition particle protein. This mode 97.25
PRK12289352 GTPase RsgA; Reviewed 97.23
cd0369487 GTPBP_II Domain II of the GP-1 family of GTPase. T 97.23
KOG1424562 consensus Predicted GTP-binding protein MMR1 [Gene 97.22
KOG1491391 consensus Predicted GTP-binding protein (ODN super 97.21
cd0409181 mtEFG1_II_like mtEFG1_C: C-terminus of mitochondri 97.2
PRK14723767 flhF flagellar biosynthesis regulator FlhF; Provis 97.18
KOG3887347 consensus Predicted small GTPase involved in nucle 97.17
cd0369986 lepA_II lepA_II: This subfamily represents the dom 97.14
TIGR02475341 CobW cobalamin biosynthesis protein CobW. A broade 97.14
COG1162301 Predicted GTPases [General function prediction onl 97.1
COG3640255 CooC CO dehydrogenase maturation factor [Cell divi 97.08
KOG1534273 consensus Putative transcription factor FET5 [Tran 97.07
cd01859156 MJ1464 MJ1464. This family represents archaeal GTP 97.06
cd0134283 Translation_Factor_II_like Translation_Factor_II_l 96.94
cd0409094 eEF2_II_snRNP Loc2 eEF2_C_snRNP, cd01514/C termina 96.93
TIGR00157245 ribosome small subunit-dependent GTPase A. The Aqu 96.89
cd0408982 eRF3_II eRF3_II: domain II of the eukaryotic class 96.87
PF02492178 cobW: CobW/HypB/UreG, nucleotide-binding domain; I 96.85
KOG0447980 consensus Dynamin-like GTP binding protein [Genera 96.85
cd0369683 selB_II selB_II: this subfamily represents the dom 96.84
cd01854287 YjeQ_engC YjeQ/EngC. YjeQ (YloQ in Bacillus subtil 96.79
cd0369487 GTPBP_II Domain II of the GP-1 family of GTPase. T 96.79
COG1419407 FlhF Flagellar GTP-binding protein [Cell motility 96.77
PRK13796365 GTPase YqeH; Provisional 96.76
PF0314474 GTP_EFTU_D2: Elongation factor Tu domain 2; InterP 96.73
PRK00098298 GTPase RsgA; Reviewed 96.71
cd0369883 eRF3_II_like eRF3_II_like: domain similar to domai 96.7
COG3523 1188 IcmF Type VI protein secretion system component Va 96.66
cd0408982 eRF3_II eRF3_II: domain II of the eukaryotic class 96.66
cd0369581 CysN_NodQ_II CysN_NodQ_II: This subfamily represen 96.65
KOG2485335 consensus Conserved ATP/GTP binding protein [Gener 96.65
PRK11537318 putative GTP-binding protein YjiA; Provisional 96.63
PRK13796365 GTPase YqeH; Provisional 96.59
cd02038139 FleN-like FleN is a member of the Fer4_NifH superf 96.52
KOG3859406 consensus Septins (P-loop GTPases) [Cell cycle con 96.48
cd02036179 MinD Bacterial cell division requires the formatio 96.44
KOG0066807 consensus eIF2-interacting protein ABC50 (ABC supe 96.43
smart00010124 small_GTPase Small GTPase of the Ras superfamily; 96.34
KOG0082354 consensus G-protein alpha subunit (small G protein 96.32
PRK13695174 putative NTPase; Provisional 96.31
COG0552340 FtsY Signal recognition particle GTPase [Intracell 96.26
cd04178172 Nucleostemin_like Nucleostemin-like. Nucleostemin 96.21
cd0369787 EFTU_II EFTU_II: Elongation factor Tu domain II. E 96.19
cd02037169 MRP-like MRP (Multiple Resistance and pH adaptatio 96.19
PF09547492 Spore_IV_A: Stage IV sporulation protein A (spore_ 96.18
cd0370093 eEF2_snRNP_like_II EF2_snRNP_like_II: this subfami 96.16
cd0134283 Translation_Factor_II_like Translation_Factor_II_l 96.14
KOG2743391 consensus Cobalamin synthesis protein [Coenzyme tr 96.14
smart00275342 G_alpha G protein alpha subunit. Subunit of G prot 96.14
KOG1707625 consensus Predicted Ras related/Rac-GTP binding pr 96.09
COG1162301 Predicted GTPases [General function prediction onl 96.09
COG1618179 Predicted nucleotide kinase [Nucleotide transport 96.01
KOG2484435 consensus GTPase [General function prediction only 95.96
PF0314474 GTP_EFTU_D2: Elongation factor Tu domain 2; InterP 95.94
cd03110179 Fer4_NifH_child This protein family's function is 95.93
cd03111106 CpaE_like This protein family consists of proteins 95.89
COG0541451 Ffh Signal recognition particle GTPase [Intracellu 95.88
PF03205140 MobB: Molybdopterin guanine dinucleotide synthesis 95.84
cd0369581 CysN_NodQ_II CysN_NodQ_II: This subfamily represen 95.73
KOG2423572 consensus Nucleolar GTPase [General function predi 95.68
PLN00043447 elongation factor 1-alpha; Provisional 95.57
KOG0780483 consensus Signal recognition particle, subunit Srp 95.57
PRK12736394 elongation factor Tu; Reviewed 95.55
KOG1533290 consensus Predicted GTPase [General function predi 95.51
PF13401131 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S 95.37
cd0198399 Fer4_NifH The Fer4_NifH superfamily contains a var 95.36
PTZ00141446 elongation factor 1- alpha; Provisional 95.34
cd02042104 ParA ParA and ParB of Caulobacter crescentus belon 95.33
PHA02518211 ParA-like protein; Provisional 95.31
PRK13849231 putative crown gall tumor protein VirC1; Provision 95.14
PTZ001212084 MAEBL; Provisional 95.05
PRK10751173 molybdopterin-guanine dinucleotide biosynthesis pr 95.04
KOG0446657 consensus Vacuolar sorting protein VPS1, dynamin, 94.75
PLN03126478 Elongation factor Tu; Provisional 94.61
PRK00049396 elongation factor Tu; Reviewed 94.51
COG3276 447 SelB Selenocysteine-specific translation elongatio 94.46
PRK01889356 GTPase RsgA; Reviewed 94.45
PF05621302 TniB: Bacterial TniB protein; InterPro: IPR008868 94.42
PRK10512 614 selenocysteinyl-tRNA-specific translation factor; 94.4
PRK12735396 elongation factor Tu; Reviewed 94.32
TIGR00483426 EF-1_alpha translation elongation factor EF-1 alph 94.23
PLN03127447 Elongation factor Tu; Provisional 94.23
KOG0781587 consensus Signal recognition particle receptor, al 94.22
cd03688113 eIF2_gamma_II eIF2_gamma_II: this subfamily repres 94.2
cd01120165 RecA-like_NTPases RecA-like NTPases. This family i 94.13
KOG4181491 consensus Uncharacterized conserved protein [Funct 94.08
TIGR00485394 EF-Tu translation elongation factor TU. This align 94.06
TIGR03499282 FlhF flagellar biosynthetic protein FlhF. 93.92
PTZ001212084 MAEBL; Provisional 93.81
PRK12317425 elongation factor 1-alpha; Reviewed 93.8
PF13671143 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1 93.74
cd0369284 mtIF2_IVc mtIF2_IVc: this family represents the C2 93.73
COG0488530 Uup ATPase components of ABC transporters with dup 93.72
>KOG1144 consensus Translation initiation factor 5B (eIF-5B) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information 
Probab=100.00  E-value=1.5e-155  Score=1342.75  Aligned_cols=595  Identities=81%  Similarity=1.242  Sum_probs=583.3

Q ss_pred             cccccCCCCEEEEEccCCCCchhhhhhhcCCcccccccCceeEeeeeeEeeccccccchhhcccccc--cccCCeEeecC
Q 000923          625 QAEENLRSPICCIMGHVDTGKTKLLDCIRGTNVQEGEAGGITQQIGATYFPAENIRERTRELKANAT--LKVPGLLVIDT  702 (1222)
Q Consensus       625 ~~~~~~R~~~V~IvG~vdsGKTTLl~~L~~~~v~~~e~~GIT~~iga~~~~~~~~~~~~~~~~~~~~--~~~~~i~~IDT  702 (1222)
                      ....++|.|+||||||+|+|||-||+.|+++||+.+++|||||+||++|||..+++.++..+..+..  |..++|++|||
T Consensus       468 ~~~~~lRSPIcCilGHVDTGKTKlld~ir~tNVqegeaggitqqIgAt~fp~~ni~e~tk~~~~~~K~~~kvPg~lvIdt  547 (1064)
T KOG1144|consen  468 ESTENLRSPICCILGHVDTGKTKLLDKIRGTNVQEGEAGGITQQIGATYFPAENIREKTKELKKDAKKRLKVPGLLVIDT  547 (1064)
T ss_pred             ccchhcCCceEEEeecccccchHHHHHhhccccccccccceeeeccccccchHHHHHHHHHHHhhhhhhcCCCeeEEecC
Confidence            3456899999999999999999999999999999999999999999999999999988888877654  88899999999


Q ss_pred             CCchhhHHHHHhhcccCceeEEEecccCCCChhHHHHHHHHHhcCCceEEEEeeeccccCcccCCCchHHHHHHHhhHHH
Q 000923          703 PGHESFTNLRSRGSGLCDIAILVVDIMHGLEPQTIESLNLLKMRNTEFIVALNKVDRLYGWKTCRNAPIVKAIKQQNTDV  782 (1222)
Q Consensus       703 PGhe~F~~~~~rg~~~aD~aILVVDa~dGv~~qT~e~l~~lk~~~vP~IVviNKiDl~~~w~~~~~a~i~~~l~~q~~~~  782 (1222)
                      |||+.|+++|.||+++||++|||||++||+.|||+++|++|+.+++||||++||||++|+|..+++++|...|..|...+
T Consensus       548 pghEsFtnlRsrgsslC~~aIlvvdImhGlepqtiESi~lLR~rktpFivALNKiDRLYgwk~~p~~~i~~~lkkQ~k~v  627 (1064)
T KOG1144|consen  548 PGHESFTNLRSRGSSLCDLAILVVDIMHGLEPQTIESINLLRMRKTPFIVALNKIDRLYGWKSCPNAPIVEALKKQKKDV  627 (1064)
T ss_pred             CCchhhhhhhhccccccceEEEEeehhccCCcchhHHHHHHHhcCCCeEEeehhhhhhcccccCCCchHHHHHHHhhHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHHHHHHHcCCchhhhhccccCCCceeEEEcCCCCCCChhhHHHHHHHHHHHHHHHhhhccccccceEEEE
Q 000923          783 QNEFNMRLVQIVTQLKEQGMNTELYYKNKDRGETFNIVPTSAISGEGIPDLLLLLVQWTQKTMVEKLTFRNELQCTVLEV  862 (1222)
Q Consensus       783 ~~~~~~~l~~i~~~L~e~gl~~e~~~~~~~~g~~v~vvpvSA~tGeGI~eLl~~i~~~~~~~l~e~l~~~~~~~~~VlEv  862 (1222)
                      +++|..++..|+.+|.++|||..+||.+.+++.+|.+||+||++|+||++||.+|+.|.+..|...|.|.+.++|+|++|
T Consensus       628 ~~EF~~R~~~ii~efaEQgLN~~LyykNk~~~~~vsiVPTSA~sGeGipdLl~llv~ltQk~m~~kl~y~~ev~cTVlEV  707 (1064)
T KOG1144|consen  628 QNEFKERLNNIIVEFAEQGLNAELYYKNKEMGETVSIVPTSAISGEGIPDLLLLLVQLTQKTMVEKLAYVDEVQCTVLEV  707 (1064)
T ss_pred             HHHHHHHHHHHHHHHHHcccchhheeecccccceEEeeecccccCCCcHHHHHHHHHHHHHHHHHHHhhhhheeeEEEEE
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             EEEcCceeEEEEEEEeeeecCCCEEEEccCCCceeeeeeeccCCCCCcceeeeeeeeehhhhccccCcEEeecCcccccC
Q 000923          863 KVIEGHGTTIDVVLVNGVLHEGDQIVVCGLQGPIVTTIRALLTPHPMKELRVKGTYLHHKQIKAAQGIKITAQGLEHAIA  942 (1222)
Q Consensus       863 ~~~~g~G~v~~~~V~~GtLk~GD~ivv~g~~g~~~~~Ir~ll~p~p~~~~rvk~~~~~~~ev~aa~g~~i~~~gL~~~~a  942 (1222)
                      +.++|+|+++++++.+|+||.||+||+||++||++++||+||+|+|++++||++.|+||++|.+|+|++|++.+|+++++
T Consensus       708 KvieG~GtTIDViLvNG~L~eGD~IvvcG~~GpIvTtIRaLLtP~PlkElRVk~~Y~hhkEvkaA~GiKI~A~~LEkaia  787 (1064)
T KOG1144|consen  708 KVIEGHGTTIDVILVNGELHEGDQIVVCGLQGPIVTTIRALLTPQPLKELRVKGTYVHHKEVKAAQGIKIAAKDLEKAIA  787 (1064)
T ss_pred             EeecCCCceEEEEEEcceeccCCEEEEcCCCCchhHHHHHhcCCcchHhhccccceeehhHhhhhccchhhhcchHHHhc
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCceEEeCCCccHHHHHHHHHHHHHHHHhhhcccCCceEEEeCCcccHHHHHHHhccCCeeeeEEEeeeCccccchHHHH
Q 000923          943 GTGLYVVGPDDDLEDVKEEAMEDMKSVMSRIDKSGEGVCVQASTLGSLEALLEFLKSDAVKIPVSGISIGPVHKKDVMRA 1022 (1222)
Q Consensus       943 G~~l~v~~~e~~~~~~~~~~~~~~~~~~~~~~~~~~~vivkadt~GSlEAl~~~L~~~~~~i~i~~~~vG~It~~DV~~A 1022 (1222)
                      |..|+|+.+++++++++..+|++|.+++++|+++++||+|+|+|+|||||||+||++  ++|||..+|||||+++|||.|
T Consensus       788 G~~l~VvgpeDd~e~lk~~~m~dl~~~l~~Id~sgeGv~vqastlgslealleflk~--~kIPv~gi~IGPVhKKDvmka  865 (1064)
T KOG1144|consen  788 GTRLLVVGPEDDIEELKEEAMEDLESVLSRIDKSGEGVYVQASTLGSLEALLEFLKT--VKIPVSGIGIGPVHKKDVMKA  865 (1064)
T ss_pred             CCeeEEeCCcccHHHHHHHHHHHHHHHHHHhhccCCceEEEecccchHHHHHHHHhh--cCcccccccccccchHHHHHH
Confidence            999999999999999999999999999999999999999999999999999999998  999999999999999999999


Q ss_pred             HhhhhccccCcEEEEecCCCCHHHHHHHHHhCCeEEEcccccchHHHHHHHHhhhhhHHHHhhccceeeceeEEeccccc
Q 000923         1023 SVMLEKKKEYATILAFDVKVTPEARELAEELGVKIFIADIIYHLFDQFTAYINNLKEEKKREAADEAVFPCVLKILPNCV 1102 (1222)
Q Consensus      1023 ~~~~~~~~~~a~IlaFnVk~~~~a~~~A~~~gV~I~~~~IIY~Lid~~~~~l~~~~~~~~~e~~~~av~p~~~~i~~~~v 1102 (1222)
                      ++|+++++.||+||||+|++..+|+.||..+||+||+++|||||||.|+.|++.+++..+++....|||||+|+|+|+||
T Consensus       866 ~~MlEk~kEyA~iLaFDVkv~~eA~e~Ad~~gVkIF~adiIYhLfD~f~~y~e~~ke~kkke~~~~AvFPc~L~ilpn~i  945 (1064)
T KOG1144|consen  866 SVMLEKKKEYATILAFDVKVEREARELADEMGVKIFCADIIYHLFDAFTKYIEEIKEEKKKESADEAVFPCVLQILPNCI  945 (1064)
T ss_pred             HHHHhhccceeEEEEEeeEeeHHHHHHHHhhCceeeehhHHHHHHHHHHHHHHHHHHHHHhhccCceeeeeehhhhhHhh
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             ccCCCCeEEEEEEEeeeeecCCCeeecCCeEEEEEeeechhcccccccccccCceEEEEEccCCchhhhhhcccccccCC
Q 000923         1103 FNKKDPIVLGVDVVEGIAKVGTPICIPQRDFIDIGRIASIENNHKPVDTAKKGQKAAIKIAGSNSEEQQKMFGRHFDIED 1182 (1222)
Q Consensus      1103 f~~~~~~IaG~~V~~G~l~~g~~i~v~~~~~i~~G~I~Slk~~k~~V~e~~kG~EcgI~i~~~n~~~~~~~~gr~f~~~d 1182 (1222)
                      ||+++|+|+||.|..|+|++|+||||+..++|++|+|+||++|+++|.+|++|++|+|+|.+.|. .+++||||||...|
T Consensus       946 fN~RdPiv~GV~V~~GilkiGTPiCv~~r~~~~lG~v~Sie~Nh~~vd~akkGqeVaiKie~~~~-e~~~mfGRHf~~~D 1024 (1064)
T KOG1144|consen  946 FNKRDPIVLGVDVEEGILKIGTPICVPKREFIDLGRVASIENNHKPVDYAKKGQEVAIKIEASNG-EEQKMFGRHFDMED 1024 (1064)
T ss_pred             ccCCCCeEEEEEeecCeeecCCceEEeccceeeeeeeeeecccCcccchhhcCCeEEEEEecCCC-CCcchhhcccCccc
Confidence            99999999999999999999999999988999999999999999999999999999999998764 56799999999999


Q ss_pred             eEEEccchhhHHHHHHHhhccCCHHHHHHHHHHHhhcCCC
Q 000923         1183 ELVSHISRKSIDVLKANYRDDLSMDEWRLLVKLKNLFKIQ 1222 (1222)
Q Consensus      1183 ~l~s~i~r~~i~~lk~~~~~~~s~~~~~~~~~lk~~~~i~ 1222 (1222)
                      +|||+|||+|||+|+.+||++||.++|+||++||++|+|+
T Consensus      1025 ~LyS~isR~SId~lK~~fr~el~~~dw~Lv~~Lk~~f~I~ 1064 (1064)
T KOG1144|consen 1025 ILYSHISRRSIDILKKAFRDELTKDDWQLVVKLKKLFGII 1064 (1064)
T ss_pred             hHHHHhhHhhHHHHHHHHHHHhhHHHHHHHHHHHHHhccC
Confidence            9999999999999999999999999999999999999996

>TIGR00491 aIF-2 translation initiation factor aIF-2/yIF-2 Back     alignment and domain information
>PRK04004 translation initiation factor IF-2; Validated Back     alignment and domain information
>PRK14845 translation initiation factor IF-2; Provisional Back     alignment and domain information
>COG0532 InfB Translation initiation factor 2 (IF-2; GTPase) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG1145 consensus Mitochondrial translation initiation factor 2 (IF-2; GTPase) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR00487 IF-2 translation initiation factor IF-2 Back     alignment and domain information
>PRK05306 infB translation initiation factor IF-2; Validated Back     alignment and domain information
>CHL00189 infB translation initiation factor 2; Provisional Back     alignment and domain information
>COG5256 TEF1 Translation elongation factor EF-1alpha (GTPase) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PTZ00141 elongation factor 1- alpha; Provisional Back     alignment and domain information
>KOG0462 consensus Elongation factor-type GTP-binding protein [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK10512 selenocysteinyl-tRNA-specific translation factor; Provisional Back     alignment and domain information
>PRK12736 elongation factor Tu; Reviewed Back     alignment and domain information
>TIGR01394 TypA_BipA GTP-binding protein TypA/BipA Back     alignment and domain information
>PLN00043 elongation factor 1-alpha; Provisional Back     alignment and domain information
>TIGR00475 selB selenocysteine-specific elongation factor SelB Back     alignment and domain information
>COG0050 TufB GTPases - translation elongation factors [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0460 consensus Mitochondrial translation elongation factor Tu [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PLN03127 Elongation factor Tu; Provisional Back     alignment and domain information
>COG0480 FusA Translation elongation factors (GTPases) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PLN03126 Elongation factor Tu; Provisional Back     alignment and domain information
>PRK12735 elongation factor Tu; Reviewed Back     alignment and domain information
>PTZ00327 eukaryotic translation initiation factor 2 gamma subunit; Provisional Back     alignment and domain information
>CHL00071 tufA elongation factor Tu Back     alignment and domain information
>PRK00049 elongation factor Tu; Reviewed Back     alignment and domain information
>TIGR00485 EF-Tu translation elongation factor TU Back     alignment and domain information
>PRK10218 GTP-binding protein; Provisional Back     alignment and domain information
>COG1217 TypA Predicted membrane GTPase involved in stress response [Signal transduction mechanisms] Back     alignment and domain information
>COG0481 LepA Membrane GTPase LepA [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK12317 elongation factor 1-alpha; Reviewed Back     alignment and domain information
>COG3276 SelB Selenocysteine-specific translation elongation factor [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR00483 EF-1_alpha translation elongation factor EF-1 alpha Back     alignment and domain information
>PRK00741 prfC peptide chain release factor 3; Provisional Back     alignment and domain information
>PRK05433 GTP-binding protein LepA; Provisional Back     alignment and domain information
>PRK12739 elongation factor G; Reviewed Back     alignment and domain information
>KOG0465 consensus Mitochondrial elongation factor [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR02034 CysN sulfate adenylyltransferase, large subunit Back     alignment and domain information
>TIGR01393 lepA GTP-binding protein LepA Back     alignment and domain information
>PRK00007 elongation factor G; Reviewed Back     alignment and domain information
>TIGR00484 EF-G translation elongation factor EF-G Back     alignment and domain information
>PRK13351 elongation factor G; Reviewed Back     alignment and domain information
>TIGR03680 eif2g_arch translation initiation factor 2 subunit gamma Back     alignment and domain information
>PRK05124 cysN sulfate adenylyltransferase subunit 1; Provisional Back     alignment and domain information
>COG5258 GTPBP1 GTPase [General function prediction only] Back     alignment and domain information
>TIGR00503 prfC peptide chain release factor 3 Back     alignment and domain information
>COG2895 CysN GTPases - Sulfate adenylate transferase subunit 1 [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK07560 elongation factor EF-2; Reviewed Back     alignment and domain information
>PRK04000 translation initiation factor IF-2 subunit gamma; Validated Back     alignment and domain information
>KOG0458 consensus Elongation factor 1 alpha [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF00009 GTP_EFTU: Elongation factor Tu GTP binding domain; InterPro: IPR000795 Elongation factors belong to a family of proteins that promote the GTP-dependent binding of aminoacyl tRNA to the A site of ribosomes during protein biosynthesis, and catalyse the translocation of the synthesised protein chain from the A to the P site Back     alignment and domain information
>PRK05506 bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Provisional Back     alignment and domain information
>PRK12740 elongation factor G; Reviewed Back     alignment and domain information
>KOG0461 consensus Selenocysteine-specific elongation factor [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG4108 PrfC Peptide chain release factor RF-3 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR00490 aEF-2 translation elongation factor aEF-2 Back     alignment and domain information
>PLN00116 translation elongation factor EF-2 subunit; Provisional Back     alignment and domain information
>COG5257 GCD11 Translation initiation factor 2, gamma subunit (eIF-2gamma; GTPase) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd01884 EF_Tu EF-Tu subfamily Back     alignment and domain information
>KOG0464 consensus Elongation factor G [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd01886 EF-G Elongation factor G (EF-G) subfamily Back     alignment and domain information
>PTZ00416 elongation factor 2; Provisional Back     alignment and domain information
>KOG0463 consensus GTP-binding protein GP-1 [General function prediction only] Back     alignment and domain information
>cd04168 TetM_like Tet(M)-like subfamily Back     alignment and domain information
>KOG0459 consensus Polypeptide release factor 3 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd04169 RF3 RF3 subfamily Back     alignment and domain information
>PF11987 IF-2: Translation-initiation factor 2; InterPro: IPR023115 Initiation factor 2 (IF-2) is one of the three factors required for the initiation of protein biosynthesis in bacteria Back     alignment and domain information
>cd01887 IF2_eIF5B IF2/eIF5B (initiation factors 2/ eukaryotic initiation factor 5B) subfamily Back     alignment and domain information
>cd01888 eIF2_gamma eIF2-gamma (gamma subunit of initiation factor 2) Back     alignment and domain information
>KOG1143 consensus Predicted translation elongation factor [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd04166 CysN_ATPS CysN_ATPS subfamily Back     alignment and domain information
>cd01889 SelB_euk SelB subfamily Back     alignment and domain information
>cd04165 GTPBP1_like GTPBP1-like Back     alignment and domain information
>cd01883 EF1_alpha Eukaryotic elongation factor 1 (EF1) alpha subfamily Back     alignment and domain information
>cd04171 SelB SelB subfamily Back     alignment and domain information
>cd01885 EF2 EF2 (for archaea and eukarya) Back     alignment and domain information
>cd04170 EF-G_bact Elongation factor G (EF-G) subfamily Back     alignment and domain information
>cd01890 LepA LepA subfamily Back     alignment and domain information
>cd01891 TypA_BipA TypA (tyrosine phosphorylated protein A)/BipA subfamily Back     alignment and domain information
>COG1159 Era GTPase [General function prediction only] Back     alignment and domain information
>cd00881 GTP_translation_factor GTP translation factor family Back     alignment and domain information
>cd03703 aeIF5B_II aeIF5B_II: This family represents the domain II of archeal and eukaryotic aeIF5B Back     alignment and domain information
>PRK15494 era GTPase Era; Provisional Back     alignment and domain information
>TIGR00436 era GTP-binding protein Era Back     alignment and domain information
>cd04167 Snu114p Snu114p subfamily Back     alignment and domain information
>PRK00089 era GTPase Era; Reviewed Back     alignment and domain information
>PF02421 FeoB_N: Ferrous iron transport protein B; InterPro: IPR011619 Escherichia coli has an iron(II) transport system (feo) which may make an important contribution to the iron supply of the cell under anaerobic conditions Back     alignment and domain information
>cd04124 RabL2 RabL2 subfamily Back     alignment and domain information
>cd01894 EngA1 EngA1 subfamily Back     alignment and domain information
>cd01864 Rab19 Rab19 subfamily Back     alignment and domain information
>TIGR03594 GTPase_EngA ribosome-associated GTPase EngA Back     alignment and domain information
>TIGR03598 GTPase_YsxC ribosome biogenesis GTP-binding protein YsxC/EngB Back     alignment and domain information
>KOG0466 consensus Translation initiation factor 2, gamma subunit (eIF-2gamma; GTPase) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG1160 Predicted GTPases [General function prediction only] Back     alignment and domain information
>PRK00093 GTP-binding protein Der; Reviewed Back     alignment and domain information
>cd04113 Rab4 Rab4 subfamily Back     alignment and domain information
>cd01861 Rab6 Rab6 subfamily Back     alignment and domain information
>cd01897 NOG NOG1 is a nucleolar GTP-binding protein present in eukaryotes ranging from trypanosomes to humans Back     alignment and domain information
>cd04106 Rab23_lke Rab23-like subfamily Back     alignment and domain information
>cd04154 Arl2 Arl2 subfamily Back     alignment and domain information
>cd01862 Rab7 Rab7 subfamily Back     alignment and domain information
>cd04160 Arfrp1 Arfrp1 subfamily Back     alignment and domain information
>cd04145 M_R_Ras_like M-Ras/R-Ras-like subfamily Back     alignment and domain information
>PRK03003 GTP-binding protein Der; Reviewed Back     alignment and domain information
>cd01895 EngA2 EngA2 subfamily Back     alignment and domain information
>cd04119 RJL RJL (RabJ-Like) subfamily Back     alignment and domain information
>smart00175 RAB Rab subfamily of small GTPases Back     alignment and domain information
>cd04114 Rab30 Rab30 subfamily Back     alignment and domain information
>KOG0469 consensus Elongation factor 2 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd04107 Rab32_Rab38 Rab38/Rab32 subfamily Back     alignment and domain information
>cd01867 Rab8_Rab10_Rab13_like Rab8/Sec4/Ypt2 Back     alignment and domain information
>cd04151 Arl1 Arl1 subfamily Back     alignment and domain information
>cd01866 Rab2 Rab2 subfamily Back     alignment and domain information
>COG1160 Predicted GTPases [General function prediction only] Back     alignment and domain information
>cd01879 FeoB Ferrous iron transport protein B (FeoB) subfamily Back     alignment and domain information
>PRK03003 GTP-binding protein Der; Reviewed Back     alignment and domain information
>cd04138 H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily Back     alignment and domain information
>cd04122 Rab14 Rab14 subfamily Back     alignment and domain information
>cd04152 Arl4_Arl7 Arl4/Arl7 subfamily Back     alignment and domain information
>cd01869 Rab1_Ypt1 Rab1/Ypt1 subfamily Back     alignment and domain information
>TIGR03594 GTPase_EngA ribosome-associated GTPase EngA Back     alignment and domain information
>smart00173 RAS Ras subfamily of RAS small GTPases Back     alignment and domain information
>PRK04213 GTP-binding protein; Provisional Back     alignment and domain information
>cd04120 Rab12 Rab12 subfamily Back     alignment and domain information
>cd01860 Rab5_related Rab5-related subfamily Back     alignment and domain information
>KOG0467 consensus Translation elongation factor 2/ribosome biogenesis protein RIA1 and related proteins [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd01898 Obg Obg subfamily Back     alignment and domain information
>PTZ00369 Ras-like protein; Provisional Back     alignment and domain information
>cd01865 Rab3 Rab3 subfamily Back     alignment and domain information
>cd04157 Arl6 Arl6 subfamily Back     alignment and domain information
>cd04127 Rab27A Rab27a subfamily Back     alignment and domain information
>cd04126 Rab20 Rab20 subfamily Back     alignment and domain information
>cd04141 Rit_Rin_Ric Rit/Rin/Ric subfamily Back     alignment and domain information
>cd01863 Rab18 Rab18 subfamily Back     alignment and domain information
>cd00877 Ran Ran (Ras-related nuclear proteins) /TC4 subfamily of small GTPases Back     alignment and domain information
>cd04116 Rab9 Rab9 subfamily Back     alignment and domain information
>PLN03071 GTP-binding nuclear protein Ran; Provisional Back     alignment and domain information
>cd01868 Rab11_like Rab11-like Back     alignment and domain information
>cd04112 Rab26 Rab26 subfamily Back     alignment and domain information
>cd04136 Rap_like Rap-like subfamily Back     alignment and domain information
>cd04175 Rap1 Rap1 subgroup Back     alignment and domain information
>cd04132 Rho4_like Rho4-like subfamily Back     alignment and domain information
>cd00878 Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-like) small GTPases Back     alignment and domain information
>cd04110 Rab35 Rab35 subfamily Back     alignment and domain information
>cd04140 ARHI_like ARHI subfamily Back     alignment and domain information
>cd04156 ARLTS1 ARLTS1 subfamily Back     alignment and domain information
>cd04153 Arl5_Arl8 Arl5/Arl8 subfamily Back     alignment and domain information
>TIGR00231 small_GTP small GTP-binding protein domain Back     alignment and domain information
>cd04115 Rab33B_Rab33A Rab33B/Rab33A subfamily Back     alignment and domain information
>cd00879 Sar1 Sar1 subfamily Back     alignment and domain information
>PRK00093 GTP-binding protein Der; Reviewed Back     alignment and domain information
>cd04144 Ras2 Ras2 subfamily Back     alignment and domain information
>cd04149 Arf6 Arf6 subfamily Back     alignment and domain information
>cd04159 Arl10_like Arl10-like subfamily Back     alignment and domain information
>COG0218 Predicted GTPase [General function prediction only] Back     alignment and domain information
>PRK00454 engB GTP-binding protein YsxC; Reviewed Back     alignment and domain information
>cd04123 Rab21 Rab21 subfamily Back     alignment and domain information
>cd00154 Rab Rab family Back     alignment and domain information
>cd01878 HflX HflX subfamily Back     alignment and domain information
>cd01874 Cdc42 Cdc42 subfamily Back     alignment and domain information
>PF14578 GTP_EFTU_D4: Elongation factor Tu domain 4; PDB: 1G7R_A 1G7S_A 1G7T_A 1XE1_A Back     alignment and domain information
>cd04150 Arf1_5_like Arf1-Arf5-like subfamily Back     alignment and domain information
>cd04163 Era Era subfamily Back     alignment and domain information
>cd04121 Rab40 Rab40 subfamily Back     alignment and domain information
>cd01893 Miro1 Miro1 subfamily Back     alignment and domain information
>cd04109 Rab28 Rab28 subfamily Back     alignment and domain information
>PRK15467 ethanolamine utilization protein EutP; Provisional Back     alignment and domain information
>cd04164 trmE TrmE (MnmE, ThdF, MSS1) is a 3-domain protein found in bacteria and eukaryotes Back     alignment and domain information
>cd04139 RalA_RalB RalA/RalB subfamily Back     alignment and domain information
>smart00178 SAR Sar1p-like members of the Ras-family of small GTPases Back     alignment and domain information
>cd04108 Rab36_Rab34 Rab34/Rab36 subfamily Back     alignment and domain information
>cd04176 Rap2 Rap2 subgroup Back     alignment and domain information
>cd04134 Rho3 Rho3 subfamily Back     alignment and domain information
>smart00177 ARF ARF-like small GTPases; ARF, ADP-ribosylation factor Back     alignment and domain information
>PLN00223 ADP-ribosylation factor; Provisional Back     alignment and domain information
>PRK09518 bifunctional cytidylate kinase/GTPase Der; Reviewed Back     alignment and domain information
>cd04135 Tc10 TC10 subfamily Back     alignment and domain information
>cd01875 RhoG RhoG subfamily Back     alignment and domain information
>PRK09518 bifunctional cytidylate kinase/GTPase Der; Reviewed Back     alignment and domain information
>PLN03110 Rab GTPase; Provisional Back     alignment and domain information
>KOG0084 consensus GTPase Rab1/YPT1, small G protein superfamily, and related GTP-binding proteins [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PLN03118 Rab family protein; Provisional Back     alignment and domain information
>cd04158 ARD1 ARD1 subfamily Back     alignment and domain information
>KOG1423 consensus Ras-like GTPase ERA [Cell cycle control, cell division, chromosome partitioning; Signal transduction mechanisms] Back     alignment and domain information
>KOG0092 consensus GTPase Rab5/YPT51 and related small G protein superfamily GTPases [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>TIGR03156 GTP_HflX GTP-binding protein HflX Back     alignment and domain information
>cd04147 Ras_dva Ras-dva subfamily Back     alignment and domain information
>TIGR02528 EutP ethanolamine utilization protein, EutP Back     alignment and domain information
>cd04143 Rhes_like Rhes_like subfamily Back     alignment and domain information
>cd04101 RabL4 RabL4 (Rab-like4) subfamily Back     alignment and domain information
>PTZ00133 ADP-ribosylation factor; Provisional Back     alignment and domain information
>cd04118 Rab24 Rab24 subfamily Back     alignment and domain information
>smart00174 RHO Rho (Ras homology) subfamily of Ras-like small GTPases Back     alignment and domain information
>cd04128 Spg1 Spg1p Back     alignment and domain information
>cd04155 Arl3 Arl3 subfamily Back     alignment and domain information
>cd01871 Rac1_like Rac1-like subfamily Back     alignment and domain information
>smart00176 RAN Ran (Ras-related nuclear proteins) /TC4 subfamily of small GTPases Back     alignment and domain information
>cd01870 RhoA_like RhoA-like subfamily Back     alignment and domain information
>cd04125 RabA_like RabA-like subfamily Back     alignment and domain information
>cd04117 Rab15 Rab15 subfamily Back     alignment and domain information
>PLN03108 Rab family protein; Provisional Back     alignment and domain information
>cd04177 RSR1 RSR1 subgroup Back     alignment and domain information
>cd04142 RRP22 RRP22 subfamily Back     alignment and domain information
>cd00880 Era_like Era (E Back     alignment and domain information
>cd04133 Rop_like Rop subfamily Back     alignment and domain information
>cd00157 Rho Rho (Ras homology) family Back     alignment and domain information
>cd04111 Rab39 Rab39 subfamily Back     alignment and domain information
>cd04161 Arl2l1_Arl13_like Arl2l1/Arl13 subfamily Back     alignment and domain information
>cd04137 RheB Rheb (Ras Homolog Enriched in Brain) subfamily Back     alignment and domain information
>cd04162 Arl9_Arfrp2_like Arl9/Arfrp2-like subfamily Back     alignment and domain information
>KOG0094 consensus GTPase Rab6/YPT6/Ryh1, small G protein superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK12299 obgE GTPase CgtA; Reviewed Back     alignment and domain information
>cd04146 RERG_RasL11_like RERG/RasL11-like subfamily Back     alignment and domain information
>COG2229 Predicted GTPase [General function prediction only] Back     alignment and domain information
>PRK11058 GTPase HflX; Provisional Back     alignment and domain information
>cd04172 Rnd3_RhoE_Rho8 Rnd3/RhoE/Rho8 subfamily Back     alignment and domain information
>cd00876 Ras Ras family Back     alignment and domain information
>PRK09554 feoB ferrous iron transport protein B; Reviewed Back     alignment and domain information
>cd04174 Rnd1_Rho6 Rnd1/Rho6 subfamily Back     alignment and domain information
>TIGR02729 Obg_CgtA Obg family GTPase CgtA Back     alignment and domain information
>PRK12298 obgE GTPase CgtA; Reviewed Back     alignment and domain information
>cd04131 Rnd Rnd subfamily Back     alignment and domain information
>cd01892 Miro2 Miro2 subfamily Back     alignment and domain information
>cd01881 Obg_like The Obg-like subfamily consists of five well-delimited, ancient subfamilies, namely Obg, DRG, YyaF/YchF, Ygr210, and NOG1 Back     alignment and domain information
>PRK05291 trmE tRNA modification GTPase TrmE; Reviewed Back     alignment and domain information
>KOG0098 consensus GTPase Rab2, small G protein superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK12296 obgE GTPase CgtA; Reviewed Back     alignment and domain information
>KOG0394 consensus Ras-related GTPase [General function prediction only] Back     alignment and domain information
>KOG1532 consensus GTPase XAB1, interacts with DNA repair protein XPA [Replication, recombination and repair] Back     alignment and domain information
>cd04130 Wrch_1 Wrch-1 subfamily Back     alignment and domain information
>cd01876 YihA_EngB The YihA (EngB) subfamily Back     alignment and domain information
>KOG0078 consensus GTP-binding protein SEC4, small G protein superfamily, and related Ras family GTP-binding proteins [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK12297 obgE GTPase CgtA; Reviewed Back     alignment and domain information
>PF10662 PduV-EutP: Ethanolamine utilisation - propanediol utilisation; InterPro: IPR012381 Members of this family function in ethanolamine [] and propanediol [] degradation pathways Back     alignment and domain information
>cd04105 SR_beta Signal recognition particle receptor, beta subunit (SR-beta) Back     alignment and domain information
>cd04148 RGK RGK subfamily Back     alignment and domain information
>cd04173 Rnd2_Rho7 Rnd2/Rho7 subfamily Back     alignment and domain information
>KOG0468 consensus U5 snRNP-specific protein [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR00450 mnmE_trmE_thdF tRNA modification GTPase TrmE Back     alignment and domain information
>PF00025 Arf: ADP-ribosylation factor family The prints entry specific to Sar1 proteins The Prosite entry specific to Sar1 proteins; InterPro: IPR006689 Small GTPases form an independent superfamily within the larger class of regulatory GTP hydrolases Back     alignment and domain information
>PTZ00132 GTP-binding nuclear protein Ran; Provisional Back     alignment and domain information
>cd00882 Ras_like_GTPase Ras-like GTPase superfamily Back     alignment and domain information
>cd04129 Rho2 Rho2 subfamily Back     alignment and domain information
>PF00071 Ras: Ras family; InterPro: IPR001806 Small GTPases form an independent superfamily within the larger class of regulatory GTP hydrolases Back     alignment and domain information
>TIGR00437 feoB ferrous iron transporter FeoB Back     alignment and domain information
>KOG0080 consensus GTPase Rab18, small G protein superfamily [General function prediction only] Back     alignment and domain information
>KOG0095 consensus GTPase Rab30, small G protein superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG0486 ThdF Predicted GTPase [General function prediction only] Back     alignment and domain information
>COG0370 FeoB Fe2+ transport system protein B [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd04103 Centaurin_gamma Centaurin gamma Back     alignment and domain information
>KOG0093 consensus GTPase Rab3, small G protein superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0087 consensus GTPase Rab11/YPT3, small G protein superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0086 consensus GTPase Rab4, small G protein superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd03692 mtIF2_IVc mtIF2_IVc: this family represents the C2 subdomain of domain IV of mitochondrial translation initiation factor 2 (mtIF2) which adopts a beta-barrel fold displaying a high degree of structural similarity with domain II of the translation elongation factor EF-Tu Back     alignment and domain information
>cd01896 DRG The developmentally regulated GTP-binding protein (DRG) subfamily is an uncharacterized member of the Obg family, an evolutionary branch of GTPase superfamily proteins Back     alignment and domain information
>cd01873 RhoBTB RhoBTB subfamily Back     alignment and domain information
>KOG0079 consensus GTP-binding protein H-ray, small G protein superfamily [General function prediction only] Back     alignment and domain information
>cd04104 p47_IIGP_like p47 (47-kDa) family Back     alignment and domain information
>PRK09866 hypothetical protein; Provisional Back     alignment and domain information
>PF01926 MMR_HSR1: 50S ribosome-binding GTPase; InterPro: IPR002917 Human HSR1, has been localized to the human MHC class I region and is highly homologous to a putative GTP-binding protein, MMR1 from mouse Back     alignment and domain information
>COG1084 Predicted GTPase [General function prediction only] Back     alignment and domain information
>COG5192 BMS1 GTP-binding protein required for 40S ribosome biogenesis [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd01882 BMS1 Bms1 Back     alignment and domain information
>KOG0075 consensus GTP-binding ADP-ribosylation factor-like protein [General function prediction only] Back     alignment and domain information
>COG1100 GTPase SAR1 and related small G proteins [General function prediction only] Back     alignment and domain information
>COG2262 HflX GTPases [General function prediction only] Back     alignment and domain information
>KOG0088 consensus GTPase Rab21, small G protein superfamily [General function prediction only] Back     alignment and domain information
>KOG0073 consensus GTP-binding ADP-ribosylation factor-like protein ARL2 [Intracellular trafficking, secretion, and vesicular transport; Cytoskeleton] Back     alignment and domain information
>KOG1489 consensus Predicted GTP-binding protein (ODN superfamily) [General function prediction only] Back     alignment and domain information
>cd04102 RabL3 RabL3 (Rab-like3) subfamily Back     alignment and domain information
>COG3596 Predicted GTPase [General function prediction only] Back     alignment and domain information
>KOG0070 consensus GTP-binding ADP-ribosylation factor Arf1 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0081 consensus GTPase Rab27, small G protein superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG0536 Obg Predicted GTPase [General function prediction only] Back     alignment and domain information
>cd01852 AIG1 AIG1 (avrRpt2-induced gene 1) Back     alignment and domain information
>KOG0091 consensus GTPase Rab39, small G protein superfamily [General function prediction only] Back     alignment and domain information
>PLN00023 GTP-binding protein; Provisional Back     alignment and domain information
>PRK13768 GTPase; Provisional Back     alignment and domain information
>KOG0097 consensus GTPase Rab14, small G protein superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0395 consensus Ras-related GTPase [General function prediction only] Back     alignment and domain information
>COG1163 DRG Predicted GTPase [General function prediction only] Back     alignment and domain information
>KOG0076 consensus GTP-binding ADP-ribosylation factor-like protein yARL3 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd01850 CDC_Septin CDC/Septin Back     alignment and domain information
>PF08477 Miro: Miro-like protein; InterPro: IPR013684 Mitochondrial Rho proteins (Miro-1, Q8IXI2 from SWISSPROT and Miro-2, Q8IXI1 from SWISSPROT) are atypical Rho GTPases Back     alignment and domain information
>KOG1191 consensus Mitochondrial GTPase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd01899 Ygr210 Ygr210 subfamily Back     alignment and domain information
>PTZ00099 rab6; Provisional Back     alignment and domain information
>PF09439 SRPRB: Signal recognition particle receptor beta subunit; InterPro: IPR019009 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] Back     alignment and domain information
>PF03029 ATP_bind_1: Conserved hypothetical ATP binding protein; InterPro: IPR004130 Members of this family are found in a range of archaea and eukaryotes and have hypothesised ATP binding activity Back     alignment and domain information
>KOG0083 consensus GTPase Rab26/Rab37, small G protein superfamily [General function prediction only] Back     alignment and domain information
>PRK09435 membrane ATPase/protein kinase; Provisional Back     alignment and domain information
>KOG0393 consensus Ras-related small GTPase, Rho type [General function prediction only] Back     alignment and domain information
>KOG0090 consensus Signal recognition particle receptor, beta subunit (small G protein superfamily) [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0072 consensus GTP-binding ADP-ribosylation factor-like protein ARL1 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4252 consensus GTP-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>PRK09602 translation-associated GTPase; Reviewed Back     alignment and domain information
>COG4917 EutP Ethanolamine utilization protein [Amino acid transport and metabolism] Back     alignment and domain information
>KOG0071 consensus GTP-binding ADP-ribosylation factor Arf6 (dArf3) [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>smart00053 DYNc Dynamin, GTPase Back     alignment and domain information
>KOG1490 consensus GTP-binding protein CRFG/NOG1 (ODN superfamily) [General function prediction only] Back     alignment and domain information
>TIGR00073 hypB hydrogenase accessory protein HypB Back     alignment and domain information
>PF05049 IIGP: Interferon-inducible GTPase (IIGP); InterPro: IPR007743 Interferon-inducible GTPase (IIGP) is thought to play a role in in intracellular defence Back     alignment and domain information
>KOG0410 consensus Predicted GTP binding protein [General function prediction only] Back     alignment and domain information
>KOG0074 consensus GTP-binding ADP-ribosylation factor-like protein ARL3 [General function prediction only] Back     alignment and domain information
>TIGR00750 lao LAO/AO transport system ATPase Back     alignment and domain information
>KOG2486 consensus Predicted GTPase [General function prediction only] Back     alignment and domain information
>PTZ00258 GTP-binding protein; Provisional Back     alignment and domain information
>cd03702 IF2_mtIF2_II This family represents the domain II of bacterial Initiation Factor 2 (IF2) and its eukaryotic mitochondrial homologue mtIF2 Back     alignment and domain information
>cd01853 Toc34_like Toc34-like (Translocon at the Outer-envelope membrane of Chloroplasts) Back     alignment and domain information
>PF00350 Dynamin_N: Dynamin family; InterPro: IPR001401 Membrane transport between compartments in eukaryotic cells requires proteins that allow the budding and scission of nascent cargo vesicles from one compartment and their targeting and fusion with another Back     alignment and domain information
>TIGR00101 ureG urease accessory protein UreG Back     alignment and domain information
>KOG0077 consensus Vesicle coat complex COPII, GTPase subunit SAR1 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF04670 Gtr1_RagA: Gtr1/RagA G protein conserved region; InterPro: IPR006762 GTR1 was first identified in Saccharomyces cerevisiae (Baker's yeast) as a suppressor of a mutation in RCC1 Back     alignment and domain information
>cd03701 IF2_IF5B_II IF2_IF5B_II: This family represents the domain II of prokaryotic Initiation Factor 2 (IF2) and its archeal and eukaryotic homologue aeIF5B Back     alignment and domain information
>TIGR02836 spore_IV_A stage IV sporulation protein A Back     alignment and domain information
>TIGR00991 3a0901s02IAP34 GTP-binding protein (Chloroplast Envelope Protein Translocase) Back     alignment and domain information
>PF03308 ArgK: ArgK protein; InterPro: IPR005129 Bacterial periplasmic transport systems require the function of a specific substrate-binding protein, located in the periplasm, and several cytoplasmic membrane transport components Back     alignment and domain information
>COG0378 HypB Ni2+-binding GTPase involved in regulation of expression and maturation of urease and hydrogenase [Posttranslational modification, protein turnover, chaperones / Transcription] Back     alignment and domain information
>COG1703 ArgK Putative periplasmic protein kinase ArgK and related GTPases of G3E family [Amino acid transport and metabolism] Back     alignment and domain information
>PRK10463 hydrogenase nickel incorporation protein HypB; Provisional Back     alignment and domain information
>KOG0066 consensus eIF2-interacting protein ABC50 (ABC superfamily) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG1954 consensus Endocytosis/signaling protein EHD1 [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF04548 AIG1: AIG1 family; InterPro: IPR006703 This entry represents a domain found in Arabidopsis protein AIG1 which appears to be involved in plant resistance to bacteria Back     alignment and domain information
>KOG1707 consensus Predicted Ras related/Rac-GTP binding protein [Defense mechanisms] Back     alignment and domain information
>KOG0052 consensus Translation elongation factor EF-1 alpha/Tu [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0096 consensus GTPase Ran/TC4/GSP1 (nuclear protein transport pathway), small G protein superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG3883 consensus Ras family small GTPase [Signal transduction mechanisms] Back     alignment and domain information
>PF00735 Septin: Septin; InterPro: IPR000038 Septins constitute a eukaryotic family of guanine nucleotide-binding proteins, most of which polymerise to form filaments [] Back     alignment and domain information
>cd01859 MJ1464 MJ1464 Back     alignment and domain information
>COG0012 Predicted GTPase, probable translation factor [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd01900 YchF YchF subfamily Back     alignment and domain information
>PRK09601 GTP-binding protein YchF; Reviewed Back     alignment and domain information
>PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>KOG1144 consensus Translation initiation factor 5B (eIF-5B) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG4423 consensus GTP-binding protein-like, RAS superfamily [Signal transduction mechanisms] Back     alignment and domain information
>COG5019 CDC3 Septin family protein [Cell division and chromosome partitioning / Cytoskeleton] Back     alignment and domain information
>cd01858 NGP_1 NGP-1 Back     alignment and domain information
>PRK14974 cell division protein FtsY; Provisional Back     alignment and domain information
>TIGR00993 3a0901s04IAP86 chloroplast protein import component Toc86/159, G and M domains Back     alignment and domain information
>cd01855 YqeH YqeH Back     alignment and domain information
>KOG1486 consensus GTP-binding protein DRG2 (ODN superfamily) [Signal transduction mechanisms] Back     alignment and domain information
>TIGR00157 ribosome small subunit-dependent GTPase A Back     alignment and domain information
>cd01856 YlqF YlqF Back     alignment and domain information
>KOG1487 consensus GTP-binding protein DRG1 (ODN superfamily) [Signal transduction mechanisms] Back     alignment and domain information
>KOG1673 consensus Ras GTPases [General function prediction only] Back     alignment and domain information
>cd01849 YlqF_related_GTPase YlqF-related GTPases Back     alignment and domain information
>TIGR03596 GTPase_YlqF ribosome biogenesis GTP-binding protein YlqF Back     alignment and domain information
>PRK10416 signal recognition particle-docking protein FtsY; Provisional Back     alignment and domain information
>TIGR00064 ftsY signal recognition particle-docking protein FtsY Back     alignment and domain information
>KOG2655 consensus Septin family protein (P-loop GTPase) [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>TIGR01425 SRP54_euk signal recognition particle protein SRP54 Back     alignment and domain information
>cd01858 NGP_1 NGP-1 Back     alignment and domain information
>PRK12289 GTPase RsgA; Reviewed Back     alignment and domain information
>cd04178 Nucleostemin_like Nucleostemin-like Back     alignment and domain information
>PRK09563 rbgA GTPase YlqF; Reviewed Back     alignment and domain information
>cd03112 CobW_like The function of this protein family is unkown Back     alignment and domain information
>cd01857 HSR1_MMR1 HSR1/MMR1 Back     alignment and domain information
>cd03690 Tet_II Tet_II: This subfamily represents domain II of ribosomal protection proteins Tet(M) and Tet(O) Back     alignment and domain information
>PRK12727 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK00771 signal recognition particle protein Srp54; Provisional Back     alignment and domain information
>PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] Back     alignment and domain information
>cd03693 EF1_alpha_II EF1_alpha_II: this family represents the domain II of elongation factor 1-alpha (EF-1a) that is found in archaea and all eukaryotic lineages Back     alignment and domain information
>KOG3905 consensus Dynein light intermediate chain [Cell motility] Back     alignment and domain information
>cd01857 HSR1_MMR1 HSR1/MMR1 Back     alignment and domain information
>KOG1547 consensus Septin CDC10 and related P-loop GTPases [Cell cycle control, cell division, chromosome partitioning; Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>cd03696 selB_II selB_II: this subfamily represents the domain of elongation factor SelB, homologous to domain II of EF-Tu Back     alignment and domain information
>cd01849 YlqF_related_GTPase YlqF-related GTPases Back     alignment and domain information
>PF03193 DUF258: Protein of unknown function, DUF258; InterPro: IPR004881 This entry contains Escherichia coli (strain K12) RsgA, which may play a role in 30S ribosomal subunit biogenesis Back     alignment and domain information
>cd03691 BipA_TypA_II BipA_TypA_II: domain II of BipA (also called TypA) having homology to domain II of the elongation factors (EFs) EF-G and EF-Tu Back     alignment and domain information
>PRK12726 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK12288 GTPase RsgA; Reviewed Back     alignment and domain information
>KOG0448 consensus Mitofusin 1 GTPase, involved in mitochondrila biogenesis [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd01855 YqeH YqeH Back     alignment and domain information
>cd01851 GBP Guanylate-binding protein (GBP), N-terminal domain Back     alignment and domain information
>PRK00098 GTPase RsgA; Reviewed Back     alignment and domain information
>PRK09563 rbgA GTPase YlqF; Reviewed Back     alignment and domain information
>PF05783 DLIC: Dynein light intermediate chain (DLIC); InterPro: IPR022780 This entry consists of several eukaryotic dynein light intermediate chain proteins Back     alignment and domain information
>cd00066 G-alpha G protein alpha subunit Back     alignment and domain information
>COG0523 Putative GTPases (G3E family) [General function prediction only] Back     alignment and domain information
>PRK12724 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>TIGR03596 GTPase_YlqF ribosome biogenesis GTP-binding protein YlqF Back     alignment and domain information
>cd04092 mtEFG2_II_like mtEFG2_C: C-terminus of mitochondrial Elongation factor G2 (mtEFG2)-like proteins found in eukaryotes Back     alignment and domain information
>KOG3886 consensus GTP-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>TIGR00092 GTP-binding protein YchF Back     alignment and domain information
>cd01856 YlqF YlqF Back     alignment and domain information
>cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes Back     alignment and domain information
>cd04088 EFG_mtEFG_II EFG_mtEFG_II: this subfamily represents the domain II of elongation factor G (EF-G) in bacteria and, the C-terminus of mitochondrial Elongation factor G1 (mtEFG1) and G2 (mtEFG2)_like proteins found in eukaryotes Back     alignment and domain information
>PRK12723 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK14721 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>cd03689 RF3_II RF3_II: this subfamily represents the domain II of bacterial Release Factor 3 (RF3) Back     alignment and domain information
>COG1161 Predicted GTPases [General function prediction only] Back     alignment and domain information
>cd03114 ArgK-like The function of this protein family is unkown Back     alignment and domain information
>TIGR03597 GTPase_YqeH ribosome biogenesis GTPase YqeH Back     alignment and domain information
>cd01854 YjeQ_engC YjeQ/EngC Back     alignment and domain information
>TIGR03597 GTPase_YqeH ribosome biogenesis GTPase YqeH Back     alignment and domain information
>PRK01889 GTPase RsgA; Reviewed Back     alignment and domain information
>PRK10867 signal recognition particle protein; Provisional Back     alignment and domain information
>PRK06995 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>PRK06731 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>PRK12288 GTPase RsgA; Reviewed Back     alignment and domain information
>cd03698 eRF3_II_like eRF3_II_like: domain similar to domain II of the eukaryotic class II release factor (eRF3) Back     alignment and domain information
>PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>cd03697 EFTU_II EFTU_II: Elongation factor Tu domain II Back     alignment and domain information
>TIGR03348 VI_IcmF type VI secretion protein IcmF Back     alignment and domain information
>cd03693 EF1_alpha_II EF1_alpha_II: this family represents the domain II of elongation factor 1-alpha (EF-1a) that is found in archaea and all eukaryotic lineages Back     alignment and domain information
>TIGR00959 ffh signal recognition particle protein Back     alignment and domain information
>PRK12289 GTPase RsgA; Reviewed Back     alignment and domain information
>cd03694 GTPBP_II Domain II of the GP-1 family of GTPase Back     alignment and domain information
>KOG1424 consensus Predicted GTP-binding protein MMR1 [General function prediction only] Back     alignment and domain information
>KOG1491 consensus Predicted GTP-binding protein (ODN superfamily) [General function prediction only] Back     alignment and domain information
>cd04091 mtEFG1_II_like mtEFG1_C: C-terminus of mitochondrial Elongation factor G1 (mtEFG1)-like proteins found in eukaryotes Back     alignment and domain information
>PRK14723 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>KOG3887 consensus Predicted small GTPase involved in nuclear protein import [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd03699 lepA_II lepA_II: This subfamily represents the domain II of LepA, a GTP-binding protein localized in the cytoplasmic membrane Back     alignment and domain information
>TIGR02475 CobW cobalamin biosynthesis protein CobW Back     alignment and domain information
>COG1162 Predicted GTPases [General function prediction only] Back     alignment and domain information
>COG3640 CooC CO dehydrogenase maturation factor [Cell division and chromosome partitioning] Back     alignment and domain information
>KOG1534 consensus Putative transcription factor FET5 [Transcription] Back     alignment and domain information
>cd01859 MJ1464 MJ1464 Back     alignment and domain information
>cd01342 Translation_Factor_II_like Translation_Factor_II_like: Elongation factor Tu (EF-Tu) domain II-like proteins Back     alignment and domain information
>cd04090 eEF2_II_snRNP Loc2 eEF2_C_snRNP, cd01514/C terminal domain:eEF2_C_snRNP: This family includes C-terminal portion of the spliceosomal human 116kD U5 small nuclear ribonucleoprotein (snRNP) protein (U5-116 kD) and, its yeast counterpart Snu114p Back     alignment and domain information
>TIGR00157 ribosome small subunit-dependent GTPase A Back     alignment and domain information
>cd04089 eRF3_II eRF3_II: domain II of the eukaryotic class II release factor (eRF3) Back     alignment and domain information
>PF02492 cobW: CobW/HypB/UreG, nucleotide-binding domain; InterPro: IPR003495 Cobalamin (vitamin B12) is a structurally complex cofactor, consisting of a modified tetrapyrrole with a centrally chelated cobalt Back     alignment and domain information
>KOG0447 consensus Dynamin-like GTP binding protein [General function prediction only] Back     alignment and domain information
>cd03696 selB_II selB_II: this subfamily represents the domain of elongation factor SelB, homologous to domain II of EF-Tu Back     alignment and domain information
>cd01854 YjeQ_engC YjeQ/EngC Back     alignment and domain information
>cd03694 GTPBP_II Domain II of the GP-1 family of GTPase Back     alignment and domain information
>COG1419 FlhF Flagellar GTP-binding protein [Cell motility and secretion] Back     alignment and domain information
>PRK13796 GTPase YqeH; Provisional Back     alignment and domain information
>PF03144 GTP_EFTU_D2: Elongation factor Tu domain 2; InterPro: IPR004161 Translation elongation factors are responsible for two main processes during protein synthesis on the ribosome [, , ] Back     alignment and domain information
>PRK00098 GTPase RsgA; Reviewed Back     alignment and domain information
>cd03698 eRF3_II_like eRF3_II_like: domain similar to domain II of the eukaryotic class II release factor (eRF3) Back     alignment and domain information
>COG3523 IcmF Type VI protein secretion system component VasK [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd04089 eRF3_II eRF3_II: domain II of the eukaryotic class II release factor (eRF3) Back     alignment and domain information
>cd03695 CysN_NodQ_II CysN_NodQ_II: This subfamily represents the domain II of the large subunit of ATP sulfurylase (ATPS): CysN or the N-terminal portion of NodQ, found mainly in proteobacteria and homologous to the domain II of EF-Tu Back     alignment and domain information
>KOG2485 consensus Conserved ATP/GTP binding protein [General function prediction only] Back     alignment and domain information
>PRK11537 putative GTP-binding protein YjiA; Provisional Back     alignment and domain information
>PRK13796 GTPase YqeH; Provisional Back     alignment and domain information
>cd02038 FleN-like FleN is a member of the Fer4_NifH superfamily Back     alignment and domain information
>KOG3859 consensus Septins (P-loop GTPases) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>cd02036 MinD Bacterial cell division requires the formation of a septum at mid-cell Back     alignment and domain information
>KOG0066 consensus eIF2-interacting protein ABC50 (ABC superfamily) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>smart00010 small_GTPase Small GTPase of the Ras superfamily; ill-defined subfamily Back     alignment and domain information
>KOG0082 consensus G-protein alpha subunit (small G protein superfamily) [Cell cycle control, cell division, chromosome partitioning; Signal transduction mechanisms] Back     alignment and domain information
>PRK13695 putative NTPase; Provisional Back     alignment and domain information
>COG0552 FtsY Signal recognition particle GTPase [Intracellular trafficking and secretion] Back     alignment and domain information
>cd04178 Nucleostemin_like Nucleostemin-like Back     alignment and domain information
>cd03697 EFTU_II EFTU_II: Elongation factor Tu domain II Back     alignment and domain information
>cd02037 MRP-like MRP (Multiple Resistance and pH adaptation) is a homologue of the Fer4_NifH superfamily Back     alignment and domain information
>PF09547 Spore_IV_A: Stage IV sporulation protein A (spore_IV_A); InterPro: IPR014201 This entry is designated stage IV sporulation protein A Back     alignment and domain information
>cd03700 eEF2_snRNP_like_II EF2_snRNP_like_II: this subfamily represents domain II of elongation factor (EF) EF-2 found eukaryotes and archaea and, the C-terminal portion of the spliceosomal human 116kD U5 small nuclear ribonucleoprotein (snRNP) protein (U5-116 kD) and, its yeast counterpart Snu114p Back     alignment and domain information
>cd01342 Translation_Factor_II_like Translation_Factor_II_like: Elongation factor Tu (EF-Tu) domain II-like proteins Back     alignment and domain information
>KOG2743 consensus Cobalamin synthesis protein [Coenzyme transport and metabolism] Back     alignment and domain information
>smart00275 G_alpha G protein alpha subunit Back     alignment and domain information
>KOG1707 consensus Predicted Ras related/Rac-GTP binding protein [Defense mechanisms] Back     alignment and domain information
>COG1162 Predicted GTPases [General function prediction only] Back     alignment and domain information
>COG1618 Predicted nucleotide kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>KOG2484 consensus GTPase [General function prediction only] Back     alignment and domain information
>PF03144 GTP_EFTU_D2: Elongation factor Tu domain 2; InterPro: IPR004161 Translation elongation factors are responsible for two main processes during protein synthesis on the ribosome [, , ] Back     alignment and domain information
>cd03110 Fer4_NifH_child This protein family's function is unkown Back     alignment and domain information
>cd03111 CpaE_like This protein family consists of proteins similar to the cpaE protein of the Caulobacter pilus assembly and the orf4 protein of Actinobacillus pilus formation gene cluster Back     alignment and domain information
>COG0541 Ffh Signal recognition particle GTPase [Intracellular trafficking and secretion] Back     alignment and domain information
>PF03205 MobB: Molybdopterin guanine dinucleotide synthesis protein B; PDB: 2F1R_B 1P9N_A 1NP6_B 2NPI_A 1XJC_A Back     alignment and domain information
>cd03695 CysN_NodQ_II CysN_NodQ_II: This subfamily represents the domain II of the large subunit of ATP sulfurylase (ATPS): CysN or the N-terminal portion of NodQ, found mainly in proteobacteria and homologous to the domain II of EF-Tu Back     alignment and domain information
>KOG2423 consensus Nucleolar GTPase [General function prediction only] Back     alignment and domain information
>PLN00043 elongation factor 1-alpha; Provisional Back     alignment and domain information
>KOG0780 consensus Signal recognition particle, subunit Srp54 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK12736 elongation factor Tu; Reviewed Back     alignment and domain information
>KOG1533 consensus Predicted GTPase [General function prediction only] Back     alignment and domain information
>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B Back     alignment and domain information
>cd01983 Fer4_NifH The Fer4_NifH superfamily contains a variety of proteins which share a common ATP-binding domain Back     alignment and domain information
>PTZ00141 elongation factor 1- alpha; Provisional Back     alignment and domain information
>cd02042 ParA ParA and ParB of Caulobacter crescentus belong to a conserved family of bacterial proteins implicated in chromosome segregation Back     alignment and domain information
>PHA02518 ParA-like protein; Provisional Back     alignment and domain information
>PRK13849 putative crown gall tumor protein VirC1; Provisional Back     alignment and domain information
>PTZ00121 MAEBL; Provisional Back     alignment and domain information
>PRK10751 molybdopterin-guanine dinucleotide biosynthesis protein B; Provisional Back     alignment and domain information
>KOG0446 consensus Vacuolar sorting protein VPS1, dynamin, and related proteins [Intracellular trafficking, secretion, and vesicular transport; General function prediction only] Back     alignment and domain information
>PLN03126 Elongation factor Tu; Provisional Back     alignment and domain information
>PRK00049 elongation factor Tu; Reviewed Back     alignment and domain information
>COG3276 SelB Selenocysteine-specific translation elongation factor [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK01889 GTPase RsgA; Reviewed Back     alignment and domain information
>PF05621 TniB: Bacterial TniB protein; InterPro: IPR008868 This family consists of several bacterial TniB NTP-binding proteins Back     alignment and domain information
>PRK10512 selenocysteinyl-tRNA-specific translation factor; Provisional Back     alignment and domain information
>PRK12735 elongation factor Tu; Reviewed Back     alignment and domain information
>TIGR00483 EF-1_alpha translation elongation factor EF-1 alpha Back     alignment and domain information
>PLN03127 Elongation factor Tu; Provisional Back     alignment and domain information
>KOG0781 consensus Signal recognition particle receptor, alpha subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd03688 eIF2_gamma_II eIF2_gamma_II: this subfamily represents the domain II of the gamma subunit of eukaryotic translation initiation factor 2 (eIF2-gamma) found in Eukaryota and Archaea Back     alignment and domain information
>cd01120 RecA-like_NTPases RecA-like NTPases Back     alignment and domain information
>KOG4181 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>TIGR00485 EF-Tu translation elongation factor TU Back     alignment and domain information
>TIGR03499 FlhF flagellar biosynthetic protein FlhF Back     alignment and domain information
>PTZ00121 MAEBL; Provisional Back     alignment and domain information
>PRK12317 elongation factor 1-alpha; Reviewed Back     alignment and domain information
>PF13671 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B Back     alignment and domain information
>cd03692 mtIF2_IVc mtIF2_IVc: this family represents the C2 subdomain of domain IV of mitochondrial translation initiation factor 2 (mtIF2) which adopts a beta-barrel fold displaying a high degree of structural similarity with domain II of the translation elongation factor EF-Tu Back     alignment and domain information
>COG0488 Uup ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1222
1g7s_A594 X-Ray Structure Of Translation Initiation Factor If 4e-99
1g7r_A594 X-Ray Structure Of Translation Initiation Factor If 2e-96
1zo1_I501 If2, If1, And Trna Fitted To Cryo-Em Data Of E. Col 5e-31
2lkc_A178 Free B.St If2-G2 Length = 178 6e-25
3izy_P537 Mammalian Mitochondrial Translation Initiation Fact 1e-19
4ac9_A482 Crystal Structure Of Translation Elongation Factor 7e-09
3vqt_A548 Crystal Structure Analysis Of The Translation Facto 4e-06
3deg_C545 Complex Of Elongating Escherichia Coli 70s Ribosome 4e-06
3cb4_D599 The Crystal Structure Of Lepa Length = 599 4e-06
2ywg_A600 Crystal Structure Of Gtp-Bound Lepa From Aquifex Ae 5e-06
2ywe_A600 Crystal Structure Of Lepa From Aquifex Aeolicus Len 1e-05
3tr5_A528 Structure Of A Peptide Chain Release Factor 3 (Prfc 1e-05
1zun_B434 Crystal Structure Of A Gtp-Regulated Atp Sulfurylas 1e-05
1jny_A435 Crystal Structure Of Sulfolobus Solfataricus Elonga 6e-05
2h5e_A529 Crystal Structure Of E.Coli Polypeptide Release Fac 6e-05
3uoq_W534 Crystal Structure Of Release Factor Rf3 Trapped In 6e-05
1u2r_A 842 Crystal Structure Of Adp-Ribosylated Ribosomal Tran 2e-04
1n0v_C 842 Crystal Structure Of Elongation Factor 2 Length = 8 2e-04
3j25_A638 Structural Basis For Tetm-Mediated Tetracycline Res 3e-04
1xb2_A409 Crystal Structure Of Bos Taurus Mitochondrial Elong 5e-04
>pdb|1G7S|A Chain A, X-Ray Structure Of Translation Initiation Factor If2EIF5B Complexed With Gdp Length = 594 Back     alignment and structure 
Iteration: 1

 Score =  359 bits (922), Expect = 4e-99,   Method: Compositional matrix adjust.
 Identities = 204/594 (34%), Positives = 337/594 (56%), Gaps = 21/594 (3%)
Query: 630  LRSPICCIMGHVDTGKTKLLDCIRGTNVQEGEAGGITQQIGATYFPAENIRERTRELKAN 689
            +RSPI  ++GHVD GKT LLD IRG+ V   EAGGITQ IGAT  P + I     +    
Sbjct: 3    IRSPIVSVLGHVDHGKTTLLDHIRGSAVASREAGGITQHIGATEIPMDVIEGICGDFLKK 62
Query: 690  ATLK--VPGLLVIDTPGHESFTNLRSRGSGLCDIAILVVDIMHGLEPQTIESLNLLKMRN 747
             +++  +PGL  IDTPGHE+FT LR RG  L D+AIL+VDI  G +PQT E+LN+L+M  
Sbjct: 63   FSIRETLPGLFFIDTPGHEAFTTLRKRGGALADLAILIVDINEGFKPQTQEALNILRMYR 122
Query: 748  TEFIVALNKVDRLYGWKTCRNAPIVKAIKQQNTDVQNEFNMRLVQIVTQLKEQGMNTELY 807
            T F+VA NK+DR++GW+     P ++   +Q+  VQ + + ++ ++V +L E+G  +E +
Sbjct: 123  TPFVVAANKIDRIHGWRVHEGRPFMETFSKQDIQVQQKLDTKVYELVGKLHEEGFESERF 182
Query: 808  YKNKDRGETFNIVPTSAISGEGIPDLLLLLVQWTQKTMVEKLTFRNE--LQCTVLEVKVI 865
             +  D     +I+P SAI+GEGIP+LL +L+   Q+ + E+L    +   + T+LEVK  
Sbjct: 183  DRVTDFASQVSIIPISAITGEGIPELLTMLMGLAQQYLREQLKIEEDSPARGTILEVKEE 242
Query: 866  EGHGTTIDVVLVNGVLHEGDQIVVCGLQGPIVTTIRALLTPHPMKELR-VKGTYLHHKQI 924
             G G TID V+ +G+L + D I +   +  I T IR+LL P P++E+R  +  +    ++
Sbjct: 243  TGLGMTIDAVIYDGILRKDDTIAMMTSKDVISTRIRSLLKPRPLEEMRESRKKFQKVDEV 302
Query: 925  KAAQGIKITAQGLEHAIAGTGLYVVGPDDDLEDVKEEAMEDMKSVMSRIDKSGEGVCVQA 984
             AA GIKI A G++  +AG+ L VV    D E V+EE + +++ +  +ID    GV V+A
Sbjct: 303  VAAAGIKIVAPGIDDVMAGSPLRVV---TDPEKVREEILSEIEDI--KIDTDEAGVVVKA 357
Query: 985  STLGSLEALLEFLKSDAVKIPVSGISIGPVHKKDVMRASVMLEKKKEYATILAFDVKVTP 1044
             TLGSLEA+++ L+   + +P+    IG V ++DV+ A + L++ + Y  I+AF+VKV P
Sbjct: 358  DTLGSLEAVVKILRD--MYVPIKVADIGDVSRRDVVNAGIALQEDRVYGAIIAFNVKVIP 415
Query: 1045 EARELAEELGVKIFIADIIYHLFDQFTAYINNLXXXXXXXXXXXXVFPCVLKILPNCVFN 1104
             A +  +   +K+F  ++IY L +++  ++  +            + P  ++++P  VF 
Sbjct: 416  SAAQELKNSDIKLFQGNVIYRLMEEYEEWVRGIEEEKKKKWMEAIIKPASIRLIPKLVFR 475
Query: 1105 KKDPIVLGVDVVEGIAKVGTPICIPQRDFIDIGRIASIENNHKPVDTXXXXXXXXXXXXX 1164
            +  P + GV+V+ G+ + G P+     D   +G + S+++  + + +             
Sbjct: 476  QSKPAIGGVEVLTGVIRQGYPLM--NDDGETVGTVESMQDKGENLKSASRGQKVAMAI-- 531
Query: 1165 SNSEEQQKMFGRHFDIEDELVSHISRKSIDVLKANYRDDLSMDEWRLLVKLKNL 1218
                 +  ++G+     D L   I      +LK     DL+ +E  L+ K+  +
Sbjct: 532  -----KDAVYGKTIHEGDTLYVDIPENHYHILKEQLSGDLTDEELDLMDKIAEI 580
>pdb|1G7R|A Chain A, X-Ray Structure Of Translation Initiation Factor If2EIF5B Length = 594 Back     alignment and structure
>pdb|1ZO1|I Chain I, If2, If1, And Trna Fitted To Cryo-Em Data Of E. Coli 70s Initiation Complex Length = 501 Back     alignment and structure
>pdb|2LKC|A Chain A, Free B.St If2-G2 Length = 178 Back     alignment and structure
>pdb|3IZY|P Chain P, Mammalian Mitochondrial Translation Initiation Factor 2 Length = 537 Back     alignment and structure
>pdb|4AC9|A Chain A, Crystal Structure Of Translation Elongation Factor Selb From Methanococcus Maripaludis In Complex With Gdp Length = 482 Back     alignment and structure
>pdb|3VQT|A Chain A, Crystal Structure Analysis Of The Translation Factor Rf3 Length = 548 Back     alignment and structure
>pdb|3DEG|C Chain C, Complex Of Elongating Escherichia Coli 70s Ribosome And Ef4(Lepa)- Gmppnp Length = 545 Back     alignment and structure
>pdb|3CB4|D Chain D, The Crystal Structure Of Lepa Length = 599 Back     alignment and structure
>pdb|2YWG|A Chain A, Crystal Structure Of Gtp-Bound Lepa From Aquifex Aeolicus Length = 600 Back     alignment and structure
>pdb|2YWE|A Chain A, Crystal Structure Of Lepa From Aquifex Aeolicus Length = 600 Back     alignment and structure
>pdb|3TR5|A Chain A, Structure Of A Peptide Chain Release Factor 3 (Prfc) From Coxiella Burnetii Length = 528 Back     alignment and structure
>pdb|1ZUN|B Chain B, Crystal Structure Of A Gtp-Regulated Atp Sulfurylase Heterodimer From Pseudomonas Syringae Length = 434 Back     alignment and structure
>pdb|1JNY|A Chain A, Crystal Structure Of Sulfolobus Solfataricus Elongation Factor 1 Alpha In Complex With Gdp Length = 435 Back     alignment and structure
>pdb|2H5E|A Chain A, Crystal Structure Of E.Coli Polypeptide Release Factor Rf3 Length = 529 Back     alignment and structure
>pdb|3UOQ|W Chain W, Crystal Structure Of Release Factor Rf3 Trapped In The Gtp State On A Rotated Conformation Of The Ribosome (Without Viomycin) Length = 534 Back     alignment and structure
>pdb|1U2R|A Chain A, Crystal Structure Of Adp-Ribosylated Ribosomal Translocase From Saccharomyces Cerevisiae Length = 842 Back     alignment and structure
>pdb|1N0V|C Chain C, Crystal Structure Of Elongation Factor 2 Length = 842 Back     alignment and structure
>pdb|3J25|A Chain A, Structural Basis For Tetm-Mediated Tetracycline Resistance Length = 638 Back     alignment and structure
>pdb|1XB2|A Chain A, Crystal Structure Of Bos Taurus Mitochondrial Elongation Factor TuTS COMPLEX Length = 409 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1222
1g7s_A594 Translation initiation factor IF2/EIF5B; translati 0.0
3izy_P537 Translation initiation factor IF-2, mitochondrial; 5e-53
1zo1_I501 IF2, translation initiation factor 2; E. coli, rib 2e-47
2lkc_A178 Translation initiation factor IF-2; NMR {Geobacill 3e-39
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-13
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-07
1vt4_I1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-05
1n0u_A 842 EF-2, elongation factor 2; G-protein, CIS-proline, 5e-13
1wb1_A482 Translation elongation factor SELB; selenocysteine 4e-12
1yrb_A262 ATP(GTP)binding protein; GTPase, P-loop, rossman f 1e-11
1g8x_A1010 Myosin II heavy chain fused to alpha-actinin 3; mo 3e-10
1g8x_A1010 Myosin II heavy chain fused to alpha-actinin 3; mo 1e-05
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 4e-09
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 1e-07
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 5e-06
3gdb_A 937 Endo-D, putative uncharacterized protein SPR0440; 9e-09
2zuo_A861 MVP, major vault protein; repeat domains, protein- 9e-08
2zuo_A861 MVP, major vault protein; repeat domains, protein- 2e-06
2elf_A370 Protein translation elongation factor 1A; tRNA, py 2e-07
2ycu_A995 Non muscle myosin 2C, alpha-actinin; motor protein 4e-07
3lvg_D190 LCB, clathrin light chain B; SELF assembly, coated 4e-07
3lvg_D190 LCB, clathrin light chain B; SELF assembly, coated 2e-05
3lvg_D190 LCB, clathrin light chain B; SELF assembly, coated 5e-05
3lvg_D190 LCB, clathrin light chain B; SELF assembly, coated 4e-04
3lvg_D190 LCB, clathrin light chain B; SELF assembly, coated 4e-04
3tr5_A528 RF-3, peptide chain release factor 3; protein synt 4e-07
2h5e_A529 Peptide chain release factor RF-3; beta barrel, tr 4e-07
1zun_B434 Sulfate adenylate transferase, subunit 1/adenylyls 6e-07
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 1e-06
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 2e-06
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 7e-06
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 8e-05
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 2e-04
1z9b_A135 Translation initiation factor IF-2; protein synthe 2e-06
3qq5_A423 Small GTP-binding protein; hydrogenase, H-cluster, 2e-06
2ywe_A600 GTP-binding protein LEPA; G domain, beta-barrel, f 2e-05
3cb4_D599 GTP-binding protein LEPA; GTPase, OB-fold, membran 2e-05
4aco_A956 Centromere DNA-binding protein complex CBF3 subun; 9e-05
1s0u_A408 EIF-2-gamma, translation initiation factor 2 gamma 1e-04
1kk1_A410 EIF2gamma; initiation of translation; HET: GNP; 1. 2e-04
2yhs_A503 FTSY, cell division protein FTSY; cell cycle, prot 2e-04
3mca_A592 HBS1, elongation factor 1 alpha-like protein; prot 4e-04
1f5n_A592 Interferon-induced guanylate-binding protein 1; GB 6e-04
1b6a_A478 Methionine aminopeptidase; angiogenesis inhibitor; 9e-04
>1g7s_A Translation initiation factor IF2/EIF5B; translational GTPase; HET: GDP; 2.00A {Methanothermobacterthermautotrophicus} SCOP: b.43.3.1 b.43.3.1 c.20.1.1 c.37.1.8 PDB: 1g7r_A* 1g7t_A* Length = 594 Back     alignment and structure
 Score =  832 bits (2152), Expect = 0.0
 Identities = 213/596 (35%), Positives = 349/596 (58%), Gaps = 21/596 (3%)

Query: 630  LRSPICCIMGHVDTGKTKLLDCIRGTNVQEGEAGGITQQIGATYFPAENIRERTREL--K 687
            +RSPI  ++GHVD GKT LLD IRG+ V   EAGGITQ IGAT  P + I     +   K
Sbjct: 3    IRSPIVSVLGHVDHGKTTLLDHIRGSAVASREAGGITQHIGATEIPMDVIEGICGDFLKK 62

Query: 688  ANATLKVPGLLVIDTPGHESFTNLRSRGSGLCDIAILVVDIMHGLEPQTIESLNLLKMRN 747
             +    +PGL  IDTPGHE+FT LR RG  L D+AIL+VDI  G +PQT E+LN+L+M  
Sbjct: 63   FSIRETLPGLFFIDTPGHEAFTTLRKRGGALADLAILIVDINEGFKPQTQEALNILRMYR 122

Query: 748  TEFIVALNKVDRLYGWKTCRNAPIVKAIKQQNTDVQNEFNMRLVQIVTQLKEQGMNTELY 807
            T F+VA NK+DR++GW+     P ++   +Q+  VQ + + ++ ++V +L E+G  +E +
Sbjct: 123  TPFVVAANKIDRIHGWRVHEGRPFMETFSKQDIQVQQKLDTKVYELVGKLHEEGFESERF 182

Query: 808  YKNKDRGETFNIVPTSAISGEGIPDLLLLLVQWTQKTMVEKLTFRNE--LQCTVLEVKVI 865
             +  D     +I+P SAI+GEGIP+LL +L+   Q+ + E+L    +   + T+LEVK  
Sbjct: 183  DRVTDFASQVSIIPISAITGEGIPELLTMLMGLAQQYLREQLKIEEDSPARGTILEVKEE 242

Query: 866  EGHGTTIDVVLVNGVLHEGDQIVVCGLQGPIVTTIRALLTPHPMKELR-VKGTYLHHKQI 924
             G G TID V+ +G+L + D I +   +  I T IR+LL P P++E+R  +  +    ++
Sbjct: 243  TGLGMTIDAVIYDGILRKDDTIAMMTSKDVISTRIRSLLKPRPLEEMRESRKKFQKVDEV 302

Query: 925  KAAQGIKITAQGLEHAIAGTGLYVVGPDDDLEDVKEEAMEDMKSVMSRIDKSGEGVCVQA 984
             AA GIKI A G++  +AG+ L VV   + + +     +ED+K     ID    GV V+A
Sbjct: 303  VAAAGIKIVAPGIDDVMAGSPLRVVTDPEKVREEILSEIEDIK-----IDTDEAGVVVKA 357

Query: 985  STLGSLEALLEFLKSDAVKIPVSGISIGPVHKKDVMRASVMLEKKKEYATILAFDVKVTP 1044
             TLGSLEA+++ L+   + +P+    IG V ++DV+ A + L++ + Y  I+AF+VKV P
Sbjct: 358  DTLGSLEAVVKILRD--MYVPIKVADIGDVSRRDVVNAGIALQEDRVYGAIIAFNVKVIP 415

Query: 1045 EARELAEELGVKIFIADIIYHLFDQFTAYINNLKEEKKREAADEAVFPCVLKILPNCVFN 1104
             A +  +   +K+F  ++IY L +++  ++  ++EEKK++  +  + P  ++++P  VF 
Sbjct: 416  SAAQELKNSDIKLFQGNVIYRLMEEYEEWVRGIEEEKKKKWMEAIIKPASIRLIPKLVFR 475

Query: 1105 KKDPIVLGVDVVEGIAKVGTPICIPQRDFIDIGRIASIENNHKPVDTAKKGQKAAIKIAG 1164
            +  P + GV+V+ G+ + G P+     D   +G + S+++  + + +A +GQK A+ I  
Sbjct: 476  QSKPAIGGVEVLTGVIRQGYPLMN--DDGETVGTVESMQDKGENLKSASRGQKVAMAI-- 531

Query: 1165 SNSEEQQKMFGRHFDIEDELVSHISRKSIDVLKANYRDDLSMDEWRLLVKLKNLFK 1220
                 +  ++G+     D L   I      +LK     DL+ +E  L+ K+  + +
Sbjct: 532  -----KDAVYGKTIHEGDTLYVDIPENHYHILKEQLSGDLTDEELDLMDKIAEIKR 582
>3izy_P Translation initiation factor IF-2, mitochondrial; E coli, RNA, ribosomal; 10.80A {Bos taurus} Length = 537 Back     alignment and structure
>1zo1_I IF2, translation initiation factor 2; E. coli, ribosome, initiation of protein synthesis, cryo-eletron microscopy, translation/RNA complex; 13.80A {Escherichia coli} Length = 501 Back     alignment and structure
>2lkc_A Translation initiation factor IF-2; NMR {Geobacillus stearothermophilus} PDB: 2lkd_A* Length = 178 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1n0u_A EF-2, elongation factor 2; G-protein, CIS-proline, translation; HET: SO1; 2.12A {Saccharomyces cerevisiae} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 d.58.11.1 PDB: 1n0v_C 1s1h_T 2e1r_A* 2npf_A* 2p8w_T* 3dny_T 3b82_A* 1zm2_A* 1zm3_A* 1zm4_A* 1zm9_A* 2p8x_T* 2p8y_T* 2p8z_T* 2zit_A* 1u2r_A* 3b78_A* 3b8h_A* Length = 842 Back     alignment and structure
>1wb1_A Translation elongation factor SELB; selenocysteine, protein synthesis, selenium, ribosome; HET: GDP DXC; 3.0A {Methanococcus maripaludis} SCOP: b.43.3.1 b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1wb2_A* 1wb3_A* Length = 482 Back     alignment and structure
>1yrb_A ATP(GTP)binding protein; GTPase, P-loop, rossman fold, GDP, HYDR; HET: GDP; 1.75A {Pyrococcus abyssi} SCOP: c.37.1.10 PDB: 1yr6_A* 1yr8_A* 1yr9_A* 1yra_A* 1yr7_A* 2oxr_A* Length = 262 Back     alignment and structure
>1g8x_A Myosin II heavy chain fused to alpha-actinin 3; motor, lever ARM, protein engineering, structural protein; HET: ADP; 2.80A {Dictyostelium discoideum} SCOP: k.1.1.1 Length = 1010 Back     alignment and structure
>1g8x_A Myosin II heavy chain fused to alpha-actinin 3; motor, lever ARM, protein engineering, structural protein; HET: ADP; 2.80A {Dictyostelium discoideum} SCOP: k.1.1.1 Length = 1010 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 Back     alignment and structure
>3gdb_A Endo-D, putative uncharacterized protein SPR0440; alpha-beta-barrels, cell WALL, peptidoglycan-anchor, secreted, hydrolase; HET: PGE; 1.87A {Streptococcus pneumoniae} PDB: 2xqx_A Length = 937 Back     alignment and structure
>2zuo_A MVP, major vault protein; repeat domains, protein-protein complex, cytoplasm, ribonucleoprotein, structural protein; 3.50A {Rattus norvegicus} PDB: 2zv4_N 2zv5_a 2qzv_A Length = 861 Back     alignment and structure
>2zuo_A MVP, major vault protein; repeat domains, protein-protein complex, cytoplasm, ribonucleoprotein, structural protein; 3.50A {Rattus norvegicus} PDB: 2zv4_N 2zv5_a 2qzv_A Length = 861 Back     alignment and structure
>2elf_A Protein translation elongation factor 1A; tRNA, pyrrolysine, structural genomics, NPPSFA; HET: CIT; 1.70A {Methanosarcina mazei} Length = 370 Back     alignment and structure
>2ycu_A Non muscle myosin 2C, alpha-actinin; motor protein; HET: AOV; 2.25A {Homo sapiens} PDB: 1br1_A* 1br4_A* 1br2_A* Length = 995 Back     alignment and structure
>3lvg_D LCB, clathrin light chain B; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} Length = 190 Back     alignment and structure
>3lvg_D LCB, clathrin light chain B; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} Length = 190 Back     alignment and structure
>3lvg_D LCB, clathrin light chain B; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} Length = 190 Back     alignment and structure
>3lvg_D LCB, clathrin light chain B; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} Length = 190 Back     alignment and structure
>3lvg_D LCB, clathrin light chain B; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} Length = 190 Back     alignment and structure
>3tr5_A RF-3, peptide chain release factor 3; protein synthesis, translation; HET: GDP; 2.11A {Coxiella burnetii} Length = 528 Back     alignment and structure
>2h5e_A Peptide chain release factor RF-3; beta barrel, translation; HET: GDP; 2.80A {Escherichia coli} PDB: 2o0f_A 3sfs_W* 3zvo_Y* 3uoq_W* Length = 529 Back     alignment and structure
>1zun_B Sulfate adenylate transferase, subunit 1/adenylylsulfate kinase; beta barrel, switch domain, heterodimer, pyrophosphate, G protein; HET: GDP AGS; 2.70A {Pseudomonas syringae PV} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 Length = 434 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1z9b_A Translation initiation factor IF-2; protein synthesis translation intiation IF2 FMet-tRNA structure; NMR {Geobacillus stearothermophilus} Length = 135 Back     alignment and structure
>3qq5_A Small GTP-binding protein; hydrogenase, H-cluster, HYDA maturation, GTP-binding domain, maturation enzyme, oxidoreductase; 2.99A {Thermotoga neapolitana} Length = 423 Back     alignment and structure
>2ywe_A GTP-binding protein LEPA; G domain, beta-barrel, ferredoxin-like domain, structural GE NPPSFA; 2.05A {Aquifex aeolicus} PDB: 2ywf_A* 2ywg_A* 2ywh_A* Length = 600 Back     alignment and structure
>3cb4_D GTP-binding protein LEPA; GTPase, OB-fold, membrane, nucleotide-binding, translation; 2.80A {Escherichia coli} PDB: 3deg_C* Length = 599 Back     alignment and structure
>4aco_A Centromere DNA-binding protein complex CBF3 subun; 1.89A {Saccharomyces cerevisiae} Length = 956 Back     alignment and structure
>1s0u_A EIF-2-gamma, translation initiation factor 2 gamma subunit; GTPase, EF-1A, tRNA; 2.40A {Methanocaldococcus jannaschii} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 Length = 408 Back     alignment and structure
>1kk1_A EIF2gamma; initiation of translation; HET: GNP; 1.80A {Pyrococcus abyssi} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1kjz_A* 1kk2_A* 1kk3_A* 1kk0_A* 2d74_A 2dcu_A* Length = 410 Back     alignment and structure
>2yhs_A FTSY, cell division protein FTSY; cell cycle, protein targeting, simibi class GTPase, GTP-BIND membrane, nucleotide-binding; 1.60A {Escherichia coli} PDB: 2qy9_A 2xxa_B* 1fts_A Length = 503 Back     alignment and structure
>3mca_A HBS1, elongation factor 1 alpha-like protein; protein protein complex, translation regulation; 2.74A {Schizosaccharomyces pombe} Length = 592 Back     alignment and structure
>1f5n_A Interferon-induced guanylate-binding protein 1; GBP, GTP hydrolysis, GDP, GMP, dynamin related, large GTPase family. GMPPNP, GPPNHP.; HET: GNP; 1.70A {Homo sapiens} SCOP: a.114.1.1 c.37.1.8 PDB: 1dg3_A* 2b8w_A* 2b92_A* 2bc9_A* 2d4h_A* Length = 592 Back     alignment and structure
>1b6a_A Methionine aminopeptidase; angiogenesis inhibitor; HET: TN4; 1.60A {Homo sapiens} SCOP: a.4.5.25 d.127.1.1 PDB: 1qzy_A* 1boa_A* 1kq0_A 1kq9_A 1bn5_A* 1b59_A* 1yw9_A* 1r5g_A* 1r5h_A* 1r58_A* 1yw8_A* 1yw7_A* 2adu_A* 2ea2_A* 2ea4_A* 2ga2_A* 2oaz_A* Length = 478 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

No hit with probability above 80.00

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 1222
d1g7sa4227 c.37.1.8 (A:1-227) Initiation factor IF2/eIF5b, N- 2e-40
d1g7sa2128 b.43.3.1 (A:460-587) Initiation factor IF2/eIF5b, 6e-39
d1g7sa3131 c.20.1.1 (A:329-459) Initiation factor IF2/eIF5b, 1e-32
d1g7sa1101 b.43.3.1 (A:228-328) Initiation factor IF2/eIF5b, 2e-29
d1yrba1244 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB09 3e-28
d2c78a3204 c.37.1.8 (A:9-212) Elongation factor Tu (EF-Tu), N 2e-20
d2bv3a2276 c.37.1.8 (A:7-282) Elongation factor G (EF-G), N-t 9e-19
d1n0ua2341 c.37.1.8 (A:3-343) Elongation factor 2 (eEF-2), N- 2e-17
d1jnya3224 c.37.1.8 (A:4-227) Elongation factor eEF-1alpha, N 4e-17
d1zunb3222 c.37.1.8 (B:16-237) Sulfate adenylate transferase 3e-16
d1d2ea3196 c.37.1.8 (A:55-250) Elongation factor Tu (EF-Tu), 4e-16
d1f60a3239 c.37.1.8 (A:2-240) Elongation factor eEF-1alpha, N 2e-12
d2qn6a3205 c.37.1.8 (A:2-206) Initiation factor eIF2 gamma su 3e-11
d1kk1a3195 c.37.1.8 (A:6-200) Initiation factor eIF2 gamma su 2e-10
d1r5ba3245 c.37.1.8 (A:215-459) Eukaryotic peptide chain rele 3e-10
d2dy1a2267 c.37.1.8 (A:8-274) Elongation factor G (EF-G), N-t 3e-10
d2es4d1280 a.137.15.1 (D:53-332) Lipase chaperone LifO (LipB) 1e-05
d2es4d1280 a.137.15.1 (D:53-332) Lipase chaperone LifO (LipB) 4e-04
d2es4d1280 a.137.15.1 (D:53-332) Lipase chaperone LifO (LipB) 0.003
d1mkya2186 c.37.1.8 (A:173-358) Probable GTPase Der, N-termin 6e-05
d2cxxa1184 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyroc 6e-05
d1tq4a_400 c.37.1.8 (A:) Interferon-inducible GTPase {Mouse ( 1e-04
d2bmea1174 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [Ta 3e-04
d1puia_188 c.37.1.8 (A:) Probable GTPase EngB {Escherichia co 4e-04
d1wb1a4179 c.37.1.8 (A:1-179) Elongation factor SelB, N-termi 4e-04
d1x3sa1177 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [Ta 4e-04
d2fu5c1173 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [Ta 5e-04
d1wf3a1178 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain { 8e-04
d1sa0e_138 a.137.10.1 (E:) Stathmin 4 {Rat (Rattus norvegicus 0.001
d1f5na1300 a.114.1.1 (A:284-583) Interferon-induced guanylate 0.002
d1g16a_166 c.37.1.8 (A:) Rab-related protein Sec4 {Baker's ye 0.002
d3raba_169 c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxI 0.002
d2bcgy1194 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Sac 0.003
>d1g7sa4 c.37.1.8 (A:1-227) Initiation factor IF2/eIF5b, N-terminal (G) domain {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Length = 227 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Initiation factor IF2/eIF5b, N-terminal (G) domain
species: Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]

 Score =  147 bits (370), Expect = 2e-40
 Identities = 99/222 (44%), Positives = 144/222 (64%), Gaps = 2/222 (0%)

Query: 630 LRSPICCIMGHVDTGKTKLLDCIRGTNVQEGEAGGITQQIGATYFPAENIRERTRELKAN 689
           +RSPI  ++GHVD GKT LLD IRG+ V   EAGGITQ IGAT  P + I     +    
Sbjct: 3   IRSPIVSVLGHVDHGKTTLLDHIRGSAVASREAGGITQHIGATEIPMDVIEGICGDFLKK 62

Query: 690 ATLKVP--GLLVIDTPGHESFTNLRSRGSGLCDIAILVVDIMHGLEPQTIESLNLLKMRN 747
            +++    GL  IDTPGHE+FT LR RG  L D+AIL+VDI  G +PQT E+LN+L+M  
Sbjct: 63  FSIRETLPGLFFIDTPGHEAFTTLRKRGGALADLAILIVDINEGFKPQTQEALNILRMYR 122

Query: 748 TEFIVALNKVDRLYGWKTCRNAPIVKAIKQQNTDVQNEFNMRLVQIVTQLKEQGMNTELY 807
           T F+VA NK+DR++GW+     P ++   +Q+  VQ + + ++ ++V +L E+G  +E +
Sbjct: 123 TPFVVAANKIDRIHGWRVHEGRPFMETFSKQDIQVQQKLDTKVYELVGKLHEEGFESERF 182

Query: 808 YKNKDRGETFNIVPTSAISGEGIPDLLLLLVQWTQKTMVEKL 849
            +  D     +I+P SAI+GEGIP+LL +L+   Q+ + E+L
Sbjct: 183 DRVTDFASQVSIIPISAITGEGIPELLTMLMGLAQQYLREQL 224
>d1g7sa2 b.43.3.1 (A:460-587) Initiation factor IF2/eIF5b, domains 2 and 4 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Length = 128 Back     information, alignment and structure
>d1g7sa3 c.20.1.1 (A:329-459) Initiation factor IF2/eIF5b, domain 3 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Length = 131 Back     information, alignment and structure
>d1g7sa1 b.43.3.1 (A:228-328) Initiation factor IF2/eIF5b, domains 2 and 4 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Length = 101 Back     information, alignment and structure
>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} Length = 244 Back     information, alignment and structure
>d2c78a3 c.37.1.8 (A:9-212) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Length = 204 Back     information, alignment and structure
>d2bv3a2 c.37.1.8 (A:7-282) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Length = 276 Back     information, alignment and structure
>d1n0ua2 c.37.1.8 (A:3-343) Elongation factor 2 (eEF-2), N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 341 Back     information, alignment and structure
>d1jnya3 c.37.1.8 (A:4-227) Elongation factor eEF-1alpha, N-terminal (G) domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Length = 224 Back     information, alignment and structure
>d1zunb3 c.37.1.8 (B:16-237) Sulfate adenylate transferase subunit cysN/C, EF-Tu domain G-like domain {Pseudomonas syringae pv. tomato [TaxId: 323]} Length = 222 Back     information, alignment and structure
>d1d2ea3 c.37.1.8 (A:55-250) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Cow (Bos taurus), mitochondrial [TaxId: 9913]} Length = 196 Back     information, alignment and structure
>d1f60a3 c.37.1.8 (A:2-240) Elongation factor eEF-1alpha, N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 239 Back     information, alignment and structure
>d2qn6a3 c.37.1.8 (A:2-206) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Sulfolobus solfataricus [TaxId: 2287]} Length = 205 Back     information, alignment and structure
>d1kk1a3 c.37.1.8 (A:6-200) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Archaeon Pyrococcus abyssi [TaxId: 29292]} Length = 195 Back     information, alignment and structure
>d1r5ba3 c.37.1.8 (A:215-459) Eukaryotic peptide chain release factor ERF2, G domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 245 Back     information, alignment and structure
>d2dy1a2 c.37.1.8 (A:8-274) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus, EF-G-2 [TaxId: 274]} Length = 267 Back     information, alignment and structure
>d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Length = 186 Back     information, alignment and structure
>d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} Length = 184 Back     information, alignment and structure
>d1tq4a_ c.37.1.8 (A:) Interferon-inducible GTPase {Mouse (Mus musculus) [TaxId: 10090]} Length = 400 Back     information, alignment and structure
>d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} Length = 174 Back     information, alignment and structure
>d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} Length = 188 Back     information, alignment and structure
>d1wb1a4 c.37.1.8 (A:1-179) Elongation factor SelB, N-terminal domain {Methanococcus maripaludis [TaxId: 39152]} Length = 179 Back     information, alignment and structure
>d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} Length = 177 Back     information, alignment and structure
>d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} Length = 173 Back     information, alignment and structure
>d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} Length = 178 Back     information, alignment and structure
>d1sa0e_ a.137.10.1 (E:) Stathmin 4 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 138 Back     information, alignment and structure
>d1f5na1 a.114.1.1 (A:284-583) Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 300 Back     information, alignment and structure
>d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 166 Back     information, alignment and structure
>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 169 Back     information, alignment and structure
>d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 194 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query1222
d1g7sa4227 Initiation factor IF2/eIF5b, N-terminal (G) domain 100.0
d1d2ea3196 Elongation factor Tu (EF-Tu), N-terminal (G) domai 99.96
d2bv3a2276 Elongation factor G (EF-G), N-terminal (G) domain 99.96
d1zunb3222 Sulfate adenylate transferase subunit cysN/C, EF-T 99.96
d2dy1a2267 Elongation factor G (EF-G), N-terminal (G) domain 99.95
d2qn6a3205 Initiation factor eIF2 gamma subunit, N-terminal ( 99.95
d2c78a3204 Elongation factor Tu (EF-Tu), N-terminal (G) domai 99.95
d1f60a3239 Elongation factor eEF-1alpha, N-terminal (G) domai 99.95
d1kk1a3195 Initiation factor eIF2 gamma subunit, N-terminal ( 99.95
d1g7sa3131 Initiation factor IF2/eIF5b, domain 3 {Archaeon Me 99.94
d1r5ba3245 Eukaryotic peptide chain release factor ERF2, G do 99.94
d1g7sa2128 Initiation factor IF2/eIF5b, domains 2 and 4 {Arch 99.94
d1jnya3224 Elongation factor eEF-1alpha, N-terminal (G) domai 99.94
d1n0ua2341 Elongation factor 2 (eEF-2), N-terminal (G) domain 99.93
d1wb1a4179 Elongation factor SelB, N-terminal domain {Methano 99.93
d1svia_195 Probable GTPase EngB {Bacillus subtilis [TaxId: 14 99.82
d2cxxa1184 GTP-binding protein engB {Pyrococcus horikoshii [T 99.82
d1wf3a1178 GTPase Era, N-terminal domain {Thermus thermophilu 99.82
d1mkya1171 Probable GTPase Der, N-terminal and middle domains 99.8
d1mkya2186 Probable GTPase Der, N-terminal and middle domains 99.8
d1yrba1244 ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss 99.76
d1udxa2180 Obg GTP-binding protein middle domain {Thermus the 99.75
d3raba_169 Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} 99.74
d2ew1a1171 Rab30 {Human (Homo sapiens) [TaxId: 9606]} 99.73
d1fzqa_176 ADP-ribosylation factor {Mouse (Mus musculus), ARL 99.72
d2bmea1174 Rab4a {Human (Homo sapiens) [TaxId: 9606]} 99.72
d2fu5c1173 Rab8a {Mouse (Mus musculus) [TaxId: 10090]} 99.72
d1ksha_165 ADP-ribosylation factor {Mouse (Mus musculus), ARL 99.71
d2f7sa1186 Rab27b {Human (Homo sapiens) [TaxId: 9606]} 99.7
d1zd9a1164 ADP-ribosylation factor {Human (Homo sapiens), ARL 99.7
d1z0fa1166 Rab14 {Human (Homo sapiens) [TaxId: 9606]} 99.7
d2gjsa1168 Rad {Human (Homo sapiens) [TaxId: 9606]} 99.7
d1kmqa_177 RhoA {Human (Homo sapiens) [TaxId: 9606]} 99.69
d2bcgy1194 GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisi 99.69
d1moza_182 ADP-ribosylation factor {Baker's yeast (Saccharomy 99.68
d1yzqa1164 Rab6 {Human (Homo sapiens) [TaxId: 9606]} 99.68
d1ky3a_175 Rab-related protein ypt7p {Baker's yeast (Saccharo 99.68
d1e0sa_173 ADP-ribosylation factor {Human (Homo sapiens), ARF 99.67
d1x3sa1177 Rab18 {Human (Homo sapiens) [TaxId: 9606]} 99.67
d1lnza2185 Obg GTP-binding protein middle domain {Bacillus su 99.67
d2fn4a1173 r-Ras {Human (Homo sapiens) [TaxId: 9606]} 99.67
d1i2ma_170 Ran {Human (Homo sapiens) [TaxId: 9606]} 99.66
d1z2aa1164 Rab23 {Mouse (Mus musculus) [TaxId: 10090]} 99.65
d1g16a_166 Rab-related protein Sec4 {Baker's yeast (Saccharom 99.65
d1z0ja1167 Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} 99.65
d2gj8a1161 Probable tRNA modification GTPase TrmE (MnmE), G d 99.65
d1r2qa_170 Rab5a {Human (Homo sapiens) [TaxId: 9606]} 99.65
d1xzpa2160 TrmE GTPase domain {Thermotoga maritima [TaxId: 23 99.64
d2g6ba1170 Rab26 {Human (Homo sapiens) [TaxId: 9606]} 99.64
d2f9la1175 Rab11b {Human (Homo sapiens) [TaxId: 9606]} 99.64
d2ngra_191 CDC42 {Human (Homo sapiens) [TaxId: 9606]} 99.64
d1z08a1167 Rab21 {Human (Homo sapiens) [TaxId: 9606]} 99.64
d1ctqa_166 cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 99.63
d1puia_188 Probable GTPase EngB {Escherichia coli [TaxId: 562 99.63
d1u8za_168 Ras-related protein RalA {Cotton-top tamarin (Sagu 99.63
d1kaoa_167 Rap2a {Human (Homo sapiens) [TaxId: 9606]} 99.63
d2atxa1185 RhoQ {Human (Homo sapiens) [TaxId: 9606]} 99.63
d2a5ja1173 Rab2b {Human (Homo sapiens) [TaxId: 9606]} 99.63
d2erxa1171 di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 99.62
d1c1ya_167 Rap1A {Human (Homo sapiens) [TaxId: 9606]} 99.62
d1mh1a_183 Rac {Human (Homo sapiens) [TaxId: 9606]} 99.62
d1vg8a_184 Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} 99.62
d1d1na_99 Initiation factor IF2/eIF5b, domains 2 and 4 {Baci 99.61
d1nrjb_209 Signal recognition particle receptor beta-subunit 99.61
d1ek0a_170 Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [T 99.6
d2erya1171 r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 99.6
d2fh5b1207 Signal recognition particle receptor beta-subunit 99.6
d1xtqa1167 GTP-binding protein RheB {Human (Homo sapiens) [Ta 99.6
d1wmsa_174 Rab9a {Human (Homo sapiens) [TaxId: 9606]} 99.59
d1x1ra1169 Ras-related protein M-Ras (XRas) {Mouse (Mus muscu 99.58
d2atva1168 Ras-like estrogen-regulated growth inhibitor, RERG 99.58
d1tq4a_400 Interferon-inducible GTPase {Mouse (Mus musculus) 99.58
d1zj6a1177 ADP-ribosylation factor {Human (Homo sapiens), ARL 99.57
d1g7sa1101 Initiation factor IF2/eIF5b, domains 2 and 4 {Arch 99.57
d1egaa1179 GTPase Era, N-terminal domain {Escherichia coli [T 99.56
d2bmja1175 Centaurin gamma 1, G domain {Human (Homo sapiens) 99.56
d1r8sa_160 ADP-ribosylation factor {Human (Homo sapiens), ARF 99.56
d2g3ya1172 GTP-binding protein GEM {Human (Homo sapiens) [Tax 99.55
d2qtvb1166 SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta 99.53
d1upta_169 ADP-ribosylation factor {Human (Homo sapiens), ARL 99.52
d1m7ba_179 RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} 99.51
d1z06a1165 Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} 99.5
d1f6ba_186 SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 99.48
d1svsa1195 Transducin (alpha subunit) {Rat (Rattus norvegicus 99.31
d2bcjq2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 99.29
d2p67a1327 LAO/AO transport system kinase ArgK {Escherichia c 99.24
d1zcba2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 99.23
d2qm8a1323 Metallochaperone MeaB {Methylobacterium extorquens 99.08
d1azta2221 Transducin (alpha subunit) {Cow (Bos taurus) [TaxI 99.07
d1h65a_257 Chloroplast protein translocon GTPase Toc34 {Garde 99.04
d2akab1299 Dynamin G domain {Rat (Rattus norvegicus) [TaxId: 98.95
d1jwyb_306 Dynamin G domain {Dictyostelium discoideum [TaxId: 98.89
d1wxqa1319 GTP-binding protein PH0525 {Pyrococcus horikoshii 98.45
d1jala1278 YchF GTP-binding protein N-terminal domain {Haemop 98.3
d1ni3a1296 YchF GTP-binding protein N-terminal domain {Fissio 98.29
d1f60a194 Elongation factor eEF-1alpha, domain 2 {Baker's ye 98.27
d1efca192 Elongation factor Tu (EF-Tu), domain 2 {Escherichi 98.24
d1puja_273 Probable GTPase YlqF {Bacillus subtilis [TaxId: 14 98.21
d1j8yf2211 GTPase domain of the signal sequence recognition p 98.13
d2bv3a1121 Elongation factor G (EF-G), domain II {Thermus the 98.12
d1d2ea198 Elongation factor Tu (EF-Tu), domain 2 {Cow (Bos t 98.1
d1jnya195 Elongation factor eEF-1alpha, domain 2 {Archaeon S 98.07
d2c78a1100 Elongation factor Tu (EF-Tu), domain 2 {Thermus th 98.06
d2qy9a2211 GTPase domain of the signal recognition particle r 98.05
d1u0la2225 Probable GTPase EngC (YjeQ), C-terminal domain {Th 98.03
d1puja_273 Probable GTPase YlqF {Bacillus subtilis [TaxId: 14 98.02
d1vmaa2213 GTPase domain of the signal recognition particle r 98.02
d1nija1222 Hypothetical protein YjiA, N-terminal domain {Esch 97.97
d1okkd2207 GTPase domain of the signal recognition particle r 97.93
d2dy1a1103 Elongation factor G (EF-G), domain II {Thermus the 97.77
d1wb1a192 Elongation factor SelB, domains 2 and 4 {Methanoco 97.71
d1t9ha2231 Probable GTPase EngC (YjeQ), C-terminal domain {Ba 97.66
d1u0la2225 Probable GTPase EngC (YjeQ), C-terminal domain {Th 97.61
d1xe1a_91 Hypothetical protein PF0907 {Pyrococcus furiosus [ 97.52
d1ls1a2207 GTPase domain of the signal sequence recognition p 97.52
d1r5ba195 Eukaryotic peptide chain release factor ERF2, post 97.41
d1t9ha2231 Probable GTPase EngC (YjeQ), C-terminal domain {Ba 97.34
d1kk1a1121 Initiation factor eIF2 gamma subunit, domain II {A 97.3
d1n0ua1138 Elongation factor 2 (eEF-2), domain II {Baker's ye 97.21
d1zunb192 Sulfate adenylate transferase subunit cysN/C, EF-T 97.08
d1s0ua1118 Initiation factor eIF2 gamma subunit, domain II {A 97.04
d1efca192 Elongation factor Tu (EF-Tu), domain 2 {Escherichi 96.94
d1xe1a_91 Hypothetical protein PF0907 {Pyrococcus furiosus [ 96.93
d1f60a194 Elongation factor eEF-1alpha, domain 2 {Baker's ye 96.91
d1g3qa_237 Cell division regulator MinD {Archaeon Pyrococcus 96.9
d1d2ea198 Elongation factor Tu (EF-Tu), domain 2 {Cow (Bos t 96.72
d2c78a1100 Elongation factor Tu (EF-Tu), domain 2 {Thermus th 96.57
d1jnya195 Elongation factor eEF-1alpha, domain 2 {Archaeon S 96.52
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 96.43
d1r5ba195 Eukaryotic peptide chain release factor ERF2, post 96.32
d1bifa1213 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata 96.27
d1zunb192 Sulfate adenylate transferase subunit cysN/C, EF-T 96.18
d1f5na2277 Interferon-induced guanylate-binding protein 1 (GB 96.17
d2qn6a1114 Initiation factor eIF2 gamma subunit, domain II {S 96.13
d1g7sa2128 Initiation factor IF2/eIF5b, domains 2 and 4 {Arch 96.03
d1s0ua1118 Initiation factor eIF2 gamma subunit, domain II {A 95.9
d1yj5a2172 5' polynucleotide kinase-3' phosphatase, C-termina 95.87
d1kk1a1121 Initiation factor eIF2 gamma subunit, domain II {A 95.81
d1wb1a192 Elongation factor SelB, domains 2 and 4 {Methanoco 95.23
d1np6a_170 Molybdopterin-guanine dinucleotide biosynthesis pr 95.15
d2ak3a1189 Adenylate kinase {Cow (Bos taurus), mitochondrial 94.57
d2qn6a1114 Initiation factor eIF2 gamma subunit, domain II {S 94.56
d1hyqa_232 Cell division regulator MinD {Archaeon Archaeoglob 94.01
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 93.45
d1sxja2253 Replication factor C1 {Baker's yeast (Saccharomyce 93.16
d1xjca_165 Molybdopterin-guanine dinucleotide biosynthesis pr 93.02
d2i3ba1189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 92.99
d2bv3a1121 Elongation factor G (EF-G), domain II {Thermus the 91.42
d1y63a_174 Probable kinase LmjF30.1890 {Leishmania major [Tax 91.39
d2vp4a1197 Deoxyribonucleoside kinase {Fruit fly (Drosophila 90.94
d1rkba_173 Adenylate kinase {Human (Homo sapiens), isoenzyme 90.88
d1l2ta_230 MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 90.79
d1qf9a_194 UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 90.78
d1cr2a_277 Gene 4 protein (g4p, DNA primase), helicase domain 90.63
d2awna2232 Maltose transport protein MalK, N-terminal domain 90.37
d1r0wa_281 Cystic fibrosis transmembrane conductance regulato 90.22
d2pmka1241 Haemolysin B ATP-binding protein {Escherichia coli 90.02
d1sgwa_200 Putative ABC transporter PF0895 {Pyrococcus furios 89.72
d1ji0a_240 Branched chain aminoacid ABC transporter {Thermoto 89.7
d3b60a1253 Multidrug resistance ABC transporter MsbA, C-termi 89.62
d1mv5a_242 Multidrug resistance ABC transporter LmrA, C-termi 89.55
d1v43a3239 Hypothetical protein PH0022, N-terminal domain {Py 89.52
d1jj7a_251 Peptide transporter Tap1, C-terminal ABC domain {H 89.49
d2hyda1255 Putative multidrug export ATP-binding/permease pro 89.23
d2onka1240 Molybdate/tungstate import ATP-binding protein Wtp 89.07
d1g2912240 Maltose transport protein MalK, N-terminal domain 89.0
d1tf7a2242 Circadian clock protein KaiC {Synechococcus sp. st 88.86
d1vpla_238 Putative ABC transporter TM0544 {Thermotoga mariti 88.77
d1uj2a_213 Uridine-cytidine kinase 2 {Human (Homo sapiens) [T 88.75
d1b0ua_258 ATP-binding subunit of the histidine permease {Sal 88.64
d1g6ha_254 MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 88.64
d3dhwc1240 Methionine import ATP-binding protein MetN {Escher 88.61
d1cp2a_269 Nitrogenase iron protein {Clostridium pasteurianum 88.59
d1g6oa_323 Hexameric traffic ATPase, HP0525 {Helicobacter pyl 88.57
d1lw7a2192 Transcriptional regulator NadR, ribosylnicotinamid 88.56
d1zaka1189 Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} 88.53
d1sxje2252 Replication factor C5 {Baker's yeast (Saccharomyce 88.26
d1a7ja_288 Phosphoribulokinase {Rhodobacter sphaeroides [TaxI 88.14
d1l7vc_231 ABC transporter involved in vitamin B12 uptake, Bt 88.04
d1g8pa_333 ATPase subunit of magnesium chelatase, BchI {Rhodo 87.95
d1rz3a_198 Hypothetical protein rbstp0775 {Bacillus stearothe 87.86
d1teva_194 UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] 87.86
d3d31a2229 Sulfate/molybdate ABC transporter, ATP-binding pro 87.72
d1gkya_186 Guanylate kinase {Baker's yeast (Saccharomyces cer 87.63
d1ukza_196 Uridylate kinase {Baker's yeast (Saccharomyces cer 87.39
d2dy1a1103 Elongation factor G (EF-G), domain II {Thermus the 87.3
d1sxjb2224 Replication factor C4 {Baker's yeast (Saccharomyce 87.17
d1kgda_178 Guanylate kinase-like domain of Cask {Human (Homo 87.02
d1knqa_171 Gluconate kinase {Escherichia coli [TaxId: 562]} 86.81
d1lvga_190 Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 86.69
d1odfa_286 Hypothetical protein Ygr205W {Baker's yeast (Sacch 86.65
d1u94a1263 RecA protein, ATPase-domain {Escherichia coli [Tax 86.64
d1m8pa3183 ATP sulfurylase C-terminal domain {Fungus (Penicil 86.47
d1sq5a_308 Pantothenate kinase PanK {Escherichia coli [TaxId: 86.37
d1khta_190 Adenylate kinase {Archaeon Methanococcus voltae [T 86.31
d2iyva1165 Shikimate kinase (AroK) {Mycobacterium tuberculosi 86.24
d2bdta1176 Hypothetical protein BH3686 {Bacillus halodurans [ 86.12
d1ak2a1190 Adenylate kinase {Cow (Bos taurus), mitochondrial 86.05
d1ckea_225 CMP kinase {Escherichia coli [TaxId: 562]} 86.0
d1qhxa_178 Chloramphenicol phosphotransferase {Streptomyces v 85.69
d3adka_194 Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} 85.66
d1fnna2276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 85.46
d1znwa1182 Guanylate kinase {Mycobacterium tuberculosis [TaxI 85.28
d1oxxk2242 Glucose transport protein GlcV, N-terminal domain 85.05
d1s96a_205 Guanylate kinase {Escherichia coli [TaxId: 562]} 84.37
d1uf9a_191 Dephospho-CoA kinase {Thermus thermophilus [TaxId: 84.36
d1q3ta_223 CMP kinase {Streptococcus pneumoniae [TaxId: 1313] 84.15
d1sxjc2227 Replication factor C3 {Baker's yeast (Saccharomyce 83.33
d1zina1182 Adenylate kinase {Bacillus stearothermophilus [Tax 83.06
d1s3ga1182 Adenylate kinase {Bacillus globisporus [TaxId: 145 82.74
d1njfa_239 delta prime subunit of DNA polymerase III, N-domai 82.48
d2cdna1181 Adenylate kinase {Mycobacterium tuberculosis [TaxI 82.26
d1kaga_169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 81.99
d1akya1180 Adenylate kinase {Baker's yeast (Saccharomyces cer 81.72
d1zp6a1176 Hypothetical protein Atu3015 {Agrobacterium tumefa 81.13
d1e4va1179 Adenylate kinase {Escherichia coli [TaxId: 562]} 81.05
g1xew.1329 Smc head domain {Pyrococcus furiosus [TaxId: 2261] 80.82
d1x6va3195 Adenosine-5'phosphosulfate kinase (APS kinase) {Hu 80.76
d1viaa_161 Shikimate kinase (AroK) {Campylobacter jejuni [Tax 80.48
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 80.02
>d1g7sa4 c.37.1.8 (A:1-227) Initiation factor IF2/eIF5b, N-terminal (G) domain {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Initiation factor IF2/eIF5b, N-terminal (G) domain
species: Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]

Probab=100.00  E-value=6.7e-36  Score=259.75  Aligned_cols=222  Identities=45%  Similarity=0.786  Sum_probs=194.1

Q ss_pred             CCCCCEEEEECCCCCCCHHHHHHHCCCCCCCCCCCCEEEEEEEEEEECCCCCCCHHHCCC--CCCCCCCCEEEECCCCCH
Q ss_conf             378988999846887810031001197101255574147520368203321000010113--444456882864499904
Q 000923          629 NLRSPICCIMGHVDTGKTKLLDCIRGTNVQEGEAGGITQQIGATYFPAENIRERTRELKA--NATLKVPGLLVIDTPGHE  706 (1222)
Q Consensus       629 ~~R~~~V~IiG~vdsGKTTLl~~L~~~~v~~~e~~gIT~~ig~~~~~~~~~~~~~~~~~~--~~~~~~~~i~iIDTPGh~  706 (1222)
                      .+|+|+|+|+||+|||||||+++|++......+.+++|.+.+...++.......+.....  ...+....++|+|||||.
T Consensus         2 ~~r~p~IaIiGh~d~GKSTL~~~L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~iDtPGh~   81 (227)
T d1g7sa4           2 KIRSPIVSVLGHVDHGKTTLLDHIRGSAVASREAGGITQHIGATEIPMDVIEGICGDFLKKFSIRETLPGLFFIDTPGHE   81 (227)
T ss_dssp             EECCCEEEEECSTTSSHHHHHHHHHHHHHSCC----CCCBTTEEEEEHHHHHHHSCGGGGGCGGGGTCCEEEEECCCTTS
T ss_pred             CCCCCEEEEEECCCCCHHHHHHHHHHHCCHHEECCCEEEECCCCCCCCCCCCCCCCCCCCCEEECCCCCCCCCCCCCCEE
T ss_conf             98998799996998549999999982366001457454531531232101223444332100110111342234641100


Q ss_pred             HHHHHHHHHCCCCCEEEEEECCCCCCCHHHHHHHHHHHHCCCCEEEEEEEECCCCCCCCCCCCHHHHHHHHHHHHHHHHH
Q ss_conf             45999983114676139984155798753799999988049925999831035567655788038999997559999999
Q 000923          707 SFTNLRSRGSGLCDIAILVVDIMHGLEPQTIESLNLLKMRNTEFIVALNKVDRLYGWKTCRNAPIVKAIKQQNTDVQNEF  786 (1222)
Q Consensus       707 ~f~~~~~~~~~~aD~aILVVDa~~Gv~~qT~e~l~~l~~~~iP~IVviNKiD~~~~w~~~~~a~~~~~l~~q~~~~~~~~  786 (1222)
                      +|...+.+++..||++|||||+.+|+++||.++|.++...++|+||++||||++..|.......+...+..+...++..+
T Consensus        82 ~f~~~~~~~~~~~D~~ilVvda~~g~~~~~~~~~~~~~~~~~p~iivlNK~D~~~~~~~~~~~~~~~~~~~~~~~v~~~~  161 (227)
T d1g7sa4          82 AFTTLRKRGGALADLAILIVDINEGFKPQTQEALNILRMYRTPFVVAANKIDRIHGWRVHEGRPFMETFSKQDIQVQQKL  161 (227)
T ss_dssp             CCTTSBCSSSBSCSEEEEEEETTTCCCHHHHHHHHHHHHTTCCEEEEEECGGGSTTCCCCTTCCHHHHHTTSCHHHHHHH
T ss_pred             CCCCCCHHCCCCCCEEEEEEECCCCCCCCHHHHHHHHHCCCCEEEEEEECCCCCCCHHHHHHHHHHHHHHCCHHHHHHHH
T ss_conf             00011100012464589998612376320257777764379759999989307881455446788875420308889899


Q ss_pred             HHHHHHHHHHHHHCCCCHHHHHCCCCCCCCEEEEECCCCCCCCHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             9999999999998088412331023579841599757877989124899999987887887530
Q 000923          787 NMRLVQIVTQLKEQGMNTELYYKNKDRGETFNIVPTSAISGEGIPDLLLLLVQWTQKTMVEKLT  850 (1222)
Q Consensus       787 ~~~i~~i~~~l~e~Gl~~e~~~~~~~~g~~v~ivpvSA~tG~GI~eLl~~l~~~~~~~l~e~l~  850 (1222)
                      ...+......+...++....++....|...++++|+||++|.||++|++.|..+++.+|.+.|.
T Consensus       162 ~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~i~pvSa~~G~gid~Ll~~l~~l~~~~~~~~l~  225 (227)
T d1g7sa4         162 DTKVYELVGKLHEEGFESERFDRVTDFASQVSIIPISAITGEGIPELLTMLMGLAQQYLREQLK  225 (227)
T ss_dssp             HHHHHHHHHHHHHTTCEEEEGGGCSCTTTEEEEEECCTTTCTTHHHHHHHHHHHHHHHCSGGGE
T ss_pred             HHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCEEEEEECCCCCCHHHHHHHHHHHHHHHHHHHHC
T ss_conf             9999999999998665666512310015777499934898989999999999999999998646
>d1d2ea3 c.37.1.8 (A:55-250) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Cow (Bos taurus), mitochondrial [TaxId: 9913]} Back     information, alignment and structure
>d2bv3a2 c.37.1.8 (A:7-282) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1zunb3 c.37.1.8 (B:16-237) Sulfate adenylate transferase subunit cysN/C, EF-Tu domain G-like domain {Pseudomonas syringae pv. tomato [TaxId: 323]} Back     information, alignment and structure
>d2dy1a2 c.37.1.8 (A:8-274) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus, EF-G-2 [TaxId: 274]} Back     information, alignment and structure
>d2qn6a3 c.37.1.8 (A:2-206) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2c78a3 c.37.1.8 (A:9-212) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1f60a3 c.37.1.8 (A:2-240) Elongation factor eEF-1alpha, N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1kk1a3 c.37.1.8 (A:6-200) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Archaeon Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1g7sa3 c.20.1.1 (A:329-459) Initiation factor IF2/eIF5b, domain 3 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1r5ba3 c.37.1.8 (A:215-459) Eukaryotic peptide chain release factor ERF2, G domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1g7sa2 b.43.3.1 (A:460-587) Initiation factor IF2/eIF5b, domains 2 and 4 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1jnya3 c.37.1.8 (A:4-227) Elongation factor eEF-1alpha, N-terminal (G) domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1n0ua2 c.37.1.8 (A:3-343) Elongation factor 2 (eEF-2), N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wb1a4 c.37.1.8 (A:1-179) Elongation factor SelB, N-terminal domain {Methanococcus maripaludis [TaxId: 39152]} Back     information, alignment and structure
>d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} Back     information, alignment and structure
>d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} Back     information, alignment and structure
>d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} Back     information, alignment and structure
>d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} Back     information, alignment and structure
>d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} Back     information, alignment and structure
>d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i2ma_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} Back     information, alignment and structure
>d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1d1na_ b.43.3.1 (A:) Initiation factor IF2/eIF5b, domains 2 and 4 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tq4a_ c.37.1.8 (A:) Interferon-inducible GTPase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} Back     information, alignment and structure
>d1g7sa1 b.43.3.1 (A:228-328) Initiation factor IF2/eIF5b, domains 2 and 4 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bmja1 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} Back     information, alignment and structure
>d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} Back     information, alignment and structure
>d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1svsa1 c.37.1.8 (A:32-60,A:182-347) Transducin (alpha subunit) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2bcjq2 c.37.1.8 (Q:38-66,Q:184-354) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1azta2 c.37.1.8 (A:35-65,A:202-391) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d2akab1 c.37.1.8 (B:6-304) Dynamin G domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1jwyb_ c.37.1.8 (B:) Dynamin G domain {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1wxqa1 c.37.1.8 (A:1-319) GTP-binding protein PH0525 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1jala1 c.37.1.8 (A:1-278) YchF GTP-binding protein N-terminal domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1ni3a1 c.37.1.8 (A:11-306) YchF GTP-binding protein N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1f60a1 b.43.3.1 (A:241-334) Elongation factor eEF-1alpha, domain 2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1efca1 b.43.3.1 (A:205-296) Elongation factor Tu (EF-Tu), domain 2 {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1puja_ c.37.1.8 (A:) Probable GTPase YlqF {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d2bv3a1 b.43.3.1 (A:283-403) Elongation factor G (EF-G), domain II {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1d2ea1 b.43.3.1 (A:251-348) Elongation factor Tu (EF-Tu), domain 2 {Cow (Bos taurus), mitochondrial [TaxId: 9913]} Back     information, alignment and structure
>d1jnya1 b.43.3.1 (A:228-322) Elongation factor eEF-1alpha, domain 2 {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2c78a1 b.43.3.1 (A:213-312) Elongation factor Tu (EF-Tu), domain 2 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1puja_ c.37.1.8 (A:) Probable GTPase YlqF {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1nija1 c.37.1.10 (A:2-223) Hypothetical protein YjiA, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d2dy1a1 b.43.3.1 (A:275-377) Elongation factor G (EF-G), domain II {Thermus thermophilus, EF-G-2 [TaxId: 274]} Back     information, alignment and structure
>d1wb1a1 b.43.3.1 (A:180-271) Elongation factor SelB, domains 2 and 4 {Methanococcus maripaludis [TaxId: 39152]} Back     information, alignment and structure
>d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1xe1a_ b.43.3.1 (A:) Hypothetical protein PF0907 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1r5ba1 b.43.3.1 (A:460-554) Eukaryotic peptide chain release factor ERF2, post-G domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1kk1a1 b.43.3.1 (A:201-321) Initiation factor eIF2 gamma subunit, domain II {Archaeon Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1n0ua1 b.43.3.1 (A:344-481) Elongation factor 2 (eEF-2), domain II {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1zunb1 b.43.3.1 (B:238-329) Sulfate adenylate transferase subunit cysN/C, EF-Tu domain 2-like domain {Pseudomonas syringae pv. tomato [TaxId: 323]} Back     information, alignment and structure
>d1s0ua1 b.43.3.1 (A:230-347) Initiation factor eIF2 gamma subunit, domain II {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1efca1 b.43.3.1 (A:205-296) Elongation factor Tu (EF-Tu), domain 2 {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xe1a_ b.43.3.1 (A:) Hypothetical protein PF0907 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1f60a1 b.43.3.1 (A:241-334) Elongation factor eEF-1alpha, domain 2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1g3qa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1d2ea1 b.43.3.1 (A:251-348) Elongation factor Tu (EF-Tu), domain 2 {Cow (Bos taurus), mitochondrial [TaxId: 9913]} Back     information, alignment and structure
>d2c78a1 b.43.3.1 (A:213-312) Elongation factor Tu (EF-Tu), domain 2 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1jnya1 b.43.3.1 (A:228-322) Elongation factor eEF-1alpha, domain 2 {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1r5ba1 b.43.3.1 (A:460-554) Eukaryotic peptide chain release factor ERF2, post-G domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1zunb1 b.43.3.1 (B:238-329) Sulfate adenylate transferase subunit cysN/C, EF-Tu domain 2-like domain {Pseudomonas syringae pv. tomato [TaxId: 323]} Back     information, alignment and structure
>d1f5na2 c.37.1.8 (A:7-283) Interferon-induced guanylate-binding protein 1 (GBP1), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2qn6a1 b.43.3.1 (A:207-320) Initiation factor eIF2 gamma subunit, domain II {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1g7sa2 b.43.3.1 (A:460-587) Initiation factor IF2/eIF5b, domains 2 and 4 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1s0ua1 b.43.3.1 (A:230-347) Initiation factor eIF2 gamma subunit, domain II {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1kk1a1 b.43.3.1 (A:201-321) Initiation factor eIF2 gamma subunit, domain II {Archaeon Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1wb1a1 b.43.3.1 (A:180-271) Elongation factor SelB, domains 2 and 4 {Methanococcus maripaludis [TaxId: 39152]} Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d2qn6a1 b.43.3.1 (A:207-320) Initiation factor eIF2 gamma subunit, domain II {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1hyqa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bv3a1 b.43.3.1 (A:283-403) Elongation factor G (EF-G), domain II {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} Back     information, alignment and structure
>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Back     information, alignment and structure
>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1cp2a_ c.37.1.10 (A:) Nitrogenase iron protein {Clostridium pasteurianum [TaxId: 1501]} Back     information, alignment and structure
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} Back     information, alignment and structure
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Back     information, alignment and structure
>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2dy1a1 b.43.3.1 (A:275-377) Elongation factor G (EF-G), domain II {Thermus thermophilus, EF-G-2 [TaxId: 274]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} Back     information, alignment and structure
>d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure