Citrus Sinensis ID: 000940
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
|
|
Close Homologs for Annotation Transfer
Close Homologs in SWISS-PROT Database Detected by BLAST 
Original result of BLAST against SWISS-PROT Database
| ID | Alignment graph | Length |
Definition |
RBH(Q2H) |
RBH(H2Q) |
Q cover |
H cover |
Identity |
E-value |
| Query | 1216 | 2.2.26 [Sep-21-2011] | |||||||
| Q9HGL2 | 1116 | Uncharacterized calcium-b | yes | no | 0.074 | 0.081 | 0.380 | 4e-16 | |
| Q96D71 | 796 | RalBP1-associated Eps dom | yes | no | 0.092 | 0.140 | 0.379 | 1e-12 | |
| O54916 | 795 | RalBP1-associated Eps dom | yes | no | 0.096 | 0.147 | 0.352 | 2e-12 | |
| Q75AA0 | 1248 | Actin cytoskeleton-regula | yes | no | 0.129 | 0.125 | 0.319 | 1e-11 | |
| Q15811 | 1721 | Intersectin-1 OS=Homo sap | no | no | 0.138 | 0.097 | 0.287 | 5e-11 | |
| A6S9N4 | 1444 | Actin cytoskeleton-regula | N/A | no | 0.078 | 0.065 | 0.364 | 6e-11 | |
| Q80XA6 | 521 | RalBP1-associated Eps dom | no | no | 0.076 | 0.178 | 0.372 | 1e-10 | |
| Q8NFH8 | 660 | RalBP1-associated Eps dom | no | no | 0.084 | 0.156 | 0.365 | 1e-10 | |
| A4R8N4 | 1462 | Actin cytoskeleton-regula | N/A | no | 0.076 | 0.063 | 0.372 | 1e-10 | |
| Q6BNL1 | 1449 | Actin cytoskeleton-regula | yes | no | 0.228 | 0.191 | 0.274 | 2e-10 |
| >sp|Q9HGL2|YHLA_SCHPO Uncharacterized calcium-binding protein C800.10c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC800.10c PE=4 SV=1 | Back alignment and function desciption |
|---|
Score = 88.2 bits (217), Expect = 4e-16, Method: Compositional matrix adjust.
Identities = 35/92 (38%), Positives = 62/92 (67%), Gaps = 1/92 (1%)
Query: 429 PWPKMTHSEVQKYTKVFVQVDIDRDGKITGEQAYNLFLSWRLPREVLKQVWDLSDQDNDG 488
PW + ++ + ++F VD G ++G +AY+ FL+ +LP +VL Q+WDLSD +++G
Sbjct: 252 PW-AIPSQDLTSFCQLFSNVDKAHKGYVSGSEAYSFFLASKLPEDVLAQIWDLSDTNSNG 310
Query: 489 MLSLKEFCTALYLMERYREGRPLPTMLPSTIM 520
L++ EFC +LYL++ G+ LP +LPS+++
Sbjct: 311 KLNIGEFCISLYLIKLKLSGKELPKVLPSSML 342
|
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (taxid: 284812) |
| >sp|Q96D71|REPS1_HUMAN RalBP1-associated Eps domain-containing protein 1 OS=Homo sapiens GN=REPS1 PE=1 SV=3 | Back alignment and function description |
|---|
| >sp|O54916|REPS1_MOUSE RalBP1-associated Eps domain-containing protein 1 OS=Mus musculus GN=Reps1 PE=1 SV=2 | Back alignment and function description |
|---|
| >sp|Q75AA0|PAN1_ASHGO Actin cytoskeleton-regulatory complex protein PAN1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=PAN1 PE=3 SV=2 | Back alignment and function description |
|---|
| >sp|Q15811|ITSN1_HUMAN Intersectin-1 OS=Homo sapiens GN=ITSN1 PE=1 SV=3 | Back alignment and function description |
|---|
| >sp|A6S9N4|PAN1_BOTFB Actin cytoskeleton-regulatory complex protein pan1 OS=Botryotinia fuckeliana (strain B05.10) GN=pan1 PE=3 SV=1 | Back alignment and function description |
|---|
| >sp|Q80XA6|REPS2_MOUSE RalBP1-associated Eps domain-containing protein 2 OS=Mus musculus GN=Reps2 PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|Q8NFH8|REPS2_HUMAN RalBP1-associated Eps domain-containing protein 2 OS=Homo sapiens GN=REPS2 PE=1 SV=2 | Back alignment and function description |
|---|
| >sp|A4R8N4|PAN1_MAGO7 Actin cytoskeleton-regulatory complex protein PAN1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=PAN1 PE=3 SV=2 | Back alignment and function description |
|---|
| >sp|Q6BNL1|PAN1_DEBHA Actin cytoskeleton-regulatory complex protein PAN1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=PAN1 PE=3 SV=2 | Back alignment and function description |
|---|
Close Homologs in the Non-Redundant Database Detected by BLAST
Original result of BLAST against Nonredundant Database
| GI | Alignment Graph | Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 1216 | ||||||
| 359474793 | 1089 | PREDICTED: uncharacterized protein LOC10 | 0.848 | 0.947 | 0.480 | 0.0 | |
| 147810085 | 1120 | hypothetical protein VITISV_043723 [Viti | 0.852 | 0.925 | 0.476 | 0.0 | |
| 224081495 | 896 | predicted protein [Populus trichocarpa] | 0.712 | 0.966 | 0.578 | 0.0 | |
| 449500203 | 1112 | PREDICTED: uncharacterized protein LOC10 | 0.882 | 0.964 | 0.477 | 0.0 | |
| 449454416 | 1110 | PREDICTED: LOW QUALITY PROTEIN: uncharac | 0.882 | 0.966 | 0.475 | 0.0 | |
| 297845134 | 1222 | calcium-binding EF hand family protein [ | 0.895 | 0.891 | 0.474 | 0.0 | |
| 356553423 | 1037 | PREDICTED: uncharacterized protein LOC10 | 0.824 | 0.967 | 0.452 | 0.0 | |
| 42562225 | 1218 | calcium-binding EF-hand-containing prote | 0.898 | 0.896 | 0.459 | 0.0 | |
| 356499525 | 994 | PREDICTED: uncharacterized protein LOC10 | 0.794 | 0.971 | 0.444 | 0.0 | |
| 334182746 | 1247 | calcium-binding EF-hand-containing prote | 0.898 | 0.875 | 0.448 | 0.0 |
| >gi|359474793|ref|XP_003631533.1| PREDICTED: uncharacterized protein LOC100854676 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 1032 bits (2669), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 610/1269 (48%), Positives = 748/1269 (58%), Gaps = 237/1269 (18%)
Query: 2 AGQTATNSDLFEAYFRRADLDGDGQISGAEAVAFFQGSNLPKQVLAQVWSHADQRKAGFL 61
A A N DLF+AYFRRADLD DG+ISG+EAVAFFQ +NLPK VLAQ+W++AD + GFL
Sbjct: 4 AQNQAPNVDLFDAYFRRADLDRDGRISGSEAVAFFQTTNLPKHVLAQIWTYADHNRIGFL 63
Query: 62 NRAEFFNALKLVTVAQSKRELTPDIVKAALYGPASARIPAPQINLAAMPSSHSRVGAPAS 121
RAEF+NALKLVTVAQSKRELTPDIVKAALYGPA+A+IPAPQINLAA P+ + +
Sbjct: 64 GRAEFYNALKLVTVAQSKRELTPDIVKAALYGPAAAKIPAPQINLAAAPTQMNTAAPAPA 123
Query: 122 QVS------GAPSP---QNVSVRGPQGLGNASTNQQSPPSQSNHFVRTPQAVLPGTTLHP 172
G+ +P QN VRGPQG +A+ NQQ P Q N +R P LPG+ P
Sbjct: 124 PAPASVAPMGSVAPTASQNFGVRGPQGPISANVNQQYFPPQGNQLMR-PTQTLPGSASLP 182
Query: 173 QQVLSGQSMPSGGTMTAPRPPTSNVSTDWLGGSTVSPLAGSTTQLPNRGSSPSLPQEGFG 232
Q + Q P GGTM R P S++S D +
Sbjct: 183 AQGAAVQGFPGGGTMAGMRLPNSSISNDLV------------------------------ 212
Query: 233 LPASSLAPSVQPRPPITSGGRAGSPLAGTTSQVSDRGISASSTLDRFGLPASSVAPSVQP 292
GGR G G SQV RG+S S + D FG+ S + SV
Sbjct: 213 ------------------GGRTGGAPTGIISQVPIRGVSPSMSQDGFGVSPSGLTASVPS 254
Query: 293 RPPGTSAQTPATAPKPQAPDSKSLVVSGNGFSSDSLFG-DVFSASPVQPKQDVAI----S 347
+P +S T+ +P A +SK++ V+GNGF+S+S+FG DVFSASP Q KQD ++ S
Sbjct: 255 KPQVSSG---ITSLEPAAKNSKAMDVTGNGFASESIFGGDVFSASPSQLKQDSSVHTSSS 311
Query: 348 GSVPTSTASVPASPAPKPSLKAGPVEPVQHAFSQPPVGGQYQQGQSAGKQNQQFAVKSTP 407
G+ P S++ P S PS+K+ ++ +Q + PVGGQ QQ Q KQNQQ +++
Sbjct: 312 GNAPISSSIAPVSSGALPSVKSRALDSLQSSPMIQPVGGQLQQAQPLSKQNQQVPTQNSS 371
Query: 408 AAASTGFPIGALNSTSSQSHVPWPKMTHSEVQKYTKVFVQVDIDRDGKITGEQAYNLFLS 467
A S G +G N+ SSQS +PWP++T S++QKYTKVFV VD DRDGKITGEQA NLFLS
Sbjct: 372 AFISAGISLGTENTASSQSQLPWPRITQSDIQKYTKVFVAVDTDRDGKITGEQARNLFLS 431
Query: 468 WRLPREVLKQVWDLSDQDNDGMLSLKEFCTALYLMERYREGRPLPTMLPSTIMPDEALFS 527
WRLPREVLKQVWDLSDQDND MLSL+EFCTALYLMERYR+GRPLP +LPS+I D F
Sbjct: 432 WRLPREVLKQVWDLSDQDNDSMLSLREFCTALYLMERYRDGRPLPAVLPSSIFAD---FP 488
Query: 528 TTSQPQAPHVSGTWGPVAGVQQPHASRPPTGKPPRPFPVPQADRSVQTTPQKSKVPELEK 587
TT QP A + PV+G + H + G+PP P +AD QT QKSKVP LEK
Sbjct: 489 TTVQPMAGY---GRMPVSGAR--HVTPAMGGRPPLPH---RADEGKQTNQQKSKVPVLEK 540
Query: 588 HLMDQLSKEEQESLNAKLKEATEADKKVEELEKEILTSREKIQFCSTKMQELILYKSRCD 647
H ++QLSKEEQ+ LN K +EA +A+KKVEELEKEIL S+EKI+FC TKMQEL+LYKSRCD
Sbjct: 541 HFVNQLSKEEQDMLNTKFREAADANKKVEELEKEILDSKEKIEFCRTKMQELVLYKSRCD 600
Query: 648 NRLNEITERVSGDKREVELLAKKYEEKYKQSGDVASKLTLEEATFRDIQEKKMELYQAIL 707
NRLNEI ERV+ DKRE E LAKKYEEKYKQSGDVASKLT+EEATFRDIQE+KMELYQAIL
Sbjct: 601 NRLNEIIERVAADKREAEALAKKYEEKYKQSGDVASKLTIEEATFRDIQERKMELYQAIL 660
Query: 708 KMEGE-SGDGTLQQHADHIQNELEELVKILNDRCKQYGLRAKPTLLVELPFGWQPGIQEG 766
KME S D ++Q AD IQ++L+ELVK LN+RCK+YGL KPT LVELPFGWQ GIQEG
Sbjct: 661 KMEENGSADESIQVRADRIQSDLDELVKALNERCKKYGLYVKPTTLVELPFGWQLGIQEG 720
Query: 767 TADWDEDWDKLEDEGFTFVKELTLEVQNVVAPPKPKSSSVKNETSSNKHDATASSSNIDS 826
ADWDEDWDK E+EG+ FVKELTL+VQN +APPKPKS V E +S TA+SS++D
Sbjct: 721 AADWDEDWDKFEEEGYVFVKELTLDVQNAIAPPKPKSMPVDKEKASTAETPTAASSSVDV 780
Query: 827 KSEKDASEGKDATEEKGA-SKEKDAS----------------------KGEEISENEP-- 861
KSE S G+ E A S+ +D S E P
Sbjct: 781 KSEDPPSMGERVVENGSAYSQTEDYSARSPGSSPLARVAMERSPAGSPAARTAMERSPVG 840
Query: 862 ------AHEQNEDG-------LARGRPNSSAGSGATENQSKEVQDFQIMKDIGADGSPQA 908
A E++ G R S A A ++ S+E D K D SP A
Sbjct: 841 SPAARAAFERSPAGSPAARTAFERSPAGSPAARPAFDSPSREFLDSHFFKPFSEDASPHA 900
Query: 909 KETQSDEVGPESVFSGNKGFDEPSWGTFDTHYDAESVWGFDTDN-SKEAAHDQHLDSSMF 967
K+TQSD G +S SG+K FDEP+WG FDT+ D ES+WG ++ + + H++H ++ F
Sbjct: 901 KDTQSDYGGADSFLSGDKSFDEPTWGKFDTNDDMESIWGMNSIGATSKMDHERHTENYFF 960
Query: 968 GLDDFNIKPIKTELFHSNNLFPGKSSSIFADSVPSTPAYSITNSPRRFSAGPDDYSFDKG 1027
G D+F++KPI+TE ++ FP KS+ F DSVPSTP YSI+NSP RF+ G
Sbjct: 961 G-DEFDLKPIRTESSQASGSFPKKSTFTFDDSVPSTPLYSISNSPSRFNEG--------- 1010
Query: 1028 KSPFIFADSVPSTPAYNFGNSPRRFSGGSEDHSFDNLSRFDSFNMHDGGLFQSPSHSLSR 1087
+HSFD SRFDSF HD G FQ P +L+R
Sbjct: 1011 -----------------------------SEHSFDPFSRFDSFKSHDSGFFQ-PRETLAR 1040
Query: 1088 FDSVHSTRDSDPNYGLSSRFDSFNARDNSFNARDSGFFQSQNSLARFDSMRSTKDFDHGH 1147
FDS+ ST D D +G
Sbjct: 1041 FDSMRSTADYDHGHG--------------------------------------------- 1055
Query: 1148 GFPAFESFDDTDPFGTTGPSNSKTSVDTPRNGSGVLAFDDTDPFGSTGPFKTSVESNTQK 1207
FP S DD+DPFGT GPFKTS++S T +
Sbjct: 1056 -FP---SSDDSDPFGT-------------------------------GPFKTSLDSQTPR 1080
Query: 1208 RSSDNWNAF 1216
R SDNW+AF
Sbjct: 1081 RGSDNWSAF 1089
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|147810085|emb|CAN64708.1| hypothetical protein VITISV_043723 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|224081495|ref|XP_002306434.1| predicted protein [Populus trichocarpa] gi|222855883|gb|EEE93430.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|449500203|ref|XP_004161034.1| PREDICTED: uncharacterized protein LOC101230942 [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|449454416|ref|XP_004144951.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC101213771 [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|297845134|ref|XP_002890448.1| calcium-binding EF hand family protein [Arabidopsis lyrata subsp. lyrata] gi|297336290|gb|EFH66707.1| calcium-binding EF hand family protein [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|356553423|ref|XP_003545056.1| PREDICTED: uncharacterized protein LOC100794495 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|42562225|ref|NP_173582.2| calcium-binding EF-hand-containing protein [Arabidopsis thaliana] gi|332192007|gb|AEE30128.1| calcium-binding EF-hand-containing protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|356499525|ref|XP_003518590.1| PREDICTED: uncharacterized protein LOC100793159 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|334182746|ref|NP_001185056.1| calcium-binding EF-hand-containing protein [Arabidopsis thaliana] gi|332192008|gb|AEE30129.1| calcium-binding EF-hand-containing protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST
Original result of BLAST against Gene Ontology (AMIGO)
| ID |
Alignment graph |
Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 1216 | ||||||
| TAIR|locus:2030432 | 1019 | AT1G20760 [Arabidopsis thalian | 0.721 | 0.860 | 0.336 | 3e-101 | |
| RGD|1305550 | 792 | Eps15 "epidermal growth factor | 0.083 | 0.127 | 0.339 | 1.1e-27 | |
| UNIPROTKB|E9PSY8 | 792 | Eps15 "Protein Eps15" [Rattus | 0.083 | 0.127 | 0.339 | 7.3e-26 | |
| UNIPROTKB|F1NLF0 | 919 | EPS15 "Uncharacterized protein | 0.231 | 0.305 | 0.234 | 5.5e-20 | |
| POMBASE|SPBC800.10c | 1116 | SPBC800.10c "EPS15 repeat fami | 0.116 | 0.127 | 0.306 | 7.8e-25 | |
| UNIPROTKB|F1MA55 | 885 | Eps15 "Protein Eps15" [Rattus | 0.083 | 0.114 | 0.339 | 8.6e-25 | |
| UNIPROTKB|F1S6G0 | 911 | EPS15 "Uncharacterized protein | 0.091 | 0.121 | 0.321 | 1e-24 | |
| UNIPROTKB|E1C8N9 | 921 | EPS15 "Uncharacterized protein | 0.231 | 0.305 | 0.234 | 1.4e-19 | |
| ZFIN|ZDB-GENE-081104-264 | 1039 | eps15 "epidermal growth factor | 0.544 | 0.637 | 0.224 | 2.8e-19 | |
| ZFIN|ZDB-GENE-060503-274 | 915 | eps15l1a "epidermal growth fac | 0.083 | 0.111 | 0.346 | 5.2e-23 |
| TAIR|locus:2030432 AT1G20760 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 1004 (358.5 bits), Expect = 3.0e-101, P = 3.0e-101
Identities = 314/934 (33%), Positives = 427/934 (45%)
Query: 189 APRP-PTSNV--STDWLGGSTVSPLAGSTTQLPNRGSSPSLPQEGF-GLPASSLAPSVQP 244
APRP P + GG + P + + P +G GL +SL P+ P
Sbjct: 110 APRPNPAATTVGPVSGFGGPGAPNAIVNQNYFPPQQNQQMRPNQGISGL--TSLRPAAGP 167
Query: 245 --RPPITSGGRAGSPLAGTTS--QVSDRGISA--SSTLDRFGLPASSVAPSVQPRP--PG 296
RP SG P+ T Q +S SST + L A + S G
Sbjct: 168 EYRPSALSGQFQPVPVGSVTHPPQPVPTSVSGPGSSTFNLNSLYAGAGNTSGYSSGFGGG 227
Query: 297 TSXXXXXXXXXXXXXDSKSLVVSGNGFSSDSLFGDVFSASPVQPKQDVAISGXXXXXXXX 356
+ D K+LVVSGNG GD+FS+ Q KQ+ +S
Sbjct: 228 SLAAPSPGLKQESHIDPKALVVSGNG-------GDMFSS--FQQKQEPTLSNSSISSAIV 278
Query: 357 XXXXXXXXXXXXXGPVEPVQHAFSQPPVXXXXXXXXXXXXXXXXFAVKSTPAAASTGFPI 416
++ +Q FS P + + + G +
Sbjct: 279 PTSAGIQPPTKPNA-LDSLQSTFSMLPSGNQLQQPRPAASSQPAVSSQGPSSGLPPGSAV 337
Query: 417 GALNST-SSQSHVPWPKMTHSEVQKYTKVFVQVDIDRDGKITGEQAYNLFLSWRLPREVL 475
G+ +ST + + PWPKM S+VQKYTKVF++VD D+DGKITGEQA NLFLSWRLPREVL
Sbjct: 338 GSGHSTPAGNNQPPWPKMKPSDVQKYTKVFMEVDSDKDGKITGEQARNLFLSWRLPREVL 397
Query: 476 KQVWDLSDQDNDGMLSLKEFCTALYLMERYREGRPLPTMLPSTIMPDEALFSTTSQPQAP 535
K VW+LSDQDND MLSL+EFC +LYLMERYREGRPLPT LPS+IM DE L S + P
Sbjct: 398 KHVWELSDQDNDTMLSLREFCISLYLMERYREGRPLPTALPSSIMFDETLLSISGAPSHG 457
Query: 536 HVSGTWGPVAG-VQQPH-ASRXXXXXXXXX----XXXXQADRSVQTTPQKSKVPELEKHL 589
+ + WG G VQQP +R Q + +++ P L+
Sbjct: 458 YANAGWGSGQGFVQQPGMGARPITPTTGMRPPVPAPGPQPGSGIPPNQPRNQAPVLDAPF 517
Query: 590 MDQLSKEEQESLNAKLKEATEADKKVEELEKEILTSREKIQFCSTKMQELILYKSRCDNR 649
+ L S N L EA ++KV+E + + SREK+ + TKMQ+++LYKSRCDNR
Sbjct: 518 ANHLGNGYSASSN--LPEAAADEEKVDEKQNAYMDSREKLDYYRTKMQDIVLYKSRCDNR 575
Query: 650 LNEITERVSGDKREVELLAXXXXXXXXQSGDVASKLTLEEATFRDIQEKKMELYQAILKM 709
LNEI+ER S DKRE E LA Q ++ SKLT+EEA FR+I+ +KMEL QAI+ M
Sbjct: 576 LNEISERASADKREAETLAKKYEEKYKQVAEIGSKLTIEEARFREIEGRKMELSQAIVNM 635
Query: 710 E-GESGDGTLQQHADHIQNELEELVKILNDRCKQYGLRAKPTLLVELPFGWQPGIQEGTA 768
E G S DG LQ AD IQ++LEEL+K L +RCK++GL LV+LP GWQPGIQEG A
Sbjct: 636 EQGGSADGLLQVRADRIQSDLEELMKALTERCKKHGLEVNSKALVDLPAGWQPGIQEGAA 695
Query: 769 XXXXXXXXXXXXGFTFVKELTLEVQNVVAPPKPKSSSVKNETSSNKHDATASSSNIDSKS 828
GF E+T + K + ++ S T N S
Sbjct: 696 LWDEEWDKFEDEGFG--NEITFDKSKEQNSSGEKENGTVDDGSGPPDSPTHVEDNYGPFS 753
Query: 829 EKDASEGKDATEEKGASKEKDAS-KGEEISENE---PAHEQNEDGLARGRPNSSAGSGAT 884
E + + E G + +D S + +S N P+ + ++ + +S+ S
Sbjct: 754 E---TSDRHHESEYGTTHSEDRSPRDSPVSRNATEVPSPDYSQGKNSEFFDDSNWASAFD 810
Query: 885 ENQSKE-VQDFQIMKDIGADGSPQAKETQSDEVGPESVFSGNKGFDEPSWGTFDTHYDAE 943
N + V F K D + + +S S + G S FD +
Sbjct: 811 TNDDVDSVWGFDASKSQDGDYFGSGDDFGGNTARADSPSSRSFGAQRKSQFAFDDSVPST 870
Query: 944 SVWGFDTDN---SKEAAHDQHLDS-SMFGLDDFNIKPIKTELFHSNNLFPGKSSSIFADS 999
+ F S +A D + DS S F D FN F S + SI +
Sbjct: 871 PLSRFGNSPPRFSDASARDNNFDSFSRF--DSFNTSEAGAG-FSSQPERLSRFDSINSSK 927
Query: 1000 VPSTPAYSITNS--PRRFSAGPDDYS-FDKGKSPFIFADSVPSTPAYNFGNSPRRFSGGS 1056
A+S +S R G + +S FD S F PS ++ NS + FSG S
Sbjct: 928 DFGGAAFSRFDSINSSRDVTGAEKFSRFDSINSSKDFGG--PSLSRFDSMNSTKDFSG-S 984
Query: 1057 EDHSFDNLSRFDSFNMHDGGLFQSPSHSLSRFDS 1090
+SFD+ F S +SP+ ++S
Sbjct: 985 HGYSFDDADPFGSTGPFKVSSDESPTKRSDNWNS 1018
|
|
| RGD|1305550 Eps15 "epidermal growth factor receptor pathway substrate 15" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E9PSY8 Eps15 "Protein Eps15" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NLF0 EPS15 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| POMBASE|SPBC800.10c SPBC800.10c "EPS15 repeat family actin cortical patch component (predicted)" [Schizosaccharomyces pombe (taxid:4896)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1MA55 Eps15 "Protein Eps15" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1S6G0 EPS15 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1C8N9 EPS15 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-081104-264 eps15 "epidermal growth factor receptor pathway substrate 15" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-060503-274 eps15l1a "epidermal growth factor receptor pathway substrate 15-like 1a" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Annotation Transfer from SWISS-PROT Entries
Original result of BLAST against SWISS-PROT
No confident hit for EC number transfering in SWISSPROT detected by BLAST
EC Number Prediction by Ezypred Server
Original result from Ezypred Server
Fail to connect to Ezypred Server
EC Number Prediction by EFICAz Software
No EC number assignment, probably not an enzyme!
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING
Original result from the STRING server
 |
 |
 |
 |
 |
 |
 |
 |
 |
 | GSVIVG00036278001 | SubName- Full=Chromosome chr3 scaffold_8, whole genome shotgun sequence; (1015 aa) | ||||||
(Vitis vinifera) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST
Original result of RPS-BLAST against CDD database part I
| ID | Alignment Graph | Length |
Definition |
E-value |
| Query | 1216 | |||
| cd00052 | 67 | cd00052, EH, Eps15 homology domain; found in prote | 9e-23 | |
| cd00052 | 67 | cd00052, EH, Eps15 homology domain; found in prote | 4e-22 | |
| smart00027 | 96 | smart00027, EH, Eps15 homology domain | 7e-22 | |
| smart00027 | 96 | smart00027, EH, Eps15 homology domain | 1e-15 | |
| pfam12763 | 104 | pfam12763, efhand_3, Cytoskeletal-regulatory compl | 2e-12 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 3e-07 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 1e-06 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 1e-06 | |
| PHA03247 | 3151 | PHA03247, PHA03247, large tegument protein UL36; P | 3e-06 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 4e-06 | |
| PHA03247 | 3151 | PHA03247, PHA03247, large tegument protein UL36; P | 9e-06 | |
| COG0419 | 908 | COG0419, SbcC, ATPase involved in DNA repair [DNA | 1e-05 | |
| PHA03307 | 1352 | PHA03307, PHA03307, transcriptional regulator ICP4 | 1e-05 | |
| pfam13499 | 60 | pfam13499, EF_hand_5, EF-hand domain pair | 1e-05 | |
| cd00051 | 63 | cd00051, EFh, EF-hand, calcium binding motif; A di | 1e-05 | |
| COG0419 | 908 | COG0419, SbcC, ATPase involved in DNA repair [DNA | 2e-05 | |
| PRK03918 | 880 | PRK03918, PRK03918, chromosome segregation protein | 4e-05 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 5e-05 | |
| PRK12704 | 520 | PRK12704, PRK12704, phosphodiesterase; Provisional | 5e-05 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 8e-05 | |
| PHA03247 | 3151 | PHA03247, PHA03247, large tegument protein UL36; P | 9e-05 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 1e-04 | |
| PRK03918 | 880 | PRK03918, PRK03918, chromosome segregation protein | 1e-04 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 1e-04 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 2e-04 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 2e-04 | |
| PRK03918 | 880 | PRK03918, PRK03918, chromosome segregation protein | 2e-04 | |
| PRK03918 | 880 | PRK03918, PRK03918, chromosome segregation protein | 2e-04 | |
| PRK02224 | 880 | PRK02224, PRK02224, chromosome segregation protein | 2e-04 | |
| COG1340 | 294 | COG1340, COG1340, Uncharacterized archaeal coiled- | 2e-04 | |
| COG0419 | 908 | COG0419, SbcC, ATPase involved in DNA repair [DNA | 3e-04 | |
| COG4487 | 438 | COG4487, COG4487, Uncharacterized protein conserve | 3e-04 | |
| pfam08703 | 181 | pfam08703, PLC-beta_C, PLC-beta C terminal | 3e-04 | |
| pfam05109 | 830 | pfam05109, Herpes_BLLF1, Herpes virus major outer | 4e-04 | |
| cd00051 | 63 | cd00051, EFh, EF-hand, calcium binding motif; A di | 5e-04 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 7e-04 | |
| PRK03918 | 880 | PRK03918, PRK03918, chromosome segregation protein | 0.001 | |
| PRK07003 | 830 | PRK07003, PRK07003, DNA polymerase III subunits ga | 0.001 | |
| COG5651 | 490 | COG5651, COG5651, PPE-repeat proteins [Cell motili | 0.001 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 0.002 | |
| pfam05109 | 830 | pfam05109, Herpes_BLLF1, Herpes virus major outer | 0.002 | |
| PRK07003 | 830 | PRK07003, PRK07003, DNA polymerase III subunits ga | 0.002 | |
| PRK12323 | 700 | PRK12323, PRK12323, DNA polymerase III subunits ga | 0.002 | |
| TIGR00618 | 1042 | TIGR00618, sbcc, exonuclease SbcC | 0.002 | |
| COG0419 | 908 | COG0419, SbcC, ATPase involved in DNA repair [DNA | 0.003 | |
| PRK07003 | 830 | PRK07003, PRK07003, DNA polymerase III subunits ga | 0.003 | |
| cd00890 | 129 | cd00890, Prefoldin, Prefoldin is a hexameric molec | 0.003 | |
| PHA03247 | 3151 | PHA03247, PHA03247, large tegument protein UL36; P | 0.004 | |
| pfam13202 | 25 | pfam13202, EF_hand_3, EF hand | 0.004 | |
| pfam13868 | 349 | pfam13868, Trichoplein, Tumour suppressor, Mitosta | 0.004 | |
| pfam03234 | 172 | pfam03234, CDC37_N, Cdc37 N terminal kinase bindin | 0.004 |
| >gnl|CDD|238009 cd00052, EH, Eps15 homology domain; found in proteins implicated in endocytosis, vesicle transport, and signal transduction | Back alignment and domain information |
|---|
Score = 92.3 bits (230), Expect = 9e-23
Identities = 27/67 (40%), Positives = 39/67 (58%)
Query: 441 YTKVFVQVDIDRDGKITGEQAYNLFLSWRLPREVLKQVWDLSDQDNDGMLSLKEFCTALY 500
Y ++F +D D DG I+G++A LPR VL Q+WDL+D D DG L +EF A++
Sbjct: 1 YDQIFRSLDPDGDGLISGDEARPFLGKSGLPRSVLAQIWDLADTDKDGKLDKEEFAIAMH 60
Query: 501 LMERYRE 507
L+
Sbjct: 61 LIALALN 67
|
The alignment contains a pair of EF-hand motifs, typically one of them is canonical and binds to Ca2+, while the other may not bind to Ca2+. A hydrophobic binding pocket is formed by residues from both EF-hand motifs. The EH domain binds to proteins containing NPF (class I), [WF]W or SWG (class II), or H[TS]F (class III) sequence motifs. Length = 67 |
| >gnl|CDD|238009 cd00052, EH, Eps15 homology domain; found in proteins implicated in endocytosis, vesicle transport, and signal transduction | Back alignment and domain information |
|---|
| >gnl|CDD|197477 smart00027, EH, Eps15 homology domain | Back alignment and domain information |
|---|
| >gnl|CDD|197477 smart00027, EH, Eps15 homology domain | Back alignment and domain information |
|---|
| >gnl|CDD|193239 pfam12763, efhand_3, Cytoskeletal-regulatory complex EF hand | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|223039 PHA03307, PHA03307, transcriptional regulator ICP4; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|222177 pfam13499, EF_hand_5, EF-hand domain pair | Back alignment and domain information |
|---|
| >gnl|CDD|238008 cd00051, EFh, EF-hand, calcium binding motif; A diverse superfamily of calcium sensors and calcium signal modulators; most examples in this alignment model have 2 active canonical EF hands | Back alignment and domain information |
|---|
| >gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|237177 PRK12704, PRK12704, phosphodiesterase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|179385 PRK02224, PRK02224, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|224259 COG1340, COG1340, Uncharacterized archaeal coiled-coil protein [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|226889 COG4487, COG4487, Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|204032 pfam08703, PLC-beta_C, PLC-beta C terminal | Back alignment and domain information |
|---|
| >gnl|CDD|218439 pfam05109, Herpes_BLLF1, Herpes virus major outer envelope glycoprotein (BLLF1) | Back alignment and domain information |
|---|
| >gnl|CDD|238008 cd00051, EFh, EF-hand, calcium binding motif; A diverse superfamily of calcium sensors and calcium signal modulators; most examples in this alignment model have 2 active canonical EF hands | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235906 PRK07003, PRK07003, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|227938 COG5651, COG5651, PPE-repeat proteins [Cell motility and secretion] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|218439 pfam05109, Herpes_BLLF1, Herpes virus major outer envelope glycoprotein (BLLF1) | Back alignment and domain information |
|---|
| >gnl|CDD|235906 PRK07003, PRK07003, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|237057 PRK12323, PRK12323, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|129705 TIGR00618, sbcc, exonuclease SbcC | Back alignment and domain information |
|---|
| >gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|235906 PRK07003, PRK07003, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|238453 cd00890, Prefoldin, Prefoldin is a hexameric molecular chaperone complex, found in both eukaryotes and archaea, that binds and stabilizes newly synthesized polypeptides allowing them to fold correctly | Back alignment and domain information |
|---|
| >gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|205383 pfam13202, EF_hand_3, EF hand | Back alignment and domain information |
|---|
| >gnl|CDD|206039 pfam13868, Trichoplein, Tumour suppressor, Mitostatin | Back alignment and domain information |
|---|
| >gnl|CDD|217443 pfam03234, CDC37_N, Cdc37 N terminal kinase binding | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch
Original result of HHsearch against CDD database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 1216 | |||
| KOG0998 | 847 | consensus Synaptic vesicle protein EHS-1 and relat | 100.0 | |
| KOG1029 | 1118 | consensus Endocytic adaptor protein intersectin [S | 100.0 | |
| KOG1029 | 1118 | consensus Endocytic adaptor protein intersectin [S | 99.86 | |
| PF12763 | 104 | EF-hand_4: Cytoskeletal-regulatory complex EF hand | 99.82 | |
| PF12763 | 104 | EF-hand_4: Cytoskeletal-regulatory complex EF hand | 99.8 | |
| smart00027 | 96 | EH Eps15 homology domain. Pair of EF hand motifs t | 99.62 | |
| KOG1955 | 737 | consensus Ral-GTPase effector RALBP1 [Intracellula | 99.53 | |
| KOG0998 | 847 | consensus Synaptic vesicle protein EHS-1 and relat | 99.51 | |
| KOG1955 | 737 | consensus Ral-GTPase effector RALBP1 [Intracellula | 99.45 | |
| smart00027 | 96 | EH Eps15 homology domain. Pair of EF hand motifs t | 99.3 | |
| KOG1954 | 532 | consensus Endocytosis/signaling protein EHD1 [Sign | 99.25 | |
| KOG1954 | 532 | consensus Endocytosis/signaling protein EHD1 [Sign | 99.06 | |
| cd00052 | 67 | EH Eps15 homology domain; found in proteins implic | 98.97 | |
| cd00052 | 67 | EH Eps15 homology domain; found in proteins implic | 98.95 | |
| PF13499 | 66 | EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A | 98.76 | |
| cd05022 | 89 | S-100A13 S-100A13: S-100A13 domain found in protei | 98.73 | |
| KOG0027 | 151 | consensus Calmodulin and related proteins (EF-Hand | 98.63 | |
| COG5126 | 160 | FRQ1 Ca2+-binding protein (EF-Hand superfamily) [S | 98.59 | |
| KOG0027 | 151 | consensus Calmodulin and related proteins (EF-Hand | 98.57 | |
| PF13499 | 66 | EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A | 98.54 | |
| cd05027 | 88 | S-100B S-100B: S-100B domain found in proteins sim | 98.54 | |
| cd05025 | 92 | S-100A1 S-100A1: S-100A1 domain found in proteins | 98.52 | |
| cd05026 | 93 | S-100Z S-100Z: S-100Z domain found in proteins sim | 98.49 | |
| cd05029 | 88 | S-100A6 S-100A6: S-100A6 domain found in proteins | 98.48 | |
| cd05031 | 94 | S-100A10_like S-100A10_like: S-100A10 domain found | 98.47 | |
| cd00213 | 88 | S-100 S-100: S-100 domain, which represents the la | 98.47 | |
| PTZ00183 | 158 | centrin; Provisional | 98.37 | |
| cd05023 | 89 | S-100A11 S-100A11: S-100A11 domain found in protei | 98.34 | |
| PTZ00184 | 149 | calmodulin; Provisional | 98.31 | |
| PRK11637 | 428 | AmiB activator; Provisional | 98.25 | |
| COG5126 | 160 | FRQ1 Ca2+-binding protein (EF-Hand superfamily) [S | 98.22 | |
| PRK09039 | 343 | hypothetical protein; Validated | 98.2 | |
| cd05022 | 89 | S-100A13 S-100A13: S-100A13 domain found in protei | 98.2 | |
| cd00051 | 63 | EFh EF-hand, calcium binding motif; A diverse supe | 98.17 | |
| cd00252 | 116 | SPARC_EC SPARC_EC; extracellular Ca2+ binding doma | 98.15 | |
| PF00038 | 312 | Filament: Intermediate filament protein; InterPro: | 98.14 | |
| cd05025 | 92 | S-100A1 S-100A1: S-100A1 domain found in proteins | 98.12 | |
| cd05027 | 88 | S-100B S-100B: S-100B domain found in proteins sim | 98.09 | |
| PF13833 | 54 | EF-hand_8: EF-hand domain pair; PDB: 3KF9_A 1TTX_A | 98.07 | |
| COG1579 | 239 | Zn-ribbon protein, possibly nucleic acid-binding [ | 98.06 | |
| PTZ00184 | 149 | calmodulin; Provisional | 98.06 | |
| cd05029 | 88 | S-100A6 S-100A6: S-100A6 domain found in proteins | 98.05 | |
| KOG0041 | 244 | consensus Predicted Ca2+-binding protein, EF-Hand | 98.03 | |
| cd05031 | 94 | S-100A10_like S-100A10_like: S-100A10 domain found | 98.01 | |
| PTZ00183 | 158 | centrin; Provisional | 98.01 | |
| PRK09039 | 343 | hypothetical protein; Validated | 98.01 | |
| TIGR02169 | 1164 | SMC_prok_A chromosome segregation protein SMC, pri | 97.99 | |
| KOG0028 | 172 | consensus Ca2+-binding protein (centrin/caltractin | 97.99 | |
| TIGR02169 | 1164 | SMC_prok_A chromosome segregation protein SMC, pri | 97.98 | |
| PF08317 | 325 | Spc7: Spc7 kinetochore protein; InterPro: IPR01325 | 97.98 | |
| COG1340 | 294 | Uncharacterized archaeal coiled-coil protein [Func | 97.97 | |
| cd05030 | 88 | calgranulins Calgranulins: S-100 domain found in p | 97.95 | |
| TIGR02168 | 1179 | SMC_prok_B chromosome segregation protein SMC, com | 97.95 | |
| cd05026 | 93 | S-100Z S-100Z: S-100Z domain found in proteins sim | 97.94 | |
| KOG0250 | 1074 | consensus DNA repair protein RAD18 (SMC family pro | 97.93 | |
| cd00213 | 88 | S-100 S-100: S-100 domain, which represents the la | 97.93 | |
| PF09726 | 697 | Macoilin: Transmembrane protein; InterPro: IPR0191 | 97.92 | |
| KOG0034 | 187 | consensus Ca2+/calmodulin-dependent protein phosph | 97.88 | |
| PF00038 | 312 | Filament: Intermediate filament protein; InterPro: | 97.86 | |
| PF14658 | 66 | EF-hand_9: EF-hand domain | 97.86 | |
| cd05023 | 89 | S-100A11 S-100A11: S-100A11 domain found in protei | 97.85 | |
| smart00787 | 312 | Spc7 Spc7 kinetochore protein. This domain is foun | 97.85 | |
| PF12718 | 143 | Tropomyosin_1: Tropomyosin like; InterPro: IPR0005 | 97.83 | |
| KOG0028 | 172 | consensus Ca2+-binding protein (centrin/caltractin | 97.83 | |
| PF12718 | 143 | Tropomyosin_1: Tropomyosin like; InterPro: IPR0005 | 97.82 | |
| KOG0250 | 1074 | consensus DNA repair protein RAD18 (SMC family pro | 97.8 | |
| PF09726 | 697 | Macoilin: Transmembrane protein; InterPro: IPR0191 | 97.75 | |
| cd00252 | 116 | SPARC_EC SPARC_EC; extracellular Ca2+ binding doma | 97.73 | |
| PF08317 | 325 | Spc7: Spc7 kinetochore protein; InterPro: IPR01325 | 97.72 | |
| PRK02224 | 880 | chromosome segregation protein; Provisional | 97.71 | |
| TIGR01843 | 423 | type_I_hlyD type I secretion membrane fusion prote | 97.68 | |
| PRK04863 | 1486 | mukB cell division protein MukB; Provisional | 97.67 | |
| PHA02562 | 562 | 46 endonuclease subunit; Provisional | 97.67 | |
| cd00051 | 63 | EFh EF-hand, calcium binding motif; A diverse supe | 97.65 | |
| KOG0971 | 1243 | consensus Microtubule-associated protein dynactin | 97.63 | |
| COG1579 | 239 | Zn-ribbon protein, possibly nucleic acid-binding [ | 97.61 | |
| PHA02562 | 562 | 46 endonuclease subunit; Provisional | 97.61 | |
| PRK03918 | 880 | chromosome segregation protein; Provisional | 97.59 | |
| PF13833 | 54 | EF-hand_8: EF-hand domain pair; PDB: 3KF9_A 1TTX_A | 97.59 | |
| PF07888 | 546 | CALCOCO1: Calcium binding and coiled-coil domain ( | 97.56 | |
| KOG0977 | 546 | consensus Nuclear envelope protein lamin, intermed | 97.52 | |
| PF10168 | 717 | Nup88: Nuclear pore component; InterPro: IPR019321 | 97.51 | |
| KOG0037 | 221 | consensus Ca2+-binding protein, EF-Hand protein su | 97.51 | |
| PF04849 | 306 | HAP1_N: HAP1 N-terminal conserved region; InterPro | 97.49 | |
| COG1196 | 1163 | Smc Chromosome segregation ATPases [Cell division | 97.49 | |
| PRK04863 | 1486 | mukB cell division protein MukB; Provisional | 97.49 | |
| KOG0031 | 171 | consensus Myosin regulatory light chain, EF-Hand p | 97.48 | |
| PF00261 | 237 | Tropomyosin: Tropomyosin; InterPro: IPR000533 Trop | 97.46 | |
| COG1196 | 1163 | Smc Chromosome segregation ATPases [Cell division | 97.45 | |
| PF15070 | 617 | GOLGA2L5: Putative golgin subfamily A member 2-lik | 97.45 | |
| PF10473 | 140 | CENP-F_leu_zip: Leucine-rich repeats of kinetochor | 97.44 | |
| PRK02224 | 880 | chromosome segregation protein; Provisional | 97.43 | |
| TIGR01843 | 423 | type_I_hlyD type I secretion membrane fusion prote | 97.42 | |
| KOG0031 | 171 | consensus Myosin regulatory light chain, EF-Hand p | 97.42 | |
| PF10186 | 302 | Atg14: UV radiation resistance protein and autopha | 97.42 | |
| PF06008 | 264 | Laminin_I: Laminin Domain I; InterPro: IPR009254 L | 97.42 | |
| COG4942 | 420 | Membrane-bound metallopeptidase [Cell division and | 97.41 | |
| PF12128 | 1201 | DUF3584: Protein of unknown function (DUF3584); In | 97.38 | |
| PF04111 | 314 | APG6: Autophagy protein Apg6; InterPro: IPR007243 | 97.37 | |
| PF07888 | 546 | CALCOCO1: Calcium binding and coiled-coil domain ( | 97.36 | |
| TIGR03017 | 444 | EpsF chain length determinant protein EpsF. Sequen | 97.36 | |
| KOG0377 | 631 | consensus Protein serine/threonine phosphatase RDG | 97.35 | |
| KOG0030 | 152 | consensus Myosin essential light chain, EF-Hand pr | 97.35 | |
| COG3883 | 265 | Uncharacterized protein conserved in bacteria [Fun | 97.34 | |
| PLN02964 | 644 | phosphatidylserine decarboxylase | 97.34 | |
| KOG0161 | 1930 | consensus Myosin class II heavy chain [Cytoskeleto | 97.31 | |
| KOG0980 | 980 | consensus Actin-binding protein SLA2/Huntingtin-in | 97.3 | |
| TIGR03007 | 498 | pepcterm_ChnLen polysaccharide chain length determ | 97.29 | |
| PF13851 | 201 | GAS: Growth-arrest specific micro-tubule binding | 97.28 | |
| TIGR01005 | 754 | eps_transp_fam exopolysaccharide transport protein | 97.28 | |
| KOG0041 | 244 | consensus Predicted Ca2+-binding protein, EF-Hand | 97.28 | |
| TIGR00606 | 1311 | rad50 rad50. This family is based on the phylogeno | 97.26 | |
| KOG0980 | 980 | consensus Actin-binding protein SLA2/Huntingtin-in | 97.26 | |
| PF04156 | 191 | IncA: IncA protein; InterPro: IPR007285 Chlamydia | 97.23 | |
| KOG0996 | 1293 | consensus Structural maintenance of chromosome pro | 97.23 | |
| KOG0161 | 1930 | consensus Myosin class II heavy chain [Cytoskeleto | 97.23 | |
| PF07926 | 132 | TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: | 97.21 | |
| KOG0030 | 152 | consensus Myosin essential light chain, EF-Hand pr | 97.21 | |
| TIGR00606 | 1311 | rad50 rad50. This family is based on the phylogeno | 97.21 | |
| KOG0996 | 1293 | consensus Structural maintenance of chromosome pro | 97.18 | |
| PF04111 | 314 | APG6: Autophagy protein Apg6; InterPro: IPR007243 | 97.17 | |
| KOG0804 | 493 | consensus Cytoplasmic Zn-finger protein BRAP2 (BRC | 97.16 | |
| COG4372 | 499 | Uncharacterized protein conserved in bacteria with | 97.15 | |
| PRK11281 | 1113 | hypothetical protein; Provisional | 97.15 | |
| cd05030 | 88 | calgranulins Calgranulins: S-100 domain found in p | 97.13 | |
| PF15619 | 194 | Lebercilin: Ciliary protein causing Leber congenit | 97.13 | |
| KOG0995 | 581 | consensus Centromere-associated protein HEC1 [Cell | 97.12 | |
| PF12128 | 1201 | DUF3584: Protein of unknown function (DUF3584); In | 97.12 | |
| smart00787 | 312 | Spc7 Spc7 kinetochore protein. This domain is foun | 97.12 | |
| COG4372 | 499 | Uncharacterized protein conserved in bacteria with | 97.11 | |
| PRK09841 | 726 | cryptic autophosphorylating protein tyrosine kinas | 97.11 | |
| PF04156 | 191 | IncA: IncA protein; InterPro: IPR007285 Chlamydia | 97.11 | |
| cd05024 | 91 | S-100A10 S-100A10: A subgroup of the S-100A10 doma | 97.1 | |
| PF12761 | 195 | End3: Actin cytoskeleton-regulatory complex protei | 97.09 | |
| TIGR03007 | 498 | pepcterm_ChnLen polysaccharide chain length determ | 97.09 | |
| PRK04778 | 569 | septation ring formation regulator EzrA; Provision | 97.09 | |
| KOG0034 | 187 | consensus Ca2+/calmodulin-dependent protein phosph | 97.09 | |
| KOG0977 | 546 | consensus Nuclear envelope protein lamin, intermed | 97.08 | |
| TIGR02680 | 1353 | conserved hypothetical protein TIGR02680. Members | 97.08 | |
| PF05667 | 594 | DUF812: Protein of unknown function (DUF812); Inte | 97.07 | |
| PF00261 | 237 | Tropomyosin: Tropomyosin; InterPro: IPR000533 Trop | 97.05 | |
| COG1340 | 294 | Uncharacterized archaeal coiled-coil protein [Func | 97.04 | |
| PRK11519 | 719 | tyrosine kinase; Provisional | 97.03 | |
| PF04012 | 221 | PspA_IM30: PspA/IM30 family; InterPro: IPR007157 T | 97.02 | |
| PF12325 | 120 | TMF_TATA_bd: TATA element modulatory factor 1 TATA | 97.02 | |
| KOG0044 | 193 | consensus Ca2+ sensor (EF-Hand superfamily) [Signa | 97.0 | |
| PLN02964 | 644 | phosphatidylserine decarboxylase | 96.99 | |
| KOG0994 | 1758 | consensus Extracellular matrix glycoprotein Lamini | 96.99 | |
| PF12795 | 240 | MscS_porin: Mechanosensitive ion channel porin dom | 96.98 | |
| KOG4674 | 1822 | consensus Uncharacterized conserved coiled-coil pr | 96.96 | |
| KOG0933 | 1174 | consensus Structural maintenance of chromosome pro | 96.95 | |
| PF11932 | 251 | DUF3450: Protein of unknown function (DUF3450); In | 96.95 | |
| PF05701 | 522 | WEMBL: Weak chloroplast movement under blue light; | 96.95 | |
| KOG0963 | 629 | consensus Transcription factor/CCAAT displacement | 96.94 | |
| PF14662 | 193 | CCDC155: Coiled-coil region of CCDC155 | 96.92 | |
| KOG2991 | 330 | consensus Splicing regulator [RNA processing and m | 96.92 | |
| COG3883 | 265 | Uncharacterized protein conserved in bacteria [Fun | 96.92 | |
| TIGR01000 | 457 | bacteriocin_acc bacteriocin secretion accessory pr | 96.92 | |
| PF15070 | 617 | GOLGA2L5: Putative golgin subfamily A member 2-lik | 96.9 | |
| KOG0999 | 772 | consensus Microtubule-associated protein Bicaudal- | 96.9 | |
| PF14658 | 66 | EF-hand_9: EF-hand domain | 96.89 | |
| PF13851 | 201 | GAS: Growth-arrest specific micro-tubule binding | 96.89 | |
| KOG0044 | 193 | consensus Ca2+ sensor (EF-Hand superfamily) [Signa | 96.86 | |
| KOG1853 | 333 | consensus LIS1-interacting protein NUDE [Cytoskele | 96.86 | |
| PRK12309 | 391 | transaldolase/EF-hand domain-containing protein; P | 96.85 | |
| KOG4360 | 596 | consensus Uncharacterized coiled coil protein [Fun | 96.84 | |
| KOG0964 | 1200 | consensus Structural maintenance of chromosome pro | 96.84 | |
| PF15397 | 258 | DUF4618: Domain of unknown function (DUF4618) | 96.84 | |
| KOG0933 | 1174 | consensus Structural maintenance of chromosome pro | 96.83 | |
| PLN02939 | 977 | transferase, transferring glycosyl groups | 96.8 | |
| PF10174 | 775 | Cast: RIM-binding protein of the cytomatrix active | 96.8 | |
| PRK10929 | 1109 | putative mechanosensitive channel protein; Provisi | 96.8 | |
| TIGR01005 | 754 | eps_transp_fam exopolysaccharide transport protein | 96.8 | |
| PF10186 | 302 | Atg14: UV radiation resistance protein and autopha | 96.8 | |
| PF09730 | 717 | BicD: Microtubule-associated protein Bicaudal-D; I | 96.79 | |
| PF07111 | 739 | HCR: Alpha helical coiled-coil rod protein (HCR); | 96.78 | |
| PRK12704 | 520 | phosphodiesterase; Provisional | 96.77 | |
| TIGR01010 | 362 | BexC_CtrB_KpsE polysaccharide export inner-membran | 96.77 | |
| PF00036 | 29 | EF-hand_1: EF hand; InterPro: IPR018248 Many calci | 96.75 | |
| KOG0046 | 627 | consensus Ca2+-binding actin-bundling protein (fim | 96.74 | |
| PF07926 | 132 | TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: | 96.74 | |
| TIGR02977 | 219 | phageshock_pspA phage shock protein A. Members of | 96.73 | |
| PF15619 | 194 | Lebercilin: Ciliary protein causing Leber congenit | 96.73 | |
| PF11559 | 151 | ADIP: Afadin- and alpha -actinin-Binding; InterPro | 96.73 | |
| KOG4643 | 1195 | consensus Uncharacterized coiled-coil protein [Fun | 96.72 | |
| TIGR03319 | 514 | YmdA_YtgF conserved hypothetical protein YmdA/YtgF | 96.72 | |
| KOG1853 | 333 | consensus LIS1-interacting protein NUDE [Cytoskele | 96.69 | |
| TIGR00634 | 563 | recN DNA repair protein RecN. All proteins in this | 96.67 | |
| KOG0978 | 698 | consensus E3 ubiquitin ligase involved in syntaxin | 96.63 | |
| PRK00106 | 535 | hypothetical protein; Provisional | 96.62 | |
| COG2433 | 652 | Uncharacterized conserved protein [Function unknow | 96.6 | |
| KOG4302 | 660 | consensus Microtubule-associated protein essential | 96.57 | |
| KOG0971 | 1243 | consensus Microtubule-associated protein dynactin | 96.56 | |
| KOG0976 | 1265 | consensus Rho/Rac1-interacting serine/threonine ki | 96.53 | |
| PF13870 | 177 | DUF4201: Domain of unknown function (DUF4201) | 96.53 | |
| KOG4673 | 961 | consensus Transcription factor TMF, TATA element m | 96.53 | |
| PF10481 | 307 | CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR0 | 96.52 | |
| PF14915 | 305 | CCDC144C: CCDC144C protein coiled-coil region | 96.52 | |
| PF13514 | 1111 | AAA_27: AAA domain | 96.49 | |
| PF06818 | 202 | Fez1: Fez1; InterPro: IPR009638 This family repres | 96.48 | |
| KOG0994 | 1758 | consensus Extracellular matrix glycoprotein Lamini | 96.48 | |
| COG5185 | 622 | HEC1 Protein involved in chromosome segregation, i | 96.47 | |
| COG1842 | 225 | PspA Phage shock protein A (IM30), suppresses sigm | 96.46 | |
| PF05701 | 522 | WEMBL: Weak chloroplast movement under blue light; | 96.45 | |
| PF10498 | 359 | IFT57: Intra-flagellar transport protein 57 ; Inte | 96.45 | |
| PRK01156 | 895 | chromosome segregation protein; Provisional | 96.44 | |
| PF15397 | 258 | DUF4618: Domain of unknown function (DUF4618) | 96.44 | |
| KOG0976 | 1265 | consensus Rho/Rac1-interacting serine/threonine ki | 96.43 | |
| KOG0037 | 221 | consensus Ca2+-binding protein, EF-Hand protein su | 96.43 | |
| PF00036 | 29 | EF-hand_1: EF hand; InterPro: IPR018248 Many calci | 96.42 | |
| PF09789 | 319 | DUF2353: Uncharacterized coiled-coil protein (DUF2 | 96.36 | |
| PF05010 | 207 | TACC: Transforming acidic coiled-coil-containing p | 96.35 | |
| KOG0964 | 1200 | consensus Structural maintenance of chromosome pro | 96.34 | |
| KOG0946 | 970 | consensus ER-Golgi vesicle-tethering protein p115 | 96.34 | |
| PF14915 | 305 | CCDC144C: CCDC144C protein coiled-coil region | 96.33 | |
| KOG2129 | 552 | consensus Uncharacterized conserved protein H4 [Fu | 96.32 | |
| PF10473 | 140 | CENP-F_leu_zip: Leucine-rich repeats of kinetochor | 96.31 | |
| PRK01156 | 895 | chromosome segregation protein; Provisional | 96.3 | |
| KOG3478 | 120 | consensus Prefoldin subunit 6, KE2 family [Posttra | 96.29 | |
| KOG0979 | 1072 | consensus Structural maintenance of chromosome pro | 96.28 | |
| PRK11281 | 1113 | hypothetical protein; Provisional | 96.28 | |
| PF13405 | 31 | EF-hand_6: EF-hand domain; PDB: 2AMI_A 3QRX_A 1W7J | 96.28 | |
| PF13870 | 177 | DUF4201: Domain of unknown function (DUF4201) | 96.27 | |
| PRK10869 | 553 | recombination and repair protein; Provisional | 96.25 | |
| PRK12309 | 391 | transaldolase/EF-hand domain-containing protein; P | 96.23 | |
| PF06160 | 560 | EzrA: Septation ring formation regulator, EzrA ; I | 96.23 | |
| PRK10698 | 222 | phage shock protein PspA; Provisional | 96.23 | |
| KOG0995 | 581 | consensus Centromere-associated protein HEC1 [Cell | 96.22 | |
| PF09304 | 107 | Cortex-I_coil: Cortexillin I, coiled coil; InterPr | 96.19 | |
| KOG0999 | 772 | consensus Microtubule-associated protein Bicaudal- | 96.18 | |
| TIGR03017 | 444 | EpsF chain length determinant protein EpsF. Sequen | 96.16 | |
| PF10146 | 230 | zf-C4H2: Zinc finger-containing protein ; InterPro | 96.16 | |
| KOG4673 | 961 | consensus Transcription factor TMF, TATA element m | 96.15 | |
| COG4942 | 420 | Membrane-bound metallopeptidase [Cell division and | 96.15 | |
| PF09789 | 319 | DUF2353: Uncharacterized coiled-coil protein (DUF2 | 96.14 | |
| KOG0038 | 189 | consensus Ca2+-binding kinase interacting protein | 96.13 | |
| TIGR02680 | 1353 | conserved hypothetical protein TIGR02680. Members | 96.1 | |
| PF04849 | 306 | HAP1_N: HAP1 N-terminal conserved region; InterPro | 96.09 | |
| KOG0377 | 631 | consensus Protein serine/threonine phosphatase RDG | 96.08 | |
| KOG0018 | 1141 | consensus Structural maintenance of chromosome pro | 96.08 | |
| KOG4807 | 593 | consensus F-actin binding protein, regulates actin | 96.08 | |
| KOG0804 | 493 | consensus Cytoplasmic Zn-finger protein BRAP2 (BRC | 96.08 | |
| PRK03947 | 140 | prefoldin subunit alpha; Reviewed | 96.06 | |
| TIGR01000 | 457 | bacteriocin_acc bacteriocin secretion accessory pr | 96.03 | |
| PF10174 | 775 | Cast: RIM-binding protein of the cytomatrix active | 96.02 | |
| PF05667 | 594 | DUF812: Protein of unknown function (DUF812); Inte | 96.0 | |
| PF06008 | 264 | Laminin_I: Laminin Domain I; InterPro: IPR009254 L | 95.98 | |
| PF13514 | 1111 | AAA_27: AAA domain | 95.98 | |
| PRK10884 | 206 | SH3 domain-containing protein; Provisional | 95.97 | |
| cd05024 | 91 | S-100A10 S-100A10: A subgroup of the S-100A10 doma | 95.97 | |
| KOG0036 | 463 | consensus Predicted mitochondrial carrier protein | 95.88 | |
| PF10481 | 307 | CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR0 | 95.88 | |
| KOG0243 | 1041 | consensus Kinesin-like protein [Cytoskeleton] | 95.87 | |
| TIGR02338 | 110 | gimC_beta prefoldin, beta subunit, archaeal. Chape | 95.87 | |
| KOG0040 | 2399 | consensus Ca2+-binding actin-bundling protein (spe | 95.86 | |
| PF04012 | 221 | PspA_IM30: PspA/IM30 family; InterPro: IPR007157 T | 95.85 | |
| KOG0036 | 463 | consensus Predicted mitochondrial carrier protein | 95.84 | |
| PRK10476 | 346 | multidrug resistance protein MdtN; Provisional | 95.84 | |
| KOG0946 | 970 | consensus ER-Golgi vesicle-tethering protein p115 | 95.84 | |
| PF14662 | 193 | CCDC155: Coiled-coil region of CCDC155 | 95.82 | |
| PF07106 | 169 | TBPIP: Tat binding protein 1(TBP-1)-interacting pr | 95.82 | |
| COG2433 | 652 | Uncharacterized conserved protein [Function unknow | 95.8 | |
| KOG4674 | 1822 | consensus Uncharacterized conserved coiled-coil pr | 95.8 | |
| PF15290 | 305 | Syntaphilin: Golgi-localised syntaxin-1-binding cl | 95.79 | |
| PF06120 | 301 | Phage_HK97_TLTM: Tail length tape measure protein; | 95.78 | |
| COG4717 | 984 | Uncharacterized conserved protein [Function unknow | 95.77 | |
| PF10146 | 230 | zf-C4H2: Zinc finger-containing protein ; InterPro | 95.75 | |
| PF05278 | 269 | PEARLI-4: Arabidopsis phospholipase-like protein ( | 95.74 | |
| cd00632 | 105 | Prefoldin_beta Prefoldin beta; Prefoldin is a hexa | 95.73 | |
| KOG0979 | 1072 | consensus Structural maintenance of chromosome pro | 95.7 | |
| KOG4302 | 660 | consensus Microtubule-associated protein essential | 95.69 | |
| PF06785 | 401 | UPF0242: Uncharacterised protein family (UPF0242); | 95.69 | |
| KOG4643 | 1195 | consensus Uncharacterized coiled-coil protein [Fun | 95.66 | |
| PF11932 | 251 | DUF3450: Protein of unknown function (DUF3450); In | 95.66 | |
| KOG0612 | 1317 | consensus Rho-associated, coiled-coil containing p | 95.65 | |
| TIGR02971 | 327 | heterocyst_DevB ABC exporter membrane fusion prote | 95.65 | |
| KOG4593 | 716 | consensus Mitotic checkpoint protein MAD1 [Cell cy | 95.6 | |
| PF15066 | 527 | CAGE1: Cancer-associated gene protein 1 family | 95.6 | |
| PRK09841 | 726 | cryptic autophosphorylating protein tyrosine kinas | 95.59 | |
| PF11559 | 151 | ADIP: Afadin- and alpha -actinin-Binding; InterPro | 95.58 | |
| KOG4223 | 325 | consensus Reticulocalbin, calumenin, DNA supercoil | 95.58 | |
| COG0497 | 557 | RecN ATPase involved in DNA repair [DNA replicatio | 95.55 | |
| KOG0963 | 629 | consensus Transcription factor/CCAAT displacement | 95.55 | |
| PF05911 | 769 | DUF869: Plant protein of unknown function (DUF869) | 95.53 | |
| PF10168 | 717 | Nup88: Nuclear pore component; InterPro: IPR019321 | 95.52 | |
| PF13805 | 271 | Pil1: Eisosome component PIL1; PDB: 3PLT_B. | 95.47 | |
| PF05911 | 769 | DUF869: Plant protein of unknown function (DUF869) | 95.47 | |
| PF10475 | 291 | DUF2450: Protein of unknown function N-terminal do | 95.46 | |
| PF13202 | 25 | EF-hand_5: EF hand; PDB: 3DD4_A 2Q4U_A 2BE4_A 1UHJ | 95.46 | |
| PRK10361 | 475 | DNA recombination protein RmuC; Provisional | 95.42 | |
| PF00769 | 246 | ERM: Ezrin/radixin/moesin family; InterPro: IPR011 | 95.42 | |
| KOG2129 | 552 | consensus Uncharacterized conserved protein H4 [Fu | 95.4 | |
| PF14988 | 206 | DUF4515: Domain of unknown function (DUF4515) | 95.39 | |
| PF09731 | 582 | Mitofilin: Mitochondrial inner membrane protein; I | 95.37 | |
| PRK09343 | 121 | prefoldin subunit beta; Provisional | 95.36 | |
| PRK10884 | 206 | SH3 domain-containing protein; Provisional | 95.33 | |
| PF06160 | 560 | EzrA: Septation ring formation regulator, EzrA ; I | 95.33 | |
| PRK15178 | 434 | Vi polysaccharide export inner membrane protein Ve | 95.33 | |
| KOG0612 | 1317 | consensus Rho-associated, coiled-coil containing p | 95.32 | |
| KOG3091 | 508 | consensus Nuclear pore complex, p54 component (sc | 95.32 | |
| TIGR02977 | 219 | phageshock_pspA phage shock protein A. Members of | 95.31 | |
| PF09731 | 582 | Mitofilin: Mitochondrial inner membrane protein; I | 95.31 | |
| PF12252 | 1439 | SidE: Dot/Icm substrate protein; InterPro: IPR0210 | 95.3 | |
| COG5185 | 622 | HEC1 Protein involved in chromosome segregation, i | 95.26 | |
| KOG1899 | 861 | consensus LAR transmembrane tyrosine phosphatase-i | 95.26 | |
| PF15272 | 196 | BBP1_C: Spindle pole body component BBP1, C-termin | 95.25 | |
| PF10591 | 113 | SPARC_Ca_bdg: Secreted protein acidic and rich in | 95.23 | |
| COG3206 | 458 | GumC Uncharacterized protein involved in exopolysa | 95.23 | |
| PF04949 | 159 | Transcrip_act: Transcriptional activator; InterPro | 95.22 | |
| PF04582 | 326 | Reo_sigmaC: Reovirus sigma C capsid protein; Inter | 95.21 | |
| PF08580 | 683 | KAR9: Yeast cortical protein KAR9; InterPro: IPR01 | 95.19 | |
| KOG4460 | 741 | consensus Nuclear pore complex, Nup88/rNup84 compo | 95.17 | |
| PRK11519 | 719 | tyrosine kinase; Provisional | 95.17 | |
| PF12795 | 240 | MscS_porin: Mechanosensitive ion channel porin dom | 95.14 | |
| KOG0018 | 1141 | consensus Structural maintenance of chromosome pro | 95.12 | |
| COG1730 | 145 | GIM5 Predicted prefoldin, molecular chaperone impl | 95.11 | |
| PRK10698 | 222 | phage shock protein PspA; Provisional | 95.11 | |
| PF09730 | 717 | BicD: Microtubule-associated protein Bicaudal-D; I | 95.09 | |
| PF10212 | 518 | TTKRSYEDQ: Predicted coiled-coil domain-containing | 95.08 | |
| PF05010 | 207 | TACC: Transforming acidic coiled-coil-containing p | 95.08 | |
| PF12072 | 201 | DUF3552: Domain of unknown function (DUF3552); Int | 95.05 | |
| TIGR00998 | 334 | 8a0101 efflux pump membrane protein (multidrug res | 95.02 | |
| PF13405 | 31 | EF-hand_6: EF-hand domain; PDB: 2AMI_A 3QRX_A 1W7J | 95.02 | |
| PF07111 | 739 | HCR: Alpha helical coiled-coil rod protein (HCR); | 95.01 | |
| KOG4572 | 1424 | consensus Predicted DNA-binding transcription fact | 95.0 | |
| PF02050 | 123 | FliJ: Flagellar FliJ protein; InterPro: IPR012823 | 94.99 | |
| TIGR00634 | 563 | recN DNA repair protein RecN. All proteins in this | 94.98 | |
| PF12325 | 120 | TMF_TATA_bd: TATA element modulatory factor 1 TATA | 94.98 | |
| KOG0288 | 459 | consensus WD40 repeat protein TipD [General functi | 94.97 | |
| PF06818 | 202 | Fez1: Fez1; InterPro: IPR009638 This family repres | 94.97 | |
| PF09755 | 310 | DUF2046: Uncharacterized conserved protein H4 (DUF | 94.95 | |
| PF09304 | 107 | Cortex-I_coil: Cortexillin I, coiled coil; InterPr | 94.95 | |
| KOG2751 | 447 | consensus Beclin-like protein [Signal transduction | 94.92 | |
| KOG1003 | 205 | consensus Actin filament-coating protein tropomyos | 94.92 | |
| COG3096 | 1480 | MukB Uncharacterized protein involved in chromosom | 94.86 | |
| KOG0243 | 1041 | consensus Kinesin-like protein [Cytoskeleton] | 94.83 | |
| PF03148 | 384 | Tektin: Tektin family; InterPro: IPR000435 Tektin | 94.83 | |
| PRK03947 | 140 | prefoldin subunit alpha; Reviewed | 94.83 | |
| KOG2751 | 447 | consensus Beclin-like protein [Signal transduction | 94.82 | |
| PF05483 | 786 | SCP-1: Synaptonemal complex protein 1 (SCP-1); Int | 94.8 | |
| KOG0982 | 502 | consensus Centrosomal protein Nuf [Cell cycle cont | 94.77 | |
| PF09787 | 511 | Golgin_A5: Golgin subfamily A member 5; InterPro: | 94.72 | |
| KOG0978 | 698 | consensus E3 ubiquitin ligase involved in syntaxin | 94.71 | |
| KOG4593 | 716 | consensus Mitotic checkpoint protein MAD1 [Cell cy | 94.7 | |
| smart00502 | 127 | BBC B-Box C-terminal domain. Coiled coil region C- | 94.65 | |
| TIGR03794 | 421 | NHPM_micro_HlyD NHPM bacteriocin system secretion | 94.64 | |
| PF01920 | 106 | Prefoldin_2: Prefoldin subunit; InterPro: IPR00277 | 94.64 | |
| PF13166 | 712 | AAA_13: AAA domain | 94.63 | |
| PF15294 | 278 | Leu_zip: Leucine zipper | 94.61 | |
| PRK10361 | 475 | DNA recombination protein RmuC; Provisional | 94.57 | |
| PF05384 | 159 | DegS: Sensor protein DegS; InterPro: IPR008595 Thi | 94.57 | |
| KOG4223 | 325 | consensus Reticulocalbin, calumenin, DNA supercoil | 94.54 | |
| PF13202 | 25 | EF-hand_5: EF hand; PDB: 3DD4_A 2Q4U_A 2BE4_A 1UHJ | 94.54 | |
| PRK12704 | 520 | phosphodiesterase; Provisional | 94.54 | |
| PRK00409 | 782 | recombination and DNA strand exchange inhibitor pr | 94.53 | |
| COG4717 | 984 | Uncharacterized conserved protein [Function unknow | 94.53 | |
| COG1842 | 225 | PspA Phage shock protein A (IM30), suppresses sigm | 94.52 | |
| PF07798 | 177 | DUF1640: Protein of unknown function (DUF1640); In | 94.52 | |
| PRK10476 | 346 | multidrug resistance protein MdtN; Provisional | 94.5 | |
| PRK10246 | 1047 | exonuclease subunit SbcC; Provisional | 94.49 | |
| cd00176 | 213 | SPEC Spectrin repeats, found in several proteins i | 94.49 | |
| PF10591 | 113 | SPARC_Ca_bdg: Secreted protein acidic and rich in | 94.49 | |
| KOG0240 | 607 | consensus Kinesin (SMY1 subfamily) [Cytoskeleton] | 94.48 | |
| COG4026 | 290 | Uncharacterized protein containing TOPRIM domain, | 94.46 | |
| PRK12705 | 508 | hypothetical protein; Provisional | 94.45 | |
| PRK10929 | 1109 | putative mechanosensitive channel protein; Provisi | 94.44 | |
| PF09728 | 309 | Taxilin: Myosin-like coiled-coil protein; InterPro | 94.38 | |
| KOG0962 | 1294 | consensus DNA repair protein RAD50, ABC-type ATPas | 94.38 | |
| COG0419 | 908 | SbcC ATPase involved in DNA repair [DNA replicatio | 94.36 | |
| KOG0239 | 670 | consensus Kinesin (KAR3 subfamily) [Cytoskeleton] | 94.36 | |
| PF15254 | 861 | CCDC14: Coiled-coil domain-containing protein 14 | 94.36 | |
| PF06120 | 301 | Phage_HK97_TLTM: Tail length tape measure protein; | 94.33 | |
| PRK10246 | 1047 | exonuclease subunit SbcC; Provisional | 94.32 | |
| PRK00286 | 438 | xseA exodeoxyribonuclease VII large subunit; Revie | 94.31 | |
| TIGR01010 | 362 | BexC_CtrB_KpsE polysaccharide export inner-membran | 94.3 | |
| PRK03598 | 331 | putative efflux pump membrane fusion protein; Prov | 94.28 | |
| PF07851 | 330 | TMPIT: TMPIT-like protein; InterPro: IPR012926 A n | 94.27 | |
| PLN03229 | 762 | acetyl-coenzyme A carboxylase carboxyl transferase | 94.27 | |
| PF09787 | 511 | Golgin_A5: Golgin subfamily A member 5; InterPro: | 94.26 | |
| PRK10869 | 553 | recombination and repair protein; Provisional | 94.25 | |
| KOG4677 | 554 | consensus Golgi integral membrane protein [Intrace | 94.21 | |
| PF05622 | 713 | HOOK: HOOK protein; InterPro: IPR008636 This famil | 94.21 | |
| TIGR03319 | 514 | YmdA_YtgF conserved hypothetical protein YmdA/YtgF | 94.2 | |
| KOG4403 | 575 | consensus Cell surface glycoprotein STIM, contains | 94.19 | |
| PF06248 | 593 | Zw10: Centromere/kinetochore Zw10; InterPro: IPR00 | 94.15 | |
| COG3206 | 458 | GumC Uncharacterized protein involved in exopolysa | 94.13 | |
| PF05266 | 190 | DUF724: Protein of unknown function (DUF724); Inte | 94.11 | |
| cd00890 | 129 | Prefoldin Prefoldin is a hexameric molecular chape | 94.08 | |
| COG4477 | 570 | EzrA Negative regulator of septation ring formatio | 94.07 | |
| TIGR02231 | 525 | conserved hypothetical protein. This family consis | 94.06 | |
| cd07648 | 261 | F-BAR_FCHO The F-BAR (FES-CIP4 Homology and Bin/Am | 94.04 | |
| PRK00106 | 535 | hypothetical protein; Provisional | 94.01 | |
| PF10267 | 395 | Tmemb_cc2: Predicted transmembrane and coiled-coil | 93.98 | |
| KOG1937 | 521 | consensus Uncharacterized conserved protein [Funct | 93.91 | |
| PF02994 | 370 | Transposase_22: L1 transposable element; InterPro: | 93.91 | |
| TIGR02473 | 141 | flagell_FliJ flagellar export protein FliJ. Member | 93.88 | |
| TIGR02338 | 110 | gimC_beta prefoldin, beta subunit, archaeal. Chape | 93.88 | |
| PF08581 | 79 | Tup_N: Tup N-terminal; InterPro: IPR013890 The N-t | 93.87 | |
| KOG4360 | 596 | consensus Uncharacterized coiled coil protein [Fun | 93.84 | |
| PF12072 | 201 | DUF3552: Domain of unknown function (DUF3552); Int | 93.82 | |
| KOG2685 | 421 | consensus Cystoskeletal protein Tektin [Cytoskelet | 93.81 | |
| KOG0239 | 670 | consensus Kinesin (KAR3 subfamily) [Cytoskeleton] | 93.8 | |
| PLN03229 | 762 | acetyl-coenzyme A carboxylase carboxyl transferase | 93.77 | |
| KOG1850 | 391 | consensus Myosin-like coiled-coil protein [Cytoske | 93.75 | |
| PF14282 | 106 | FlxA: FlxA-like protein | 93.75 | |
| KOG0042 | 680 | consensus Glycerol-3-phosphate dehydrogenase [Ener | 93.72 | |
| PF01576 | 859 | Myosin_tail_1: Myosin tail; InterPro: IPR002928 Mu | 93.71 | |
| PF05335 | 188 | DUF745: Protein of unknown function (DUF745); Inte | 93.71 | |
| TIGR03545 | 555 | conserved hypothetical protein TIGR03545. This mod | 93.7 | |
| TIGR02231 | 525 | conserved hypothetical protein. This family consis | 93.67 | |
| PF14362 | 301 | DUF4407: Domain of unknown function (DUF4407) | 93.66 | |
| COG4913 | 1104 | Uncharacterized protein conserved in bacteria [Fun | 93.65 | |
| COG4026 | 290 | Uncharacterized protein containing TOPRIM domain, | 93.63 | |
| COG0497 | 557 | RecN ATPase involved in DNA repair [DNA replicatio | 93.63 | |
| PRK09343 | 121 | prefoldin subunit beta; Provisional | 93.61 | |
| PRK14011 | 144 | prefoldin subunit alpha; Provisional | 93.58 | |
| PF05557 | 722 | MAD: Mitotic checkpoint protein; InterPro: IPR0086 | 93.57 | |
| PF13166 | 712 | AAA_13: AAA domain | 93.55 | |
| COG5293 | 591 | Predicted ATPase [General function prediction only | 93.53 | |
| COG1730 | 145 | GIM5 Predicted prefoldin, molecular chaperone impl | 93.51 | |
| KOG1103 | 561 | consensus Predicted coiled-coil protein [Function | 93.46 | |
| PF05557 | 722 | MAD: Mitotic checkpoint protein; InterPro: IPR0086 | 93.46 | |
| PF01920 | 106 | Prefoldin_2: Prefoldin subunit; InterPro: IPR00277 | 93.44 | |
| PF09728 | 309 | Taxilin: Myosin-like coiled-coil protein; InterPro | 93.43 | |
| KOG1854 | 657 | consensus Mitochondrial inner membrane protein (mi | 93.31 | |
| PF07106 | 169 | TBPIP: Tat binding protein 1(TBP-1)-interacting pr | 93.24 | |
| PF10498 | 359 | IFT57: Intra-flagellar transport protein 57 ; Inte | 93.22 | |
| PTZ00464 | 211 | SNF-7-like protein; Provisional | 93.19 | |
| TIGR03794 | 421 | NHPM_micro_HlyD NHPM bacteriocin system secretion | 93.18 | |
| PF15294 | 278 | Leu_zip: Leucine zipper | 93.17 | |
| PF05700 | 221 | BCAS2: Breast carcinoma amplified sequence 2 (BCAS | 93.17 | |
| KOG2991 | 330 | consensus Splicing regulator [RNA processing and m | 93.16 | |
| cd07673 | 269 | F-BAR_FCHO2 The F-BAR (FES-CIP4 Homology and Bin/A | 93.16 | |
| PF15066 | 527 | CAGE1: Cancer-associated gene protein 1 family | 93.13 | |
| PF05384 | 159 | DegS: Sensor protein DegS; InterPro: IPR008595 Thi | 93.12 | |
| TIGR00293 | 126 | prefoldin, archaeal alpha subunit/eukaryotic subun | 93.12 | |
| KOG1962 | 216 | consensus B-cell receptor-associated protein and r | 93.1 | |
| KOG0962 | 1294 | consensus DNA repair protein RAD50, ABC-type ATPas | 93.08 | |
| KOG1003 | 205 | consensus Actin filament-coating protein tropomyos | 93.08 | |
| PF14992 | 280 | TMCO5: TMCO5 family | 93.07 | |
| KOG3809 | 583 | consensus Microtubule-binding protein MIP-T3 [Cyto | 93.06 | |
| PF12329 | 74 | TMF_DNA_bd: TATA element modulatory factor 1 DNA b | 93.05 | |
| PF15556 | 252 | Zwint: ZW10 interactor | 93.04 | |
| TIGR00998 | 334 | 8a0101 efflux pump membrane protein (multidrug res | 93.03 | |
| PF07200 | 150 | Mod_r: Modifier of rudimentary (Mod(r)) protein; I | 93.03 | |
| PF07200 | 150 | Mod_r: Modifier of rudimentary (Mod(r)) protein; I | 92.99 | |
| PF09602 | 165 | PhaP_Bmeg: Polyhydroxyalkanoic acid inclusion prot | 92.99 | |
| PF15450 | 531 | DUF4631: Domain of unknown function (DUF4631) | 92.98 | |
| COG1382 | 119 | GimC Prefoldin, chaperonin cofactor [Posttranslati | 92.94 | |
| PF13863 | 126 | DUF4200: Domain of unknown function (DUF4200) | 92.91 | |
| TIGR01541 | 332 | tape_meas_lam_C phage tail tape measure protein, l | 92.88 | |
| PF05278 | 269 | PEARLI-4: Arabidopsis phospholipase-like protein ( | 92.87 | |
| TIGR03752 | 472 | conj_TIGR03752 integrating conjugative element pro | 92.85 | |
| COG5283 | 1213 | Phage-related tail protein [Function unknown] | 92.83 | |
| PF07889 | 126 | DUF1664: Protein of unknown function (DUF1664); In | 92.82 | |
| KOG4657 | 246 | consensus Uncharacterized conserved protein [Funct | 92.82 | |
| PF05622 | 713 | HOOK: HOOK protein; InterPro: IPR008636 This famil | 92.79 | |
| PF14992 | 280 | TMCO5: TMCO5 family | 92.77 | |
| TIGR00237 | 432 | xseA exodeoxyribonuclease VII, large subunit. This | 92.77 | |
| PF13863 | 126 | DUF4200: Domain of unknown function (DUF4200) | 92.75 | |
| cd07653 | 251 | F-BAR_CIP4-like The F-BAR (FES-CIP4 Homology and B | 92.74 | |
| TIGR02971 | 327 | heterocyst_DevB ABC exporter membrane fusion prote | 92.72 | |
| PF04912 | 388 | Dynamitin: Dynamitin ; InterPro: IPR006996 Dynamit | 92.7 | |
| cd00584 | 129 | Prefoldin_alpha Prefoldin alpha subunit; Prefoldin | 92.7 | |
| KOG2891 | 445 | consensus Surface glycoprotein [General function p | 92.67 | |
| PRK05689 | 147 | fliJ flagellar biosynthesis chaperone; Validated | 92.61 | |
| PF14073 | 178 | Cep57_CLD: Centrosome localisation domain of Cep57 | 92.61 | |
| KOG3215 | 222 | consensus Uncharacterized conserved protein [Funct | 92.6 | |
| PF15254 | 861 | CCDC14: Coiled-coil domain-containing protein 14 | 92.57 | |
| COG2882 | 148 | FliJ Flagellar biosynthesis chaperone [Cell motili | 92.55 | |
| PF14788 | 51 | EF-hand_10: EF hand; PDB: 1DJW_B 1DJI_B 1DJG_B 1QA | 92.54 | |
| PF11180 | 192 | DUF2968: Protein of unknown function (DUF2968); In | 92.54 | |
| KOG3215 | 222 | consensus Uncharacterized conserved protein [Funct | 92.53 | |
| cd00176 | 213 | SPEC Spectrin repeats, found in several proteins i | 92.52 | |
| PF06810 | 155 | Phage_GP20: Phage minor structural protein GP20; I | 92.52 | |
| PRK12705 | 508 | hypothetical protein; Provisional | 92.5 | |
| KOG0249 | 916 | consensus LAR-interacting protein and related prot | 92.5 | |
| PF05769 | 181 | DUF837: Protein of unknown function (DUF837); Inte | 92.5 | |
| PF07889 | 126 | DUF1664: Protein of unknown function (DUF1664); In | 92.49 | |
| PF06705 | 247 | SF-assemblin: SF-assemblin/beta giardin | 92.45 | |
| PRK15178 | 434 | Vi polysaccharide export inner membrane protein Ve | 92.45 | |
| PRK07720 | 146 | fliJ flagellar biosynthesis chaperone; Validated | 92.45 | |
| KOG4572 | 1424 | consensus Predicted DNA-binding transcription fact | 92.43 | |
| PF04582 | 326 | Reo_sigmaC: Reovirus sigma C capsid protein; Inter | 92.41 | |
| PRK00286 | 438 | xseA exodeoxyribonuclease VII large subunit; Revie | 92.4 | |
| smart00502 | 127 | BBC B-Box C-terminal domain. Coiled coil region C- | 92.4 | |
| KOG0046 | 627 | consensus Ca2+-binding actin-bundling protein (fim | 92.37 | |
| PF06785 | 401 | UPF0242: Uncharacterised protein family (UPF0242); | 92.35 | |
| cd07651 | 236 | F-BAR_PombeCdc15_like The F-BAR (FES-CIP4 Homology | 92.34 | |
| PF02403 | 108 | Seryl_tRNA_N: Seryl-tRNA synthetase N-terminal dom | 92.34 | |
| PF10046 | 99 | BLOC1_2: Biogenesis of lysosome-related organelles | 92.32 | |
| TIGR03752 | 472 | conj_TIGR03752 integrating conjugative element pro | 92.3 | |
| KOG2008 | 426 | consensus BTK-associated SH3-domain binding protei | 92.3 | |
| PF02994 | 370 | Transposase_22: L1 transposable element; InterPro: | 92.29 | |
| PF06005 | 72 | DUF904: Protein of unknown function (DUF904); Inte | 92.29 | |
| PF03962 | 188 | Mnd1: Mnd1 family; InterPro: IPR005647 This family | 92.27 | |
| PF00435 | 105 | Spectrin: Spectrin repeat; InterPro: IPR002017 Spe | 92.27 | |
| PF14197 | 69 | Cep57_CLD_2: Centrosome localisation domain of PPC | 92.24 | |
| KOG4065 | 144 | consensus Uncharacterized conserved protein [Funct | 92.22 | |
| KOG2196 | 254 | consensus Nuclear porin [Nuclear structure] | 92.19 |
| >KOG0998 consensus Synaptic vesicle protein EHS-1 and related EH domain proteins [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
Probab=100.00 E-value=6.9e-47 Score=463.37 Aligned_cols=585 Identities=29% Similarity=0.391 Sum_probs=374.1
Q ss_pred CcccHHHHHHHHHhhCCCCCCcccHHHHHHHHHhCCCCHHHHHHHHHhhcCCCCCCCCHHHHHHHHHHHHHHhcCCCCCh
Q 000940 5 TATNSDLFEAYFRRADLDGDGQISGAEAVAFFQGSNLPKQVLAQVWSHADQRKAGFLNRAEFFNALKLVTVAQSKRELTP 84 (1216)
Q Consensus 5 taee~~~Y~~vF~~lD~DgDGkISg~Ea~~fL~~SgLP~~~L~qIW~LAD~d~DG~LdrdEF~vAM~LValAQ~G~elsp 84 (1216)
.+.+..+|+.+|+.+|+.++|+|+|.+++.||..+||+..+|++||.++|..+.|+|++.+||+|||||+++|+|++++.
T Consensus 6 ~~~~q~~~~~~~~~~d~~~~G~i~g~~a~~f~~~s~L~~qvl~qiws~~d~~~~g~l~~q~f~~~lrlva~aq~~~~~~~ 85 (847)
T KOG0998|consen 6 SPPGQPLFDQYFKSADPQGDGRITGAEAVAFLSKSGLPDQVLGQIWSLADSSGKGFLNRQGFYAALRLVAQAQSGRELSA 85 (847)
T ss_pred CCCccchHHHhhhccCcccCCcccHHHhhhhhhccccchhhhhccccccccccCCccccccccccchHhhhhhcccCcCc
Confidence 56777999999999999999999999999999999999999999999999999999999999999999999999999977
Q ss_pred hhhhhccCCCccCCCCCCccccCCCCCCCCCCCCCCCCCCCCCCCCCcccCCCCCCCCCCCCCCCCCCCCCCccCCCCCC
Q 000940 85 DIVKAALYGPASARIPAPQINLAAMPSSHSRVGAPASQVSGAPSPQNVSVRGPQGLGNASTNQQSPPSQSNHFVRTPQAV 164 (1216)
Q Consensus 85 e~Lp~~L~~Ps~~~iP~P~l~~~~~p~p~~~~~~~~~~~~~~~~~q~~~~~g~~~~~~~~~~qq~~p~~~~~~~r~~~~~ 164 (1216)
+.+ .++....|+|+++....|.++.+..++. ++ ..+....+++....+. ++
T Consensus 86 ~~~-----~~~~~~pp~~~~~~~~~~~~~~~~~~s~---------------~~-~~p~~~~qe~aky~q~------f~-- 136 (847)
T KOG0998|consen 86 KKV-----LPASAVPPPPKISHDTSPPSRPSSSTSA---------------AP-FVPAITPQEQAKYDQI------FR-- 136 (847)
T ss_pred ccc-----ccccCCCCCCccCccCCCcccCCCCCCC---------------cc-cCCCCCHHHHHHHHHH------Hh--
Confidence 765 3456777777777766665544322111 00 1112222222221111 11
Q ss_pred CCCCCCCccccccCCCCCCCCCCCCCCCCCCCCcccccCCccccCCCCCCCCCCCCCCCCCCCCCCCCCCcCCCCCCCCC
Q 000940 165 LPGTTLHPQQVLSGQSMPSGGTMTAPRPPTSNVSTDWLGGSTVSPLAGSTTQLPNRGSSPSLPQEGFGLPASSLAPSVQP 244 (1216)
Q Consensus 165 ~~~~~~~P~~~~~~~g~~~gG~~~~~~~~~s~l~~~~l~~~~~~~p~g~~~~~~~~~~~p~~~~~~f~~~~~~~~~~~~~ 244 (1216)
.+.|. +|+ +.|+.+++++++++|+.+|||.+| .++++++.+.+++.+|.++|.++.-.+..
T Consensus 137 ----s~~p~-----~g~-~sg~~~~pil~~s~Lp~~~l~~iw---------~l~d~d~~g~Ld~~ef~~am~l~~~~l~~ 197 (847)
T KOG0998|consen 137 ----SLSPS-----NGL-LSGDKAKPILLNSKLPSDVLGRIW---------ELSDIDKDGNLDRDEFAVAMHLINDLLNG 197 (847)
T ss_pred ----ccCCC-----CCc-cccchhhhhhhcCCCChhhhcccc---------ccccccccCCCChhhhhhhhhHHHHHhhc
Confidence 22222 677 899999999999999999999998 68999999999988888755554322111
Q ss_pred CCCCCCCCCCCCCCCCccccccCcccccccccccCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCccceeccCCCC
Q 000940 245 RPPITSGGRAGSPLAGTTSQVSDRGISASSTLDRFGLPASSVAPSVQPRPPGTSAQTPATAPKPQAPDSKSLVVSGNGFS 324 (1216)
Q Consensus 245 ~~~~~~~~~~~~p~~~~~~~~~~~~~~a~~~~~~~~~~~~~v~~~~~~~~~~s~~~~p~~~~~~~~~~~k~~~~~gng~~ 324 (1216)
. ..++|. -+....++| .. ..+...+..++
T Consensus 198 ~-------------------------------------~~p~P~-----~~p~~lIpp--------s~-~~~~~~~~~~~ 226 (847)
T KOG0998|consen 198 N-------------------------------------SEPVPS-----RLPPSLIPP--------SK-SELSANSSSKA 226 (847)
T ss_pred c-------------------------------------cCCCCc-----cCCcccCCc--------ch-hcccccCcccc
Confidence 0 112221 000011222 11 11122222233
Q ss_pred CCCccCCcccCCCCCCCCCCccCCCCCCCCCccCCCCCCCCCCCCCCCCccccccCCCCCCCccccCCcccccccccccc
Q 000940 325 SDSLFGDVFSASPVQPKQDVAISGSVPTSTASVPASPAPKPSLKAGPVEPVQHAFSQPPVGGQYQQGQSAGKQNQQFAVK 404 (1216)
Q Consensus 325 S~~~~gd~fsa~p~~~~~~~~~~~~~p~s~~~~p~s~~~~p~~~~~~~d~lq~~~~~~~~g~~~~~~~~~~~~~~~~~~~ 404 (1216)
.+...+. .+.+..+ ...+++.+.+ ++.+..++......
T Consensus 227 ~~~~~~~------~~~~~~~------~~~~~l~~~s--------------------------~~~~~~s~~~~~~~---- 264 (847)
T KOG0998|consen 227 IPFSQPF------LASMASP------TTLSSLVDLS--------------------------ALNSNPSLSSLSLA---- 264 (847)
T ss_pred ccccccc------ccccccc------cccccccchh--------------------------cccCCccccccccc----
Confidence 3222221 0011110 0111111111 11112222211110
Q ss_pred CCCCCCCCCccccccCCCCCCCCCCC-CCCCHHHHHHHHHHHHHhCCCCCCcccHHHHHHHHHcCCCCHHHHHHHHHHhC
Q 000940 405 STPAAASTGFPIGALNSTSSQSHVPW-PKMTHSEVQKYTKVFVQVDIDRDGKITGEQAYNLFLSWRLPREVLKQVWDLSD 483 (1216)
Q Consensus 405 ~~~~~~sp~~p~g~~~~~~~~~~~~W-p~LS~eEk~ey~eaF~~fDkDgDG~ISgdELr~~flgs~LpeeeL~qIW~LaD 483 (1216)
...+....| ++|++.++.+|.+||..+|++.+|+|++.+++.+|+.++|++..|++||.++|
T Consensus 265 -----------------~~~q~~~s~~~~vsp~d~~~~~~if~q~d~~~dG~I~s~~~~~~f~~~gl~~~~l~~~w~l~d 327 (847)
T KOG0998|consen 265 -----------------SSMQLIVSWSPKVSPSDKQKYSKIFSQVDKDNDGSISSNEARNIFLPFGLSKPRLAHVWLLAD 327 (847)
T ss_pred -----------------cccccccccCcccChHHHHHHHHHHHhccccCCCcccccccccccccCCCChhhhhhhhhhcc
Confidence 122334445 46899999999999999999999999999999999999999999999999999
Q ss_pred CCCCCccCHHHHHHHHHHHHHH-hcCCCCCCCCCCCCCCCcccccCCCCCCCC--CCCCCCCCCCCCCCCCCC-----CC
Q 000940 484 QDNDGMLSLKEFCTALYLMERY-REGRPLPTMLPSTIMPDEALFSTTSQPQAP--HVSGTWGPVAGVQQPHAS-----RP 555 (1216)
Q Consensus 484 iD~DGkLdfdEFvvAM~LI~~~-l~G~~LP~~LPp~L~Pp~~~~~~~~~P~~~--~~~~~~~~~~g~~Q~~g~-----~p 555 (1216)
++++|+|+++|||++||++.++ ++|+.||.+||.+|+|+.. +.+..+... ++ ..|....+-.++..+ ..
T Consensus 328 ~~n~~~ls~~ef~~~~~~~~~~~~~g~~lP~vl~~s~~p~~~--~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~ 404 (847)
T KOG0998|consen 328 TQNTGTLSKDEFALAMHLLEQKRAEGRSLPSVLPSSLIPSEN--RKQTNPTTRASTA-ESPSSEQSSLAELKSLALSIAS 404 (847)
T ss_pred hhccCcccccccchhhhhhhhhhhcCCCCcccccccccCccc--cccCCcccccccc-ccCCcccccccccccccccccc
Confidence 9999999999999999999999 8999999999999999842 222222211 11 122222111111111 11
Q ss_pred CC-CCCCCCCCCCCCCCCCCCCCCCCCCchhhHHHHhhhcHHHHHHHHHhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q 000940 556 PT-GKPPRPFPVPQADRSVQTTPQKSKVPELEKHLMDQLSKEEQESLNAKLKEATEADKKVEELEKEILTSREKIQFCST 634 (1216)
Q Consensus 556 ~~-~rpp~p~l~pq~d~~~~~~~~ks~~P~ldd~lL~ql~~Eee~~ln~~rqEAeE~dkKL~ELeaEi~~lrqEIE~lrt 634 (1216)
.. .|+.+ .+.+......+.....+.++ +.+++..++....+-.++..+ .+.++.|+.+++..++++...++.
T Consensus 405 ~~~~k~~~----~~~~~~~~~~~~~~~s~~~~--~~~~l~~~~s~~~~l~~~~~~-~~~k~~e~~~~~s~s~~~~~~~~~ 477 (847)
T KOG0998|consen 405 NPREKPRL----EQSSSEAPRTTPVKTSPVLE--LANELSNLASTSQQLPAQKDT-VQDKLNELDAQKSQSKEKFSTTRK 477 (847)
T ss_pred cccccccc----ccccccccccCccccccccc--chhhhhhcchhhhccccccch-hhhhhhhhhhhhhHHHhhhhhhhh
Confidence 11 13311 12222122222222222222 245666666655544332222 568999999999999999999999
Q ss_pred HHHHHHHHHhhhhHHHHHHHHHHHhcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhcCCC
Q 000940 635 KMQELILYKSRCDNRLNEITERVSGDKREVELLAKKYEEKYKQSGDVASKLTLEEATFRDIQEKKMELYQAILKMEGESG 714 (1216)
Q Consensus 635 QmQEL~m~kqR~edeLnei~eEvs~lKrEiE~Lr~kYEE~~kQIsELqsqIA~lEaeLqDiQ~Q~~eLqaALa~lE~r~e 714 (1216)
+|+++.++.++|.++|+++..++..+++||+.++.+|+++++|+..|...|...|.+++
T Consensus 478 k~~~~~~~~s~~~~~~~~~~~~~~~~~~ei~~~~~~ln~~~qq~~~l~~~v~~~~~~ve--------------------- 536 (847)
T KOG0998|consen 478 KKQEEPQWISSLDNDLNLLPLQLSNDNREISSLEKELNELQQQLSVLEGSVKAIESQVE--------------------- 536 (847)
T ss_pred hhhccccccccccchhhhcccccccchhhHHHHHHHHhhhHHHHhHHhhhhhhhhhhhh---------------------
Confidence 99999999999999999999999999999999999998777777665555555554433
Q ss_pred CccHHHHHHHHHHHHHHHHHHHHHHHHhhCcccCcccccccccCcccCcccccchhccchhcccccccchhhhhhhcccc
Q 000940 715 DGTLQQHADHIQNELEELVKILNDRCKQYGLRAKPTLLVELPFGWQPGIQEGTADWDEDWDKLEDEGFTFVKELTLEVQN 794 (1216)
Q Consensus 715 da~LQeRlk~iQ~kL~eLEKaL~earkq~GL~aK~~~~vElp~g~~~~~qe~a~~w~edw~~~~d~gf~~~~~~t~~~~~ 794 (1216)
+|.+.|+++|.++....|..+..++.|.|+..++|....|.++|++.+. ...++|...+++
T Consensus 537 ----------------~l~~~L~~~~~~~~~~~s~~~~l~~~~~~~~~~~~~~~~~~k~~n~~~~---~s~~~l~~~~e~ 597 (847)
T KOG0998|consen 537 ----------------NLQKELLDLIYEMADTRSKSTLLDDSFKVGMELFEQLLKGSKLVNGKDQ---NSSTELAGYLEG 597 (847)
T ss_pred ----------------hhHhHHHHHHHHHHhhcccchhhhhhhhhhhhhhhhhhhhhhccccccc---cchhhhhhhccc
Confidence 3444444444444444444444455555555555555555555555422 344444444444
Q ss_pred cCC
Q 000940 795 VVA 797 (1216)
Q Consensus 795 ~~~ 797 (1216)
++.
T Consensus 598 ~~~ 600 (847)
T KOG0998|consen 598 TIN 600 (847)
T ss_pred ccc
Confidence 443
|
|
| >KOG1029 consensus Endocytic adaptor protein intersectin [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG1029 consensus Endocytic adaptor protein intersectin [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PF12763 EF-hand_4: Cytoskeletal-regulatory complex EF hand; PDB: 2QPT_A 2KSP_A 2KFG_A 2JQ6_A 2KFH_A 2KFF_A 1IQ3_A 3FIA_A 2KHN_A 2KGR_A | Back alignment and domain information |
|---|
| >PF12763 EF-hand_4: Cytoskeletal-regulatory complex EF hand; PDB: 2QPT_A 2KSP_A 2KFG_A 2JQ6_A 2KFH_A 2KFF_A 1IQ3_A 3FIA_A 2KHN_A 2KGR_A | Back alignment and domain information |
|---|
| >smart00027 EH Eps15 homology domain | Back alignment and domain information |
|---|
| >KOG1955 consensus Ral-GTPase effector RALBP1 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG0998 consensus Synaptic vesicle protein EHS-1 and related EH domain proteins [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG1955 consensus Ral-GTPase effector RALBP1 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >smart00027 EH Eps15 homology domain | Back alignment and domain information |
|---|
| >KOG1954 consensus Endocytosis/signaling protein EHD1 [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG1954 consensus Endocytosis/signaling protein EHD1 [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >cd00052 EH Eps15 homology domain; found in proteins implicated in endocytosis, vesicle transport, and signal transduction | Back alignment and domain information |
|---|
| >cd00052 EH Eps15 homology domain; found in proteins implicated in endocytosis, vesicle transport, and signal transduction | Back alignment and domain information |
|---|
| >PF13499 EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A 1TN4_A 1A2X_A 2CT9_B 2OTG_B 2OS8_B 1SNL_A 3O4Y_A 3J04_E | Back alignment and domain information |
|---|
| >cd05022 S-100A13 S-100A13: S-100A13 domain found in proteins similar to S100A13 | Back alignment and domain information |
|---|
| >KOG0027 consensus Calmodulin and related proteins (EF-Hand superfamily) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >COG5126 FRQ1 Ca2+-binding protein (EF-Hand superfamily) [Signal transduction mechanisms / Cytoskeleton / Cell division and chromosome partitioning / General function prediction only] | Back alignment and domain information |
|---|
| >KOG0027 consensus Calmodulin and related proteins (EF-Hand superfamily) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF13499 EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A 1TN4_A 1A2X_A 2CT9_B 2OTG_B 2OS8_B 1SNL_A 3O4Y_A 3J04_E | Back alignment and domain information |
|---|
| >cd05027 S-100B S-100B: S-100B domain found in proteins similar to S100B | Back alignment and domain information |
|---|
| >cd05025 S-100A1 S-100A1: S-100A1 domain found in proteins similar to S100A1 | Back alignment and domain information |
|---|
| >cd05026 S-100Z S-100Z: S-100Z domain found in proteins similar to S100Z | Back alignment and domain information |
|---|
| >cd05029 S-100A6 S-100A6: S-100A6 domain found in proteins similar to S100A6 | Back alignment and domain information |
|---|
| >cd05031 S-100A10_like S-100A10_like: S-100A10 domain found in proteins similar to S100A10 | Back alignment and domain information |
|---|
| >cd00213 S-100 S-100: S-100 domain, which represents the largest family within the superfamily of proteins carrying the Ca-binding EF-hand motif | Back alignment and domain information |
|---|
| >PTZ00183 centrin; Provisional | Back alignment and domain information |
|---|
| >cd05023 S-100A11 S-100A11: S-100A11 domain found in proteins similar to S100A11 | Back alignment and domain information |
|---|
| >PTZ00184 calmodulin; Provisional | Back alignment and domain information |
|---|
| >PRK11637 AmiB activator; Provisional | Back alignment and domain information |
|---|
| >COG5126 FRQ1 Ca2+-binding protein (EF-Hand superfamily) [Signal transduction mechanisms / Cytoskeleton / Cell division and chromosome partitioning / General function prediction only] | Back alignment and domain information |
|---|
| >PRK09039 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >cd05022 S-100A13 S-100A13: S-100A13 domain found in proteins similar to S100A13 | Back alignment and domain information |
|---|
| >cd00051 EFh EF-hand, calcium binding motif; A diverse superfamily of calcium sensors and calcium signal modulators; most examples in this alignment model have 2 active canonical EF hands | Back alignment and domain information |
|---|
| >cd00252 SPARC_EC SPARC_EC; extracellular Ca2+ binding domain (containing 2 EF-hand motifs) of SPARC and related proteins (QR1, SC1/hevin, testican and tsc-36/FRP) | Back alignment and domain information |
|---|
| >PF00038 Filament: Intermediate filament protein; InterPro: IPR016044 Intermediate filaments (IF) [, , ] are proteins which are primordial components of the cytoskeleton and the nuclear envelope | Back alignment and domain information |
|---|
| >cd05025 S-100A1 S-100A1: S-100A1 domain found in proteins similar to S100A1 | Back alignment and domain information |
|---|
| >cd05027 S-100B S-100B: S-100B domain found in proteins similar to S100B | Back alignment and domain information |
|---|
| >PF13833 EF-hand_8: EF-hand domain pair; PDB: 3KF9_A 1TTX_A 1WLZ_A 1ALV_A 1NX3_A 1ALW_A 1NX2_A 1NX1_A 1NX0_A 1DF0_A | Back alignment and domain information |
|---|
| >COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] | Back alignment and domain information |
|---|
| >PTZ00184 calmodulin; Provisional | Back alignment and domain information |
|---|
| >cd05029 S-100A6 S-100A6: S-100A6 domain found in proteins similar to S100A6 | Back alignment and domain information |
|---|
| >KOG0041 consensus Predicted Ca2+-binding protein, EF-Hand protein superfamily [General function prediction only] | Back alignment and domain information |
|---|
| >cd05031 S-100A10_like S-100A10_like: S-100A10 domain found in proteins similar to S100A10 | Back alignment and domain information |
|---|
| >PTZ00183 centrin; Provisional | Back alignment and domain information |
|---|
| >PRK09039 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >TIGR02169 SMC_prok_A chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >KOG0028 consensus Ca2+-binding protein (centrin/caltractin), EF-Hand superfamily protein [Cytoskeleton; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >TIGR02169 SMC_prok_A chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >PF08317 Spc7: Spc7 kinetochore protein; InterPro: IPR013253 This entry consists of cell division proteins which are required for kinetochore-spindle association [] | Back alignment and domain information |
|---|
| >COG1340 Uncharacterized archaeal coiled-coil protein [Function unknown] | Back alignment and domain information |
|---|
| >cd05030 calgranulins Calgranulins: S-100 domain found in proteins belonging to the Calgranulin subgroup of the S100 family of EF-hand calcium-modulated proteins, including S100A8, S100A9, and S100A12 | Back alignment and domain information |
|---|
| >TIGR02168 SMC_prok_B chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >cd05026 S-100Z S-100Z: S-100Z domain found in proteins similar to S100Z | Back alignment and domain information |
|---|
| >KOG0250 consensus DNA repair protein RAD18 (SMC family protein) [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >cd00213 S-100 S-100: S-100 domain, which represents the largest family within the superfamily of proteins carrying the Ca-binding EF-hand motif | Back alignment and domain information |
|---|
| >PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes | Back alignment and domain information |
|---|
| >KOG0034 consensus Ca2+/calmodulin-dependent protein phosphatase (calcineurin subunit B), EF-Hand superfamily protein [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF00038 Filament: Intermediate filament protein; InterPro: IPR016044 Intermediate filaments (IF) [, , ] are proteins which are primordial components of the cytoskeleton and the nuclear envelope | Back alignment and domain information |
|---|
| >PF14658 EF-hand_9: EF-hand domain | Back alignment and domain information |
|---|
| >cd05023 S-100A11 S-100A11: S-100A11 domain found in proteins similar to S100A11 | Back alignment and domain information |
|---|
| >smart00787 Spc7 Spc7 kinetochore protein | Back alignment and domain information |
|---|
| >PF12718 Tropomyosin_1: Tropomyosin like; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells | Back alignment and domain information |
|---|
| >KOG0028 consensus Ca2+-binding protein (centrin/caltractin), EF-Hand superfamily protein [Cytoskeleton; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PF12718 Tropomyosin_1: Tropomyosin like; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells | Back alignment and domain information |
|---|
| >KOG0250 consensus DNA repair protein RAD18 (SMC family protein) [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes | Back alignment and domain information |
|---|
| >cd00252 SPARC_EC SPARC_EC; extracellular Ca2+ binding domain (containing 2 EF-hand motifs) of SPARC and related proteins (QR1, SC1/hevin, testican and tsc-36/FRP) | Back alignment and domain information |
|---|
| >PF08317 Spc7: Spc7 kinetochore protein; InterPro: IPR013253 This entry consists of cell division proteins which are required for kinetochore-spindle association [] | Back alignment and domain information |
|---|
| >PRK02224 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >TIGR01843 type_I_hlyD type I secretion membrane fusion protein, HlyD family | Back alignment and domain information |
|---|
| >PRK04863 mukB cell division protein MukB; Provisional | Back alignment and domain information |
|---|
| >PHA02562 46 endonuclease subunit; Provisional | Back alignment and domain information |
|---|
| >cd00051 EFh EF-hand, calcium binding motif; A diverse superfamily of calcium sensors and calcium signal modulators; most examples in this alignment model have 2 active canonical EF hands | Back alignment and domain information |
|---|
| >KOG0971 consensus Microtubule-associated protein dynactin DCTN1/Glued [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton] | Back alignment and domain information |
|---|
| >COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] | Back alignment and domain information |
|---|
| >PHA02562 46 endonuclease subunit; Provisional | Back alignment and domain information |
|---|
| >PRK03918 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >PF13833 EF-hand_8: EF-hand domain pair; PDB: 3KF9_A 1TTX_A 1WLZ_A 1ALV_A 1NX3_A 1ALW_A 1NX2_A 1NX1_A 1NX0_A 1DF0_A | Back alignment and domain information |
|---|
| >PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT) | Back alignment and domain information |
|---|
| >KOG0977 consensus Nuclear envelope protein lamin, intermediate filament superfamily [Cell cycle control, cell division, chromosome partitioning; Nuclear structure] | Back alignment and domain information |
|---|
| >PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs | Back alignment and domain information |
|---|
| >KOG0037 consensus Ca2+-binding protein, EF-Hand protein superfamily [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF04849 HAP1_N: HAP1 N-terminal conserved region; InterPro: IPR006933 This family is defined by an N-terminal conserved region found in several huntingtin-associated protein 1 (HAP1) homologues | Back alignment and domain information |
|---|
| >COG1196 Smc Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PRK04863 mukB cell division protein MukB; Provisional | Back alignment and domain information |
|---|
| >KOG0031 consensus Myosin regulatory light chain, EF-Hand protein superfamily [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF00261 Tropomyosin: Tropomyosin; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells | Back alignment and domain information |
|---|
| >COG1196 Smc Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PF15070 GOLGA2L5: Putative golgin subfamily A member 2-like protein 5 | Back alignment and domain information |
|---|
| >PF10473 CENP-F_leu_zip: Leucine-rich repeats of kinetochore protein Cenp-F/LEK1; InterPro: IPR019513 Cenp-F, a centromeric kinetochore, microtubule-binding protein consisting of two 1,600-amino acid-long coils, is essential for the full functioning of the mitotic checkpoint pathway [, ] | Back alignment and domain information |
|---|
| >PRK02224 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >TIGR01843 type_I_hlyD type I secretion membrane fusion protein, HlyD family | Back alignment and domain information |
|---|
| >KOG0031 consensus Myosin regulatory light chain, EF-Hand protein superfamily [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF10186 Atg14: UV radiation resistance protein and autophagy-related subunit 14; InterPro: IPR018791 Class III phosphatidylinositol 3-kinase (PI3-kinase) regulates multiple membrane trafficking | Back alignment and domain information |
|---|
| >PF06008 Laminin_I: Laminin Domain I; InterPro: IPR009254 Laminins are glycoproteins that are major constituents of the basement membrane of cells | Back alignment and domain information |
|---|
| >COG4942 Membrane-bound metallopeptidase [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PF12128 DUF3584: Protein of unknown function (DUF3584); InterPro: IPR021979 This family consist of uncharacterised bacterial proteins | Back alignment and domain information |
|---|
| >PF04111 APG6: Autophagy protein Apg6; InterPro: IPR007243 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells | Back alignment and domain information |
|---|
| >PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT) | Back alignment and domain information |
|---|
| >TIGR03017 EpsF chain length determinant protein EpsF | Back alignment and domain information |
|---|
| >KOG0377 consensus Protein serine/threonine phosphatase RDGC/PPEF, contains STphosphatase and EF-hand domains [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0030 consensus Myosin essential light chain, EF-Hand protein superfamily [Cytoskeleton] | Back alignment and domain information |
|---|
| >COG3883 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >PLN02964 phosphatidylserine decarboxylase | Back alignment and domain information |
|---|
| >KOG0161 consensus Myosin class II heavy chain [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG0980 consensus Actin-binding protein SLA2/Huntingtin-interacting protein Hip1 [Cytoskeleton] | Back alignment and domain information |
|---|
| >TIGR03007 pepcterm_ChnLen polysaccharide chain length determinant protein, PEP-CTERM locus subfamily | Back alignment and domain information |
|---|
| >PF13851 GAS: Growth-arrest specific micro-tubule binding | Back alignment and domain information |
|---|
| >TIGR01005 eps_transp_fam exopolysaccharide transport protein family | Back alignment and domain information |
|---|
| >KOG0041 consensus Predicted Ca2+-binding protein, EF-Hand protein superfamily [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR00606 rad50 rad50 | Back alignment and domain information |
|---|
| >KOG0980 consensus Actin-binding protein SLA2/Huntingtin-interacting protein Hip1 [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF04156 IncA: IncA protein; InterPro: IPR007285 Chlamydia trachomatis is an obligate intracellular bacterium that develops within a parasitophorous vacuole termed an inclusion | Back alignment and domain information |
|---|
| >KOG0996 consensus Structural maintenance of chromosome protein 4 (chromosome condensation complex Condensin, subunit C) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0161 consensus Myosin class II heavy chain [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF07926 TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: IPR012929 This domain is found in a number of proteins, including TPR protein (P12270 from SWISSPROT) and yeast myosin-like proteins 1 (MLP1, Q02455 from SWISSPROT) and 2 (MLP2, P40457 from SWISSPROT) | Back alignment and domain information |
|---|
| >KOG0030 consensus Myosin essential light chain, EF-Hand protein superfamily [Cytoskeleton] | Back alignment and domain information |
|---|
| >TIGR00606 rad50 rad50 | Back alignment and domain information |
|---|
| >KOG0996 consensus Structural maintenance of chromosome protein 4 (chromosome condensation complex Condensin, subunit C) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PF04111 APG6: Autophagy protein Apg6; InterPro: IPR007243 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells | Back alignment and domain information |
|---|
| >KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] | Back alignment and domain information |
|---|
| >COG4372 Uncharacterized protein conserved in bacteria with the myosin-like domain [Function unknown] | Back alignment and domain information |
|---|
| >PRK11281 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >cd05030 calgranulins Calgranulins: S-100 domain found in proteins belonging to the Calgranulin subgroup of the S100 family of EF-hand calcium-modulated proteins, including S100A8, S100A9, and S100A12 | Back alignment and domain information |
|---|
| >PF15619 Lebercilin: Ciliary protein causing Leber congenital amaurosis disease | Back alignment and domain information |
|---|
| >KOG0995 consensus Centromere-associated protein HEC1 [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PF12128 DUF3584: Protein of unknown function (DUF3584); InterPro: IPR021979 This family consist of uncharacterised bacterial proteins | Back alignment and domain information |
|---|
| >smart00787 Spc7 Spc7 kinetochore protein | Back alignment and domain information |
|---|
| >COG4372 Uncharacterized protein conserved in bacteria with the myosin-like domain [Function unknown] | Back alignment and domain information |
|---|
| >PRK09841 cryptic autophosphorylating protein tyrosine kinase Etk; Provisional | Back alignment and domain information |
|---|
| >PF04156 IncA: IncA protein; InterPro: IPR007285 Chlamydia trachomatis is an obligate intracellular bacterium that develops within a parasitophorous vacuole termed an inclusion | Back alignment and domain information |
|---|
| >cd05024 S-100A10 S-100A10: A subgroup of the S-100A10 domain found in proteins similar to S100A10 | Back alignment and domain information |
|---|
| >PF12761 End3: Actin cytoskeleton-regulatory complex protein END3 | Back alignment and domain information |
|---|
| >TIGR03007 pepcterm_ChnLen polysaccharide chain length determinant protein, PEP-CTERM locus subfamily | Back alignment and domain information |
|---|
| >PRK04778 septation ring formation regulator EzrA; Provisional | Back alignment and domain information |
|---|
| >KOG0034 consensus Ca2+/calmodulin-dependent protein phosphatase (calcineurin subunit B), EF-Hand superfamily protein [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0977 consensus Nuclear envelope protein lamin, intermediate filament superfamily [Cell cycle control, cell division, chromosome partitioning; Nuclear structure] | Back alignment and domain information |
|---|
| >TIGR02680 conserved hypothetical protein TIGR02680 | Back alignment and domain information |
|---|
| >PF05667 DUF812: Protein of unknown function (DUF812); InterPro: IPR008530 This family consists of several eukaryotic proteins of unknown function | Back alignment and domain information |
|---|
| >PF00261 Tropomyosin: Tropomyosin; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells | Back alignment and domain information |
|---|
| >COG1340 Uncharacterized archaeal coiled-coil protein [Function unknown] | Back alignment and domain information |
|---|
| >PRK11519 tyrosine kinase; Provisional | Back alignment and domain information |
|---|
| >PF04012 PspA_IM30: PspA/IM30 family; InterPro: IPR007157 This family includes PspA a protein that suppresses sigma54-dependent transcription | Back alignment and domain information |
|---|
| >PF12325 TMF_TATA_bd: TATA element modulatory factor 1 TATA binding; InterPro: IPR022091 This is the C-terminal conserved coiled coil region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes [] | Back alignment and domain information |
|---|
| >KOG0044 consensus Ca2+ sensor (EF-Hand superfamily) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PLN02964 phosphatidylserine decarboxylase | Back alignment and domain information |
|---|
| >KOG0994 consensus Extracellular matrix glycoprotein Laminin subunit beta [Extracellular structures] | Back alignment and domain information |
|---|
| >PF12795 MscS_porin: Mechanosensitive ion channel porin domain | Back alignment and domain information |
|---|
| >KOG4674 consensus Uncharacterized conserved coiled-coil protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0933 consensus Structural maintenance of chromosome protein 2 (chromosome condensation complex Condensin, subunit E) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PF11932 DUF3450: Protein of unknown function (DUF3450); InterPro: IPR016866 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function | Back alignment and domain information |
|---|
| >PF05701 WEMBL: Weak chloroplast movement under blue light; InterPro: IPR008545 This family consists of several plant proteins of unknown function | Back alignment and domain information |
|---|
| >KOG0963 consensus Transcription factor/CCAAT displacement protein CDP1 [Transcription] | Back alignment and domain information |
|---|
| >PF14662 CCDC155: Coiled-coil region of CCDC155 | Back alignment and domain information |
|---|
| >KOG2991 consensus Splicing regulator [RNA processing and modification] | Back alignment and domain information |
|---|
| >COG3883 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >TIGR01000 bacteriocin_acc bacteriocin secretion accessory protein | Back alignment and domain information |
|---|
| >PF15070 GOLGA2L5: Putative golgin subfamily A member 2-like protein 5 | Back alignment and domain information |
|---|
| >KOG0999 consensus Microtubule-associated protein Bicaudal-D [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PF14658 EF-hand_9: EF-hand domain | Back alignment and domain information |
|---|
| >PF13851 GAS: Growth-arrest specific micro-tubule binding | Back alignment and domain information |
|---|
| >KOG0044 consensus Ca2+ sensor (EF-Hand superfamily) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1853 consensus LIS1-interacting protein NUDE [Cytoskeleton] | Back alignment and domain information |
|---|
| >PRK12309 transaldolase/EF-hand domain-containing protein; Provisional | Back alignment and domain information |
|---|
| >KOG4360 consensus Uncharacterized coiled coil protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0964 consensus Structural maintenance of chromosome protein 3 (sister chromatid cohesion complex Cohesin, subunit SMC3) [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PF15397 DUF4618: Domain of unknown function (DUF4618) | Back alignment and domain information |
|---|
| >KOG0933 consensus Structural maintenance of chromosome protein 2 (chromosome condensation complex Condensin, subunit E) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PLN02939 transferase, transferring glycosyl groups | Back alignment and domain information |
|---|
| >PF10174 Cast: RIM-binding protein of the cytomatrix active zone; InterPro: IPR019323 This entry represents a family of proteins that form part of the CAZ (cytomatrix at the active zone) complex which is involved in determining the site of synaptic vesicle fusion [] | Back alignment and domain information |
|---|
| >PRK10929 putative mechanosensitive channel protein; Provisional | Back alignment and domain information |
|---|
| >TIGR01005 eps_transp_fam exopolysaccharide transport protein family | Back alignment and domain information |
|---|
| >PF10186 Atg14: UV radiation resistance protein and autophagy-related subunit 14; InterPro: IPR018791 Class III phosphatidylinositol 3-kinase (PI3-kinase) regulates multiple membrane trafficking | Back alignment and domain information |
|---|
| >PF09730 BicD: Microtubule-associated protein Bicaudal-D; InterPro: IPR018477 BicD proteins consist of three coiled-coiled domains and are involved in dynein-mediated minus end-directed transport from the Golgi apparatus to the endoplasmic reticulum (ER) [] | Back alignment and domain information |
|---|
| >PF07111 HCR: Alpha helical coiled-coil rod protein (HCR); InterPro: IPR009800 This family consists of several mammalian alpha helical coiled-coil rod HCR proteins | Back alignment and domain information |
|---|
| >PRK12704 phosphodiesterase; Provisional | Back alignment and domain information |
|---|
| >TIGR01010 BexC_CtrB_KpsE polysaccharide export inner-membrane protein, BexC/CtrB/KpsE family | Back alignment and domain information |
|---|
| >PF00036 EF-hand_1: EF hand; InterPro: IPR018248 Many calcium-binding proteins belong to the same evolutionary family and share a type of calcium-binding domain known as the EF-hand | Back alignment and domain information |
|---|
| >KOG0046 consensus Ca2+-binding actin-bundling protein (fimbrin/plastin), EF-Hand protein superfamily [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF07926 TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: IPR012929 This domain is found in a number of proteins, including TPR protein (P12270 from SWISSPROT) and yeast myosin-like proteins 1 (MLP1, Q02455 from SWISSPROT) and 2 (MLP2, P40457 from SWISSPROT) | Back alignment and domain information |
|---|
| >TIGR02977 phageshock_pspA phage shock protein A | Back alignment and domain information |
|---|
| >PF15619 Lebercilin: Ciliary protein causing Leber congenital amaurosis disease | Back alignment and domain information |
|---|
| >PF11559 ADIP: Afadin- and alpha -actinin-Binding; InterPro: IPR021622 This family is found in mammals where it is localised at cell-cell adherens junctions [], and in Sch | Back alignment and domain information |
|---|
| >KOG4643 consensus Uncharacterized coiled-coil protein [Function unknown] | Back alignment and domain information |
|---|
| >TIGR03319 YmdA_YtgF conserved hypothetical protein YmdA/YtgF | Back alignment and domain information |
|---|
| >KOG1853 consensus LIS1-interacting protein NUDE [Cytoskeleton] | Back alignment and domain information |
|---|
| >TIGR00634 recN DNA repair protein RecN | Back alignment and domain information |
|---|
| >KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK00106 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >COG2433 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG4302 consensus Microtubule-associated protein essential for anaphase spindle elongation [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG0971 consensus Microtubule-associated protein dynactin DCTN1/Glued [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG0976 consensus Rho/Rac1-interacting serine/threonine kinase Citron [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF13870 DUF4201: Domain of unknown function (DUF4201) | Back alignment and domain information |
|---|
| >KOG4673 consensus Transcription factor TMF, TATA element modulatory factor [Transcription] | Back alignment and domain information |
|---|
| >PF10481 CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR018463 Mitosin or centromere-associated protein-F (Cenp-F) is found bound across the centromere as one of the proteins of the outer layer of the kinetochore [] | Back alignment and domain information |
|---|
| >PF14915 CCDC144C: CCDC144C protein coiled-coil region | Back alignment and domain information |
|---|
| >PF13514 AAA_27: AAA domain | Back alignment and domain information |
|---|
| >PF06818 Fez1: Fez1; InterPro: IPR009638 This family represents the eukaryotic Fez1 protein | Back alignment and domain information |
|---|
| >KOG0994 consensus Extracellular matrix glycoprotein Laminin subunit beta [Extracellular structures] | Back alignment and domain information |
|---|
| >COG5185 HEC1 Protein involved in chromosome segregation, interacts with SMC proteins [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >COG1842 PspA Phage shock protein A (IM30), suppresses sigma54-dependent transcription [Transcription / Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF05701 WEMBL: Weak chloroplast movement under blue light; InterPro: IPR008545 This family consists of several plant proteins of unknown function | Back alignment and domain information |
|---|
| >PF10498 IFT57: Intra-flagellar transport protein 57 ; InterPro: IPR019530 Eukaryotic cilia and flagella are specialised organelles found at the periphery of cells of diverse organisms | Back alignment and domain information |
|---|
| >PRK01156 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >PF15397 DUF4618: Domain of unknown function (DUF4618) | Back alignment and domain information |
|---|
| >KOG0976 consensus Rho/Rac1-interacting serine/threonine kinase Citron [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0037 consensus Ca2+-binding protein, EF-Hand protein superfamily [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF00036 EF-hand_1: EF hand; InterPro: IPR018248 Many calcium-binding proteins belong to the same evolutionary family and share a type of calcium-binding domain known as the EF-hand | Back alignment and domain information |
|---|
| >PF09789 DUF2353: Uncharacterized coiled-coil protein (DUF2353); InterPro: IPR019179 Members of this family have been annotated as being coiled-coil domain-containing protein 149, however they currently have no known function | Back alignment and domain information |
|---|
| >PF05010 TACC: Transforming acidic coiled-coil-containing protein (TACC); InterPro: IPR007707 This family contains the proteins TACC 1, 2 and 3, found concentrated in the centrosomes of eukaryotes which may play a conserved role in organising centrosomal microtubules | Back alignment and domain information |
|---|
| >KOG0964 consensus Structural maintenance of chromosome protein 3 (sister chromatid cohesion complex Cohesin, subunit SMC3) [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0946 consensus ER-Golgi vesicle-tethering protein p115 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PF14915 CCDC144C: CCDC144C protein coiled-coil region | Back alignment and domain information |
|---|
| >KOG2129 consensus Uncharacterized conserved protein H4 [Function unknown] | Back alignment and domain information |
|---|
| >PF10473 CENP-F_leu_zip: Leucine-rich repeats of kinetochore protein Cenp-F/LEK1; InterPro: IPR019513 Cenp-F, a centromeric kinetochore, microtubule-binding protein consisting of two 1,600-amino acid-long coils, is essential for the full functioning of the mitotic checkpoint pathway [, ] | Back alignment and domain information |
|---|
| >PRK01156 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >KOG3478 consensus Prefoldin subunit 6, KE2 family [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0979 consensus Structural maintenance of chromosome protein SMC5/Spr18, SMC superfamily [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PRK11281 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF13405 EF-hand_6: EF-hand domain; PDB: 2AMI_A 3QRX_A 1W7J_B 1OE9_B 1W7I_B 1KFU_S 1KFX_S 2BL0_B 1Y1X_B 3MSE_B | Back alignment and domain information |
|---|
| >PF13870 DUF4201: Domain of unknown function (DUF4201) | Back alignment and domain information |
|---|
| >PRK10869 recombination and repair protein; Provisional | Back alignment and domain information |
|---|
| >PRK12309 transaldolase/EF-hand domain-containing protein; Provisional | Back alignment and domain information |
|---|
| >PF06160 EzrA: Septation ring formation regulator, EzrA ; InterPro: IPR010379 During the bacterial cell cycle, the tubulin-like cell-division protein FtsZ polymerises into a ring structure that establishes the location of the nascent division site | Back alignment and domain information |
|---|
| >PRK10698 phage shock protein PspA; Provisional | Back alignment and domain information |
|---|
| >KOG0995 consensus Centromere-associated protein HEC1 [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PF09304 Cortex-I_coil: Cortexillin I, coiled coil; InterPro: IPR015383 This domain is predominantly found in the actin-bundling protein cortexillin I from Dictyostelium discoideum (Slime mold) | Back alignment and domain information |
|---|
| >KOG0999 consensus Microtubule-associated protein Bicaudal-D [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >TIGR03017 EpsF chain length determinant protein EpsF | Back alignment and domain information |
|---|
| >PF10146 zf-C4H2: Zinc finger-containing protein ; InterPro: IPR018482 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >KOG4673 consensus Transcription factor TMF, TATA element modulatory factor [Transcription] | Back alignment and domain information |
|---|
| >COG4942 Membrane-bound metallopeptidase [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PF09789 DUF2353: Uncharacterized coiled-coil protein (DUF2353); InterPro: IPR019179 Members of this family have been annotated as being coiled-coil domain-containing protein 149, however they currently have no known function | Back alignment and domain information |
|---|
| >KOG0038 consensus Ca2+-binding kinase interacting protein (KIP) (EF-Hand protein superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR02680 conserved hypothetical protein TIGR02680 | Back alignment and domain information |
|---|
| >PF04849 HAP1_N: HAP1 N-terminal conserved region; InterPro: IPR006933 This family is defined by an N-terminal conserved region found in several huntingtin-associated protein 1 (HAP1) homologues | Back alignment and domain information |
|---|
| >KOG0377 consensus Protein serine/threonine phosphatase RDGC/PPEF, contains STphosphatase and EF-hand domains [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0018 consensus Structural maintenance of chromosome protein 1 (sister chromatid cohesion complex Cohesin, subunit SMC1) [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG4807 consensus F-actin binding protein, regulates actin cytoskeletal organization [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] | Back alignment and domain information |
|---|
| >PRK03947 prefoldin subunit alpha; Reviewed | Back alignment and domain information |
|---|
| >TIGR01000 bacteriocin_acc bacteriocin secretion accessory protein | Back alignment and domain information |
|---|
| >PF10174 Cast: RIM-binding protein of the cytomatrix active zone; InterPro: IPR019323 This entry represents a family of proteins that form part of the CAZ (cytomatrix at the active zone) complex which is involved in determining the site of synaptic vesicle fusion [] | Back alignment and domain information |
|---|
| >PF05667 DUF812: Protein of unknown function (DUF812); InterPro: IPR008530 This family consists of several eukaryotic proteins of unknown function | Back alignment and domain information |
|---|
| >PF06008 Laminin_I: Laminin Domain I; InterPro: IPR009254 Laminins are glycoproteins that are major constituents of the basement membrane of cells | Back alignment and domain information |
|---|
| >PF13514 AAA_27: AAA domain | Back alignment and domain information |
|---|
| >PRK10884 SH3 domain-containing protein; Provisional | Back alignment and domain information |
|---|
| >cd05024 S-100A10 S-100A10: A subgroup of the S-100A10 domain found in proteins similar to S100A10 | Back alignment and domain information |
|---|
| >KOG0036 consensus Predicted mitochondrial carrier protein [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PF10481 CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR018463 Mitosin or centromere-associated protein-F (Cenp-F) is found bound across the centromere as one of the proteins of the outer layer of the kinetochore [] | Back alignment and domain information |
|---|
| >KOG0243 consensus Kinesin-like protein [Cytoskeleton] | Back alignment and domain information |
|---|
| >TIGR02338 gimC_beta prefoldin, beta subunit, archaeal | Back alignment and domain information |
|---|
| >KOG0040 consensus Ca2+-binding actin-bundling protein (spectrin), alpha chain (EF-Hand protein superfamily) [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF04012 PspA_IM30: PspA/IM30 family; InterPro: IPR007157 This family includes PspA a protein that suppresses sigma54-dependent transcription | Back alignment and domain information |
|---|
| >KOG0036 consensus Predicted mitochondrial carrier protein [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PRK10476 multidrug resistance protein MdtN; Provisional | Back alignment and domain information |
|---|
| >KOG0946 consensus ER-Golgi vesicle-tethering protein p115 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PF14662 CCDC155: Coiled-coil region of CCDC155 | Back alignment and domain information |
|---|
| >PF07106 TBPIP: Tat binding protein 1(TBP-1)-interacting protein (TBPIP); InterPro: IPR010776 This family consists of several eukaryotic TBP-1 interacting protein (TBPIP) sequences | Back alignment and domain information |
|---|
| >COG2433 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG4674 consensus Uncharacterized conserved coiled-coil protein [Function unknown] | Back alignment and domain information |
|---|
| >PF15290 Syntaphilin: Golgi-localised syntaxin-1-binding clamp | Back alignment and domain information |
|---|
| >PF06120 Phage_HK97_TLTM: Tail length tape measure protein; InterPro: IPR009302 This entry consists of the tail length tape measure protein from Bacteriophage HK97 and related sequences from Escherichia coli (strain K12) | Back alignment and domain information |
|---|
| >COG4717 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF10146 zf-C4H2: Zinc finger-containing protein ; InterPro: IPR018482 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >PF05278 PEARLI-4: Arabidopsis phospholipase-like protein (PEARLI 4); InterPro: IPR007942 This family contains several phospholipase-like proteins from Arabidopsis thaliana and other members of the Streptophyta which are homologous to PEARLI 4 | Back alignment and domain information |
|---|
| >cd00632 Prefoldin_beta Prefoldin beta; Prefoldin is a hexameric molecular chaperone complex, composed of two evolutionarily related subunits (alpha and beta), which are found in both eukaryotes and archaea | Back alignment and domain information |
|---|
| >KOG0979 consensus Structural maintenance of chromosome protein SMC5/Spr18, SMC superfamily [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG4302 consensus Microtubule-associated protein essential for anaphase spindle elongation [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton] | Back alignment and domain information |
|---|
| >PF06785 UPF0242: Uncharacterised protein family (UPF0242); InterPro: IPR009623 This is a group of proteins of unknown function | Back alignment and domain information |
|---|
| >KOG4643 consensus Uncharacterized coiled-coil protein [Function unknown] | Back alignment and domain information |
|---|
| >PF11932 DUF3450: Protein of unknown function (DUF3450); InterPro: IPR016866 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function | Back alignment and domain information |
|---|
| >KOG0612 consensus Rho-associated, coiled-coil containing protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >TIGR02971 heterocyst_DevB ABC exporter membrane fusion protein, DevB family | Back alignment and domain information |
|---|
| >KOG4593 consensus Mitotic checkpoint protein MAD1 [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PF15066 CAGE1: Cancer-associated gene protein 1 family | Back alignment and domain information |
|---|
| >PRK09841 cryptic autophosphorylating protein tyrosine kinase Etk; Provisional | Back alignment and domain information |
|---|
| >PF11559 ADIP: Afadin- and alpha -actinin-Binding; InterPro: IPR021622 This family is found in mammals where it is localised at cell-cell adherens junctions [], and in Sch | Back alignment and domain information |
|---|
| >KOG4223 consensus Reticulocalbin, calumenin, DNA supercoiling factor, and related Ca2+-binding proteins of the CREC family (EF-Hand protein superfamily) [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >COG0497 RecN ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >KOG0963 consensus Transcription factor/CCAAT displacement protein CDP1 [Transcription] | Back alignment and domain information |
|---|
| >PF05911 DUF869: Plant protein of unknown function (DUF869); InterPro: IPR008587 This family consists of a number of sequences found in plants | Back alignment and domain information |
|---|
| >PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs | Back alignment and domain information |
|---|
| >PF13805 Pil1: Eisosome component PIL1; PDB: 3PLT_B | Back alignment and domain information |
|---|
| >PF05911 DUF869: Plant protein of unknown function (DUF869); InterPro: IPR008587 This family consists of a number of sequences found in plants | Back alignment and domain information |
|---|
| >PF10475 DUF2450: Protein of unknown function N-terminal domain (DUF2450) ; InterPro: IPR019515 This entry represents Vacuolar protein sorting-associated protein 54, and is thought to be involved in retrograde transport from early and late endosomes to late Golgi found in eukaryotes, but its function is not known | Back alignment and domain information |
|---|
| >PF13202 EF-hand_5: EF hand; PDB: 3DD4_A 2Q4U_A 2BE4_A 1UHJ_B 1UHI_A 1UHH_B 1EJ3_B 1UHK_A 2ZFD_A 1UHN_A | Back alignment and domain information |
|---|
| >PRK10361 DNA recombination protein RmuC; Provisional | Back alignment and domain information |
|---|
| >PF00769 ERM: Ezrin/radixin/moesin family; InterPro: IPR011259 The ERM family consists of three closely-related proteins, ezrin, radixin and moesin [] | Back alignment and domain information |
|---|
| >KOG2129 consensus Uncharacterized conserved protein H4 [Function unknown] | Back alignment and domain information |
|---|
| >PF14988 DUF4515: Domain of unknown function (DUF4515) | Back alignment and domain information |
|---|
| >PF09731 Mitofilin: Mitochondrial inner membrane protein; InterPro: IPR019133 Mitofilin controls mitochondrial cristae morphology | Back alignment and domain information |
|---|
| >PRK09343 prefoldin subunit beta; Provisional | Back alignment and domain information |
|---|
| >PRK10884 SH3 domain-containing protein; Provisional | Back alignment and domain information |
|---|
| >PF06160 EzrA: Septation ring formation regulator, EzrA ; InterPro: IPR010379 During the bacterial cell cycle, the tubulin-like cell-division protein FtsZ polymerises into a ring structure that establishes the location of the nascent division site | Back alignment and domain information |
|---|
| >PRK15178 Vi polysaccharide export inner membrane protein VexD; Provisional | Back alignment and domain information |
|---|
| >KOG0612 consensus Rho-associated, coiled-coil containing protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG3091 consensus Nuclear pore complex, p54 component (sc Nup57) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >TIGR02977 phageshock_pspA phage shock protein A | Back alignment and domain information |
|---|
| >PF09731 Mitofilin: Mitochondrial inner membrane protein; InterPro: IPR019133 Mitofilin controls mitochondrial cristae morphology | Back alignment and domain information |
|---|
| >PF12252 SidE: Dot/Icm substrate protein; InterPro: IPR021014 This entry represents bacterial proteins that are typically between 397 and 1543 amino acids in length including SidE protein in the Dot/Icm pathway of Legionella pneumophila bacteria | Back alignment and domain information |
|---|
| >COG5185 HEC1 Protein involved in chromosome segregation, interacts with SMC proteins [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG1899 consensus LAR transmembrane tyrosine phosphatase-interacting protein liprin [General function prediction only] | Back alignment and domain information |
|---|
| >PF15272 BBP1_C: Spindle pole body component BBP1, C-terminal | Back alignment and domain information |
|---|
| >PF10591 SPARC_Ca_bdg: Secreted protein acidic and rich in cysteine Ca binding region; InterPro: IPR019577 This entry represents the calcium-binding domain found in SPARC (Secreted Protein Acidic and Rich in Cysteine) and Testican (also known as SPOCK; or SParc/Osteonectin, Cwcv and Kazal-like domains) proteins | Back alignment and domain information |
|---|
| >COG3206 GumC Uncharacterized protein involved in exopolysaccharide biosynthesis [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >PF04949 Transcrip_act: Transcriptional activator; InterPro: IPR007033 Golgins are a family of coiled-coil proteins associated with the Golgi apparatus necessary for tethering events in membrane fusion and as structural supports for Golgi cisternae [] | Back alignment and domain information |
|---|
| >PF04582 Reo_sigmaC: Reovirus sigma C capsid protein; InterPro: IPR007662 Protein sigmaC in its native state was shown to be a homotrimer | Back alignment and domain information |
|---|
| >PF08580 KAR9: Yeast cortical protein KAR9; InterPro: IPR013889 The KAR9 protein in Saccharomyces cerevisiae (Baker's yeast) is a cytoskeletal protein required for karyogamy, correct positioning of the mitotic spindle and for orientation of cytoplasmic microtubules [] | Back alignment and domain information |
|---|
| >KOG4460 consensus Nuclear pore complex, Nup88/rNup84 component [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PRK11519 tyrosine kinase; Provisional | Back alignment and domain information |
|---|
| >PF12795 MscS_porin: Mechanosensitive ion channel porin domain | Back alignment and domain information |
|---|
| >KOG0018 consensus Structural maintenance of chromosome protein 1 (sister chromatid cohesion complex Cohesin, subunit SMC1) [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >COG1730 GIM5 Predicted prefoldin, molecular chaperone implicated in de novo protein folding [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK10698 phage shock protein PspA; Provisional | Back alignment and domain information |
|---|
| >PF09730 BicD: Microtubule-associated protein Bicaudal-D; InterPro: IPR018477 BicD proteins consist of three coiled-coiled domains and are involved in dynein-mediated minus end-directed transport from the Golgi apparatus to the endoplasmic reticulum (ER) [] | Back alignment and domain information |
|---|
| >PF10212 TTKRSYEDQ: Predicted coiled-coil domain-containing protein; InterPro: IPR019348 This entry represents a C-terminal 500 residue region, which contains a conserved TTKRSYEDQ motif | Back alignment and domain information |
|---|
| >PF05010 TACC: Transforming acidic coiled-coil-containing protein (TACC); InterPro: IPR007707 This family contains the proteins TACC 1, 2 and 3, found concentrated in the centrosomes of eukaryotes which may play a conserved role in organising centrosomal microtubules | Back alignment and domain information |
|---|
| >PF12072 DUF3552: Domain of unknown function (DUF3552); InterPro: IPR022711 This presumed domain is functionally uncharacterised | Back alignment and domain information |
|---|
| >TIGR00998 8a0101 efflux pump membrane protein (multidrug resistance protein A) | Back alignment and domain information |
|---|
| >PF13405 EF-hand_6: EF-hand domain; PDB: 2AMI_A 3QRX_A 1W7J_B 1OE9_B 1W7I_B 1KFU_S 1KFX_S 2BL0_B 1Y1X_B 3MSE_B | Back alignment and domain information |
|---|
| >PF07111 HCR: Alpha helical coiled-coil rod protein (HCR); InterPro: IPR009800 This family consists of several mammalian alpha helical coiled-coil rod HCR proteins | Back alignment and domain information |
|---|
| >KOG4572 consensus Predicted DNA-binding transcription factor, interacts with stathmin [Transcription; General function prediction only; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF02050 FliJ: Flagellar FliJ protein; InterPro: IPR012823 Many flagellar proteins are exported by a flagellum-specific export pathway | Back alignment and domain information |
|---|
| >TIGR00634 recN DNA repair protein RecN | Back alignment and domain information |
|---|
| >PF12325 TMF_TATA_bd: TATA element modulatory factor 1 TATA binding; InterPro: IPR022091 This is the C-terminal conserved coiled coil region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes [] | Back alignment and domain information |
|---|
| >KOG0288 consensus WD40 repeat protein TipD [General function prediction only] | Back alignment and domain information |
|---|
| >PF06818 Fez1: Fez1; InterPro: IPR009638 This family represents the eukaryotic Fez1 protein | Back alignment and domain information |
|---|
| >PF09755 DUF2046: Uncharacterized conserved protein H4 (DUF2046); InterPro: IPR019152 This is the conserved N-terminal 350 residues of a family of proteins of unknown function possibly containing a coiled-coil domain | Back alignment and domain information |
|---|
| >PF09304 Cortex-I_coil: Cortexillin I, coiled coil; InterPro: IPR015383 This domain is predominantly found in the actin-bundling protein cortexillin I from Dictyostelium discoideum (Slime mold) | Back alignment and domain information |
|---|
| >KOG2751 consensus Beclin-like protein [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1003 consensus Actin filament-coating protein tropomyosin [Cytoskeleton] | Back alignment and domain information |
|---|
| >COG3096 MukB Uncharacterized protein involved in chromosome partitioning [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0243 consensus Kinesin-like protein [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF03148 Tektin: Tektin family; InterPro: IPR000435 Tektin heteropolymers form unique protofilaments of flagellar microtubules [] | Back alignment and domain information |
|---|
| >PRK03947 prefoldin subunit alpha; Reviewed | Back alignment and domain information |
|---|
| >KOG2751 consensus Beclin-like protein [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF05483 SCP-1: Synaptonemal complex protein 1 (SCP-1); InterPro: IPR008827 Synaptonemal complex protein 1 (SCP-1) is the major component of the transverse filaments of the synaptonemal complex | Back alignment and domain information |
|---|
| >KOG0982 consensus Centrosomal protein Nuf [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton] | Back alignment and domain information |
|---|
| >PF09787 Golgin_A5: Golgin subfamily A member 5; InterPro: IPR019177 This entry represents a family of proteins involved in maintaining Golgi structure | Back alignment and domain information |
|---|
| >KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4593 consensus Mitotic checkpoint protein MAD1 [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >smart00502 BBC B-Box C-terminal domain | Back alignment and domain information |
|---|
| >TIGR03794 NHPM_micro_HlyD NHPM bacteriocin system secretion protein | Back alignment and domain information |
|---|
| >PF01920 Prefoldin_2: Prefoldin subunit; InterPro: IPR002777 Prefoldin (PFD) is a chaperone that interacts exclusively with type II chaperonins, hetero-oligomers lacking an obligate co-chaperonin that are found only in eukaryotes (chaperonin-containing T-complex polypeptide-1 (CCT)) and archaea | Back alignment and domain information |
|---|
| >PF13166 AAA_13: AAA domain | Back alignment and domain information |
|---|
| >PF15294 Leu_zip: Leucine zipper | Back alignment and domain information |
|---|
| >PRK10361 DNA recombination protein RmuC; Provisional | Back alignment and domain information |
|---|
| >PF05384 DegS: Sensor protein DegS; InterPro: IPR008595 This is a group of Bacillus DegS proteins | Back alignment and domain information |
|---|
| >KOG4223 consensus Reticulocalbin, calumenin, DNA supercoiling factor, and related Ca2+-binding proteins of the CREC family (EF-Hand protein superfamily) [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PF13202 EF-hand_5: EF hand; PDB: 3DD4_A 2Q4U_A 2BE4_A 1UHJ_B 1UHI_A 1UHH_B 1EJ3_B 1UHK_A 2ZFD_A 1UHN_A | Back alignment and domain information |
|---|
| >PRK12704 phosphodiesterase; Provisional | Back alignment and domain information |
|---|
| >PRK00409 recombination and DNA strand exchange inhibitor protein; Reviewed | Back alignment and domain information |
|---|
| >COG4717 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >COG1842 PspA Phage shock protein A (IM30), suppresses sigma54-dependent transcription [Transcription / Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF07798 DUF1640: Protein of unknown function (DUF1640); InterPro: IPR024461 This family consists of uncharacterised proteins | Back alignment and domain information |
|---|
| >PRK10476 multidrug resistance protein MdtN; Provisional | Back alignment and domain information |
|---|
| >PRK10246 exonuclease subunit SbcC; Provisional | Back alignment and domain information |
|---|
| >cd00176 SPEC Spectrin repeats, found in several proteins involved in cytoskeletal structure; family members include spectrin, alpha-actinin and dystrophin; the spectrin repeat forms a three helix bundle with the second helix interrupted by proline in some sequences; the repeats are independent folding units; tandem repeats are found in differing numbers and arrange in an antiparallel manner to form dimers; the repeats are defined by a characteristic tryptophan (W) residue in helix A and a leucine (L) at the carboxyl end of helix C and separated by a linker of 5 residues; two copies of the repeat are present here | Back alignment and domain information |
|---|
| >PF10591 SPARC_Ca_bdg: Secreted protein acidic and rich in cysteine Ca binding region; InterPro: IPR019577 This entry represents the calcium-binding domain found in SPARC (Secreted Protein Acidic and Rich in Cysteine) and Testican (also known as SPOCK; or SParc/Osteonectin, Cwcv and Kazal-like domains) proteins | Back alignment and domain information |
|---|
| >KOG0240 consensus Kinesin (SMY1 subfamily) [Cytoskeleton] | Back alignment and domain information |
|---|
| >COG4026 Uncharacterized protein containing TOPRIM domain, potential nuclease [General function prediction only] | Back alignment and domain information |
|---|
| >PRK12705 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK10929 putative mechanosensitive channel protein; Provisional | Back alignment and domain information |
|---|
| >PF09728 Taxilin: Myosin-like coiled-coil protein; InterPro: IPR019132 Taxilin contains an extraordinarily long coiled-coil domain in its C-terminal half and is ubiquitously expressed | Back alignment and domain information |
|---|
| >KOG0962 consensus DNA repair protein RAD50, ABC-type ATPase/SMC superfamily [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >COG0419 SbcC ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >KOG0239 consensus Kinesin (KAR3 subfamily) [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF15254 CCDC14: Coiled-coil domain-containing protein 14 | Back alignment and domain information |
|---|
| >PF06120 Phage_HK97_TLTM: Tail length tape measure protein; InterPro: IPR009302 This entry consists of the tail length tape measure protein from Bacteriophage HK97 and related sequences from Escherichia coli (strain K12) | Back alignment and domain information |
|---|
| >PRK10246 exonuclease subunit SbcC; Provisional | Back alignment and domain information |
|---|
| >PRK00286 xseA exodeoxyribonuclease VII large subunit; Reviewed | Back alignment and domain information |
|---|
| >TIGR01010 BexC_CtrB_KpsE polysaccharide export inner-membrane protein, BexC/CtrB/KpsE family | Back alignment and domain information |
|---|
| >PRK03598 putative efflux pump membrane fusion protein; Provisional | Back alignment and domain information |
|---|
| >PF07851 TMPIT: TMPIT-like protein; InterPro: IPR012926 A number of members of this family are annotated as being transmembrane proteins induced by tumour necrosis factor alpha, but no literature was found to support this | Back alignment and domain information |
|---|
| >PLN03229 acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha; Provisional | Back alignment and domain information |
|---|
| >PF09787 Golgin_A5: Golgin subfamily A member 5; InterPro: IPR019177 This entry represents a family of proteins involved in maintaining Golgi structure | Back alignment and domain information |
|---|
| >PRK10869 recombination and repair protein; Provisional | Back alignment and domain information |
|---|
| >KOG4677 consensus Golgi integral membrane protein [Intracellular trafficking, secretion, and vesicular transport; General function prediction only] | Back alignment and domain information |
|---|
| >PF05622 HOOK: HOOK protein; InterPro: IPR008636 This family consists of several HOOK1, 2 and 3 proteins from different eukaryotic organisms | Back alignment and domain information |
|---|
| >TIGR03319 YmdA_YtgF conserved hypothetical protein YmdA/YtgF | Back alignment and domain information |
|---|
| >KOG4403 consensus Cell surface glycoprotein STIM, contains SAM domain [General function prediction only] | Back alignment and domain information |
|---|
| >PF06248 Zw10: Centromere/kinetochore Zw10; InterPro: IPR009361 Zeste white 10 (ZW10) was initially identified as a mitotic checkpoint protein involved in chromosome segregation, and then implicated in targeting cytoplasmic dynein and dynactin to mitotic kinetochores, but it is also important in non-dividing cells | Back alignment and domain information |
|---|
| >COG3206 GumC Uncharacterized protein involved in exopolysaccharide biosynthesis [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >PF05266 DUF724: Protein of unknown function (DUF724); InterPro: IPR007930 This family contains several uncharacterised proteins found exclusively in Arabidopsis thaliana | Back alignment and domain information |
|---|
| >cd00890 Prefoldin Prefoldin is a hexameric molecular chaperone complex, found in both eukaryotes and archaea, that binds and stabilizes newly synthesized polypeptides allowing them to fold correctly | Back alignment and domain information |
|---|
| >COG4477 EzrA Negative regulator of septation ring formation [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >TIGR02231 conserved hypothetical protein | Back alignment and domain information |
|---|
| >cd07648 F-BAR_FCHO The F-BAR (FES-CIP4 Homology and Bin/Amphiphysin/Rvs) domain of FCH domain Only proteins | Back alignment and domain information |
|---|
| >PRK00106 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF10267 Tmemb_cc2: Predicted transmembrane and coiled-coil 2 protein; InterPro: IPR019394 This family of transmembrane coiled-coil containing proteins is conserved from worms to humans | Back alignment and domain information |
|---|
| >KOG1937 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF02994 Transposase_22: L1 transposable element; InterPro: IPR004244 Many human L1 elements are capable of retrotransposition | Back alignment and domain information |
|---|
| >TIGR02473 flagell_FliJ flagellar export protein FliJ | Back alignment and domain information |
|---|
| >TIGR02338 gimC_beta prefoldin, beta subunit, archaeal | Back alignment and domain information |
|---|
| >PF08581 Tup_N: Tup N-terminal; InterPro: IPR013890 The N-terminal region of the Tup protein has been shown to interact with the Ssn6 transcriptional co-repressor [] | Back alignment and domain information |
|---|
| >KOG4360 consensus Uncharacterized coiled coil protein [Function unknown] | Back alignment and domain information |
|---|
| >PF12072 DUF3552: Domain of unknown function (DUF3552); InterPro: IPR022711 This presumed domain is functionally uncharacterised | Back alignment and domain information |
|---|
| >KOG2685 consensus Cystoskeletal protein Tektin [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG0239 consensus Kinesin (KAR3 subfamily) [Cytoskeleton] | Back alignment and domain information |
|---|
| >PLN03229 acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha; Provisional | Back alignment and domain information |
|---|
| >KOG1850 consensus Myosin-like coiled-coil protein [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF14282 FlxA: FlxA-like protein | Back alignment and domain information |
|---|
| >KOG0042 consensus Glycerol-3-phosphate dehydrogenase [Energy production and conversion] | Back alignment and domain information |
|---|
| >PF01576 Myosin_tail_1: Myosin tail; InterPro: IPR002928 Muscle contraction is caused by sliding between the thick and thin filaments of the myofibril | Back alignment and domain information |
|---|
| >PF05335 DUF745: Protein of unknown function (DUF745); InterPro: IPR007999 This family consists of several uncharacterised Drosophila melanogaster proteins of unknown function | Back alignment and domain information |
|---|
| >TIGR03545 conserved hypothetical protein TIGR03545 | Back alignment and domain information |
|---|
| >TIGR02231 conserved hypothetical protein | Back alignment and domain information |
|---|
| >PF14362 DUF4407: Domain of unknown function (DUF4407) | Back alignment and domain information |
|---|
| >COG4913 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >COG4026 Uncharacterized protein containing TOPRIM domain, potential nuclease [General function prediction only] | Back alignment and domain information |
|---|
| >COG0497 RecN ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK09343 prefoldin subunit beta; Provisional | Back alignment and domain information |
|---|
| >PRK14011 prefoldin subunit alpha; Provisional | Back alignment and domain information |
|---|
| >PF05557 MAD: Mitotic checkpoint protein; InterPro: IPR008672 This family consists of several eukaryotic mitotic checkpoint (Mitotic arrest deficient or MAD) proteins | Back alignment and domain information |
|---|
| >PF13166 AAA_13: AAA domain | Back alignment and domain information |
|---|
| >COG5293 Predicted ATPase [General function prediction only] | Back alignment and domain information |
|---|
| >COG1730 GIM5 Predicted prefoldin, molecular chaperone implicated in de novo protein folding [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1103 consensus Predicted coiled-coil protein [Function unknown] | Back alignment and domain information |
|---|
| >PF05557 MAD: Mitotic checkpoint protein; InterPro: IPR008672 This family consists of several eukaryotic mitotic checkpoint (Mitotic arrest deficient or MAD) proteins | Back alignment and domain information |
|---|
| >PF01920 Prefoldin_2: Prefoldin subunit; InterPro: IPR002777 Prefoldin (PFD) is a chaperone that interacts exclusively with type II chaperonins, hetero-oligomers lacking an obligate co-chaperonin that are found only in eukaryotes (chaperonin-containing T-complex polypeptide-1 (CCT)) and archaea | Back alignment and domain information |
|---|
| >PF09728 Taxilin: Myosin-like coiled-coil protein; InterPro: IPR019132 Taxilin contains an extraordinarily long coiled-coil domain in its C-terminal half and is ubiquitously expressed | Back alignment and domain information |
|---|
| >KOG1854 consensus Mitochondrial inner membrane protein (mitofilin) [Cell wall/membrane/envelope biogenesis] | Back alignment and domain information |
|---|
| >PF07106 TBPIP: Tat binding protein 1(TBP-1)-interacting protein (TBPIP); InterPro: IPR010776 This family consists of several eukaryotic TBP-1 interacting protein (TBPIP) sequences | Back alignment and domain information |
|---|
| >PF10498 IFT57: Intra-flagellar transport protein 57 ; InterPro: IPR019530 Eukaryotic cilia and flagella are specialised organelles found at the periphery of cells of diverse organisms | Back alignment and domain information |
|---|
| >PTZ00464 SNF-7-like protein; Provisional | Back alignment and domain information |
|---|
| >TIGR03794 NHPM_micro_HlyD NHPM bacteriocin system secretion protein | Back alignment and domain information |
|---|
| >PF15294 Leu_zip: Leucine zipper | Back alignment and domain information |
|---|
| >PF05700 BCAS2: Breast carcinoma amplified sequence 2 (BCAS2); InterPro: IPR008409 This family consists of several eukaryotic sequences of unknown function | Back alignment and domain information |
|---|
| >KOG2991 consensus Splicing regulator [RNA processing and modification] | Back alignment and domain information |
|---|
| >cd07673 F-BAR_FCHO2 The F-BAR (FES-CIP4 Homology and Bin/Amphiphysin/Rvs) domain of FCH domain Only 2 protein | Back alignment and domain information |
|---|
| >PF15066 CAGE1: Cancer-associated gene protein 1 family | Back alignment and domain information |
|---|
| >PF05384 DegS: Sensor protein DegS; InterPro: IPR008595 This is a group of Bacillus DegS proteins | Back alignment and domain information |
|---|
| >TIGR00293 prefoldin, archaeal alpha subunit/eukaryotic subunit 5 | Back alignment and domain information |
|---|
| >KOG1962 consensus B-cell receptor-associated protein and related proteins [Defense mechanisms] | Back alignment and domain information |
|---|
| >KOG0962 consensus DNA repair protein RAD50, ABC-type ATPase/SMC superfamily [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG1003 consensus Actin filament-coating protein tropomyosin [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF14992 TMCO5: TMCO5 family | Back alignment and domain information |
|---|
| >KOG3809 consensus Microtubule-binding protein MIP-T3 [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF12329 TMF_DNA_bd: TATA element modulatory factor 1 DNA binding; InterPro: IPR022092 This is the middle region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes that contains at its N-terminal section a number of leucine zippers that could potentially form coiled coil structures | Back alignment and domain information |
|---|
| >PF15556 Zwint: ZW10 interactor | Back alignment and domain information |
|---|
| >TIGR00998 8a0101 efflux pump membrane protein (multidrug resistance protein A) | Back alignment and domain information |
|---|
| >PF07200 Mod_r: Modifier of rudimentary (Mod(r)) protein; InterPro: IPR009851 This entry represents a conserved region approximately 150 residues long within a number of eukaryotic proteins that show homology with Drosophila melanogaster Modifier of rudimentary (Mod(r)) proteins | Back alignment and domain information |
|---|
| >PF07200 Mod_r: Modifier of rudimentary (Mod(r)) protein; InterPro: IPR009851 This entry represents a conserved region approximately 150 residues long within a number of eukaryotic proteins that show homology with Drosophila melanogaster Modifier of rudimentary (Mod(r)) proteins | Back alignment and domain information |
|---|
| >PF09602 PhaP_Bmeg: Polyhydroxyalkanoic acid inclusion protein (PhaP_Bmeg); InterPro: IPR011728 This entry describes a protein found in polyhydroxyalkanoic acid (PHA) gene regions and incorporated into PHA inclusions in Bacillus cereus and Bacillus megaterium | Back alignment and domain information |
|---|
| >PF15450 DUF4631: Domain of unknown function (DUF4631) | Back alignment and domain information |
|---|
| >COG1382 GimC Prefoldin, chaperonin cofactor [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF13863 DUF4200: Domain of unknown function (DUF4200) | Back alignment and domain information |
|---|
| >TIGR01541 tape_meas_lam_C phage tail tape measure protein, lambda family | Back alignment and domain information |
|---|
| >PF05278 PEARLI-4: Arabidopsis phospholipase-like protein (PEARLI 4); InterPro: IPR007942 This family contains several phospholipase-like proteins from Arabidopsis thaliana and other members of the Streptophyta which are homologous to PEARLI 4 | Back alignment and domain information |
|---|
| >TIGR03752 conj_TIGR03752 integrating conjugative element protein, PFL_4705 family | Back alignment and domain information |
|---|
| >COG5283 Phage-related tail protein [Function unknown] | Back alignment and domain information |
|---|
| >PF07889 DUF1664: Protein of unknown function (DUF1664); InterPro: IPR012458 The members of this family are hypothetical plant proteins of unknown function | Back alignment and domain information |
|---|
| >KOG4657 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF05622 HOOK: HOOK protein; InterPro: IPR008636 This family consists of several HOOK1, 2 and 3 proteins from different eukaryotic organisms | Back alignment and domain information |
|---|
| >PF14992 TMCO5: TMCO5 family | Back alignment and domain information |
|---|
| >TIGR00237 xseA exodeoxyribonuclease VII, large subunit | Back alignment and domain information |
|---|
| >PF13863 DUF4200: Domain of unknown function (DUF4200) | Back alignment and domain information |
|---|
| >cd07653 F-BAR_CIP4-like The F-BAR (FES-CIP4 Homology and Bin/Amphiphysin/Rvs) domain of Cdc42-Interacting Protein 4 and similar proteins | Back alignment and domain information |
|---|
| >TIGR02971 heterocyst_DevB ABC exporter membrane fusion protein, DevB family | Back alignment and domain information |
|---|
| >PF04912 Dynamitin: Dynamitin ; InterPro: IPR006996 Dynamitin is a subunit of the microtubule-dependent motor complex, it is also implicated in cell adhesion by binding to macrophage-enriched myristoylated alanine-rice C kinase substrate (MacMARCKS) [] | Back alignment and domain information |
|---|
| >cd00584 Prefoldin_alpha Prefoldin alpha subunit; Prefoldin is a hexameric molecular chaperone complex, found in both eukaryotes and archaea, that binds and stabilizes newly synthesized polypeptides allowing them to fold correctly | Back alignment and domain information |
|---|
| >KOG2891 consensus Surface glycoprotein [General function prediction only] | Back alignment and domain information |
|---|
| >PRK05689 fliJ flagellar biosynthesis chaperone; Validated | Back alignment and domain information |
|---|
| >PF14073 Cep57_CLD: Centrosome localisation domain of Cep57 | Back alignment and domain information |
|---|
| >KOG3215 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF15254 CCDC14: Coiled-coil domain-containing protein 14 | Back alignment and domain information |
|---|
| >COG2882 FliJ Flagellar biosynthesis chaperone [Cell motility and secretion / Intracellular trafficking and secretion / Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF14788 EF-hand_10: EF hand; PDB: 1DJW_B 1DJI_B 1DJG_B 1QAS_B 2ISD_B 1DJZ_B 1DJY_B 1DJX_B 1QAT_A 1DJH_A | Back alignment and domain information |
|---|
| >PF11180 DUF2968: Protein of unknown function (DUF2968); InterPro: IPR021350 This family of proteins has no known function | Back alignment and domain information |
|---|
| >KOG3215 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >cd00176 SPEC Spectrin repeats, found in several proteins involved in cytoskeletal structure; family members include spectrin, alpha-actinin and dystrophin; the spectrin repeat forms a three helix bundle with the second helix interrupted by proline in some sequences; the repeats are independent folding units; tandem repeats are found in differing numbers and arrange in an antiparallel manner to form dimers; the repeats are defined by a characteristic tryptophan (W) residue in helix A and a leucine (L) at the carboxyl end of helix C and separated by a linker of 5 residues; two copies of the repeat are present here | Back alignment and domain information |
|---|
| >PF06810 Phage_GP20: Phage minor structural protein GP20; InterPro: IPR009636 This family consists of several phage minor structural protein Gp20 sequences and prophage sequences of around 180 residues in length | Back alignment and domain information |
|---|
| >PRK12705 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG0249 consensus LAR-interacting protein and related proteins [General function prediction only] | Back alignment and domain information |
|---|
| >PF05769 DUF837: Protein of unknown function (DUF837); InterPro: IPR008555 This family consists of several eukaryotic proteins of unknown function | Back alignment and domain information |
|---|
| >PF07889 DUF1664: Protein of unknown function (DUF1664); InterPro: IPR012458 The members of this family are hypothetical plant proteins of unknown function | Back alignment and domain information |
|---|
| >PF06705 SF-assemblin: SF-assemblin/beta giardin | Back alignment and domain information |
|---|
| >PRK15178 Vi polysaccharide export inner membrane protein VexD; Provisional | Back alignment and domain information |
|---|
| >PRK07720 fliJ flagellar biosynthesis chaperone; Validated | Back alignment and domain information |
|---|
| >KOG4572 consensus Predicted DNA-binding transcription factor, interacts with stathmin [Transcription; General function prediction only; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF04582 Reo_sigmaC: Reovirus sigma C capsid protein; InterPro: IPR007662 Protein sigmaC in its native state was shown to be a homotrimer | Back alignment and domain information |
|---|
| >PRK00286 xseA exodeoxyribonuclease VII large subunit; Reviewed | Back alignment and domain information |
|---|
| >smart00502 BBC B-Box C-terminal domain | Back alignment and domain information |
|---|
| >KOG0046 consensus Ca2+-binding actin-bundling protein (fimbrin/plastin), EF-Hand protein superfamily [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF06785 UPF0242: Uncharacterised protein family (UPF0242); InterPro: IPR009623 This is a group of proteins of unknown function | Back alignment and domain information |
|---|
| >cd07651 F-BAR_PombeCdc15_like The F-BAR (FES-CIP4 Homology and Bin/Amphiphysin/Rvs) domain of Schizosaccharomyces pombe Cdc15, and similar proteins | Back alignment and domain information |
|---|
| >PF02403 Seryl_tRNA_N: Seryl-tRNA synthetase N-terminal domain; InterPro: IPR015866 The aminoacyl-tRNA synthetases (6 | Back alignment and domain information |
|---|
| >PF10046 BLOC1_2: Biogenesis of lysosome-related organelles complex-1 subunit 2 ; InterPro: IPR019269 This entry represents a family of proteins that play a role in cellular proliferation, as well as in the biogenesis of specialised organelles of the endosomal-lysosomal system [] | Back alignment and domain information |
|---|
| >TIGR03752 conj_TIGR03752 integrating conjugative element protein, PFL_4705 family | Back alignment and domain information |
|---|
| >KOG2008 consensus BTK-associated SH3-domain binding protein SAB [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF02994 Transposase_22: L1 transposable element; InterPro: IPR004244 Many human L1 elements are capable of retrotransposition | Back alignment and domain information |
|---|
| >PF06005 DUF904: Protein of unknown function (DUF904); InterPro: IPR009252 Cell division protein ZapB is a non-essential, abundant cell division factor that is required for proper Z-ring formation | Back alignment and domain information |
|---|
| >PF03962 Mnd1: Mnd1 family; InterPro: IPR005647 This family of proteins includes meiotic nuclear division protein 1 (MND1) from Saccharomyces cerevisiae (Baker's yeast) | Back alignment and domain information |
|---|
| >PF00435 Spectrin: Spectrin repeat; InterPro: IPR002017 Spectrin repeats [] are found in several proteins involved in cytoskeletal structure | Back alignment and domain information |
|---|
| >PF14197 Cep57_CLD_2: Centrosome localisation domain of PPC89 | Back alignment and domain information |
|---|
| >KOG4065 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG2196 consensus Nuclear porin [Nuclear structure] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST
Original result of BLAST against Protein Data Bank
| ID | Alignment Graph | Length |
Definition |
E-value | |
| Query | 1216 | ||||
| 1iq3_A | 110 | Solution Structure Of The Eps15 Homology Domain Of | 3e-12 | ||
| 1fi6_A | 92 | Solution Structure Of The Reps1 Eh Domain Length = | 5e-11 | ||
| 2qpt_A | 550 | Crystal Structure Of An Ehd Atpase Involved In Memb | 4e-10 | ||
| 2kgr_A | 111 | Solution Structure Of Protein Itsn1 From Homo Sapie | 6e-10 | ||
| 1qjt_A | 99 | Solution Structure Of The Apo Eh1 Domain Of Mouse E | 5e-09 | ||
| 1qjt_A | 99 | Solution Structure Of The Apo Eh1 Domain Of Mouse E | 5e-04 | ||
| 2khn_A | 121 | Nmr Solution Structure Of The Eh 1 Domain From Huma | 2e-08 | ||
| 1eh2_A | 106 | Structure Of The Second Eps15 Homology Domain Of Hu | 4e-08 | ||
| 1f8h_A | 95 | Structure Of The Second Eps15 Homology Domain Of Hu | 6e-08 | ||
| 1ff1_A | 95 | Structure Of The Second Eps15 Homology Domain Of Hu | 7e-08 | ||
| 2jxc_A | 100 | Structure Of The Eps15-Eh2 Stonin2 Complex Length = | 9e-08 | ||
| 3fia_A | 121 | Crystal Structure Of The Eh 1 Domain From Human Int | 9e-08 | ||
| 2kff_A | 105 | Structure Of The C-Terminal Domain Of Ehd1 With Fny | 3e-07 | ||
| 2jq6_A | 139 | Structure Of Eh-Domain Of Ehd1 Length = 139 | 5e-07 | ||
| 1c07_A | 95 | Structure Of The Third Eps15 Homology Domain Of Hum | 4e-06 |
| >pdb|1IQ3|A Chain A, Solution Structure Of The Eps15 Homology Domain Of A Human Pob1 Length = 110 | Back alignment and structure |
|
| >pdb|1FI6|A Chain A, Solution Structure Of The Reps1 Eh Domain Length = 92 | Back alignment and structure |
| >pdb|2QPT|A Chain A, Crystal Structure Of An Ehd Atpase Involved In Membrane Remodelling Length = 550 | Back alignment and structure |
| >pdb|2KGR|A Chain A, Solution Structure Of Protein Itsn1 From Homo Sapiens. Northeast Structural Genomics Consortium Target Hr5524a Length = 111 | Back alignment and structure |
| >pdb|1QJT|A Chain A, Solution Structure Of The Apo Eh1 Domain Of Mouse Epidermal Growth Factor Receptor Substrate 15, Eps15 Length = 99 | Back alignment and structure |
| >pdb|1QJT|A Chain A, Solution Structure Of The Apo Eh1 Domain Of Mouse Epidermal Growth Factor Receptor Substrate 15, Eps15 Length = 99 | Back alignment and structure |
| >pdb|2KHN|A Chain A, Nmr Solution Structure Of The Eh 1 Domain From Human Intersectin-1 Protein. Northeast Structural Genomics Consortium Target Hr3646e Length = 121 | Back alignment and structure |
| >pdb|1EH2|A Chain A, Structure Of The Second Eps15 Homology Domain Of Human Eps15, Nmr, 20 Structures Length = 106 | Back alignment and structure |
| >pdb|1F8H|A Chain A, Structure Of The Second Eps15 Homology Domain Of Human Eps15 In Complex With Ptgssstnpfr Length = 95 | Back alignment and structure |
| >pdb|1FF1|A Chain A, Structure Of The Second Eps15 Homology Domain Of Human Eps15 In Complex With Ptgssstnpfl Length = 95 | Back alignment and structure |
| >pdb|2JXC|A Chain A, Structure Of The Eps15-Eh2 Stonin2 Complex Length = 100 | Back alignment and structure |
| >pdb|3FIA|A Chain A, Crystal Structure Of The Eh 1 Domain From Human Intersectin- 1 Protein. Northeast Structural Genomics Consortium Target Hr3646e Length = 121 | Back alignment and structure |
| >pdb|2KFF|A Chain A, Structure Of The C-Terminal Domain Of Ehd1 With Fnyestnpftak Length = 105 | Back alignment and structure |
| >pdb|2JQ6|A Chain A, Structure Of Eh-Domain Of Ehd1 Length = 139 | Back alignment and structure |
| >pdb|1C07|A Chain A, Structure Of The Third Eps15 Homology Domain Of Human Eps15 Length = 95 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST
Original result of RPS-BLAST against PDB70 database
| >1iq3_A Ralbp1-interacting protein (partner of ralbp1); EF-hand domain, POB1 EH domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: a.39.1.6 Length = 110 | Back alignment and structure |
|---|
Score = 127 bits (321), Expect = 1e-34
Identities = 39/106 (36%), Positives = 55/106 (51%), Gaps = 1/106 (0%)
Query: 417 GALNSTSSQSHVPWPKMTHSEVQKYTKVFVQVDIDRDGKITGEQAYNLFLSWRLPREVLK 476
G+L SS PW ++T + + Y F + D I+G A N F +L L
Sbjct: 1 GSLQDNSSYPDEPW-RITEEQREYYVNQFRSLQPDPSSFISGSVAKNFFTKSKLSIPELS 59
Query: 477 QVWDLSDQDNDGMLSLKEFCTALYLMERYREGRPLPTMLPSTIMPD 522
+W+LSD D DG L+L EFC A +L+ + G PLP LP T+ P+
Sbjct: 60 YIWELSDADCDGALTLPEFCAAFHLIVARKNGYPLPEGLPPTLQPE 105
|
| >1iq3_A Ralbp1-interacting protein (partner of ralbp1); EF-hand domain, POB1 EH domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: a.39.1.6 Length = 110 | Back alignment and structure |
|---|
| >2kgr_A Intersectin-1; structure, alternative splicing, calcium, cell junction, cell projection, coiled coil, endocytosis, membrane, phosphoprotein; NMR {Homo sapiens} Length = 111 | Back alignment and structure |
|---|
| >2kgr_A Intersectin-1; structure, alternative splicing, calcium, cell junction, cell projection, coiled coil, endocytosis, membrane, phosphoprotein; NMR {Homo sapiens} Length = 111 | Back alignment and structure |
|---|
| >1fi6_A EH domain protein REPS1; EPS15 homology domain, EF hand, calcium, RAS signal transduction, endocytosis/exocytosis complex; NMR {Mus musculus} SCOP: a.39.1.6 Length = 92 | Back alignment and structure |
|---|
| >1fi6_A EH domain protein REPS1; EPS15 homology domain, EF hand, calcium, RAS signal transduction, endocytosis/exocytosis complex; NMR {Mus musculus} SCOP: a.39.1.6 Length = 92 | Back alignment and structure |
|---|
| >1c07_A Protein (epidermal growth factor receptor pathway substrate 15); calcium binding, signaling domain, NPF binding, FW binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 Length = 95 | Back alignment and structure |
|---|
| >1c07_A Protein (epidermal growth factor receptor pathway substrate 15); calcium binding, signaling domain, NPF binding, FW binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 Length = 95 | Back alignment and structure |
|---|
| >1eh2_A EPS15; calcium binding, signaling domain, NPF binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 PDB: 2jxc_A 1f8h_A 1ff1_A Length = 106 | Back alignment and structure |
|---|
| >1eh2_A EPS15; calcium binding, signaling domain, NPF binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 PDB: 2jxc_A 1f8h_A 1ff1_A Length = 106 | Back alignment and structure |
|---|
| >2qpt_A EH domain-containing protein-2; protein-nucleotide complex, membrane protein, endocytosis; HET: ANP; 3.10A {Mus musculus} Length = 550 | Back alignment and structure |
|---|
| >2qpt_A EH domain-containing protein-2; protein-nucleotide complex, membrane protein, endocytosis; HET: ANP; 3.10A {Mus musculus} Length = 550 | Back alignment and structure |
|---|
| >3fia_A Intersectin-1; EH 1 domain, NESG, structural genomics, PSI- 2, protein structure initiative, northeast structural genomics consortium; 1.45A {Homo sapiens} PDB: 2khn_A Length = 121 | Back alignment and structure |
|---|
| >3fia_A Intersectin-1; EH 1 domain, NESG, structural genomics, PSI- 2, protein structure initiative, northeast structural genomics consortium; 1.45A {Homo sapiens} PDB: 2khn_A Length = 121 | Back alignment and structure |
|---|
| >2jq6_A EH domain-containing protein 1; metal binding protein; NMR {Homo sapiens} PDB: 2kff_A 2kfg_A 2kfh_A 2ksp_A Length = 139 | Back alignment and structure |
|---|
| >2jq6_A EH domain-containing protein 1; metal binding protein; NMR {Homo sapiens} PDB: 2kff_A 2kfg_A 2kfh_A 2ksp_A Length = 139 | Back alignment and structure |
|---|
| >1qjt_A EH1, epidermal growth factor receptor substrate substrate 15, EPS15; EH domain, EF-hand, solution structure, S100 protein; NMR {Mus musculus} SCOP: a.39.1.6 Length = 99 | Back alignment and structure |
|---|
| >1qjt_A EH1, epidermal growth factor receptor substrate substrate 15, EPS15; EH domain, EF-hand, solution structure, S100 protein; NMR {Mus musculus} SCOP: a.39.1.6 Length = 99 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >3sjs_A URE3-BP sequence specific DNA binding protein; EF-hand, structural genomics, seattle S genomics center for infectious disease, ssgcid; 1.90A {Entamoeba histolytica} PDB: 3sia_A 3sib_A Length = 220 | Back alignment and structure |
|---|
| >1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Length = 284 | Back alignment and structure |
|---|
| >1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Length = 284 | Back alignment and structure |
|---|
| >2pmy_A RAS and EF-hand domain-containing protein; rasef, calcium-binding domain, structural genomics, structural genomics consortium, SGC; 2.30A {Homo sapiens} Length = 91 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
| >2r2i_A Guanylyl cyclase-activating protein 1; EF hand, GCAP, guanylate cyclase activating protein, GCAP1, GCAP-1, calcium, lipoprotein, myristate; HET: MYR; 2.00A {Gallus gallus} Length = 198 | Back alignment and structure |
|---|
| >1ij5_A Plasmodial specific LAV1-2 protein; fourty kDa calcium binding protein, CBP40, metal binding protein; 3.00A {Physarum polycephalum} SCOP: a.39.1.9 PDB: 1ij6_A Length = 323 | Back alignment and structure |
|---|
| >1ij5_A Plasmodial specific LAV1-2 protein; fourty kDa calcium binding protein, CBP40, metal binding protein; 3.00A {Physarum polycephalum} SCOP: a.39.1.9 PDB: 1ij6_A Length = 323 | Back alignment and structure |
|---|
| >1ij5_A Plasmodial specific LAV1-2 protein; fourty kDa calcium binding protein, CBP40, metal binding protein; 3.00A {Physarum polycephalum} SCOP: a.39.1.9 PDB: 1ij6_A Length = 323 | Back alignment and structure |
|---|
| >1ij5_A Plasmodial specific LAV1-2 protein; fourty kDa calcium binding protein, CBP40, metal binding protein; 3.00A {Physarum polycephalum} SCOP: a.39.1.9 PDB: 1ij6_A Length = 323 | Back alignment and structure |
|---|
| >1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 | Back alignment and structure |
|---|
| >1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 | Back alignment and structure |
|---|
| >3li6_A Calcium-binding protein; calcium signaling protein, assemble free energy, dynamic behaviour, cytoskeleton, metal binding; 2.50A {Entamoeba histolytica} Length = 66 | Back alignment and structure |
|---|
| >3li6_A Calcium-binding protein; calcium signaling protein, assemble free energy, dynamic behaviour, cytoskeleton, metal binding; 2.50A {Entamoeba histolytica} Length = 66 | Back alignment and structure |
|---|
| >1q80_A SCP, sarcoplasmic calcium-binding protein; all-alpha, metal binding protein; NMR {Neanthes diversicolor} SCOP: a.39.1.5 PDB: 2scp_A Length = 174 | Back alignment and structure |
|---|
| >1q80_A SCP, sarcoplasmic calcium-binding protein; all-alpha, metal binding protein; NMR {Neanthes diversicolor} SCOP: a.39.1.5 PDB: 2scp_A Length = 174 | Back alignment and structure |
|---|
| >2ggz_A Guanylyl cyclase-activating protein 3; EF hand, guanylate cyclase activating protein, GCAP, GCAP3, GCAP-3, lyase activator; 3.00A {Homo sapiens} Length = 211 | Back alignment and structure |
|---|
| >3mse_B Calcium-dependent protein kinase, putative; CDPKS, malaria, structural genomics consortium, SGC, transfe; 2.10A {Plasmodium falciparum} Length = 180 | Back alignment and structure |
|---|
| >3akb_A Putative calcium binding protein; EF-hand, metal binding protein; 1.50A {Streptomyces coelicolor} PDB: 3aka_A Length = 166 | Back alignment and structure |
|---|
| >3akb_A Putative calcium binding protein; EF-hand, metal binding protein; 1.50A {Streptomyces coelicolor} PDB: 3aka_A Length = 166 | Back alignment and structure |
|---|
| >2sas_A Sarcoplasmic calcium-binding protein; 2.40A {Branchiostoma lanceolatum} SCOP: a.39.1.5 Length = 185 | Back alignment and structure |
|---|
| >2sas_A Sarcoplasmic calcium-binding protein; 2.40A {Branchiostoma lanceolatum} SCOP: a.39.1.5 Length = 185 | Back alignment and structure |
|---|
| >1bjf_A Neurocalcin delta; calcium-binding, myristoylation, neuronal specific guanylate cyclase activator; 2.40A {Bos taurus} SCOP: a.39.1.5 Length = 193 | Back alignment and structure |
|---|
| >1nya_A Calerythrin; EF-hand, metal binding protein; NMR {Saccharopolyspora erythraea} SCOP: a.39.1.5 Length = 176 | Back alignment and structure |
|---|
| >1nya_A Calerythrin; EF-hand, metal binding protein; NMR {Saccharopolyspora erythraea} SCOP: a.39.1.5 Length = 176 | Back alignment and structure |
|---|
| >2hpk_A Photoprotein berovin; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 2.00A {Beroe abyssicola} Length = 208 | Back alignment and structure |
|---|
| >2hpk_A Photoprotein berovin; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 2.00A {Beroe abyssicola} Length = 208 | Back alignment and structure |
|---|
| >2hpk_A Photoprotein berovin; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 2.00A {Beroe abyssicola} Length = 208 | Back alignment and structure |
|---|
| >2zfd_A Calcineurin B-like protein 2; calcium binding protein, protein-protein complex, ATP-bindin kinase, nucleotide-binding; 1.20A {Arabidopsis thaliana} SCOP: a.39.1.5 PDB: 1uhn_A Length = 226 | Back alignment and structure |
|---|
| >2xs1_A Programmed cell death 6-interacting protein; protein transport-viral protein complex, cell cycle; 2.30A {Homo sapiens} PDB: 2xs8_A 2oev_A 2r05_A 2r02_A 2r03_A 2oex_A 2ojq_A Length = 704 | Back alignment and structure |
|---|
| >2ccm_A Calexcitin; EF hand, calcium, signaling protein; 1.8A {Loligo pealeii} Length = 191 | Back alignment and structure |
|---|
| >2ccm_A Calexcitin; EF hand, calcium, signaling protein; 1.8A {Loligo pealeii} Length = 191 | Back alignment and structure |
|---|
| >3dd4_A KV channel-interacting protein 4; EF-hands protein, ION transport, ionic channel, membrane, PO potassium channel, potassium transport, transport; 3.00A {Mus musculus} PDB: 2e6w_A Length = 229 | Back alignment and structure |
|---|
| >3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Length = 504 | Back alignment and structure |
|---|
| >3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Length = 504 | Back alignment and structure |
|---|
| >2v71_A Nuclear distribution protein NUDE-like 1; developmental protein, nuclear protein, neurogenesis, cytosk LIS1 binding, differentiation; 2.24A {Rattus norvegicus} Length = 189 | Back alignment and structure |
|---|
| >3e3r_A Calcyphosin, calcyphosine; human calcyphosine, EF-hand, phosphoprotein, calcium binding; 2.65A {Homo sapiens} Length = 204 | Back alignment and structure |
|---|
| >2ct9_A Calcium-binding protein P22; EF-hand, metal binding protein; 2.20A {Rattus norvegicus} PDB: 2e30_A Length = 208 | Back alignment and structure |
|---|
| >1wlz_A DJBP, CAP-binding protein complex interacting protein 1 isoform A; EF-hand like, unknown function; 1.60A {Homo sapiens} SCOP: a.39.1.7 Length = 105 | Back alignment and structure |
|---|
| >2hps_A Coelenterazine-binding protein with bound coelent; bioluminescence, southeast collabora structural genomics, secsg, structural genomics, PSI; HET: CTZ; 1.72A {Renilla muelleri} PDB: 2hq8_A Length = 186 | Back alignment and structure |
|---|
| >2hps_A Coelenterazine-binding protein with bound coelent; bioluminescence, southeast collabora structural genomics, secsg, structural genomics, PSI; HET: CTZ; 1.72A {Renilla muelleri} PDB: 2hq8_A Length = 186 | Back alignment and structure |
|---|
| >2hps_A Coelenterazine-binding protein with bound coelent; bioluminescence, southeast collabora structural genomics, secsg, structural genomics, PSI; HET: CTZ; 1.72A {Renilla muelleri} PDB: 2hq8_A Length = 186 | Back alignment and structure |
|---|
| >2efr_A General control protein GCN4 and tropomyosin 1 Al; destabilizing cluster, hydrophobic core, contractIle protein; 1.80A {Saccharomyces cerevisiae} PDB: 2efs_A 2d3e_A Length = 155 | Back alignment and structure |
|---|
| >2znd_A Programmed cell death protein 6; penta-EF-hand protein, calcium binding protein, apoptosis, calcium, endoplasmic reticulum, membrane, nucleus; 1.70A {Homo sapiens} PDB: 2zn9_A 2zn8_A 1hqv_A 3aak_A 2zne_A 2zrs_A 2zrt_A 3aaj_A Length = 172 | Back alignment and structure |
|---|
| >2znd_A Programmed cell death protein 6; penta-EF-hand protein, calcium binding protein, apoptosis, calcium, endoplasmic reticulum, membrane, nucleus; 1.70A {Homo sapiens} PDB: 2zn9_A 2zn8_A 1hqv_A 3aak_A 2zne_A 2zrs_A 2zrt_A 3aaj_A Length = 172 | Back alignment and structure |
|---|
| >3k21_A PFCDPK3, calcium-dependent protein kinase 3; calcium kinase structural genomics malaria, structural genom consortium, SGC, ATP-binding; 1.15A {Plasmodium falciparum} PDB: 3o4y_A Length = 191 | Back alignment and structure |
|---|
| >2fxo_A Myosin heavy chain, cardiac muscle beta isoform; coiled coil (dimeric, parallel), familial hypertrophic cardiomyopathy, FHC-associated mutant E924K; 2.50A {Homo sapiens} SCOP: h.1.26.1 PDB: 2fxm_A Length = 129 | Back alignment and structure |
|---|
| >1tiz_A Calmodulin-related protein, putative; helix-turn-helix, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} SCOP: a.39.1.5 Length = 67 | Back alignment and structure |
|---|
| >1tiz_A Calmodulin-related protein, putative; helix-turn-helix, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} SCOP: a.39.1.5 Length = 67 | Back alignment and structure |
|---|
| >3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Length = 494 | Back alignment and structure |
|---|
| >3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Length = 494 | Back alignment and structure |
|---|
| >3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Length = 484 | Back alignment and structure |
|---|
| >3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Length = 484 | Back alignment and structure |
|---|
| >3na7_A HP0958; flagellar biogenesis, flagellum export, C4 Zn-ribbon, coiled post-transcriptional, gene regulation, chaperone; HET: EPE; 2.20A {Helicobacter pylori} Length = 256 | Back alignment and structure |
|---|
| >3o0z_A RHO-associated protein kinase 1; coiled-coil, transferase; HET: MSE; 2.33A {Homo sapiens} Length = 168 | Back alignment and structure |
|---|
| >4f61_I Stathmin-like domain R4; alpha-tubulin, beta-tubulin, GTPase, microtubule, RB3, stath tubulin, cell cycle; HET: GTP GDP; 4.17A {Artificial gene} Length = 240 | Back alignment and structure |
|---|
| >1y1x_A Leishmania major homolog of programmed cell death protein; SGPP, structural genomics, PSI; 1.95A {Leishmania major} SCOP: a.39.1.8 Length = 191 | Back alignment and structure |
|---|
| >3pm8_A PFCDPK2, calcium-dependent protein kinase 2; malaria, structural genomics, structural genomics CONS SGC; 2.00A {Plasmodium falciparum K1} Length = 197 | Back alignment and structure |
|---|
| >1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 | Back alignment and structure |
|---|
| >2ehb_A Calcineurin B-like protein 4; protein complex, Ca(II) IONS bound to SOS3 (EF-hands 1 and 4 FISL motif; 2.10A {Arabidopsis thaliana} PDB: 1v1g_A 1v1f_A Length = 207 | Back alignment and structure |
|---|
| >3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 | Back alignment and structure |
|---|
| >2b9c_A Striated-muscle alpha tropomyosin; alpha-helix, coiled coil, alanine, axial stagger, radius, SIDE-chain packing, crystal packing; 2.30A {Rattus norvegicus} SCOP: h.1.5.1 Length = 147 | Back alignment and structure |
|---|
| >1s6j_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Length = 87 | Back alignment and structure |
|---|
| >2aao_A CDPK, calcium-dependent protein kinase, isoform AK1; calmodulin-like domain, EF calcium binding protein, transferase; 2.00A {Arabidopsis thaliana} Length = 166 | Back alignment and structure |
|---|
| >3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Length = 486 | Back alignment and structure |
|---|
| >1dgu_A Calcium-saturated CIB; helical, EF-hands, blood clotting; NMR {Homo sapiens} SCOP: a.39.1.5 PDB: 1dgv_A 1xo5_A 1y1a_A* Length = 183 | Back alignment and structure |
|---|
| >1jba_A GCAP-2, protein (guanylate cyclase activating protein 2); EF-hand, calcium-binding protein, guanylyl cyclase regulation, lyase; NMR {Bos taurus} SCOP: a.39.1.5 Length = 204 | Back alignment and structure |
|---|
| >3i00_A HIP-I, huntingtin-interacting protein 1; transcription; 2.30A {Homo sapiens} PDB: 2qa7_A Length = 120 | Back alignment and structure |
|---|
| >1fpw_A Yeast frequenin, calcium-binding protein NCS-1; EF-hand, metal binding protein; NMR {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2ju0_A Length = 190 | Back alignment and structure |
|---|
| >2l2e_A Calcium-binding protein NCS-1; NCS1P, myristoylated, metal binding protein; HET: MYR; NMR {Schizosaccharomyces pombe} Length = 190 | Back alignment and structure |
|---|
| >3khe_A Calmodulin-like domain protein kinase isoform 3; calcium dependent kinase, structural genomics, structural GE consortium, SGC, ATP-binding; 1.95A {Toxoplasma gondii} Length = 191 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch
Original result of HHsearch against PDB70 database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 1216 | |||
| 3fia_A | 121 | Intersectin-1; EH 1 domain, NESG, structural genom | 99.86 | |
| 1eh2_A | 106 | EPS15; calcium binding, signaling domain, NPF bind | 99.82 | |
| 1c07_A | 95 | Protein (epidermal growth factor receptor pathway | 99.8 | |
| 1iq3_A | 110 | Ralbp1-interacting protein (partner of ralbp1); EF | 99.8 | |
| 1fi6_A | 92 | EH domain protein REPS1; EPS15 homology domain, EF | 99.8 | |
| 3fia_A | 121 | Intersectin-1; EH 1 domain, NESG, structural genom | 99.79 | |
| 2jq6_A | 139 | EH domain-containing protein 1; metal binding prot | 99.78 | |
| 1eh2_A | 106 | EPS15; calcium binding, signaling domain, NPF bind | 99.73 | |
| 2kgr_A | 111 | Intersectin-1; structure, alternative splicing, ca | 99.72 | |
| 2jq6_A | 139 | EH domain-containing protein 1; metal binding prot | 99.71 | |
| 1qjt_A | 99 | EH1, epidermal growth factor receptor substrate su | 99.71 | |
| 2qpt_A | 550 | EH domain-containing protein-2; protein-nucleotide | 99.7 | |
| 2qpt_A | 550 | EH domain-containing protein-2; protein-nucleotide | 99.67 | |
| 1c07_A | 95 | Protein (epidermal growth factor receptor pathway | 99.66 | |
| 1fi6_A | 92 | EH domain protein REPS1; EPS15 homology domain, EF | 99.64 | |
| 1iq3_A | 110 | Ralbp1-interacting protein (partner of ralbp1); EF | 99.64 | |
| 1qjt_A | 99 | EH1, epidermal growth factor receptor substrate su | 99.6 | |
| 2kgr_A | 111 | Intersectin-1; structure, alternative splicing, ca | 99.55 | |
| 2lv7_A | 100 | Calcium-binding protein 7; metal binding protein; | 99.21 | |
| 2ktg_A | 85 | Calmodulin, putative; ehcam, Ca-binding protein, p | 99.02 | |
| 2joj_A | 77 | Centrin protein; N-terminal domain, centrin soluti | 99.01 | |
| 2opo_A | 86 | Polcalcin CHE A 3; calcium-binding protein, dimer, | 98.99 | |
| 1avs_A | 90 | Troponin C; muscle contraction, calcium-activated, | 98.99 | |
| 2pmy_A | 91 | RAS and EF-hand domain-containing protein; rasef, | 98.95 | |
| 2kn2_A | 92 | Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco | 98.93 | |
| 3n22_A | 98 | Protein S100-A2; EF-hand, calcium-binding, zinc-bi | 98.89 | |
| 1yx7_A | 83 | Calsensin, LAN3-6 antigen; calcium-binding protein | 98.89 | |
| 1j7q_A | 86 | CAVP, calcium vector protein; EF-hand family, calc | 98.89 | |
| 3nso_A | 101 | Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, meta | 98.88 | |
| 3zwh_A | 104 | Protein S100-A4; Ca-binding protein-motor protein | 98.86 | |
| 4eto_A | 93 | Protein S100-A4; calcium-binding protein, EF-hand, | 98.85 | |
| 2lnk_A | 113 | Protein S100-A4; EF-hand, calcium binding, all alp | 98.85 | |
| 1tiz_A | 67 | Calmodulin-related protein, putative; helix-turn-h | 98.85 | |
| 2kz2_A | 94 | Calmodulin, CAM; TR2C, metal binding protein; NMR | 98.85 | |
| 2lmt_A | 148 | Calmodulin-related protein 97A; spermatogenesis, m | 98.83 | |
| 2b1u_A | 71 | Calmodulin-like protein 5; CLSP, calmodulin-like S | 98.8 | |
| 2opo_A | 86 | Polcalcin CHE A 3; calcium-binding protein, dimer, | 98.79 | |
| 2y5i_A | 99 | S100Z, S100 calcium binding protein Z; metal-bindi | 98.79 | |
| 1k9u_A | 78 | Polcalcin PHL P 7; pollen allergen, calcium-bindin | 98.78 | |
| 1k2h_A | 93 | S100A1, S-100 protein, alpha chain; non-covalent h | 98.77 | |
| 3nxa_A | 100 | Protein S100-A16; S100 family, calcium binding pro | 98.77 | |
| 3rm1_A | 92 | Protein S100-B; alpha-helical, EF hand, metal bind | 98.76 | |
| 2wcb_A | 95 | Protein S100-A12; calcium signalling, HOST-parasit | 98.76 | |
| 4drw_A | 121 | Protein S100-A10/annexin A2 chimeric protein; atyp | 98.76 | |
| 1c7v_A | 81 | CAVP, calcium vector protein; EF-hand family, calc | 98.76 | |
| 3i5g_C | 159 | Myosin catalytic light chain LC-1, mantle muscle; | 98.76 | |
| 2ktg_A | 85 | Calmodulin, putative; ehcam, Ca-binding protein, p | 98.75 | |
| 1j55_A | 95 | S-100P protein; metal binding protein; 2.00A {Homo | 98.75 | |
| 3i5g_B | 153 | Myosin regulatory light chain LC-2, mantle muscle; | 98.75 | |
| 1wlz_A | 105 | DJBP, CAP-binding protein complex interacting prot | 98.75 | |
| 2d58_A | 107 | Allograft inflammatory factor 1; EF-hand, metal bi | 98.75 | |
| 2pmy_A | 91 | RAS and EF-hand domain-containing protein; rasef, | 98.75 | |
| 2obh_A | 143 | Centrin-2; DNA repair complex EF hand superfamily | 98.75 | |
| 2lhi_A | 176 | Calmodulin, serine/threonine-protein phosphatase c | 98.74 | |
| 5pal_A | 109 | Parvalbumin; calcium-binding protein; 1.54A {Triak | 98.74 | |
| 1s6j_A | 87 | CDPK, calcium-dependent protein kinase SK5; EF-han | 98.74 | |
| 3li6_A | 66 | Calcium-binding protein; calcium signaling protein | 98.74 | |
| 1qx2_A | 76 | Vitamin D-dependent calcium-binding protein, INTE; | 98.73 | |
| 2kax_A | 92 | Protein S100-A5; EF-hand, calcium binding protien, | 98.73 | |
| 1dtl_A | 161 | Cardiac troponin C; helix-turn-helix, structural p | 98.73 | |
| 1xk4_C | 113 | Calgranulin B; S100 family, heterotetramer, metal | 98.72 | |
| 1pva_A | 110 | Parvalbumin; calcium binding; 1.65A {Esox lucius} | 98.71 | |
| 3fs7_A | 109 | Parvalbumin, thymic; calcium-binding protein, EF-h | 98.71 | |
| 2obh_A | 143 | Centrin-2; DNA repair complex EF hand superfamily | 98.71 | |
| 1exr_A | 148 | Calmodulin; high resolution, disorder, metal trans | 98.71 | |
| 2jnf_A | 158 | Troponin C; stretch activated muscle contraction, | 98.71 | |
| 2bl0_C | 142 | Myosin regulatory light chain; muscle protein, sli | 98.71 | |
| 4ds7_A | 147 | Calmodulin, CAM; protein binding, metal binding, s | 98.7 | |
| 3qrx_A | 169 | Centrin; calcium-binding, EF-hand, cell division, | 98.7 | |
| 2pvb_A | 108 | Protein (parvalbumin); calcium binding protein, me | 98.7 | |
| 3h4s_E | 135 | KCBP interacting Ca2+-binding protein; kinesin, mo | 98.7 | |
| 3fwb_A | 161 | Cell division control protein 31; gene gating, com | 98.7 | |
| 1rwy_A | 109 | Parvalbumin alpha; EF-hand, calcium-binding, calci | 98.7 | |
| 3ox6_A | 153 | Calcium-binding protein 1; EF-hand, calcium-sensor | 98.69 | |
| 1bu3_A | 109 | Calcium-binding protein; 1.65A {Merluccius bilinea | 98.69 | |
| 2lv7_A | 100 | Calcium-binding protein 7; metal binding protein; | 98.68 | |
| 1exr_A | 148 | Calmodulin; high resolution, disorder, metal trans | 98.68 | |
| 1qls_A | 99 | S100C protein, calgizzarin; metal-binding protein/ | 98.67 | |
| 1wy9_A | 147 | Allograft inflammatory factor 1; EF-hand, calucium | 98.66 | |
| 1xk4_A | 93 | Calgranulin A; S100 family, heterotetramer, metal | 98.66 | |
| 2jjz_A | 150 | Ionized calcium-binding adapter molecule 2; EF-han | 98.65 | |
| 2h2k_A | 106 | Protein S100-A13; calcium binding protein, metal b | 98.65 | |
| 1avs_A | 90 | Troponin C; muscle contraction, calcium-activated, | 98.65 | |
| 1psr_A | 100 | Psoriasin, S100A7; EF-hand protein, MAD phasing, p | 98.64 | |
| 2f2o_A | 179 | Calmodulin fused with calmodulin-binding domain of | 98.64 | |
| 1rro_A | 108 | RAT oncomodulin; calcium-binding protein; 1.30A {R | 98.64 | |
| 3u0k_A | 440 | Rcamp; fluorescent protein, calcium binding, EF-ha | 98.62 | |
| 1k8u_A | 90 | S100A6, calcyclin, CACY; calcium regulatory protei | 98.62 | |
| 2lmt_A | 148 | Calmodulin-related protein 97A; spermatogenesis, m | 98.62 | |
| 2lhi_A | 176 | Calmodulin, serine/threonine-protein phosphatase c | 98.62 | |
| 2mys_C | 149 | Myosin; muscle protein, motor protein; HET: MLY; 2 | 98.61 | |
| 1top_A | 162 | Troponin C; contractIle system protein; 1.78A {Gal | 98.61 | |
| 2aao_A | 166 | CDPK, calcium-dependent protein kinase, isoform AK | 98.61 | |
| 1a4p_A | 96 | S100A10; S100 family, EF-hand protein, ligand of a | 98.6 | |
| 3qrx_A | 169 | Centrin; calcium-binding, EF-hand, cell division, | 98.59 | |
| 2kn2_A | 92 | Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco | 98.59 | |
| 2ovk_C | 159 | Myosin catalytic light chain LC-1, mantle muscle, | 98.59 | |
| 1j7q_A | 86 | CAVP, calcium vector protein; EF-hand family, calc | 98.59 | |
| 1cb1_A | 78 | Calbindin D9K; calcium-binding protein; NMR {Sus s | 98.59 | |
| 2mys_B | 166 | Myosin; muscle protein, motor protein; HET: MLY; 2 | 98.58 | |
| 3j04_B | 143 | Myosin regulatory light chain 2, smooth muscle MA | 98.58 | |
| 1nya_A | 176 | Calerythrin; EF-hand, metal binding protein; NMR { | 98.57 | |
| 1qv0_A | 195 | Obelin, OBL; photoprotein, bioluminescence, atomic | 98.56 | |
| 1yx7_A | 83 | Calsensin, LAN3-6 antigen; calcium-binding protein | 98.56 | |
| 2bl0_B | 145 | Myosin regulatory light chain; muscle protein, sli | 98.55 | |
| 3sjs_A | 220 | URE3-BP sequence specific DNA binding protein; EF- | 98.55 | |
| 1top_A | 162 | Troponin C; contractIle system protein; 1.78A {Gal | 98.55 | |
| 3fwb_A | 161 | Cell division control protein 31; gene gating, com | 98.55 | |
| 1m45_A | 148 | MLC1P, myosin light chain; protein-peptide complex | 98.54 | |
| 3ox6_A | 153 | Calcium-binding protein 1; EF-hand, calcium-sensor | 98.54 | |
| 2joj_A | 77 | Centrin protein; N-terminal domain, centrin soluti | 98.54 | |
| 1uhk_A | 191 | Aequorin 2, aequorin; EF-hand motif, complex, lumi | 98.53 | |
| 2mys_C | 149 | Myosin; muscle protein, motor protein; HET: MLY; 2 | 98.53 | |
| 3mse_B | 180 | Calcium-dependent protein kinase, putative; CDPKS, | 98.53 | |
| 3akb_A | 166 | Putative calcium binding protein; EF-hand, metal b | 98.52 | |
| 1tiz_A | 67 | Calmodulin-related protein, putative; helix-turn-h | 98.52 | |
| 2ccm_A | 191 | Calexcitin; EF hand, calcium, signaling protein; 1 | 98.51 | |
| 2kz2_A | 94 | Calmodulin, CAM; TR2C, metal binding protein; NMR | 98.51 | |
| 1s6i_A | 188 | CDPK, calcium-dependent protein kinase SK5; EF-han | 98.5 | |
| 1wdc_C | 156 | Scallop myosin; calcium binding protein, muscle pr | 98.5 | |
| 1wdc_C | 156 | Scallop myosin; calcium binding protein, muscle pr | 98.5 | |
| 1q80_A | 174 | SCP, sarcoplasmic calcium-binding protein; all-alp | 98.5 | |
| 3k21_A | 191 | PFCDPK3, calcium-dependent protein kinase 3; calci | 98.49 | |
| 2sas_A | 185 | Sarcoplasmic calcium-binding protein; 2.40A {Branc | 98.49 | |
| 3khe_A | 191 | Calmodulin-like domain protein kinase isoform 3; c | 98.49 | |
| 1w7j_B | 151 | Myosin light chain 1; motor protein, unconventiona | 98.49 | |
| 1wdc_B | 156 | Scallop myosin; calcium binding protein, muscle pr | 98.49 | |
| 2b1u_A | 71 | Calmodulin-like protein 5; CLSP, calmodulin-like S | 98.49 | |
| 2ovk_B | 153 | RLC, myosin regulatory light chain LC-2, mantle mu | 98.48 | |
| 2jnf_A | 158 | Troponin C; stretch activated muscle contraction, | 98.48 | |
| 2bl0_C | 142 | Myosin regulatory light chain; muscle protein, sli | 98.48 | |
| 4ds7_A | 147 | Calmodulin, CAM; protein binding, metal binding, s | 98.48 | |
| 1ggw_A | 140 | Protein (CDC4P); light chain, cytokinesis, cell cy | 98.48 | |
| 3pm8_A | 197 | PFCDPK2, calcium-dependent protein kinase 2; malar | 98.47 | |
| 1s6j_A | 87 | CDPK, calcium-dependent protein kinase SK5; EF-han | 98.47 | |
| 2bec_A | 202 | Calcineurin B homologous protein 2; calcineurin-ho | 98.47 | |
| 1qls_A | 99 | S100C protein, calgizzarin; metal-binding protein/ | 98.47 | |
| 2lnk_A | 113 | Protein S100-A4; EF-hand, calcium binding, all alp | 98.47 | |
| 1y1x_A | 191 | Leishmania major homolog of programmed cell death | 98.47 | |
| 3a8r_A | 179 | Putative uncharacterized protein; EF-hand, membran | 98.46 | |
| 2ccm_A | 191 | Calexcitin; EF hand, calcium, signaling protein; 1 | 98.46 | |
| 1qv0_A | 195 | Obelin, OBL; photoprotein, bioluminescence, atomic | 98.46 | |
| 1c7v_A | 81 | CAVP, calcium vector protein; EF-hand family, calc | 98.46 | |
| 3tnu_B | 129 | Keratin, type II cytoskeletal 5; coiled-coil, stru | 98.46 | |
| 3n22_A | 98 | Protein S100-A2; EF-hand, calcium-binding, zinc-bi | 98.46 | |
| 3zwh_A | 104 | Protein S100-A4; Ca-binding protein-motor protein | 98.45 | |
| 1dtl_A | 161 | Cardiac troponin C; helix-turn-helix, structural p | 98.45 | |
| 1uhk_A | 191 | Aequorin 2, aequorin; EF-hand motif, complex, lumi | 98.45 | |
| 3li6_A | 66 | Calcium-binding protein; calcium signaling protein | 98.45 | |
| 3sjs_A | 220 | URE3-BP sequence specific DNA binding protein; EF- | 98.45 | |
| 2znd_A | 172 | Programmed cell death protein 6; penta-EF-hand pro | 98.45 | |
| 1w7j_B | 151 | Myosin light chain 1; motor protein, unconventiona | 98.45 | |
| 4eto_A | 93 | Protein S100-A4; calcium-binding protein, EF-hand, | 98.45 | |
| 3i5g_C | 159 | Myosin catalytic light chain LC-1, mantle muscle; | 98.44 | |
| 1h8b_A | 75 | ACT-EF34, alpha-actinin 2, skeletal muscle isoform | 98.44 | |
| 3nso_A | 101 | Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, meta | 98.44 | |
| 3tnu_A | 131 | Keratin, type I cytoskeletal 14; coiled-coil, stru | 98.43 | |
| 2f2o_A | 179 | Calmodulin fused with calmodulin-binding domain of | 98.43 | |
| 2hpk_A | 208 | Photoprotein berovin; structural genomics, PSI, pr | 98.42 | |
| 3e3r_A | 204 | Calcyphosin, calcyphosine; human calcyphosine, EF- | 98.42 | |
| 1nya_A | 176 | Calerythrin; EF-hand, metal binding protein; NMR { | 98.42 | |
| 1k9u_A | 78 | Polcalcin PHL P 7; pollen allergen, calcium-bindin | 98.42 | |
| 1xk4_A | 93 | Calgranulin A; S100 family, heterotetramer, metal | 98.42 | |
| 2kax_A | 92 | Protein S100-A5; EF-hand, calcium binding protien, | 98.42 | |
| 3pm8_A | 197 | PFCDPK2, calcium-dependent protein kinase 2; malar | 98.41 | |
| 1k2h_A | 93 | S100A1, S-100 protein, alpha chain; non-covalent h | 98.41 | |
| 2i7a_A | 174 | Calpain 13; calcium-dependent cytoplasmic cysteine | 98.41 | |
| 2sas_A | 185 | Sarcoplasmic calcium-binding protein; 2.40A {Branc | 98.41 | |
| 3ll8_B | 155 | Calcineurin subunit B type 1; protein-peptide dock | 98.41 | |
| 3mse_B | 180 | Calcium-dependent protein kinase, putative; CDPKS, | 98.41 | |
| 3k21_A | 191 | PFCDPK3, calcium-dependent protein kinase 3; calci | 98.4 | |
| 1k8u_A | 90 | S100A6, calcyclin, CACY; calcium regulatory protei | 98.4 | |
| 1alv_A | 173 | Calpain, S-camld; calcium binding, calmodulin like | 98.39 | |
| 2qac_A | 146 | Myosin A tail domain interacting protein MTIP; mal | 98.39 | |
| 2ct9_A | 208 | Calcium-binding protein P22; EF-hand, metal bindin | 98.39 | |
| 2znd_A | 172 | Programmed cell death protein 6; penta-EF-hand pro | 98.39 | |
| 3a4u_B | 143 | Multiple coagulation factor deficiency protein 2; | 98.39 | |
| 2hpk_A | 208 | Photoprotein berovin; structural genomics, PSI, pr | 98.38 | |
| 1y1x_A | 191 | Leishmania major homolog of programmed cell death | 98.38 | |
| 3u0k_A | 440 | Rcamp; fluorescent protein, calcium binding, EF-ha | 98.37 | |
| 2aao_A | 166 | CDPK, calcium-dependent protein kinase, isoform AK | 98.37 | |
| 1snl_A | 103 | Nucleobindin 1, calnuc; EF-hand, calcium-binding, | 98.36 | |
| 3tnu_B | 129 | Keratin, type II cytoskeletal 5; coiled-coil, stru | 98.36 | |
| 3dtp_E | 196 | RLC, myosin regulatory light chain; muscle protein | 98.35 | |
| 1qx2_A | 76 | Vitamin D-dependent calcium-binding protein, INTE; | 98.35 | |
| 3cs1_A | 219 | Flagellar calcium-binding protein; myristoylated, | 98.35 | |
| 4drw_A | 121 | Protein S100-A10/annexin A2 chimeric protein; atyp | 98.35 | |
| 3tnu_A | 131 | Keratin, type I cytoskeletal 14; coiled-coil, stru | 98.35 | |
| 5pal_A | 109 | Parvalbumin; calcium-binding protein; 1.54A {Triak | 98.34 | |
| 2kyc_A | 108 | Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand p | 98.34 | |
| 3rm1_A | 92 | Protein S100-B; alpha-helical, EF hand, metal bind | 98.34 | |
| 3fs7_A | 109 | Parvalbumin, thymic; calcium-binding protein, EF-h | 98.34 | |
| 1pva_A | 110 | Parvalbumin; calcium binding; 1.65A {Esox lucius} | 98.33 | |
| 3khe_A | 191 | Calmodulin-like domain protein kinase isoform 3; c | 98.33 | |
| 1juo_A | 198 | Sorcin; calcium-binding proteins, penta-EF-hand, P | 98.33 | |
| 1rro_A | 108 | RAT oncomodulin; calcium-binding protein; 1.30A {R | 98.33 | |
| 3j04_B | 143 | Myosin regulatory light chain 2, smooth muscle MA | 98.33 | |
| 3ll8_B | 155 | Calcineurin subunit B type 1; protein-peptide dock | 98.32 | |
| 2d58_A | 107 | Allograft inflammatory factor 1; EF-hand, metal bi | 98.32 | |
| 2y5i_A | 99 | S100Z, S100 calcium binding protein Z; metal-bindi | 98.32 | |
| 3akb_A | 166 | Putative calcium binding protein; EF-hand, metal b | 98.32 | |
| 1alv_A | 173 | Calpain, S-camld; calcium binding, calmodulin like | 98.32 | |
| 2pvb_A | 108 | Protein (parvalbumin); calcium binding protein, me | 98.31 | |
| 1wdc_B | 156 | Scallop myosin; calcium binding protein, muscle pr | 98.31 | |
| 1cb1_A | 78 | Calbindin D9K; calcium-binding protein; NMR {Sus s | 98.31 | |
| 2lvv_A | 226 | Flagellar calcium-binding protein TB-24; EF-hand, | 98.31 | |
| 3h4s_E | 135 | KCBP interacting Ca2+-binding protein; kinesin, mo | 98.31 | |
| 1rwy_A | 109 | Parvalbumin alpha; EF-hand, calcium-binding, calci | 98.3 | |
| 1q80_A | 174 | SCP, sarcoplasmic calcium-binding protein; all-alp | 98.3 | |
| 1jfj_A | 134 | Ehcabp, calcium-binding protein; EF-hand, helix-lo | 98.3 | |
| 1wlz_A | 105 | DJBP, CAP-binding protein complex interacting prot | 98.29 | |
| 1bu3_A | 109 | Calcium-binding protein; 1.65A {Merluccius bilinea | 98.29 | |
| 1xk4_C | 113 | Calgranulin B; S100 family, heterotetramer, metal | 98.29 | |
| 3dtp_E | 196 | RLC, myosin regulatory light chain; muscle protein | 98.28 | |
| 2bl0_B | 145 | Myosin regulatory light chain; muscle protein, sli | 98.27 | |
| 1jba_A | 204 | GCAP-2, protein (guanylate cyclase activating prot | 98.27 | |
| 1dgu_A | 183 | Calcium-saturated CIB; helical, EF-hands, blood cl | 98.26 | |
| 3i5g_B | 153 | Myosin regulatory light chain LC-2, mantle muscle; | 98.26 | |
| 2ovk_B | 153 | RLC, myosin regulatory light chain LC-2, mantle mu | 98.24 | |
| 2l4h_A | 214 | Calcium and integrin-binding protein 1; metal bind | 98.24 | |
| 3e3r_A | 204 | Calcyphosin, calcyphosine; human calcyphosine, EF- | 98.24 | |
| 2hps_A | 186 | Coelenterazine-binding protein with bound coelent; | 98.24 | |
| 2bec_A | 202 | Calcineurin B homologous protein 2; calcineurin-ho | 98.24 | |
| 3nyv_A | 484 | Calmodulin-domain protein kinase 1; serine/threoni | 98.23 | |
| 1s6i_A | 188 | CDPK, calcium-dependent protein kinase SK5; EF-han | 98.23 | |
| 2ovk_C | 159 | Myosin catalytic light chain LC-1, mantle muscle, | 98.22 | |
| 2mys_B | 166 | Myosin; muscle protein, motor protein; HET: MLY; 2 | 98.22 | |
| 2wcb_A | 95 | Protein S100-A12; calcium signalling, HOST-parasit | 98.21 | |
| 1k94_A | 165 | Grancalcin; penta-EF-hand protein, calcium binding | 98.21 | |
| 3nxa_A | 100 | Protein S100-A16; S100 family, calcium binding pro | 98.2 | |
| 1m45_A | 148 | MLC1P, myosin light chain; protein-peptide complex | 98.2 | |
| 1c1g_A | 284 | Tropomyosin; contractIle protein; 7.00A {Sus scrof | 98.2 | |
| 2l2e_A | 190 | Calcium-binding protein NCS-1; NCS1P, myristoylate | 98.19 | |
| 2jjz_A | 150 | Ionized calcium-binding adapter molecule 2; EF-han | 98.19 | |
| 3q5i_A | 504 | Protein kinase; CDPK, malaria, phosphotransferase, | 98.19 | |
| 1gjy_A | 167 | Sorcin, CP-22, V19; calcium binding, calcium-bindi | 98.18 | |
| 3q5i_A | 504 | Protein kinase; CDPK, malaria, phosphotransferase, | 98.18 | |
| 1j55_A | 95 | S-100P protein; metal binding protein; 2.00A {Homo | 98.18 | |
| 2ehb_A | 207 | Calcineurin B-like protein 4; protein complex, Ca( | 98.18 | |
| 1wy9_A | 147 | Allograft inflammatory factor 1; EF-hand, calucium | 98.17 | |
| 3dd4_A | 229 | KV channel-interacting protein 4; EF-hands protein | 98.17 | |
| 2zfd_A | 226 | Calcineurin B-like protein 2; calcium binding prot | 98.17 | |
| 1gjy_A | 167 | Sorcin, CP-22, V19; calcium binding, calcium-bindi | 98.16 | |
| 2ggz_A | 211 | Guanylyl cyclase-activating protein 3; EF hand, gu | 98.16 | |
| 1juo_A | 198 | Sorcin; calcium-binding proteins, penta-EF-hand, P | 98.16 | |
| 1jfj_A | 134 | Ehcabp, calcium-binding protein; EF-hand, helix-lo | 98.15 | |
| 2lvv_A | 226 | Flagellar calcium-binding protein TB-24; EF-hand, | 98.15 | |
| 2h2k_A | 106 | Protein S100-A13; calcium binding protein, metal b | 98.15 | |
| 1s6c_A | 183 | KV4 potassium channel-interacting protein kchip1B; | 98.14 | |
| 2ehb_A | 207 | Calcineurin B-like protein 4; protein complex, Ca( | 98.14 | |
| 2be4_A | 272 | Hypothetical protein LOC449832; DR.36843, BC083168 | 98.13 | |
| 1g8i_A | 190 | Frequenin, neuronal calcium sensor 1; calcium bind | 98.13 | |
| 2r2i_A | 198 | Guanylyl cyclase-activating protein 1; EF hand, GC | 98.13 | |
| 2f33_A | 263 | Calbindin; EF-hand, Ca2+-binding, metal binding pr | 98.13 | |
| 3sg6_A | 450 | Gcamp2, myosin light chain kinase, green fluoresce | 98.13 | |
| 3lij_A | 494 | Calcium/calmodulin dependent protein kinase with A | 98.12 | |
| 1k94_A | 165 | Grancalcin; penta-EF-hand protein, calcium binding | 98.11 | |
| 3ghg_A | 562 | Fibrinogen alpha chain; triple-stranded coiled coi | 98.11 | |
| 1fpw_A | 190 | Yeast frequenin, calcium-binding protein NCS-1; EF | 98.11 | |
| 2zfd_A | 226 | Calcineurin B-like protein 2; calcium binding prot | 98.1 | |
| 3mwu_A | 486 | Calmodulin-domain protein kinase 1; serine/threoni | 98.08 | |
| 1ggw_A | 140 | Protein (CDC4P); light chain, cytokinesis, cell cy | 98.08 | |
| 2r2i_A | 198 | Guanylyl cyclase-activating protein 1; EF hand, GC | 98.06 | |
| 1snl_A | 103 | Nucleobindin 1, calnuc; EF-hand, calcium-binding, | 98.06 | |
| 2d8n_A | 207 | Recoverin; structural genomics, NPPSFA, national p | 98.05 | |
| 2kld_A | 123 | Polycystin-2; PC2, PKD2, calcium binding domain, E | 98.04 | |
| 1bjf_A | 193 | Neurocalcin delta; calcium-binding, myristoylation | 98.04 | |
| 3lij_A | 494 | Calcium/calmodulin dependent protein kinase with A | 98.04 | |
| 3sg6_A | 450 | Gcamp2, myosin light chain kinase, green fluoresce | 98.03 | |
| 3a4u_B | 143 | Multiple coagulation factor deficiency protein 2; | 98.03 | |
| 3nyv_A | 484 | Calmodulin-domain protein kinase 1; serine/threoni | 98.03 | |
| 1psr_A | 100 | Psoriasin, S100A7; EF-hand protein, MAD phasing, p | 98.02 | |
| 1jba_A | 204 | GCAP-2, protein (guanylate cyclase activating prot | 98.02 | |
| 1s1e_A | 224 | KV channel interacting protein 1; kchip, calcium-b | 98.02 | |
| 3a8r_A | 179 | Putative uncharacterized protein; EF-hand, membran | 98.02 | |
| 2v71_A | 189 | Nuclear distribution protein NUDE-like 1; developm | 98.01 | |
| 2f33_A | 263 | Calbindin; EF-hand, Ca2+-binding, metal binding pr | 98.01 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 98.0 | |
| 2jul_A | 256 | Calsenilin; EF-hand, calcium, LXXLL, DNA binding p | 98.0 | |
| 3na7_A | 256 | HP0958; flagellar biogenesis, flagellum export, C4 | 98.0 | |
| 1s6c_A | 183 | KV4 potassium channel-interacting protein kchip1B; | 97.99 | |
| 3mwu_A | 486 | Calmodulin-domain protein kinase 1; serine/threoni | 97.98 | |
| 2l2e_A | 190 | Calcium-binding protein NCS-1; NCS1P, myristoylate | 97.98 | |
| 1a4p_A | 96 | S100A10; S100 family, EF-hand protein, ligand of a | 97.97 | |
| 1fpw_A | 190 | Yeast frequenin, calcium-binding protein NCS-1; EF | 97.96 | |
| 1g8i_A | 190 | Frequenin, neuronal calcium sensor 1; calcium bind | 97.96 | |
| 2ggz_A | 211 | Guanylyl cyclase-activating protein 3; EF hand, gu | 97.95 | |
| 2be4_A | 272 | Hypothetical protein LOC449832; DR.36843, BC083168 | 97.94 | |
| 2qac_A | 146 | Myosin A tail domain interacting protein MTIP; mal | 97.92 | |
| 2ct9_A | 208 | Calcium-binding protein P22; EF-hand, metal bindin | 97.91 | |
| 2d8n_A | 207 | Recoverin; structural genomics, NPPSFA, national p | 97.9 | |
| 1dgu_A | 183 | Calcium-saturated CIB; helical, EF-hands, blood cl | 97.9 | |
| 1ij5_A | 323 | Plasmodial specific LAV1-2 protein; fourty kDa cal | 97.9 | |
| 1bjf_A | 193 | Neurocalcin delta; calcium-binding, myristoylation | 97.9 | |
| 1sjj_A | 863 | Actinin; 3-helix bundle, calponin homology domain, | 97.89 | |
| 1ij5_A | 323 | Plasmodial specific LAV1-2 protein; fourty kDa cal | 97.86 | |
| 2kyc_A | 108 | Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand p | 97.85 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 97.85 | |
| 1deq_A | 390 | Fibrinogen (alpha chain); coiled-coil, blood clott | 97.83 | |
| 3na7_A | 256 | HP0958; flagellar biogenesis, flagellum export, C4 | 97.83 | |
| 3bow_A | 714 | Calpain-2 catalytic subunit; cysteine protease, in | 97.81 | |
| 3cs1_A | 219 | Flagellar calcium-binding protein; myristoylated, | 97.8 | |
| 3dd4_A | 229 | KV channel-interacting protein 4; EF-hands protein | 97.77 | |
| 2jul_A | 256 | Calsenilin; EF-hand, calcium, LXXLL, DNA binding p | 97.76 | |
| 2hps_A | 186 | Coelenterazine-binding protein with bound coelent; | 97.76 | |
| 3trt_A | 77 | Vimentin; cytoskeleton, intermediate filament, alp | 97.76 | |
| 2l4h_A | 214 | Calcium and integrin-binding protein 1; metal bind | 97.75 | |
| 3bow_A | 714 | Calpain-2 catalytic subunit; cysteine protease, in | 97.75 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 97.74 | |
| 2i7a_A | 174 | Calpain 13; calcium-dependent cytoplasmic cysteine | 97.73 | |
| 1s1e_A | 224 | KV channel interacting protein 1; kchip, calcium-b | 97.71 | |
| 3o0z_A | 168 | RHO-associated protein kinase 1; coiled-coil, tran | 97.69 | |
| 1djx_A | 624 | PLC-D1, phosphoinositide-specific phospholipase C, | 97.68 | |
| 2v71_A | 189 | Nuclear distribution protein NUDE-like 1; developm | 97.67 | |
| 3o0z_A | 168 | RHO-associated protein kinase 1; coiled-coil, tran | 97.63 | |
| 3vkg_A | 3245 | Dynein heavy chain, cytoplasmic; AAA+ protein, mol | 97.6 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 97.54 | |
| 1qxp_A | 900 | MU-like calpain; M-calpain, MU-calpain, catalytic | 97.54 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 97.53 | |
| 1sra_A | 151 | Sparc; extracellular matrix protein, calcium-bindi | 97.44 | |
| 3vkg_A | 3245 | Dynein heavy chain, cytoplasmic; AAA+ protein, mol | 97.43 | |
| 2kld_A | 123 | Polycystin-2; PC2, PKD2, calcium binding domain, E | 97.36 | |
| 1h8b_A | 75 | ACT-EF34, alpha-actinin 2, skeletal muscle isoform | 97.33 | |
| 3ghg_A | 562 | Fibrinogen alpha chain; triple-stranded coiled coi | 97.33 | |
| 3trt_A | 77 | Vimentin; cytoskeleton, intermediate filament, alp | 97.32 | |
| 1sjj_A | 863 | Actinin; 3-helix bundle, calponin homology domain, | 97.13 | |
| 2fxo_A | 129 | Myosin heavy chain, cardiac muscle beta isoform; c | 97.07 | |
| 1eg3_A | 261 | Dystrophin; EF-hand like domain, WW domain, struct | 96.98 | |
| 1djx_A | 624 | PLC-D1, phosphoinositide-specific phospholipase C, | 96.95 | |
| 2zkm_X | 799 | 1-phosphatidylinositol-4,5-bisphosphate phosphodie | 96.95 | |
| 1sra_A | 151 | Sparc; extracellular matrix protein, calcium-bindi | 96.93 | |
| 3u1c_A | 101 | Tropomyosin alpha-1 chain; anti-parallel coiled co | 96.89 | |
| 2v66_B | 111 | Nuclear distribution protein NUDE-like 1; structur | 96.8 | |
| 2fxo_A | 129 | Myosin heavy chain, cardiac muscle beta isoform; c | 96.78 | |
| 1nub_A | 229 | Basement membrane protein BM-40; extracellular mod | 96.78 | |
| 2efr_A | 155 | General control protein GCN4 and tropomyosin 1 Al; | 96.75 | |
| 3u1c_A | 101 | Tropomyosin alpha-1 chain; anti-parallel coiled co | 96.74 | |
| 1ic2_A | 81 | Tropomyosin alpha chain, skeletal muscle; alpha-he | 96.72 | |
| 1qxp_A | 900 | MU-like calpain; M-calpain, MU-calpain, catalytic | 96.7 | |
| 2zkm_X | 799 | 1-phosphatidylinositol-4,5-bisphosphate phosphodie | 96.67 | |
| 2ocy_A | 154 | RAB guanine nucleotide exchange factor SEC2; RAB, | 96.55 | |
| 3u59_A | 101 | Tropomyosin beta chain; muscle contraction, actin, | 96.45 | |
| 2v66_B | 111 | Nuclear distribution protein NUDE-like 1; structur | 96.44 | |
| 1m1j_A | 491 | Fibrinogen alpha subunit; coiled coils, disulfide | 96.44 | |
| 3hnw_A | 138 | Uncharacterized protein; coiled-coil, structural g | 96.37 | |
| 2efr_A | 155 | General control protein GCN4 and tropomyosin 1 Al; | 96.36 | |
| 3iox_A | 497 | AGI/II, PA; alpha helix, PPII helix, supersandwich | 96.34 | |
| 1nub_A | 229 | Basement membrane protein BM-40; extracellular mod | 96.23 | |
| 2ocy_A | 154 | RAB guanine nucleotide exchange factor SEC2; RAB, | 96.22 | |
| 1eg3_A | 261 | Dystrophin; EF-hand like domain, WW domain, struct | 96.17 | |
| 2eqb_B | 97 | RAB guanine nucleotide exchange factor SEC2; coile | 96.13 | |
| 3q8t_A | 96 | Beclin-1; autophagy, ATG14L uvrag, apoptosis; 1.90 | 96.09 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 96.09 | |
| 3mq9_A | 471 | Bone marrow stromal antigen 2 fused to maltose-BI | 96.04 | |
| 2zqm_A | 117 | Prefoldin beta subunit 1; chaperone; HET: CIT; 1.9 | 96.01 | |
| 3hnw_A | 138 | Uncharacterized protein; coiled-coil, structural g | 95.93 | |
| 4gkw_A | 167 | Spindle assembly abnormal protein 6; double helix, | 95.9 | |
| 3ol1_A | 119 | Vimentin; structural genomics, PSI-2, protein stru | 95.9 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 95.9 | |
| 3ohm_B | 885 | 1-phosphatidylinositol-4,5-bisphosphate phosphodi | 95.69 | |
| 3mq9_A | 471 | Bone marrow stromal antigen 2 fused to maltose-BI | 95.67 | |
| 3ohm_B | 885 | 1-phosphatidylinositol-4,5-bisphosphate phosphodi | 95.53 | |
| 1u5p_A | 216 | Spectrin alpha chain, brain; alpha spectrin, two r | 95.41 | |
| 1m1j_B | 464 | Fibrinogen beta chain; coiled coils, disulfide rin | 95.39 | |
| 1ic2_A | 81 | Tropomyosin alpha chain, skeletal muscle; alpha-he | 95.36 | |
| 1m1j_B | 464 | Fibrinogen beta chain; coiled coils, disulfide rin | 95.35 | |
| 1fxk_A | 107 | Prefoldin; archaeal protein, chaperone; 2.30A {Met | 95.34 | |
| 1x79_B | 112 | RAB GTPase binding effector protein 1; rabaptin5, | 95.25 | |
| 1tuz_A | 118 | Diacylglycerol kinase alpha; transferase, HR532, n | 95.23 | |
| 3i00_A | 120 | HIP-I, huntingtin-interacting protein 1; transcrip | 95.21 | |
| 3mq7_A | 121 | Bone marrow stromal antigen 2; HIV, antiviral prot | 95.21 | |
| 1deq_A | 390 | Fibrinogen (alpha chain); coiled-coil, blood clott | 95.09 | |
| 2b9c_A | 147 | Striated-muscle alpha tropomyosin; alpha-helix, co | 95.06 | |
| 1gk4_A | 84 | Vimentin; intermediate filament, dimer, parallel c | 94.96 | |
| 2e7s_A | 135 | RAB guanine nucleotide exchange factor SEC2; coile | 94.9 | |
| 2v0o_A | 276 | FCHO2, FCH domain only protein 2; lipid-binding pr | 94.88 | |
| 3plt_A | 234 | Sphingolipid long chain base-responsive protein L; | 94.87 | |
| 4ad8_A | 517 | DNA repair protein RECN; DNA binding protein, ATPa | 94.65 | |
| 3q8t_A | 96 | Beclin-1; autophagy, ATG14L uvrag, apoptosis; 1.90 | 94.62 | |
| 3cl3_D | 130 | NF-kappa-B essential modulator; death effector dom | 94.62 | |
| 2eqb_B | 97 | RAB guanine nucleotide exchange factor SEC2; coile | 94.58 | |
| 1cun_A | 213 | Protein (alpha spectrin); two repeats of spectrin, | 94.55 | |
| 3ol1_A | 119 | Vimentin; structural genomics, PSI-2, protein stru | 94.52 | |
| 1m1j_C | 409 | Fibrinogen gamma chain; coiled coils, disulfide ri | 94.51 | |
| 1s35_A | 214 | Beta-I spectrin, spectrin beta chain, erythrocyte; | 94.5 | |
| 3qr0_A | 816 | Phospholipase C-beta (PLC-beta); PH domain, EF han | 94.38 | |
| 2i1j_A | 575 | Moesin; FERM, coiled-coil, C-ermad, ERM, radixin, | 94.2 | |
| 3mq7_A | 121 | Bone marrow stromal antigen 2; HIV, antiviral prot | 94.15 | |
| 2zqm_A | 117 | Prefoldin beta subunit 1; chaperone; HET: CIT; 1.9 | 94.07 | |
| 3qr0_A | 816 | Phospholipase C-beta (PLC-beta); PH domain, EF han | 94.01 | |
| 1fxk_C | 133 | Protein (prefoldin); archaeal protein, chaperone; | 93.9 | |
| 3ajw_A | 150 | Flagellar FLIJ protein; flagellum, type III secret | 93.76 | |
| 1fxk_A | 107 | Prefoldin; archaeal protein, chaperone; 2.30A {Met | 93.73 | |
| 2jee_A | 81 | YIIU; FTSZ, septum, coiled-coil, cell division, ce | 93.72 | |
| 4gkw_A | 167 | Spindle assembly abnormal protein 6; double helix, | 93.61 | |
| 2no2_A | 107 | HIP-I, huntingtin-interacting protein 1; clathrin | 93.56 | |
| 3edv_A | 323 | Spectrin beta chain, brain 1; spectrin repeat, coi | 93.48 | |
| 1x8y_A | 86 | Lamin A/C; structural protein, intermediate filame | 93.43 | |
| 1m1j_A | 491 | Fibrinogen alpha subunit; coiled coils, disulfide | 93.42 | |
| 2b9c_A | 147 | Striated-muscle alpha tropomyosin; alpha-helix, co | 93.41 | |
| 1u4q_A | 322 | Spectrin alpha chain, brain; alpha spectrin, three | 93.4 | |
| 1x79_B | 112 | RAB GTPase binding effector protein 1; rabaptin5, | 93.31 | |
| 2e7s_A | 135 | RAB guanine nucleotide exchange factor SEC2; coile | 93.3 | |
| 1u4q_A | 322 | Spectrin alpha chain, brain; alpha spectrin, three | 93.22 | |
| 2efk_A | 301 | CDC42-interacting protein 4; EFC domain, structura | 93.06 | |
| 1l8d_A | 112 | DNA double-strand break repair RAD50 ATPase; zinc | 93.04 | |
| 3bas_A | 89 | Myosin heavy chain, striated muscle/general contro | 93.0 | |
| 2oto_A | 155 | M protein; helical coiled coil, fibrinogen-binding | 92.97 | |
| 2efl_A | 305 | Formin-binding protein 1; EFC domain, structural g | 92.96 | |
| 1f5n_A | 592 | Interferon-induced guanylate-binding protein 1; GB | 92.86 | |
| 3i00_A | 120 | HIP-I, huntingtin-interacting protein 1; transcrip | 92.75 | |
| 3swk_A | 86 | Vimentin; cytoskeleton, intermediate filament, alp | 92.61 | |
| 2xnx_M | 146 | M protein, M1-BC1; cell adhesion, virulence factor | 92.49 | |
| 3mov_A | 95 | Lamin-B1; LMNB1, B-type lamins, intermediate filam | 92.49 | |
| 1d7m_A | 101 | Cortexillin I; coiled-coil, coiled-coil trigger si | 92.47 | |
| 3kbt_A | 326 | Beta-I spectrin, spectrin beta chain, erythrocyte; | 92.19 | |
| 1l8d_A | 112 | DNA double-strand break repair RAD50 ATPase; zinc | 92.09 | |
| 3s84_A | 273 | Apolipoprotein A-IV; four helix bundle, transport | 92.02 | |
| 3abh_A | 312 | Pacsin2, protein kinase C and casein kinase substr | 91.93 | |
| 3haj_A | 486 | Human pacsin2 F-BAR; pacsin,syndapin,FAP52,F-BAR, | 91.88 | |
| 2v4h_A | 110 | NF-kappa-B essential modulator; transcription, met | 91.7 | |
| 2efl_A | 305 | Formin-binding protein 1; EFC domain, structural g | 91.69 | |
| 3ajw_A | 150 | Flagellar FLIJ protein; flagellum, type III secret | 91.61 | |
| 1gk4_A | 84 | Vimentin; intermediate filament, dimer, parallel c | 91.61 | |
| 3k29_A | 169 | Putative uncharacterized protein; YSCO, type III s | 91.5 | |
| 3iox_A | 497 | AGI/II, PA; alpha helix, PPII helix, supersandwich | 91.43 | |
| 3haj_A | 486 | Human pacsin2 F-BAR; pacsin,syndapin,FAP52,F-BAR, | 91.43 | |
| 3a7p_A | 152 | Autophagy protein 16; coiled-coil, coiled coil, cy | 91.42 | |
| 1m1j_C | 409 | Fibrinogen gamma chain; coiled coils, disulfide ri | 91.27 | |
| 1cun_A | 213 | Protein (alpha spectrin); two repeats of spectrin, | 91.24 | |
| 1tuz_A | 118 | Diacylglycerol kinase alpha; transferase, HR532, n | 91.18 | |
| 3hhm_B | 373 | NISH2 P85alpha; PI3KCA, PI3K, PIK3R1, phosphatidil | 91.1 | |
| 3edu_A | 218 | Beta-I spectrin, spectrin beta chain, erythrocyte; | 91.1 | |
| 3swk_A | 86 | Vimentin; cytoskeleton, intermediate filament, alp | 90.87 | |
| 1ez3_A | 127 | Syntaxin-1A; three helix bundle, endocytosis/exocy | 90.86 | |
| 1cii_A | 602 | Colicin IA; bacteriocin, ION channel formation, tr | 90.83 | |
| 3l4q_C | 170 | Phosphatidylinositol 3-kinase regulatory subunit b | 90.83 | |
| 3pdy_A | 210 | Plectin; cytoskeleton, plakin, intermediate filame | 90.81 | |
| 3ghg_B | 461 | Fibrinogen beta chain; triple-stranded coiled coil | 90.78 | |
| 3fb2_A | 218 | Spectrin alpha chain, brain spectrin; non-erythroi | 90.72 | |
| 3kbt_A | 326 | Beta-I spectrin, spectrin beta chain, erythrocyte; | 90.71 | |
| 2zdi_C | 151 | Prefoldin subunit alpha; chaperone, cytoplasm; 3.0 | 90.67 | |
| 3fpp_A | 341 | Macrolide-specific efflux protein MACA; hexameric | 90.63 | |
| 3lay_A | 175 | Zinc resistance-associated protein; salmonella typ | 90.6 | |
| 3edv_A | 323 | Spectrin beta chain, brain 1; spectrin repeat, coi | 90.56 | |
| 2i1j_A | 575 | Moesin; FERM, coiled-coil, C-ermad, ERM, radixin, | 90.52 | |
| 3abh_A | 312 | Pacsin2, protein kinase C and casein kinase substr | 90.49 | |
| 2xzr_A | 114 | Immunoglobulin-binding protein EIBD; cell adhesion | 90.42 | |
| 2xnx_M | 146 | M protein, M1-BC1; cell adhesion, virulence factor | 90.39 | |
| 2b5u_A | 551 | Colicin E3; high resolution colicin E3, ribosome i | 90.22 | |
| 3lbx_A | 161 | Spectrin alpha chain, erythrocyte; tetramer, compl | 90.03 | |
| 2w83_C | 77 | C-JUN-amino-terminal kinase-interacting protein 4; | 89.98 | |
| 4emc_A | 190 | Monopolin complex subunit CSM1; RWD domain, kineto | 89.87 | |
| 2x3v_A | 337 | Syndapin I, protein kinase C and casein kinase sub | 89.76 | |
| 3r6n_A | 450 | Desmoplakin; spectrin repeat, SH3 domain, cell adh | 89.7 | |
| 2lw1_A | 89 | ABC transporter ATP-binding protein UUP; ABC REG s | 89.69 | |
| 2a01_A | 243 | Apolipoprotein A-I; four-helix bundle, lipid trans | 89.52 | |
| 2odv_A | 235 | Plectin 1, HD1; plakin domain, spectrin repeat, cy | 89.44 | |
| 3cvf_A | 79 | Homer-3, homer protein homolog 3; coiled coil, alt | 89.44 | |
| 2b5u_A | 551 | Colicin E3; high resolution colicin E3, ribosome i | 89.39 | |
| 4h22_A | 103 | Leucine-rich repeat flightless-interacting protei; | 89.17 | |
| 3f31_A | 149 | Spectrin alpha chain, brain; LONE helix followed b | 89.08 | |
| 3bas_A | 89 | Myosin heavy chain, striated muscle/general contro | 89.01 | |
| 4fla_A | 152 | Regulation of nuclear PRE-mRNA domain-containing 1 | 88.85 | |
| 1cii_A | 602 | Colicin IA; bacteriocin, ION channel formation, tr | 88.8 | |
| 4dyl_A | 406 | Tyrosine-protein kinase FES/FPS; structural genomi | 88.77 | |
| 1bf5_A | 575 | Signal transducer and activator of transcription 1 | 88.71 | |
| 3caz_A | 294 | BAR protein; thermo-acidophilic RED ALGA, protein | 88.7 | |
| 1quu_A | 250 | Human skeletal muscle alpha-actinin 2; triple-heli | 88.59 | |
| 1fxk_C | 133 | Protein (prefoldin); archaeal protein, chaperone; | 88.56 | |
| 4h22_A | 103 | Leucine-rich repeat flightless-interacting protei; | 88.48 | |
| 2avr_X | 119 | Adhesion A; antiparallel helix-loop-helix, leucine | 88.45 | |
| 2v0o_A | 276 | FCHO2, FCH domain only protein 2; lipid-binding pr | 88.24 | |
| 2v4h_A | 110 | NF-kappa-B essential modulator; transcription, met | 88.04 | |
| 3uun_A | 119 | Dystrophin; triple helical, cell structure and sta | 87.95 | |
| 2ch7_A | 309 | Methyl-accepting chemotaxis protein; receptor, fou | 87.92 | |
| 1wle_A | 501 | Seryl-tRNA synthetase; ligase; HET: SRP; 1.65A {Bo | 87.9 | |
| 1pul_A | 125 | Hypothetical protein C32E8.3 in chromosome I; alph | 87.79 | |
| 1nfn_A | 191 | Apolipoprotein E3; lipid transport, heparin-bindin | 87.66 | |
| 3aco_A | 350 | Pacsin2, protein kinase C and casein kinase substr | 87.58 | |
| 2x3v_A | 337 | Syndapin I, protein kinase C and casein kinase sub | 87.57 | |
| 3ghg_C | 411 | Fibrinogen gamma chain; triple-stranded coiled coi | 87.51 | |
| 1bg1_A | 596 | Protein (transcription factor STAT3B); protein-DNA | 87.42 | |
| 3etw_A | 119 | Adhesin A; antiparallel helix-loop-helix, leucine | 87.39 | |
| 1y1u_A | 585 | Signal transducer and activator of transcription; | 87.15 | |
| 2p22_C | 192 | Protein SRN2; endosome, trafficking complex, VPS23 | 86.9 | |
| 2nrj_A | 346 | HBL B protein; enterotoxin, hemolysis, transmembra | 86.87 | |
| 2qih_A | 157 | Protein USPA1; trimeric, parallel alpha-helical co | 86.74 | |
| 3fpp_A | 341 | Macrolide-specific efflux protein MACA; hexameric | 86.64 | |
| 3ni0_A | 99 | Bone marrow stromal antigen 2; coiled-coil, antivi | 86.64 | |
| 3c9i_A | 242 | Tail needle protein GP26; xenon, coiled-coil, prot | 86.58 | |
| 3okq_A | 141 | BUD site selection protein 6; coiled-coil, protein | 86.58 | |
| 3etw_A | 119 | Adhesin A; antiparallel helix-loop-helix, leucine | 86.57 | |
| 1go4_E | 100 | MAD1 (mitotic arrest deficient)-like 1; mitotic sp | 86.55 | |
| 2efk_A | 301 | CDC42-interacting protein 4; EFC domain, structura | 86.39 | |
| 1quu_A | 250 | Human skeletal muscle alpha-actinin 2; triple-heli | 86.3 | |
| 1nfn_A | 191 | Apolipoprotein E3; lipid transport, heparin-bindin | 86.25 | |
| 4hpq_C | 413 | ATG17, KLTH0D15642P; autophagy, protein transport; | 86.23 | |
| 3r6n_A | 450 | Desmoplakin; spectrin repeat, SH3 domain, cell adh | 86.2 | |
| 3plt_A | 234 | Sphingolipid long chain base-responsive protein L; | 86.1 |
| >3fia_A Intersectin-1; EH 1 domain, NESG, structural genomics, PSI- 2, protein structure initiative, northeast structural genomics consortium; 1.45A {Homo sapiens} PDB: 2khn_A | Back alignment and structure |
|---|
Probab=99.86 E-value=1.3e-21 Score=191.06 Aligned_cols=96 Identities=35% Similarity=0.565 Sum_probs=90.8
Q ss_pred CCCCCCCCCCHHHHHHHHHHHHHhCCCCCCcccHHHHHHHHHcCCCCHHHHHHHHHHhCCCCCCccCHHHHHHHHHHHHH
Q 000940 425 QSHVPWPKMTHSEVQKYTKVFVQVDIDRDGKITGEQAYNLFLSWRLPREVLKQVWDLSDQDNDGMLSLKEFCTALYLMER 504 (1216)
Q Consensus 425 ~~~~~Wp~LS~eEk~ey~eaF~~fDkDgDG~ISgdELr~~flgs~LpeeeL~qIW~LaDiD~DGkLdfdEFvvAM~LI~~ 504 (1216)
.+..+| .|+++++++|+++|+.+|+ ++|+|+++|++.+|++++|++++|++||+++|.|+||+|+|+||++||+||++
T Consensus 20 g~~~~W-~it~ee~~~y~~iF~~lD~-~dG~Isg~elr~~~~~sgLp~~~L~~Iw~laD~d~dG~Ld~~EF~~aM~Li~~ 97 (121)
T 3fia_A 20 GSLDTW-AITVEERAKHDQQFHSLKP-ISGFITGDQARNFFFQSGLPQPVLAQIWALADMNNDGRMDQVEFSIAMKLIKL 97 (121)
T ss_dssp CCTTTS-CCCHHHHHHHHHHHHHTCC-BTTBEEHHHHHHHHGGGCCCHHHHHHHHHHHCTTCSSEECHHHHHHHHHHHHH
T ss_pred CCCCCC-CCCHHHHHHHHHHHHHhCC-CCCeECHHHHHHHHHHcCCCHHHHHHHHHHHcCCCCCcCCHHHHHHHHHHHHH
Confidence 445689 7999999999999999998 89999999999999999999999999999999999999999999999999999
Q ss_pred HhcCCCCCCCCCCCCCCC
Q 000940 505 YREGRPLPTMLPSTIMPD 522 (1216)
Q Consensus 505 ~l~G~~LP~~LPp~L~Pp 522 (1216)
+++|++||.+||+.|+.+
T Consensus 98 ~~~G~~lP~~LP~~l~~~ 115 (121)
T 3fia_A 98 KLQGYQLPSALPPVMKQQ 115 (121)
T ss_dssp HHTTCCCCSSCCGGGC--
T ss_pred HHcCCCCCCCCCHHHHcC
Confidence 999999999999999875
|
| >1eh2_A EPS15; calcium binding, signaling domain, NPF binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 PDB: 2jxc_A 1f8h_A 1ff1_A | Back alignment and structure |
|---|
| >1c07_A Protein (epidermal growth factor receptor pathway substrate 15); calcium binding, signaling domain, NPF binding, FW binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 | Back alignment and structure |
|---|
| >1iq3_A Ralbp1-interacting protein (partner of ralbp1); EF-hand domain, POB1 EH domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: a.39.1.6 | Back alignment and structure |
|---|
| >1fi6_A EH domain protein REPS1; EPS15 homology domain, EF hand, calcium, RAS signal transduction, endocytosis/exocytosis complex; NMR {Mus musculus} SCOP: a.39.1.6 | Back alignment and structure |
|---|
| >3fia_A Intersectin-1; EH 1 domain, NESG, structural genomics, PSI- 2, protein structure initiative, northeast structural genomics consortium; 1.45A {Homo sapiens} PDB: 2khn_A | Back alignment and structure |
|---|
| >2jq6_A EH domain-containing protein 1; metal binding protein; NMR {Homo sapiens} PDB: 2kff_A 2kfg_A 2kfh_A 2ksp_A | Back alignment and structure |
|---|
| >1eh2_A EPS15; calcium binding, signaling domain, NPF binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 PDB: 2jxc_A 1f8h_A 1ff1_A | Back alignment and structure |
|---|
| >2kgr_A Intersectin-1; structure, alternative splicing, calcium, cell junction, cell projection, coiled coil, endocytosis, membrane, phosphoprotein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2jq6_A EH domain-containing protein 1; metal binding protein; NMR {Homo sapiens} PDB: 2kff_A 2kfg_A 2kfh_A 2ksp_A | Back alignment and structure |
|---|
| >1qjt_A EH1, epidermal growth factor receptor substrate substrate 15, EPS15; EH domain, EF-hand, solution structure, S100 protein; NMR {Mus musculus} SCOP: a.39.1.6 | Back alignment and structure |
|---|
| >2qpt_A EH domain-containing protein-2; protein-nucleotide complex, membrane protein, endocytosis; HET: ANP; 3.10A {Mus musculus} | Back alignment and structure |
|---|
| >2qpt_A EH domain-containing protein-2; protein-nucleotide complex, membrane protein, endocytosis; HET: ANP; 3.10A {Mus musculus} | Back alignment and structure |
|---|
| >1c07_A Protein (epidermal growth factor receptor pathway substrate 15); calcium binding, signaling domain, NPF binding, FW binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 | Back alignment and structure |
|---|
| >1fi6_A EH domain protein REPS1; EPS15 homology domain, EF hand, calcium, RAS signal transduction, endocytosis/exocytosis complex; NMR {Mus musculus} SCOP: a.39.1.6 | Back alignment and structure |
|---|
| >1iq3_A Ralbp1-interacting protein (partner of ralbp1); EF-hand domain, POB1 EH domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: a.39.1.6 | Back alignment and structure |
|---|
| >1qjt_A EH1, epidermal growth factor receptor substrate substrate 15, EPS15; EH domain, EF-hand, solution structure, S100 protein; NMR {Mus musculus} SCOP: a.39.1.6 | Back alignment and structure |
|---|
| >2kgr_A Intersectin-1; structure, alternative splicing, calcium, cell junction, cell projection, coiled coil, endocytosis, membrane, phosphoprotein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2lv7_A Calcium-binding protein 7; metal binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2joj_A Centrin protein; N-terminal domain, centrin solution structure, EF-hand calcium binding protein, cell cycle; NMR {Euplotes octocarinatus} | Back alignment and structure |
|---|
| >2opo_A Polcalcin CHE A 3; calcium-binding protein, dimer, domain-swapping, EF-hand; 1.75A {Chenopodium album} SCOP: a.39.1.10 PDB: 1h4b_A | Back alignment and structure |
|---|
| >1avs_A Troponin C; muscle contraction, calcium-activated, E-F hand calcium-binding protein; 1.75A {Gallus gallus} SCOP: a.39.1.5 PDB: 1blq_A 1skt_A 1tnp_A 1tnq_A 1zac_A 1smg_A 1npq_A 1trf_A | Back alignment and structure |
|---|
| >2pmy_A RAS and EF-hand domain-containing protein; rasef, calcium-binding domain, structural genomics, structural genomics consortium, SGC; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >2kn2_A Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco MKP1, metal binding Pro; NMR {Glycine max} | Back alignment and structure |
|---|
| >1yx7_A Calsensin, LAN3-6 antigen; calcium-binding protein EF-hand, helix-loop- helix, nervous system, metal binding protein; NMR {Haemopis marmorata} PDB: 1yx8_A | Back alignment and structure |
|---|
| >1j7q_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1j7r_A | Back alignment and structure |
|---|
| >3nso_A Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, metal binding protein; 1.45A {Homo sapiens} SCOP: a.39.1.2 PDB: 3nsi_A 1kso_A 3nsk_A 3nsl_A | Back alignment and structure |
|---|
| >3zwh_A Protein S100-A4; Ca-binding protein-motor protein complex, S100 proteins, EF-; 1.94A {Homo sapiens} | Back alignment and structure |
|---|
| >4eto_A Protein S100-A4; calcium-binding protein, EF-hand, structural genomics, PSI-B protein structure initiative, NEW YORK structural genomics consortium; 1.54A {Homo sapiens} PDB: 1m31_A 2q91_A 3cga_A 3ko0_A* 3m0w_A* | Back alignment and structure |
|---|
| >2lnk_A Protein S100-A4; EF-hand, calcium binding, all alpha, metal binding protein, binding protein; NMR {Homo sapiens} PDB: 3c1v_A | Back alignment and structure |
|---|
| >1tiz_A Calmodulin-related protein, putative; helix-turn-helix, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >2kz2_A Calmodulin, CAM; TR2C, metal binding protein; NMR {Gallus gallus} | Back alignment and structure |
|---|
| >2lmt_A Calmodulin-related protein 97A; spermatogenesis, metal binding protein; NMR {Drosophila melanogaster} PDB: 2lmu_A 2lmv_A | Back alignment and structure |
|---|
| >2b1u_A Calmodulin-like protein 5; CLSP, calmodulin-like SKIN protein, solution structure, backbone dynamic, structural genomics; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2opo_A Polcalcin CHE A 3; calcium-binding protein, dimer, domain-swapping, EF-hand; 1.75A {Chenopodium album} SCOP: a.39.1.10 PDB: 1h4b_A | Back alignment and structure |
|---|
| >2y5i_A S100Z, S100 calcium binding protein Z; metal-binding protein, EF-hand, calcium regulation, oligomer neuronal development, spine2; 2.03A {Danio rerio} | Back alignment and structure |
|---|
| >1k9u_A Polcalcin PHL P 7; pollen allergen, calcium-binding, EF-hand, cross-reactivity; 1.75A {Phleum pratense} SCOP: a.39.1.10 | Back alignment and structure |
|---|
| >1k2h_A S100A1, S-100 protein, alpha chain; non-covalent homodimer, X-type four-helix bundle, metal binding protein; NMR {Rattus norvegicus} SCOP: a.39.1.2 PDB: 1zfs_A 2k2f_A 2kbm_A 2l0p_A 2jpt_A | Back alignment and structure |
|---|
| >3nxa_A Protein S100-A16; S100 family, calcium binding protein, APO, EF-hand calcium binding proteins, S100 proteins, protein dynamics, binding protein; 2.10A {Homo sapiens} SCOP: a.39.1.0 PDB: 2l0u_A 2l0v_A 2l50_A 2l51_A | Back alignment and structure |
|---|
| >3rm1_A Protein S100-B; alpha-helical, EF hand, metal binding protein-protein bindin; 1.24A {Bos taurus} PDB: 3rlz_A 1cfp_A 3cr2_A 3cr4_X* 3cr5_X* 3gk1_A* 3gk2_A* 3gk4_X* 3iqo_A 3iqq_A 3lle_A* 1psb_A 3czt_X 2h61_A 3d0y_A* 3d10_A* 3hcm_A* 3lk1_A* 3lk0_A* 1b4c_A ... | Back alignment and structure |
|---|
| >2wcb_A Protein S100-A12; calcium signalling, HOST-parasite response, metal binding PR; 1.73A {Homo sapiens} PDB: 1odb_A* 2wc8_A 2wcf_A 2wce_A 1e8a_A 1gqm_A | Back alignment and structure |
|---|
| >4drw_A Protein S100-A10/annexin A2 chimeric protein; atypical EF-hand, heteropentameric complex, membrane repair; 3.50A {Homo sapiens} | Back alignment and structure |
|---|
| >1c7v_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1c7w_A | Back alignment and structure |
|---|
| >3i5g_C Myosin catalytic light chain LC-1, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_C 3i5h_C 3i5i_C | Back alignment and structure |
|---|
| >1j55_A S-100P protein; metal binding protein; 2.00A {Homo sapiens} SCOP: a.39.1.2 PDB: 1ozo_A | Back alignment and structure |
|---|
| >3i5g_B Myosin regulatory light chain LC-2, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_B 3i5h_B 3i5i_B | Back alignment and structure |
|---|
| >1wlz_A DJBP, CAP-binding protein complex interacting protein 1 isoform A; EF-hand like, unknown function; 1.60A {Homo sapiens} SCOP: a.39.1.7 | Back alignment and structure |
|---|
| >2d58_A Allograft inflammatory factor 1; EF-hand, metal binding protein; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >2pmy_A RAS and EF-hand domain-containing protein; rasef, calcium-binding domain, structural genomics, structural genomics consortium, SGC; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >2obh_A Centrin-2; DNA repair complex EF hand superfamily protein-peptide compl cycle; 1.80A {Homo sapiens} SCOP: a.39.1.5 PDB: 3kf9_A 1m39_A 2a4j_A 2k2i_A 1oqp_A | Back alignment and structure |
|---|
| >2lhi_A Calmodulin, serine/threonine-protein phosphatase catalytic subunit A1; yeast calmodulin, CNA1, metal binding protein; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >5pal_A Parvalbumin; calcium-binding protein; 1.54A {Triakis semifasciata} SCOP: a.39.1.4 | Back alignment and structure |
|---|
| >1s6j_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >3li6_A Calcium-binding protein; calcium signaling protein, assemble free energy, dynamic behaviour, cytoskeleton, metal binding; 2.50A {Entamoeba histolytica} | Back alignment and structure |
|---|
| >1qx2_A Vitamin D-dependent calcium-binding protein, INTE; EF-hand (helix-loop-helix) calcium binding protein, four-HEL domain, protein engineering; HET: FME; 1.44A {Bos taurus} SCOP: a.39.1.1 PDB: 1kcy_A 1kqv_A 1ksm_A 1n65_A 1ht9_A 4icb_A 1cdn_A 1clb_A 2bca_A 1ig5_A 1igv_A 3icb_A 1d1o_A 1b1g_A 2bcb_A 1boc_A 1bod_A | Back alignment and structure |
|---|
| >2kax_A Protein S100-A5; EF-hand, calcium binding protien, calcium, polymorphism, structural genomics, spine2, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 2kay_A | Back alignment and structure |
|---|
| >1dtl_A Cardiac troponin C; helix-turn-helix, structural protein; HET: BEP; 2.15A {Gallus gallus} SCOP: a.39.1.5 PDB: 1j1d_A 1j1e_A 2jt3_A 2jt0_A 1la0_A 2jtz_A* 2jt8_A* 2kfx_T* 1wrk_A* 1wrl_A* 1ap4_A 1lxf_C* 1mxl_C 1spy_A 2krd_C* 2l1r_A* 3rv5_A* 2ctn_A 2kgb_C 2jxl_A ... | Back alignment and structure |
|---|
| >1xk4_C Calgranulin B; S100 family, heterotetramer, metal binding protein; HET: FLC; 1.80A {Homo sapiens} SCOP: a.39.1.2 PDB: 1irj_A* | Back alignment and structure |
|---|
| >1pva_A Parvalbumin; calcium binding; 1.65A {Esox lucius} SCOP: a.39.1.4 PDB: 2pas_A 3pat_A | Back alignment and structure |
|---|
| >3fs7_A Parvalbumin, thymic; calcium-binding protein, EF-hand, acetylation, calcium, metal binding protein; 1.95A {Gallus gallus} SCOP: a.39.1.4 PDB: 2kqy_A | Back alignment and structure |
|---|
| >2obh_A Centrin-2; DNA repair complex EF hand superfamily protein-peptide compl cycle; 1.80A {Homo sapiens} SCOP: a.39.1.5 PDB: 3kf9_A 1m39_A 2a4j_A 2k2i_A 1oqp_A | Back alignment and structure |
|---|
| >1exr_A Calmodulin; high resolution, disorder, metal transport; 1.00A {Paramecium tetraurelia} SCOP: a.39.1.5 PDB: 1n0y_A 1osa_A 1clm_A 1mxe_A 2bbm_A 2bbn_A 4cln_A 4djc_A 2wel_D* 2x51_B 2vas_B* 2bkh_B 3gn4_B 3l9i_C 2ygg_B* 2w73_A 1lvc_D* 1wrz_A 2bki_B 2r28_A ... | Back alignment and structure |
|---|
| >2jnf_A Troponin C; stretch activated muscle contraction, EF-hand, metal binding protein; NMR {Lethocerus indicus} PDB: 2k2a_A | Back alignment and structure |
|---|
| >2bl0_C Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} | Back alignment and structure |
|---|
| >4ds7_A Calmodulin, CAM; protein binding, metal binding, structura; 2.15A {Kluyveromyces lactis} PDB: 1lkj_A 2lhh_A 1f54_A 1f55_A | Back alignment and structure |
|---|
| >3qrx_A Centrin; calcium-binding, EF-hand, cell division, calcium binding, ME binding protein-toxin complex; 2.20A {Chlamydomonas reinhardtii} PDB: 2ggm_A 2ami_A 1zmz_A | Back alignment and structure |
|---|
| >2pvb_A Protein (parvalbumin); calcium binding protein, metal binding protein; 0.91A {Esox lucius} SCOP: a.39.1.4 PDB: 1pvb_A 2pal_A 1pal_A 3pal_A 4pal_A 4cpv_A 1cdp_A 5cpv_A 1b8r_A 1b9a_A 1b8l_A 1b8c_A 1a75_B 1a75_A | Back alignment and structure |
|---|
| >3h4s_E KCBP interacting Ca2+-binding protein; kinesin, motor protein, regulation, complex, calcium, EF- hand, calmodulin, ATP-binding, microtubule; HET: ADP; 2.40A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3fwb_A Cell division control protein 31; gene gating, complex, cell cycle, cell division, mitosis, MR transport, nuclear pore complex, nucleus, phosphoprotein; 2.50A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2gv5_A 2doq_A 3fwc_A | Back alignment and structure |
|---|
| >1rwy_A Parvalbumin alpha; EF-hand, calcium-binding, calcium-binding protein; HET: PG4; 1.05A {Rattus norvegicus} SCOP: a.39.1.4 PDB: 1rtp_1* 2jww_A 3f45_A 1s3p_A 1xvj_A 1rjv_A 1rk9_A 1g33_A | Back alignment and structure |
|---|
| >3ox6_A Calcium-binding protein 1; EF-hand, calcium-sensor; 2.40A {Homo sapiens} PDB: 3ox5_A 2lan_A 2lap_A 2k7b_A 2k7c_A 2k7d_A | Back alignment and structure |
|---|
| >1bu3_A Calcium-binding protein; 1.65A {Merluccius bilinearis} SCOP: a.39.1.4 | Back alignment and structure |
|---|
| >2lv7_A Calcium-binding protein 7; metal binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1exr_A Calmodulin; high resolution, disorder, metal transport; 1.00A {Paramecium tetraurelia} SCOP: a.39.1.5 PDB: 1n0y_A 1osa_A 1clm_A 1mxe_A 2bbm_A 2bbn_A 4cln_A 4djc_A 2wel_D* 2x51_B 2vas_B* 2bkh_B 3gn4_B 3l9i_C 2ygg_B* 2w73_A 1lvc_D* 1wrz_A 2bki_B 2r28_A ... | Back alignment and structure |
|---|
| >1qls_A S100C protein, calgizzarin; metal-binding protein/inhibitor, S100 family, EF-hand protein, complex (ligand/annexin), ligand of annexin II; 2.3A {Sus scrofa} SCOP: a.39.1.2 PDB: 1nsh_A | Back alignment and structure |
|---|
| >1wy9_A Allograft inflammatory factor 1; EF-hand, calucium binding, metal binding protein; 2.10A {Mus musculus} PDB: 2g2b_A | Back alignment and structure |
|---|
| >1xk4_A Calgranulin A; S100 family, heterotetramer, metal binding protein; HET: FLC; 1.80A {Homo sapiens} SCOP: a.39.1.2 PDB: 1mr8_A | Back alignment and structure |
|---|
| >2jjz_A Ionized calcium-binding adapter molecule 2; EF-hand, actin crosslinking, ionized calciu binding adapter molecule 2, metal-binding protein; 2.15A {Homo sapiens} PDB: 2jjz_B 2vtg_A | Back alignment and structure |
|---|
| >2h2k_A Protein S100-A13; calcium binding protein, metal binding protein; 2.00A {Homo sapiens} PDB: 1yur_A 1yus_A 1yut_A 1yuu_A 2egd_A 2k8m_B 2ki4_B* 2ki6_C* 2kot_A* 2l5x_B 2cxj_A | Back alignment and structure |
|---|
| >1avs_A Troponin C; muscle contraction, calcium-activated, E-F hand calcium-binding protein; 1.75A {Gallus gallus} SCOP: a.39.1.5 PDB: 1blq_A 1skt_A 1tnp_A 1tnq_A 1zac_A 1smg_A 1npq_A 1trf_A | Back alignment and structure |
|---|
| >1psr_A Psoriasin, S100A7; EF-hand protein, MAD phasing, psoriasis, S100 protein family; 1.05A {Homo sapiens} SCOP: a.39.1.2 PDB: 2psr_A 2wor_A* 2wos_A* 3psr_A 2wnd_A | Back alignment and structure |
|---|
| >2f2o_A Calmodulin fused with calmodulin-binding domain of calcineurin; EF-hands, calcium, metal binding protein; 2.17A {Bos taurus} PDB: 2f2p_A | Back alignment and structure |
|---|
| >1rro_A RAT oncomodulin; calcium-binding protein; 1.30A {Rattus rattus} SCOP: a.39.1.4 PDB: 1omd_A 2nln_A 1ttx_A | Back alignment and structure |
|---|
| >3u0k_A Rcamp; fluorescent protein, calcium binding, EF-hand, genetically E calcium indicator; HET: NFA CRK; 2.10A {Entacmaea quadricolor} | Back alignment and structure |
|---|
| >1k8u_A S100A6, calcyclin, CACY; calcium regulatory protein, calcium free, signaling protein; HET: MSE; 1.15A {Homo sapiens} SCOP: a.39.1.2 PDB: 1k96_A 1k9k_A 1k9p_A 1a03_A 1cnp_A 1jwd_A 2cnp_A 2jtt_A | Back alignment and structure |
|---|
| >2lmt_A Calmodulin-related protein 97A; spermatogenesis, metal binding protein; NMR {Drosophila melanogaster} PDB: 2lmu_A 2lmv_A | Back alignment and structure |
|---|
| >2lhi_A Calmodulin, serine/threonine-protein phosphatase catalytic subunit A1; yeast calmodulin, CNA1, metal binding protein; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2mys_C Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1m8q_C* 1mvw_C* 1o18_F* 1o19_C* 1o1a_C* 1o1b_C* 1o1c_C* 1o1d_C* 1o1e_C* 1o1f_C* 1o1g_C* | Back alignment and structure |
|---|
| >1top_A Troponin C; contractIle system protein; 1.78A {Gallus gallus} SCOP: a.39.1.5 PDB: 1ncy_A 1ncz_A 1ncx_A 1ytz_C* 1yv0_C 1tnw_A 1tnx_A 5tnc_A 2w49_0 2w4u_0 4tnc_A 1a2x_A 1tcf_A 1tn4_A 2tn4_A 1aj4_A 1jc2_A 1fi5_A 1sbj_A 1scv_A ... | Back alignment and structure |
|---|
| >2aao_A CDPK, calcium-dependent protein kinase, isoform AK1; calmodulin-like domain, EF calcium binding protein, transferase; 2.00A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1a4p_A S100A10; S100 family, EF-hand protein, ligand of annexin II, calcium/phospholipid binding protein, calcium-phospholipid protein complex; 2.25A {Homo sapiens} SCOP: a.39.1.2 PDB: 1bt6_A | Back alignment and structure |
|---|
| >3qrx_A Centrin; calcium-binding, EF-hand, cell division, calcium binding, ME binding protein-toxin complex; 2.20A {Chlamydomonas reinhardtii} PDB: 2ggm_A 2ami_A 1zmz_A | Back alignment and structure |
|---|
| >2kn2_A Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco MKP1, metal binding Pro; NMR {Glycine max} | Back alignment and structure |
|---|
| >1j7q_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1j7r_A | Back alignment and structure |
|---|
| >1cb1_A Calbindin D9K; calcium-binding protein; NMR {Sus scrofa} SCOP: a.39.1.1 | Back alignment and structure |
|---|
| >2mys_B Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1i84_U* 1m8q_B* 1mvw_B* 1o18_E* 1o19_B* 1o1a_B* 1o1b_B* 1o1c_B* 1o1d_B* 1o1e_B* 1o1f_B* 1o1g_B* 2w4a_B 2w4g_B 2w4h_B | Back alignment and structure |
|---|
| >3j04_B Myosin regulatory light chain 2, smooth muscle MA isoform; phosphorylation, 2D crystalline arrays, myosin regulation, M light chains, structural protein; 20.00A {Gallus gallus} | Back alignment and structure |
|---|
| >1nya_A Calerythrin; EF-hand, metal binding protein; NMR {Saccharopolyspora erythraea} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >1qv0_A Obelin, OBL; photoprotein, bioluminescence, atomic resolution, Ca binding, EF-hand, luminescent protein; HET: CZH; 1.10A {Obelia longissima} SCOP: a.39.1.5 PDB: 1qv1_A* 1sl9_A* 1el4_A* 2f8p_A* 1sl7_A 1jf2_A* 1s36_A* 1jf0_A* 3kpx_A* | Back alignment and structure |
|---|
| >1yx7_A Calsensin, LAN3-6 antigen; calcium-binding protein EF-hand, helix-loop- helix, nervous system, metal binding protein; NMR {Haemopis marmorata} PDB: 1yx8_A | Back alignment and structure |
|---|
| >2bl0_B Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} | Back alignment and structure |
|---|
| >3sjs_A URE3-BP sequence specific DNA binding protein; EF-hand, structural genomics, seattle S genomics center for infectious disease, ssgcid; 1.90A {Entamoeba histolytica} PDB: 3sia_A 3sib_A | Back alignment and structure |
|---|
| >1top_A Troponin C; contractIle system protein; 1.78A {Gallus gallus} SCOP: a.39.1.5 PDB: 1ncy_A 1ncz_A 1ncx_A 1ytz_C* 1yv0_C 1tnw_A 1tnx_A 5tnc_A 2w49_0 2w4u_0 4tnc_A 1a2x_A 1tcf_A 1tn4_A 2tn4_A 1aj4_A 1jc2_A 1fi5_A 1sbj_A 1scv_A ... | Back alignment and structure |
|---|
| >3fwb_A Cell division control protein 31; gene gating, complex, cell cycle, cell division, mitosis, MR transport, nuclear pore complex, nucleus, phosphoprotein; 2.50A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2gv5_A 2doq_A 3fwc_A | Back alignment and structure |
|---|
| >1m45_A MLC1P, myosin light chain; protein-peptide complex, myosin light chain, cell cycle protein; 1.65A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 1m46_A 1n2d_A 2fcd_A 2fce_A | Back alignment and structure |
|---|
| >3ox6_A Calcium-binding protein 1; EF-hand, calcium-sensor; 2.40A {Homo sapiens} PDB: 3ox5_A 2lan_A 2lap_A 2k7b_A 2k7c_A 2k7d_A | Back alignment and structure |
|---|
| >2joj_A Centrin protein; N-terminal domain, centrin solution structure, EF-hand calcium binding protein, cell cycle; NMR {Euplotes octocarinatus} | Back alignment and structure |
|---|
| >1uhk_A Aequorin 2, aequorin; EF-hand motif, complex, luminescent protein; HET: CZN; 1.60A {Aequorea victoria} SCOP: a.39.1.5 PDB: 1ej3_A* 1uhi_A* 1uhj_A* 1uhh_A* 1sl8_A | Back alignment and structure |
|---|
| >2mys_C Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1m8q_C* 1mvw_C* 1o18_F* 1o19_C* 1o1a_C* 1o1b_C* 1o1c_C* 1o1d_C* 1o1e_C* 1o1f_C* 1o1g_C* | Back alignment and structure |
|---|
| >3mse_B Calcium-dependent protein kinase, putative; CDPKS, malaria, structural genomics consortium, SGC, transfe; 2.10A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >3akb_A Putative calcium binding protein; EF-hand, metal binding protein; 1.50A {Streptomyces coelicolor} PDB: 3aka_A | Back alignment and structure |
|---|
| >1tiz_A Calmodulin-related protein, putative; helix-turn-helix, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >2ccm_A Calexcitin; EF hand, calcium, signaling protein; 1.8A {Loligo pealeii} | Back alignment and structure |
|---|
| >2kz2_A Calmodulin, CAM; TR2C, metal binding protein; NMR {Gallus gallus} | Back alignment and structure |
|---|
| >1s6i_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >1wdc_C Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Z 1kqm_C* 1kwo_C* 1l2o_C* 1qvi_Z* 1s5g_Z* 1sr6_C 1b7t_Z 3jvt_C 3jtd_C 1kk8_C* 2ec6_C 1dfk_Z 1dfl_Z* 2w4t_Z 2w4v_Z 2w4w_Z 2otg_C* 2os8_C* 3pn7_C ... | Back alignment and structure |
|---|
| >1wdc_C Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Z 1kqm_C* 1kwo_C* 1l2o_C* 1qvi_Z* 1s5g_Z* 1sr6_C 1b7t_Z 3jvt_C 3jtd_C 1kk8_C* 2ec6_C 1dfk_Z 1dfl_Z* 2w4t_Z 2w4v_Z 2w4w_Z 2otg_C* 2os8_C* 3pn7_C ... | Back alignment and structure |
|---|
| >1q80_A SCP, sarcoplasmic calcium-binding protein; all-alpha, metal binding protein; NMR {Neanthes diversicolor} SCOP: a.39.1.5 PDB: 2scp_A | Back alignment and structure |
|---|
| >3k21_A PFCDPK3, calcium-dependent protein kinase 3; calcium kinase structural genomics malaria, structural genom consortium, SGC, ATP-binding; 1.15A {Plasmodium falciparum} PDB: 3o4y_A | Back alignment and structure |
|---|
| >2sas_A Sarcoplasmic calcium-binding protein; 2.40A {Branchiostoma lanceolatum} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >3khe_A Calmodulin-like domain protein kinase isoform 3; calcium dependent kinase, structural genomics, structural GE consortium, SGC, ATP-binding; 1.95A {Toxoplasma gondii} | Back alignment and structure |
|---|
| >1w7j_B Myosin light chain 1; motor protein, unconventional myosin, myosin V, chicken, molecular motor, ATPase, ELC, IQ motif, muscle protein, ATP-binding; HET: ADP; 2A {Homo sapiens} SCOP: a.39.1.5 PDB: 1w7i_B* 1oe9_B* 3j04_C 1br1_B* 1br4_B* 1i84_T* 3dtp_C 2w4a_C 2w4g_C 2w4h_C | Back alignment and structure |
|---|
| >1wdc_B Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Y 1kqm_B* 1kwo_B* 1l2o_B* 1qvi_Y* 1s5g_Y* 1sr6_B 1b7t_Y 3jtd_B 3jvt_B 1scm_B 1kk8_B* 1dfk_Y 1dfl_Y* 2w4t_Y 2w4v_Y 2w4w_Y 2otg_B* 2os8_B* 3pn7_B ... | Back alignment and structure |
|---|
| >2b1u_A Calmodulin-like protein 5; CLSP, calmodulin-like SKIN protein, solution structure, backbone dynamic, structural genomics; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2jnf_A Troponin C; stretch activated muscle contraction, EF-hand, metal binding protein; NMR {Lethocerus indicus} PDB: 2k2a_A | Back alignment and structure |
|---|
| >2bl0_C Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} | Back alignment and structure |
|---|
| >4ds7_A Calmodulin, CAM; protein binding, metal binding, structura; 2.15A {Kluyveromyces lactis} PDB: 1lkj_A 2lhh_A 1f54_A 1f55_A | Back alignment and structure |
|---|
| >1ggw_A Protein (CDC4P); light chain, cytokinesis, cell cycle, EF-hand; NMR {Schizosaccharomyces pombe} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >3pm8_A PFCDPK2, calcium-dependent protein kinase 2; malaria, structural genomics, structural genomics CONS SGC; 2.00A {Plasmodium falciparum K1} | Back alignment and structure |
|---|
| >1s6j_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >2bec_A Calcineurin B homologous protein 2; calcineurin-homologous protein, calcium-binding protein, NHE1 regulating protein; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >1qls_A S100C protein, calgizzarin; metal-binding protein/inhibitor, S100 family, EF-hand protein, complex (ligand/annexin), ligand of annexin II; 2.3A {Sus scrofa} SCOP: a.39.1.2 PDB: 1nsh_A | Back alignment and structure |
|---|
| >2lnk_A Protein S100-A4; EF-hand, calcium binding, all alpha, metal binding protein, binding protein; NMR {Homo sapiens} PDB: 3c1v_A | Back alignment and structure |
|---|
| >1y1x_A Leishmania major homolog of programmed cell death protein; SGPP, structural genomics, PSI; 1.95A {Leishmania major} SCOP: a.39.1.8 | Back alignment and structure |
|---|
| >3a8r_A Putative uncharacterized protein; EF-hand, membrane, oxidoreductase, transmembrane, calcium BI protein; 2.40A {Oryza sativa japonica group} | Back alignment and structure |
|---|
| >2ccm_A Calexcitin; EF hand, calcium, signaling protein; 1.8A {Loligo pealeii} | Back alignment and structure |
|---|
| >1qv0_A Obelin, OBL; photoprotein, bioluminescence, atomic resolution, Ca binding, EF-hand, luminescent protein; HET: CZH; 1.10A {Obelia longissima} SCOP: a.39.1.5 PDB: 1qv1_A* 1sl9_A* 1el4_A* 2f8p_A* 1sl7_A 1jf2_A* 1s36_A* 1jf0_A* 3kpx_A* | Back alignment and structure |
|---|
| >1c7v_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1c7w_A | Back alignment and structure |
|---|
| >3tnu_B Keratin, type II cytoskeletal 5; coiled-coil, structural support, cytosolic protein; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3zwh_A Protein S100-A4; Ca-binding protein-motor protein complex, S100 proteins, EF-; 1.94A {Homo sapiens} | Back alignment and structure |
|---|
| >1dtl_A Cardiac troponin C; helix-turn-helix, structural protein; HET: BEP; 2.15A {Gallus gallus} SCOP: a.39.1.5 PDB: 1j1d_A 1j1e_A 2jt3_A 2jt0_A 1la0_A 2jtz_A* 2jt8_A* 2kfx_T* 1wrk_A* 1wrl_A* 1ap4_A 1lxf_C* 1mxl_C 1spy_A 2krd_C* 2l1r_A* 3rv5_A* 2ctn_A 2kgb_C 2jxl_A ... | Back alignment and structure |
|---|
| >1uhk_A Aequorin 2, aequorin; EF-hand motif, complex, luminescent protein; HET: CZN; 1.60A {Aequorea victoria} SCOP: a.39.1.5 PDB: 1ej3_A* 1uhi_A* 1uhj_A* 1uhh_A* 1sl8_A | Back alignment and structure |
|---|
| >3li6_A Calcium-binding protein; calcium signaling protein, assemble free energy, dynamic behaviour, cytoskeleton, metal binding; 2.50A {Entamoeba histolytica} | Back alignment and structure |
|---|
| >3sjs_A URE3-BP sequence specific DNA binding protein; EF-hand, structural genomics, seattle S genomics center for infectious disease, ssgcid; 1.90A {Entamoeba histolytica} PDB: 3sia_A 3sib_A | Back alignment and structure |
|---|
| >2znd_A Programmed cell death protein 6; penta-EF-hand protein, calcium binding protein, apoptosis, calcium, endoplasmic reticulum, membrane, nucleus; 1.70A {Homo sapiens} PDB: 2zn9_A 2zn8_A 1hqv_A 3aak_A 2zne_A 2zrs_A 2zrt_A 3aaj_A | Back alignment and structure |
|---|
| >1w7j_B Myosin light chain 1; motor protein, unconventional myosin, myosin V, chicken, molecular motor, ATPase, ELC, IQ motif, muscle protein, ATP-binding; HET: ADP; 2A {Homo sapiens} SCOP: a.39.1.5 PDB: 1w7i_B* 1oe9_B* 3j04_C 1br1_B* 1br4_B* 1i84_T* 3dtp_C 2w4a_C 2w4g_C 2w4h_C | Back alignment and structure |
|---|
| >4eto_A Protein S100-A4; calcium-binding protein, EF-hand, structural genomics, PSI-B protein structure initiative, NEW YORK structural genomics consortium; 1.54A {Homo sapiens} PDB: 1m31_A 2q91_A 3cga_A 3ko0_A* 3m0w_A* | Back alignment and structure |
|---|
| >3i5g_C Myosin catalytic light chain LC-1, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_C 3i5h_C 3i5i_C | Back alignment and structure |
|---|
| >3nso_A Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, metal binding protein; 1.45A {Homo sapiens} SCOP: a.39.1.2 PDB: 3nsi_A 1kso_A 3nsk_A 3nsl_A | Back alignment and structure |
|---|
| >3tnu_A Keratin, type I cytoskeletal 14; coiled-coil, structural support, cytosolic protein; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2f2o_A Calmodulin fused with calmodulin-binding domain of calcineurin; EF-hands, calcium, metal binding protein; 2.17A {Bos taurus} PDB: 2f2p_A | Back alignment and structure |
|---|
| >2hpk_A Photoprotein berovin; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 2.00A {Beroe abyssicola} | Back alignment and structure |
|---|
| >3e3r_A Calcyphosin, calcyphosine; human calcyphosine, EF-hand, phosphoprotein, calcium binding; 2.65A {Homo sapiens} | Back alignment and structure |
|---|
| >1nya_A Calerythrin; EF-hand, metal binding protein; NMR {Saccharopolyspora erythraea} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >1k9u_A Polcalcin PHL P 7; pollen allergen, calcium-binding, EF-hand, cross-reactivity; 1.75A {Phleum pratense} SCOP: a.39.1.10 | Back alignment and structure |
|---|
| >1xk4_A Calgranulin A; S100 family, heterotetramer, metal binding protein; HET: FLC; 1.80A {Homo sapiens} SCOP: a.39.1.2 PDB: 1mr8_A | Back alignment and structure |
|---|
| >2kax_A Protein S100-A5; EF-hand, calcium binding protien, calcium, polymorphism, structural genomics, spine2, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 2kay_A | Back alignment and structure |
|---|
| >3pm8_A PFCDPK2, calcium-dependent protein kinase 2; malaria, structural genomics, structural genomics CONS SGC; 2.00A {Plasmodium falciparum K1} | Back alignment and structure |
|---|
| >1k2h_A S100A1, S-100 protein, alpha chain; non-covalent homodimer, X-type four-helix bundle, metal binding protein; NMR {Rattus norvegicus} SCOP: a.39.1.2 PDB: 1zfs_A 2k2f_A 2kbm_A 2l0p_A 2jpt_A | Back alignment and structure |
|---|
| >2i7a_A Calpain 13; calcium-dependent cytoplasmic cysteine proteinases, like, EF-hand, structural genomics, structural genomics CON SGC, hydrolase; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2sas_A Sarcoplasmic calcium-binding protein; 2.40A {Branchiostoma lanceolatum} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >3ll8_B Calcineurin subunit B type 1; protein-peptide docking, protein targeting, AKA beta-augmentation, calmodulin-binding, membrane, hydrolase; 2.00A {Homo sapiens} PDB: 1mf8_B* 2p6b_B 1aui_B 1m63_B* 1tco_B* | Back alignment and structure |
|---|
| >3mse_B Calcium-dependent protein kinase, putative; CDPKS, malaria, structural genomics consortium, SGC, transfe; 2.10A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >3k21_A PFCDPK3, calcium-dependent protein kinase 3; calcium kinase structural genomics malaria, structural genom consortium, SGC, ATP-binding; 1.15A {Plasmodium falciparum} PDB: 3o4y_A | Back alignment and structure |
|---|
| >1k8u_A S100A6, calcyclin, CACY; calcium regulatory protein, calcium free, signaling protein; HET: MSE; 1.15A {Homo sapiens} SCOP: a.39.1.2 PDB: 1k96_A 1k9k_A 1k9p_A 1a03_A 1cnp_A 1jwd_A 2cnp_A 2jtt_A | Back alignment and structure |
|---|
| >1alv_A Calpain, S-camld; calcium binding, calmodulin like, domain of cystein protease; 1.90A {Sus scrofa} SCOP: a.39.1.8 PDB: 1alw_A* 1nx0_A 1nx1_A 1nx2_A 1nx3_A* 1kfu_S 1kfx_S 3bow_B 1u5i_B 1df0_B 3df0_B 1aj5_A 1dvi_A 1np8_A | Back alignment and structure |
|---|
| >2qac_A Myosin A tail domain interacting protein MTIP; malaria invasion, structural genomics, PSI, protein structur initiative, structural genomics of pathogenic protozoa CONS SGPP; 1.70A {Plasmodium falciparum} PDB: 2auc_A | Back alignment and structure |
|---|
| >2ct9_A Calcium-binding protein P22; EF-hand, metal binding protein; 2.20A {Rattus norvegicus} PDB: 2e30_A | Back alignment and structure |
|---|
| >2znd_A Programmed cell death protein 6; penta-EF-hand protein, calcium binding protein, apoptosis, calcium, endoplasmic reticulum, membrane, nucleus; 1.70A {Homo sapiens} PDB: 2zn9_A 2zn8_A 1hqv_A 3aak_A 2zne_A 2zrs_A 2zrt_A 3aaj_A | Back alignment and structure |
|---|
| >3a4u_B Multiple coagulation factor deficiency protein 2; lectin, ergic, ER, golgi, transport, disulfide bond, endopla reticulum, ER-golgi transport; 1.84A {Homo sapiens} PDB: 2vrg_A 3lcp_C | Back alignment and structure |
|---|
| >2hpk_A Photoprotein berovin; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 2.00A {Beroe abyssicola} | Back alignment and structure |
|---|
| >1y1x_A Leishmania major homolog of programmed cell death protein; SGPP, structural genomics, PSI; 1.95A {Leishmania major} SCOP: a.39.1.8 | Back alignment and structure |
|---|
| >3u0k_A Rcamp; fluorescent protein, calcium binding, EF-hand, genetically E calcium indicator; HET: NFA CRK; 2.10A {Entacmaea quadricolor} | Back alignment and structure |
|---|
| >2aao_A CDPK, calcium-dependent protein kinase, isoform AK1; calmodulin-like domain, EF calcium binding protein, transferase; 2.00A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1snl_A Nucleobindin 1, calnuc; EF-hand, calcium-binding, metal binding protein; NMR {Homo sapiens} SCOP: a.39.1.7 | Back alignment and structure |
|---|
| >3tnu_B Keratin, type II cytoskeletal 5; coiled-coil, structural support, cytosolic protein; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3dtp_E RLC, myosin regulatory light chain; muscle protein, smooth muscle, myosin subfragment 2, heavy meromyosin, essential light chain; 20.00A {Avicularia avicularia} | Back alignment and structure |
|---|
| >1qx2_A Vitamin D-dependent calcium-binding protein, INTE; EF-hand (helix-loop-helix) calcium binding protein, four-HEL domain, protein engineering; HET: FME; 1.44A {Bos taurus} SCOP: a.39.1.1 PDB: 1kcy_A 1kqv_A 1ksm_A 1n65_A 1ht9_A 4icb_A 1cdn_A 1clb_A 2bca_A 1ig5_A 1igv_A 3icb_A 1d1o_A 1b1g_A 2bcb_A 1boc_A 1bod_A | Back alignment and structure |
|---|
| >3cs1_A Flagellar calcium-binding protein; myristoylated, palmitoylated, SEN membrane targeting, EF-hand, cell projection, cilium; 2.00A {Trypanosoma cruzi} | Back alignment and structure |
|---|
| >4drw_A Protein S100-A10/annexin A2 chimeric protein; atypical EF-hand, heteropentameric complex, membrane repair; 3.50A {Homo sapiens} | Back alignment and structure |
|---|
| >3tnu_A Keratin, type I cytoskeletal 14; coiled-coil, structural support, cytosolic protein; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
| >5pal_A Parvalbumin; calcium-binding protein; 1.54A {Triakis semifasciata} SCOP: a.39.1.4 | Back alignment and structure |
|---|
| >2kyc_A Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand protein, calcium binding protein; NMR {Gallus gallus} PDB: 2kyf_A | Back alignment and structure |
|---|
| >3rm1_A Protein S100-B; alpha-helical, EF hand, metal binding protein-protein bindin; 1.24A {Bos taurus} PDB: 3rlz_A 1cfp_A 3cr2_A 3cr4_X* 3cr5_X* 3gk1_A* 3gk2_A* 3gk4_X* 3iqo_A 3iqq_A 3lle_A* 1psb_A 3czt_X 2h61_A 3d0y_A* 3d10_A* 3hcm_A* 3lk1_A* 3lk0_A* 1b4c_A ... | Back alignment and structure |
|---|
| >3fs7_A Parvalbumin, thymic; calcium-binding protein, EF-hand, acetylation, calcium, metal binding protein; 1.95A {Gallus gallus} SCOP: a.39.1.4 PDB: 2kqy_A | Back alignment and structure |
|---|
| >1pva_A Parvalbumin; calcium binding; 1.65A {Esox lucius} SCOP: a.39.1.4 PDB: 2pas_A 3pat_A | Back alignment and structure |
|---|
| >3khe_A Calmodulin-like domain protein kinase isoform 3; calcium dependent kinase, structural genomics, structural GE consortium, SGC, ATP-binding; 1.95A {Toxoplasma gondii} | Back alignment and structure |
|---|
| >1juo_A Sorcin; calcium-binding proteins, penta-EF-hand, PEF, X-RAY, metal transport; 2.20A {Homo sapiens} SCOP: a.39.1.8 PDB: 2jc2_A | Back alignment and structure |
|---|
| >1rro_A RAT oncomodulin; calcium-binding protein; 1.30A {Rattus rattus} SCOP: a.39.1.4 PDB: 1omd_A 2nln_A 1ttx_A | Back alignment and structure |
|---|
| >3j04_B Myosin regulatory light chain 2, smooth muscle MA isoform; phosphorylation, 2D crystalline arrays, myosin regulation, M light chains, structural protein; 20.00A {Gallus gallus} | Back alignment and structure |
|---|
| >3ll8_B Calcineurin subunit B type 1; protein-peptide docking, protein targeting, AKA beta-augmentation, calmodulin-binding, membrane, hydrolase; 2.00A {Homo sapiens} PDB: 1mf8_B* 2p6b_B 1aui_B 1m63_B* 1tco_B* | Back alignment and structure |
|---|
| >2d58_A Allograft inflammatory factor 1; EF-hand, metal binding protein; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >2y5i_A S100Z, S100 calcium binding protein Z; metal-binding protein, EF-hand, calcium regulation, oligomer neuronal development, spine2; 2.03A {Danio rerio} | Back alignment and structure |
|---|
| >3akb_A Putative calcium binding protein; EF-hand, metal binding protein; 1.50A {Streptomyces coelicolor} PDB: 3aka_A | Back alignment and structure |
|---|
| >1alv_A Calpain, S-camld; calcium binding, calmodulin like, domain of cystein protease; 1.90A {Sus scrofa} SCOP: a.39.1.8 PDB: 1alw_A* 1nx0_A 1nx1_A 1nx2_A 1nx3_A* 1kfu_S 1kfx_S 3bow_B 1u5i_B 1df0_B 3df0_B 1aj5_A 1dvi_A 1np8_A | Back alignment and structure |
|---|
| >2pvb_A Protein (parvalbumin); calcium binding protein, metal binding protein; 0.91A {Esox lucius} SCOP: a.39.1.4 PDB: 1pvb_A 2pal_A 1pal_A 3pal_A 4pal_A 4cpv_A 1cdp_A 5cpv_A 1b8r_A 1b9a_A 1b8l_A 1b8c_A 1a75_B 1a75_A | Back alignment and structure |
|---|
| >1wdc_B Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Y 1kqm_B* 1kwo_B* 1l2o_B* 1qvi_Y* 1s5g_Y* 1sr6_B 1b7t_Y 3jtd_B 3jvt_B 1scm_B 1kk8_B* 1dfk_Y 1dfl_Y* 2w4t_Y 2w4v_Y 2w4w_Y 2otg_B* 2os8_B* 3pn7_B ... | Back alignment and structure |
|---|
| >1cb1_A Calbindin D9K; calcium-binding protein; NMR {Sus scrofa} SCOP: a.39.1.1 | Back alignment and structure |
|---|
| >2lvv_A Flagellar calcium-binding protein TB-24; EF-hand, metal binding protein; NMR {Trypanosoma brucei brucei} | Back alignment and structure |
|---|
| >3h4s_E KCBP interacting Ca2+-binding protein; kinesin, motor protein, regulation, complex, calcium, EF- hand, calmodulin, ATP-binding, microtubule; HET: ADP; 2.40A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1rwy_A Parvalbumin alpha; EF-hand, calcium-binding, calcium-binding protein; HET: PG4; 1.05A {Rattus norvegicus} SCOP: a.39.1.4 PDB: 1rtp_1* 2jww_A 3f45_A 1s3p_A 1xvj_A 1rjv_A 1rk9_A 1g33_A | Back alignment and structure |
|---|
| >1q80_A SCP, sarcoplasmic calcium-binding protein; all-alpha, metal binding protein; NMR {Neanthes diversicolor} SCOP: a.39.1.5 PDB: 2scp_A | Back alignment and structure |
|---|
| >1jfj_A Ehcabp, calcium-binding protein; EF-hand, helix-loop-helix, metal binding protein; NMR {Entamoeba histolytica} SCOP: a.39.1.5 PDB: 1jfk_A 2nxq_A 3px1_A 3qjk_A 2jnx_A 2i18_A | Back alignment and structure |
|---|
| >1wlz_A DJBP, CAP-binding protein complex interacting protein 1 isoform A; EF-hand like, unknown function; 1.60A {Homo sapiens} SCOP: a.39.1.7 | Back alignment and structure |
|---|
| >1bu3_A Calcium-binding protein; 1.65A {Merluccius bilinearis} SCOP: a.39.1.4 | Back alignment and structure |
|---|
| >1xk4_C Calgranulin B; S100 family, heterotetramer, metal binding protein; HET: FLC; 1.80A {Homo sapiens} SCOP: a.39.1.2 PDB: 1irj_A* | Back alignment and structure |
|---|
| >3dtp_E RLC, myosin regulatory light chain; muscle protein, smooth muscle, myosin subfragment 2, heavy meromyosin, essential light chain; 20.00A {Avicularia avicularia} | Back alignment and structure |
|---|
| >2bl0_B Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} | Back alignment and structure |
|---|
| >1jba_A GCAP-2, protein (guanylate cyclase activating protein 2); EF-hand, calcium-binding protein, guanylyl cyclase regulation, lyase; NMR {Bos taurus} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >1dgu_A Calcium-saturated CIB; helical, EF-hands, blood clotting; NMR {Homo sapiens} SCOP: a.39.1.5 PDB: 1dgv_A 1xo5_A 1y1a_A* | Back alignment and structure |
|---|
| >3i5g_B Myosin regulatory light chain LC-2, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_B 3i5h_B 3i5i_B | Back alignment and structure |
|---|
| >2l4h_A Calcium and integrin-binding protein 1; metal binding protei; NMR {Homo sapiens} PDB: 2l4i_A 2lm5_A | Back alignment and structure |
|---|
| >3e3r_A Calcyphosin, calcyphosine; human calcyphosine, EF-hand, phosphoprotein, calcium binding; 2.65A {Homo sapiens} | Back alignment and structure |
|---|
| >2hps_A Coelenterazine-binding protein with bound coelent; bioluminescence, southeast collabora structural genomics, secsg, structural genomics, PSI; HET: CTZ; 1.72A {Renilla muelleri} PDB: 2hq8_A | Back alignment and structure |
|---|
| >2bec_A Calcineurin B homologous protein 2; calcineurin-homologous protein, calcium-binding protein, NHE1 regulating protein; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* | Back alignment and structure |
|---|
| >1s6i_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >2mys_B Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1i84_U* 1m8q_B* 1mvw_B* 1o18_E* 1o19_B* 1o1a_B* 1o1b_B* 1o1c_B* 1o1d_B* 1o1e_B* 1o1f_B* 1o1g_B* 2w4a_B 2w4g_B 2w4h_B | Back alignment and structure |
|---|
| >2wcb_A Protein S100-A12; calcium signalling, HOST-parasite response, metal binding PR; 1.73A {Homo sapiens} PDB: 1odb_A* 2wc8_A 2wcf_A 2wce_A 1e8a_A 1gqm_A | Back alignment and structure |
|---|
| >1k94_A Grancalcin; penta-EF-hand protein, calcium binding protein, metal binding protein; 1.70A {Homo sapiens} SCOP: a.39.1.8 PDB: 1k95_A 1f4q_A 1f4o_A | Back alignment and structure |
|---|
| >3nxa_A Protein S100-A16; S100 family, calcium binding protein, APO, EF-hand calcium binding proteins, S100 proteins, protein dynamics, binding protein; 2.10A {Homo sapiens} SCOP: a.39.1.0 PDB: 2l0u_A 2l0v_A 2l50_A 2l51_A | Back alignment and structure |
|---|
| >1m45_A MLC1P, myosin light chain; protein-peptide complex, myosin light chain, cell cycle protein; 1.65A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 1m46_A 1n2d_A 2fcd_A 2fce_A | Back alignment and structure |
|---|
| >1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A | Back alignment and structure |
|---|
| >2l2e_A Calcium-binding protein NCS-1; NCS1P, myristoylated, metal binding protein; HET: MYR; NMR {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >2jjz_A Ionized calcium-binding adapter molecule 2; EF-hand, actin crosslinking, ionized calciu binding adapter molecule 2, metal-binding protein; 2.15A {Homo sapiens} PDB: 2jjz_B 2vtg_A | Back alignment and structure |
|---|
| >3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} | Back alignment and structure |
|---|
| >1gjy_A Sorcin, CP-22, V19; calcium binding, calcium-binding, phosphorylation; 2.2A {Chinese hamster} SCOP: a.39.1.8 | Back alignment and structure |
|---|
| >3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} | Back alignment and structure |
|---|
| >1j55_A S-100P protein; metal binding protein; 2.00A {Homo sapiens} SCOP: a.39.1.2 PDB: 1ozo_A | Back alignment and structure |
|---|
| >2ehb_A Calcineurin B-like protein 4; protein complex, Ca(II) IONS bound to SOS3 (EF-hands 1 and 4 FISL motif; 2.10A {Arabidopsis thaliana} PDB: 1v1g_A 1v1f_A | Back alignment and structure |
|---|
| >1wy9_A Allograft inflammatory factor 1; EF-hand, calucium binding, metal binding protein; 2.10A {Mus musculus} PDB: 2g2b_A | Back alignment and structure |
|---|
| >3dd4_A KV channel-interacting protein 4; EF-hands protein, ION transport, ionic channel, membrane, PO potassium channel, potassium transport, transport; 3.00A {Mus musculus} PDB: 2e6w_A | Back alignment and structure |
|---|
| >2zfd_A Calcineurin B-like protein 2; calcium binding protein, protein-protein complex, ATP-bindin kinase, nucleotide-binding; 1.20A {Arabidopsis thaliana} SCOP: a.39.1.5 PDB: 1uhn_A | Back alignment and structure |
|---|
| >1gjy_A Sorcin, CP-22, V19; calcium binding, calcium-binding, phosphorylation; 2.2A {Chinese hamster} SCOP: a.39.1.8 | Back alignment and structure |
|---|
| >2ggz_A Guanylyl cyclase-activating protein 3; EF hand, guanylate cyclase activating protein, GCAP, GCAP3, GCAP-3, lyase activator; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1juo_A Sorcin; calcium-binding proteins, penta-EF-hand, PEF, X-RAY, metal transport; 2.20A {Homo sapiens} SCOP: a.39.1.8 PDB: 2jc2_A | Back alignment and structure |
|---|
| >1jfj_A Ehcabp, calcium-binding protein; EF-hand, helix-loop-helix, metal binding protein; NMR {Entamoeba histolytica} SCOP: a.39.1.5 PDB: 1jfk_A 2nxq_A 3px1_A 3qjk_A 2jnx_A 2i18_A | Back alignment and structure |
|---|
| >2lvv_A Flagellar calcium-binding protein TB-24; EF-hand, metal binding protein; NMR {Trypanosoma brucei brucei} | Back alignment and structure |
|---|
| >2h2k_A Protein S100-A13; calcium binding protein, metal binding protein; 2.00A {Homo sapiens} PDB: 1yur_A 1yus_A 1yut_A 1yuu_A 2egd_A 2k8m_B 2ki4_B* 2ki6_C* 2kot_A* 2l5x_B 2cxj_A | Back alignment and structure |
|---|
| >1s6c_A KV4 potassium channel-interacting protein kchip1B; EF-hand, transport protein; 2.00A {Rattus norvegicus} SCOP: a.39.1.5 PDB: 2nz0_A 2i2r_E | Back alignment and structure |
|---|
| >2ehb_A Calcineurin B-like protein 4; protein complex, Ca(II) IONS bound to SOS3 (EF-hands 1 and 4 FISL motif; 2.10A {Arabidopsis thaliana} PDB: 1v1g_A 1v1f_A | Back alignment and structure |
|---|
| >2be4_A Hypothetical protein LOC449832; DR.36843, BC083168, calicium binding, EF-hand superfamily, S genomics, protein structure initiative, PSI; 2.10A {Danio rerio} PDB: 2q4u_A | Back alignment and structure |
|---|
| >1g8i_A Frequenin, neuronal calcium sensor 1; calcium binding-protein, EF-hand, calcium ION, metal binding protein; HET: 1PE P6G; 1.90A {Homo sapiens} SCOP: a.39.1.5 PDB: 2lcp_A | Back alignment and structure |
|---|
| >2r2i_A Guanylyl cyclase-activating protein 1; EF hand, GCAP, guanylate cyclase activating protein, GCAP1, GCAP-1, calcium, lipoprotein, myristate; HET: MYR; 2.00A {Gallus gallus} | Back alignment and structure |
|---|
| >2f33_A Calbindin; EF-hand, Ca2+-binding, metal binding protein; NMR {Rattus norvegicus} PDB: 2g9b_A | Back alignment and structure |
|---|
| >3sg6_A Gcamp2, myosin light chain kinase, green fluorescent PROT calmodulin chimera; calcium sensor, fluorescent protein; HET: CRO; 1.70A {Gallus gallus} PDB: 3evu_A* 3ek4_A* 3ek7_A* 3evv_A* 3ek8_A* 3ekh_A* 3sg2_A* 3sg3_A* 3sg7_A* 3ekj_A* 3sg4_A* 3sg5_A* 3evr_A* 3o78_A* 3o77_A* 1trf_A | Back alignment and structure |
|---|
| >3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* | Back alignment and structure |
|---|
| >1k94_A Grancalcin; penta-EF-hand protein, calcium binding protein, metal binding protein; 1.70A {Homo sapiens} SCOP: a.39.1.8 PDB: 1k95_A 1f4q_A 1f4o_A | Back alignment and structure |
|---|
| >3ghg_A Fibrinogen alpha chain; triple-stranded coiled coil, beta sheets, alpha helices, AMY amyloidosis, blood coagulation, disease mutation, glycoprot phosphoprotein; HET: NAG NDG BMA MAN GAL SIA; 2.90A {Homo sapiens} PDB: 3h32_A* 2a45_G* | Back alignment and structure |
|---|
| >1fpw_A Yeast frequenin, calcium-binding protein NCS-1; EF-hand, metal binding protein; NMR {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2ju0_A | Back alignment and structure |
|---|
| >2zfd_A Calcineurin B-like protein 2; calcium binding protein, protein-protein complex, ATP-bindin kinase, nucleotide-binding; 1.20A {Arabidopsis thaliana} SCOP: a.39.1.5 PDB: 1uhn_A | Back alignment and structure |
|---|
| >3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* | Back alignment and structure |
|---|
| >1ggw_A Protein (CDC4P); light chain, cytokinesis, cell cycle, EF-hand; NMR {Schizosaccharomyces pombe} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >2r2i_A Guanylyl cyclase-activating protein 1; EF hand, GCAP, guanylate cyclase activating protein, GCAP1, GCAP-1, calcium, lipoprotein, myristate; HET: MYR; 2.00A {Gallus gallus} | Back alignment and structure |
|---|
| >1snl_A Nucleobindin 1, calnuc; EF-hand, calcium-binding, metal binding protein; NMR {Homo sapiens} SCOP: a.39.1.7 | Back alignment and structure |
|---|
| >2d8n_A Recoverin; structural genomics, NPPSFA, national project on protein STR and functional analyses, riken structural genomics/proteomi initiative; 2.20A {Homo sapiens} PDB: 2i94_A 1iku_A* 1jsa_A* 1omr_A 1rec_A 1la3_A* 1omv_A 2het_A | Back alignment and structure |
|---|
| >2kld_A Polycystin-2; PC2, PKD2, calcium binding domain, EF hand, cytosolic, calcium, coiled coil, disease mutation, glycoprotein, ION transport; NMR {Homo sapiens} PDB: 2kle_A 2kq6_A 2y4q_A | Back alignment and structure |
|---|
| >1bjf_A Neurocalcin delta; calcium-binding, myristoylation, neuronal specific guanylate cyclase activator; 2.40A {Bos taurus} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* | Back alignment and structure |
|---|
| >3sg6_A Gcamp2, myosin light chain kinase, green fluorescent PROT calmodulin chimera; calcium sensor, fluorescent protein; HET: CRO; 1.70A {Gallus gallus} PDB: 3evu_A* 3ek4_A* 3ek7_A* 3evv_A* 3ek8_A* 3ekh_A* 3sg2_A* 3sg3_A* 3sg7_A* 3ekj_A* 3sg4_A* 3sg5_A* 3evr_A* 3o78_A* 3o77_A* 1trf_A | Back alignment and structure |
|---|
| >3a4u_B Multiple coagulation factor deficiency protein 2; lectin, ergic, ER, golgi, transport, disulfide bond, endopla reticulum, ER-golgi transport; 1.84A {Homo sapiens} PDB: 2vrg_A 3lcp_C | Back alignment and structure |
|---|
| >3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* | Back alignment and structure |
|---|
| >1psr_A Psoriasin, S100A7; EF-hand protein, MAD phasing, psoriasis, S100 protein family; 1.05A {Homo sapiens} SCOP: a.39.1.2 PDB: 2psr_A 2wor_A* 2wos_A* 3psr_A 2wnd_A | Back alignment and structure |
|---|
| >1jba_A GCAP-2, protein (guanylate cyclase activating protein 2); EF-hand, calcium-binding protein, guanylyl cyclase regulation, lyase; NMR {Bos taurus} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >1s1e_A KV channel interacting protein 1; kchip, calcium-binding protein, EF-finger, transport protein; 2.30A {Homo sapiens} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >3a8r_A Putative uncharacterized protein; EF-hand, membrane, oxidoreductase, transmembrane, calcium BI protein; 2.40A {Oryza sativa japonica group} | Back alignment and structure |
|---|
| >2v71_A Nuclear distribution protein NUDE-like 1; developmental protein, nuclear protein, neurogenesis, cytosk LIS1 binding, differentiation; 2.24A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2f33_A Calbindin; EF-hand, Ca2+-binding, metal binding protein; NMR {Rattus norvegicus} PDB: 2g9b_A | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A | Back alignment and structure |
|---|
| >2jul_A Calsenilin; EF-hand, calcium, LXXLL, DNA binding protein, dimer, alternative splicing, apoptosis, cytoplasm, endoplasmic reticulum, golgi apparatus; NMR {Mus musculus} | Back alignment and structure |
|---|
| >3na7_A HP0958; flagellar biogenesis, flagellum export, C4 Zn-ribbon, coiled post-transcriptional, gene regulation, chaperone; HET: EPE; 2.20A {Helicobacter pylori} | Back alignment and structure |
|---|
| >1s6c_A KV4 potassium channel-interacting protein kchip1B; EF-hand, transport protein; 2.00A {Rattus norvegicus} SCOP: a.39.1.5 PDB: 2nz0_A 2i2r_E | Back alignment and structure |
|---|
| >3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* | Back alignment and structure |
|---|
| >2l2e_A Calcium-binding protein NCS-1; NCS1P, myristoylated, metal binding protein; HET: MYR; NMR {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >1a4p_A S100A10; S100 family, EF-hand protein, ligand of annexin II, calcium/phospholipid binding protein, calcium-phospholipid protein complex; 2.25A {Homo sapiens} SCOP: a.39.1.2 PDB: 1bt6_A | Back alignment and structure |
|---|
| >1fpw_A Yeast frequenin, calcium-binding protein NCS-1; EF-hand, metal binding protein; NMR {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2ju0_A | Back alignment and structure |
|---|
| >1g8i_A Frequenin, neuronal calcium sensor 1; calcium binding-protein, EF-hand, calcium ION, metal binding protein; HET: 1PE P6G; 1.90A {Homo sapiens} SCOP: a.39.1.5 PDB: 2lcp_A | Back alignment and structure |
|---|
| >2ggz_A Guanylyl cyclase-activating protein 3; EF hand, guanylate cyclase activating protein, GCAP, GCAP3, GCAP-3, lyase activator; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2be4_A Hypothetical protein LOC449832; DR.36843, BC083168, calicium binding, EF-hand superfamily, S genomics, protein structure initiative, PSI; 2.10A {Danio rerio} PDB: 2q4u_A | Back alignment and structure |
|---|
| >2qac_A Myosin A tail domain interacting protein MTIP; malaria invasion, structural genomics, PSI, protein structur initiative, structural genomics of pathogenic protozoa CONS SGPP; 1.70A {Plasmodium falciparum} PDB: 2auc_A | Back alignment and structure |
|---|
| >2ct9_A Calcium-binding protein P22; EF-hand, metal binding protein; 2.20A {Rattus norvegicus} PDB: 2e30_A | Back alignment and structure |
|---|
| >2d8n_A Recoverin; structural genomics, NPPSFA, national project on protein STR and functional analyses, riken structural genomics/proteomi initiative; 2.20A {Homo sapiens} PDB: 2i94_A 1iku_A* 1jsa_A* 1omr_A 1rec_A 1la3_A* 1omv_A 2het_A | Back alignment and structure |
|---|
| >1dgu_A Calcium-saturated CIB; helical, EF-hands, blood clotting; NMR {Homo sapiens} SCOP: a.39.1.5 PDB: 1dgv_A 1xo5_A 1y1a_A* | Back alignment and structure |
|---|
| >1ij5_A Plasmodial specific LAV1-2 protein; fourty kDa calcium binding protein, CBP40, metal binding protein; 3.00A {Physarum polycephalum} SCOP: a.39.1.9 PDB: 1ij6_A | Back alignment and structure |
|---|
| >1bjf_A Neurocalcin delta; calcium-binding, myristoylation, neuronal specific guanylate cyclase activator; 2.40A {Bos taurus} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >1sjj_A Actinin; 3-helix bundle, calponin homology domain, calmodulin-like domain, actin binding protein, contractIle protein; 20.00A {Gallus gallus} SCOP: i.15.1.1 | Back alignment and structure |
|---|
| >1ij5_A Plasmodial specific LAV1-2 protein; fourty kDa calcium binding protein, CBP40, metal binding protein; 3.00A {Physarum polycephalum} SCOP: a.39.1.9 PDB: 1ij6_A | Back alignment and structure |
|---|
| >2kyc_A Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand protein, calcium binding protein; NMR {Gallus gallus} PDB: 2kyf_A | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A | Back alignment and structure |
|---|
| >3na7_A HP0958; flagellar biogenesis, flagellum export, C4 Zn-ribbon, coiled post-transcriptional, gene regulation, chaperone; HET: EPE; 2.20A {Helicobacter pylori} | Back alignment and structure |
|---|
| >3bow_A Calpain-2 catalytic subunit; cysteine protease, inhibitor, cell membrane, hydrolase, MEMB protease, thiol protease, phosphoprotein; 2.40A {Rattus norvegicus} PDB: 3df0_A 1df0_A 1u5i_A 1kfu_L 1kfx_L | Back alignment and structure |
|---|
| >3cs1_A Flagellar calcium-binding protein; myristoylated, palmitoylated, SEN membrane targeting, EF-hand, cell projection, cilium; 2.00A {Trypanosoma cruzi} | Back alignment and structure |
|---|
| >3dd4_A KV channel-interacting protein 4; EF-hands protein, ION transport, ionic channel, membrane, PO potassium channel, potassium transport, transport; 3.00A {Mus musculus} PDB: 2e6w_A | Back alignment and structure |
|---|
| >2jul_A Calsenilin; EF-hand, calcium, LXXLL, DNA binding protein, dimer, alternative splicing, apoptosis, cytoplasm, endoplasmic reticulum, golgi apparatus; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2hps_A Coelenterazine-binding protein with bound coelent; bioluminescence, southeast collabora structural genomics, secsg, structural genomics, PSI; HET: CTZ; 1.72A {Renilla muelleri} PDB: 2hq8_A | Back alignment and structure |
|---|
| >3trt_A Vimentin; cytoskeleton, intermediate filament, alpha-helix, structural protein; 2.30A {Homo sapiens} PDB: 3klt_A* | Back alignment and structure |
|---|
| >2l4h_A Calcium and integrin-binding protein 1; metal binding protei; NMR {Homo sapiens} PDB: 2l4i_A 2lm5_A | Back alignment and structure |
|---|
| >3bow_A Calpain-2 catalytic subunit; cysteine protease, inhibitor, cell membrane, hydrolase, MEMB protease, thiol protease, phosphoprotein; 2.40A {Rattus norvegicus} PDB: 3df0_A 1df0_A 1u5i_A 1kfu_L 1kfx_L | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >2i7a_A Calpain 13; calcium-dependent cytoplasmic cysteine proteinases, like, EF-hand, structural genomics, structural genomics CON SGC, hydrolase; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1s1e_A KV channel interacting protein 1; kchip, calcium-binding protein, EF-finger, transport protein; 2.30A {Homo sapiens} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >3o0z_A RHO-associated protein kinase 1; coiled-coil, transferase; HET: MSE; 2.33A {Homo sapiens} | Back alignment and structure |
|---|
| >1djx_A PLC-D1, phosphoinositide-specific phospholipase C, isozyme delta1; phosphoric diester hydrolase, hydrolase, lipid degradation, transducer; HET: I3P; 2.30A {Rattus norvegicus} SCOP: a.39.1.7 b.7.1.1 c.1.18.1 PDB: 1djg_A 1dji_A 1djh_A* 1djw_A* 1djy_A* 1djz_A* 2isd_A 1qas_A 1qat_A | Back alignment and structure |
|---|
| >2v71_A Nuclear distribution protein NUDE-like 1; developmental protein, nuclear protein, neurogenesis, cytosk LIS1 binding, differentiation; 2.24A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3o0z_A RHO-associated protein kinase 1; coiled-coil, transferase; HET: MSE; 2.33A {Homo sapiens} | Back alignment and structure |
|---|
| >3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} | Back alignment and structure |
|---|
| >1qxp_A MU-like calpain; M-calpain, MU-calpain, catalytic triad, Ca(2+) requirement, hydrolase chimera; 2.80A {Rattus norvegicus} SCOP: a.39.1.8 a.39.1.8 b.14.1.1 d.3.1.3 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} | Back alignment and structure |
|---|
| >1sra_A Sparc; extracellular matrix protein, calcium-binding protein; 2.00A {Homo sapiens} SCOP: a.39.1.3 | Back alignment and structure |
|---|
| >3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* | Back alignment and structure |
|---|
| >2kld_A Polycystin-2; PC2, PKD2, calcium binding domain, EF hand, cytosolic, calcium, coiled coil, disease mutation, glycoprotein, ION transport; NMR {Homo sapiens} PDB: 2kle_A 2kq6_A 2y4q_A | Back alignment and structure |
|---|
| >3ghg_A Fibrinogen alpha chain; triple-stranded coiled coil, beta sheets, alpha helices, AMY amyloidosis, blood coagulation, disease mutation, glycoprot phosphoprotein; HET: NAG NDG BMA MAN GAL SIA; 2.90A {Homo sapiens} PDB: 3h32_A* 2a45_G* | Back alignment and structure |
|---|
| >3trt_A Vimentin; cytoskeleton, intermediate filament, alpha-helix, structural protein; 2.30A {Homo sapiens} PDB: 3klt_A* | Back alignment and structure |
|---|
| >1sjj_A Actinin; 3-helix bundle, calponin homology domain, calmodulin-like domain, actin binding protein, contractIle protein; 20.00A {Gallus gallus} SCOP: i.15.1.1 | Back alignment and structure |
|---|
| >2fxo_A Myosin heavy chain, cardiac muscle beta isoform; coiled coil (dimeric, parallel), familial hypertrophic cardiomyopathy, FHC-associated mutant E924K; 2.50A {Homo sapiens} SCOP: h.1.26.1 PDB: 2fxm_A | Back alignment and structure |
|---|
| >1eg3_A Dystrophin; EF-hand like domain, WW domain, structural protein; 2.00A {Homo sapiens} SCOP: a.39.1.7 a.39.1.7 b.72.1.1 PDB: 1eg4_A | Back alignment and structure |
|---|
| >1djx_A PLC-D1, phosphoinositide-specific phospholipase C, isozyme delta1; phosphoric diester hydrolase, hydrolase, lipid degradation, transducer; HET: I3P; 2.30A {Rattus norvegicus} SCOP: a.39.1.7 b.7.1.1 c.1.18.1 PDB: 1djg_A 1dji_A 1djh_A* 1djw_A* 1djy_A* 1djz_A* 2isd_A 1qas_A 1qat_A | Back alignment and structure |
|---|
| >2zkm_X 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase beta-2; phospholipase C, phosphoinositide phospholipase, PLC-beta-2, calcium, coiled coil; 1.62A {Homo sapiens} SCOP: a.39.1.7 b.7.1.1 b.55.1.1 c.1.18.1 PDB: 2fju_B | Back alignment and structure |
|---|
| >1sra_A Sparc; extracellular matrix protein, calcium-binding protein; 2.00A {Homo sapiens} SCOP: a.39.1.3 | Back alignment and structure |
|---|
| >3u1c_A Tropomyosin alpha-1 chain; anti-parallel coiled coil, contractIle protein; 1.80A {Gallus gallus} PDB: 3u1a_A | Back alignment and structure |
|---|
| >2v66_B Nuclear distribution protein NUDE-like 1; structural protein, developmental protein, structural protei phosphorylation, transport, microtubule; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2fxo_A Myosin heavy chain, cardiac muscle beta isoform; coiled coil (dimeric, parallel), familial hypertrophic cardiomyopathy, FHC-associated mutant E924K; 2.50A {Homo sapiens} SCOP: h.1.26.1 PDB: 2fxm_A | Back alignment and structure |
|---|
| >1nub_A Basement membrane protein BM-40; extracellular module, glycoprotein, anti-adhesive protein, C binding, site-directed mutagenesis; HET: NAG; 2.80A {Homo sapiens} SCOP: a.39.1.3 g.3.11.3 g.68.1.1 PDB: 2v53_A* 1bmo_A* | Back alignment and structure |
|---|
| >2efr_A General control protein GCN4 and tropomyosin 1 Al; destabilizing cluster, hydrophobic core, contractIle protein; 1.80A {Saccharomyces cerevisiae} PDB: 2efs_A 2d3e_A | Back alignment and structure |
|---|
| >3u1c_A Tropomyosin alpha-1 chain; anti-parallel coiled coil, contractIle protein; 1.80A {Gallus gallus} PDB: 3u1a_A | Back alignment and structure |
|---|
| >1ic2_A Tropomyosin alpha chain, skeletal muscle; alpha-helical coiled coil, alanine, symmetry, axial stagger, BEND, contractIle protein; 2.00A {Gallus gallus} SCOP: h.1.5.1 | Back alignment and structure |
|---|
| >1qxp_A MU-like calpain; M-calpain, MU-calpain, catalytic triad, Ca(2+) requirement, hydrolase chimera; 2.80A {Rattus norvegicus} SCOP: a.39.1.8 a.39.1.8 b.14.1.1 d.3.1.3 | Back alignment and structure |
|---|
| >2zkm_X 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase beta-2; phospholipase C, phosphoinositide phospholipase, PLC-beta-2, calcium, coiled coil; 1.62A {Homo sapiens} SCOP: a.39.1.7 b.7.1.1 b.55.1.1 c.1.18.1 PDB: 2fju_B | Back alignment and structure |
|---|
| >2ocy_A RAB guanine nucleotide exchange factor SEC2; RAB, GEF, guanine exchange factor, coiled-coil, endocytosis/exocytosis complex; 3.30A {Saccharomyces cerevisiae} SCOP: h.1.33.1 | Back alignment and structure |
|---|
| >3u59_A Tropomyosin beta chain; muscle contraction, actin, contractIle protein; 2.50A {Gallus gallus} | Back alignment and structure |
|---|
| >2v66_B Nuclear distribution protein NUDE-like 1; structural protein, developmental protein, structural protei phosphorylation, transport, microtubule; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >1m1j_A Fibrinogen alpha subunit; coiled coils, disulfide rings, fibrinogen, blood clotting; HET: NDG NAG; 2.70A {Gallus gallus} SCOP: h.1.8.1 PDB: 1ei3_A | Back alignment and structure |
|---|
| >3hnw_A Uncharacterized protein; coiled-coil, structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 2.20A {Eubacterium eligens} | Back alignment and structure |
|---|
| >2efr_A General control protein GCN4 and tropomyosin 1 Al; destabilizing cluster, hydrophobic core, contractIle protein; 1.80A {Saccharomyces cerevisiae} PDB: 2efs_A 2d3e_A | Back alignment and structure |
|---|
| >3iox_A AGI/II, PA; alpha helix, PPII helix, supersandwich fold, surface adhesin WALL, peptidoglycan-anchor, cell adhesion; HET: PMS; 1.80A {Streptococcus mutans} PDB: 3ipk_A* 1jmm_A | Back alignment and structure |
|---|
| >1nub_A Basement membrane protein BM-40; extracellular module, glycoprotein, anti-adhesive protein, C binding, site-directed mutagenesis; HET: NAG; 2.80A {Homo sapiens} SCOP: a.39.1.3 g.3.11.3 g.68.1.1 PDB: 2v53_A* 1bmo_A* | Back alignment and structure |
|---|
| >2ocy_A RAB guanine nucleotide exchange factor SEC2; RAB, GEF, guanine exchange factor, coiled-coil, endocytosis/exocytosis complex; 3.30A {Saccharomyces cerevisiae} SCOP: h.1.33.1 | Back alignment and structure |
|---|
| >1eg3_A Dystrophin; EF-hand like domain, WW domain, structural protein; 2.00A {Homo sapiens} SCOP: a.39.1.7 a.39.1.7 b.72.1.1 PDB: 1eg4_A | Back alignment and structure |
|---|
| >2eqb_B RAB guanine nucleotide exchange factor SEC2; coiled coil, endocytosis/exocytosis complex; 2.70A {Saccharomyces cerevisiae} SCOP: h.1.33.1 | Back alignment and structure |
|---|
| >3q8t_A Beclin-1; autophagy, ATG14L uvrag, apoptosis; 1.90A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3mq9_A Bone marrow stromal antigen 2 fused to maltose-BI periplasmic protein; HIV, antiviral protein; 2.80A {Escherichia coli} | Back alignment and structure |
|---|
| >2zqm_A Prefoldin beta subunit 1; chaperone; HET: CIT; 1.90A {Thermococcus SP} PDB: 2zdi_A | Back alignment and structure |
|---|
| >3hnw_A Uncharacterized protein; coiled-coil, structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 2.20A {Eubacterium eligens} | Back alignment and structure |
|---|
| >4gkw_A Spindle assembly abnormal protein 6; double helix, SAS-5, centriole, structural protein; 3.30A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3ohm_B 1-phosphatidylinositol-4,5-bisphosphate phosphodi beta-3; PH domain, EF hand, TIM barrel, C2 domain, GTPase, lipase, C binding, GTP binding; HET: GDP; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3mq9_A Bone marrow stromal antigen 2 fused to maltose-BI periplasmic protein; HIV, antiviral protein; 2.80A {Escherichia coli} | Back alignment and structure |
|---|
| >3ohm_B 1-phosphatidylinositol-4,5-bisphosphate phosphodi beta-3; PH domain, EF hand, TIM barrel, C2 domain, GTPase, lipase, C binding, GTP binding; HET: GDP; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >1u5p_A Spectrin alpha chain, brain; alpha spectrin, two repeats of spectrin, alpha-helical linker region, 3-helix coiled coil, structural protein; 2.00A {Gallus gallus} SCOP: a.7.1.1 a.7.1.1 | Back alignment and structure |
|---|
| >1m1j_B Fibrinogen beta chain; coiled coils, disulfide rings, fibrinogen, blood clotting; HET: NDG NAG; 2.70A {Gallus gallus} SCOP: d.171.1.1 h.1.8.1 PDB: 1ei3_B* | Back alignment and structure |
|---|
| >1ic2_A Tropomyosin alpha chain, skeletal muscle; alpha-helical coiled coil, alanine, symmetry, axial stagger, BEND, contractIle protein; 2.00A {Gallus gallus} SCOP: h.1.5.1 | Back alignment and structure |
|---|
| >1m1j_B Fibrinogen beta chain; coiled coils, disulfide rings, fibrinogen, blood clotting; HET: NDG NAG; 2.70A {Gallus gallus} SCOP: d.171.1.1 h.1.8.1 PDB: 1ei3_B* | Back alignment and structure |
|---|
| >1fxk_A Prefoldin; archaeal protein, chaperone; 2.30A {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: a.2.5.1 PDB: 1fxk_B | Back alignment and structure |
|---|
| >1x79_B RAB GTPase binding effector protein 1; rabaptin5, GGA protein, GAT domain, intracellular trafficking, protein transport; 2.41A {Homo sapiens} SCOP: h.1.27.2 | Back alignment and structure |
|---|
| >1tuz_A Diacylglycerol kinase alpha; transferase, HR532, nesgc, structural genomics, PSI, protein structure initiative; NMR {Homo sapiens} SCOP: a.39.1.7 | Back alignment and structure |
|---|
| >3i00_A HIP-I, huntingtin-interacting protein 1; transcription; 2.30A {Homo sapiens} PDB: 2qa7_A | Back alignment and structure |
|---|
| >3mq7_A Bone marrow stromal antigen 2; HIV, antiviral protein; 2.28A {Homo sapiens} PDB: 3mqc_A 3mqb_A 3mkx_A 3nwh_A 2xg7_A* 2x7a_A | Back alignment and structure |
|---|
| >2b9c_A Striated-muscle alpha tropomyosin; alpha-helix, coiled coil, alanine, axial stagger, radius, SIDE-chain packing, crystal packing; 2.30A {Rattus norvegicus} SCOP: h.1.5.1 | Back alignment and structure |
|---|
| >1gk4_A Vimentin; intermediate filament, dimer, parallel coiled coil, heptad repeat, stutter; 2.3A {Homo sapiens} SCOP: h.1.20.1 | Back alignment and structure |
|---|
| >2e7s_A RAB guanine nucleotide exchange factor SEC2; coiled coil, endocytosis/exocytosis complex; 3.00A {Saccharomyces cerevisiae} SCOP: h.1.33.1 | Back alignment and structure |
|---|
| >2v0o_A FCHO2, FCH domain only protein 2; lipid-binding protein, EFC domain, vesicle trafficking, membrane curvature, endocytosis, exocytosis, F-BAR domain; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >3plt_A Sphingolipid long chain base-responsive protein L; eisosomes, LSP1, PIL1, BAR domain, plasma membrane, SELF-ASS phosphoprotein; 2.90A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4ad8_A DNA repair protein RECN; DNA binding protein, ATPase domain; HET: DNA; 4.00A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >3q8t_A Beclin-1; autophagy, ATG14L uvrag, apoptosis; 1.90A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3cl3_D NF-kappa-B essential modulator; death effector domain, coiled-coil, coiled coil, cytoplasm, disease mutation, ectodermal dysplasia; 3.20A {Homo sapiens} | Back alignment and structure |
|---|
| >2eqb_B RAB guanine nucleotide exchange factor SEC2; coiled coil, endocytosis/exocytosis complex; 2.70A {Saccharomyces cerevisiae} SCOP: h.1.33.1 | Back alignment and structure |
|---|
| >1cun_A Protein (alpha spectrin); two repeats of spectrin, alpha helical linker region, 2 tandem 3-helix coiled- coils, structural protein; 2.00A {Gallus gallus} SCOP: a.7.1.1 a.7.1.1 PDB: 1aj3_A | Back alignment and structure |
|---|
| >1m1j_C Fibrinogen gamma chain; coiled coils, disulfide rings, fibrinogen, blood clotting; HET: NDG NAG; 2.70A {Gallus gallus} SCOP: d.171.1.1 h.1.8.1 PDB: 1ei3_C | Back alignment and structure |
|---|
| >1s35_A Beta-I spectrin, spectrin beta chain, erythrocyte; two repeats of spectrin, alpha helical linker region, 3- helix coiled-coils, beta spectrin; 2.40A {Homo sapiens} SCOP: a.7.1.1 a.7.1.1 | Back alignment and structure |
|---|
| >3qr0_A Phospholipase C-beta (PLC-beta); PH domain, EF hand, C2 domain, TIM barrel domain, hydrolase, calcium binding, phospholipid binding; 2.00A {Sepia officinalis} PDB: 3qr1_A | Back alignment and structure |
|---|
| >2i1j_A Moesin; FERM, coiled-coil, C-ermad, ERM, radixin, ezrin, MER actin binding, masking, regulation, SELF-inhibition, cell A membrane protein; 2.10A {Spodoptera frugiperda} PDB: 2i1k_A 1e5w_A | Back alignment and structure |
|---|
| >3mq7_A Bone marrow stromal antigen 2; HIV, antiviral protein; 2.28A {Homo sapiens} PDB: 3mqc_A 3mqb_A 3mkx_A 3nwh_A 2xg7_A* 2x7a_A | Back alignment and structure |
|---|
| >2zqm_A Prefoldin beta subunit 1; chaperone; HET: CIT; 1.90A {Thermococcus SP} PDB: 2zdi_A | Back alignment and structure |
|---|
| >3qr0_A Phospholipase C-beta (PLC-beta); PH domain, EF hand, C2 domain, TIM barrel domain, hydrolase, calcium binding, phospholipid binding; 2.00A {Sepia officinalis} PDB: 3qr1_A | Back alignment and structure |
|---|
| >1fxk_C Protein (prefoldin); archaeal protein, chaperone; 2.30A {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: a.2.5.1 | Back alignment and structure |
|---|
| >3ajw_A Flagellar FLIJ protein; flagellum, type III secretion, coiled-coil, protein transpor; 2.10A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >1fxk_A Prefoldin; archaeal protein, chaperone; 2.30A {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: a.2.5.1 PDB: 1fxk_B | Back alignment and structure |
|---|
| >2jee_A YIIU; FTSZ, septum, coiled-coil, cell division, cell cycle, hypothetical protein; 2.8A {Escherichia coli} | Back alignment and structure |
|---|
| >4gkw_A Spindle assembly abnormal protein 6; double helix, SAS-5, centriole, structural protein; 3.30A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >2no2_A HIP-I, huntingtin-interacting protein 1; clathrin light chain binding, HIP1 coiled-coil domain, endocytosis, clathrin SELF-assembly, cell adhesion; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3edv_A Spectrin beta chain, brain 1; spectrin repeat, coiled coil, actin capping, actin-binding, alternative splicing, calmodulin-binding, cytoplasm; 1.95A {Homo sapiens} | Back alignment and structure |
|---|
| >1x8y_A Lamin A/C; structural protein, intermediate filament protein; 2.20A {Homo sapiens} SCOP: h.1.20.1 PDB: 3v5b_A 3v4w_A 3v4q_A | Back alignment and structure |
|---|
| >1m1j_A Fibrinogen alpha subunit; coiled coils, disulfide rings, fibrinogen, blood clotting; HET: NDG NAG; 2.70A {Gallus gallus} SCOP: h.1.8.1 PDB: 1ei3_A | Back alignment and structure |
|---|
| >2b9c_A Striated-muscle alpha tropomyosin; alpha-helix, coiled coil, alanine, axial stagger, radius, SIDE-chain packing, crystal packing; 2.30A {Rattus norvegicus} SCOP: h.1.5.1 | Back alignment and structure |
|---|
| >1u4q_A Spectrin alpha chain, brain; alpha spectrin, three repeats of spectrin, alpha-helical linker region, 3-helix coiled-coil, structural protein; 2.50A {Gallus gallus} SCOP: a.7.1.1 a.7.1.1 a.7.1.1 | Back alignment and structure |
|---|
| >1x79_B RAB GTPase binding effector protein 1; rabaptin5, GGA protein, GAT domain, intracellular trafficking, protein transport; 2.41A {Homo sapiens} SCOP: h.1.27.2 | Back alignment and structure |
|---|
| >2e7s_A RAB guanine nucleotide exchange factor SEC2; coiled coil, endocytosis/exocytosis complex; 3.00A {Saccharomyces cerevisiae} SCOP: h.1.33.1 | Back alignment and structure |
|---|
| >1u4q_A Spectrin alpha chain, brain; alpha spectrin, three repeats of spectrin, alpha-helical linker region, 3-helix coiled-coil, structural protein; 2.50A {Gallus gallus} SCOP: a.7.1.1 a.7.1.1 a.7.1.1 | Back alignment and structure |
|---|
| >2efk_A CDC42-interacting protein 4; EFC domain, structural genomics, NPPSFA, national project on structural and functional analyses; 2.30A {Homo sapiens} SCOP: a.238.1.4 | Back alignment and structure |
|---|
| >1l8d_A DNA double-strand break repair RAD50 ATPase; zinc finger, DNA repair, recombination, HOOK motif, replication; HET: DNA CIT; 2.20A {Pyrococcus furiosus} SCOP: h.4.12.1 | Back alignment and structure |
|---|
| >3bas_A Myosin heavy chain, striated muscle/general control protein GCN4 chimera; alpha-helical coiled coil, disorder, salt links; 2.30A {Argopecten irradians} SCOP: h.1.26.1 PDB: 1nkn_A 3bat_A | Back alignment and structure |
|---|
| >2oto_A M protein; helical coiled coil, fibrinogen-binding, virulence factor, S active protein, toxin; 3.04A {Streptococcus pyogenes serotype M1} PDB: 2xny_M | Back alignment and structure |
|---|
| >2efl_A Formin-binding protein 1; EFC domain, structural genomics, NPPSFA, national project on structural and functional analyses; 2.61A {Homo sapiens} SCOP: a.238.1.4 | Back alignment and structure |
|---|
| >1f5n_A Interferon-induced guanylate-binding protein 1; GBP, GTP hydrolysis, GDP, GMP, dynamin related, large GTPase family. GMPPNP, GPPNHP.; HET: GNP; 1.70A {Homo sapiens} SCOP: a.114.1.1 c.37.1.8 PDB: 1dg3_A* 2b8w_A* 2b92_A* 2bc9_A* 2d4h_A* | Back alignment and structure |
|---|
| >3i00_A HIP-I, huntingtin-interacting protein 1; transcription; 2.30A {Homo sapiens} PDB: 2qa7_A | Back alignment and structure |
|---|
| >3swk_A Vimentin; cytoskeleton, intermediate filament, alpha-helix, structural; 1.70A {Homo sapiens} | Back alignment and structure |
|---|
| >2xnx_M M protein, M1-BC1; cell adhesion, virulence factor, streptococcal toxic shock S; 3.30A {Streptococcus pyogenes} | Back alignment and structure |
|---|
| >1d7m_A Cortexillin I; coiled-coil, coiled-coil trigger site, alpha helix, dimeriza contractIle protein; 2.70A {Dictyostelium discoideum} SCOP: h.1.10.1 | Back alignment and structure |
|---|
| >3kbt_A Beta-I spectrin, spectrin beta chain, erythrocyte; complex, spectrin, spectrin repeat, three helix bundle, ANKY binding, disease mutation, structural protein, ZU5 sandwich; 2.75A {Homo sapiens} PDB: 3kbu_A | Back alignment and structure |
|---|
| >1l8d_A DNA double-strand break repair RAD50 ATPase; zinc finger, DNA repair, recombination, HOOK motif, replication; HET: DNA CIT; 2.20A {Pyrococcus furiosus} SCOP: h.4.12.1 | Back alignment and structure |
|---|
| >3s84_A Apolipoprotein A-IV; four helix bundle, transport protein; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >3abh_A Pacsin2, protein kinase C and casein kinase substrate in neurons protein 2; helix bundle, coiled-coil, endocytosis; 2.00A {Homo sapiens} PDB: 3q0k_A 3lll_A 3hah_A 3qni_A 3hai_A 3q84_A | Back alignment and structure |
|---|
| >3haj_A Human pacsin2 F-BAR; pacsin,syndapin,FAP52,F-BAR, alternative splicing, coiled coil, cytoplasmic vesicle, endocytosis, phosphoprotein, polymorphism; 2.78A {Homo sapiens} | Back alignment and structure |
|---|
| >2v4h_A NF-kappa-B essential modulator; transcription, metal-binding, NEMO - IKK gamma - NFKB pathwa darpin, transcription regulation; 2.9A {Mus musculus} | Back alignment and structure |
|---|
| >2efl_A Formin-binding protein 1; EFC domain, structural genomics, NPPSFA, national project on structural and functional analyses; 2.61A {Homo sapiens} SCOP: a.238.1.4 | Back alignment and structure |
|---|
| >3ajw_A Flagellar FLIJ protein; flagellum, type III secretion, coiled-coil, protein transpor; 2.10A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >1gk4_A Vimentin; intermediate filament, dimer, parallel coiled coil, heptad repeat, stutter; 2.3A {Homo sapiens} SCOP: h.1.20.1 | Back alignment and structure |
|---|
| >3k29_A Putative uncharacterized protein; YSCO, type III secretion apparatus, S genomics, csgid; HET: MSE; 2.00A {Chlamydia trachomatis} | Back alignment and structure |
|---|
| >3iox_A AGI/II, PA; alpha helix, PPII helix, supersandwich fold, surface adhesin WALL, peptidoglycan-anchor, cell adhesion; HET: PMS; 1.80A {Streptococcus mutans} PDB: 3ipk_A* 1jmm_A | Back alignment and structure |
|---|
| >3haj_A Human pacsin2 F-BAR; pacsin,syndapin,FAP52,F-BAR, alternative splicing, coiled coil, cytoplasmic vesicle, endocytosis, phosphoprotein, polymorphism; 2.78A {Homo sapiens} | Back alignment and structure |
|---|
| >3a7p_A Autophagy protein 16; coiled-coil, coiled coil, cytoplasmic vesicle, protein transport, transport, vacuole; 2.80A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1m1j_C Fibrinogen gamma chain; coiled coils, disulfide rings, fibrinogen, blood clotting; HET: NDG NAG; 2.70A {Gallus gallus} SCOP: d.171.1.1 h.1.8.1 PDB: 1ei3_C | Back alignment and structure |
|---|
| >1cun_A Protein (alpha spectrin); two repeats of spectrin, alpha helical linker region, 2 tandem 3-helix coiled- coils, structural protein; 2.00A {Gallus gallus} SCOP: a.7.1.1 a.7.1.1 PDB: 1aj3_A | Back alignment and structure |
|---|
| >1tuz_A Diacylglycerol kinase alpha; transferase, HR532, nesgc, structural genomics, PSI, protein structure initiative; NMR {Homo sapiens} SCOP: a.39.1.7 | Back alignment and structure |
|---|
| >3hhm_B NISH2 P85alpha; PI3KCA, PI3K, PIK3R1, phosphatidilynositol 3,4,5- triphosphate, wortmannin, H1047R, ATP-binding, disease mutation, kinase; HET: KWT; 2.80A {Homo sapiens} PDB: 3hiz_B 2rd0_B 4a55_B* 3mtt_A | Back alignment and structure |
|---|
| >3edu_A Beta-I spectrin, spectrin beta chain, erythrocyte; ankyrin, ankyrin-binding domain, actin capping, AC binding, cytoskeleton, disease mutation; 2.10A {Homo sapiens} PDB: 3f57_A | Back alignment and structure |
|---|
| >3swk_A Vimentin; cytoskeleton, intermediate filament, alpha-helix, structural; 1.70A {Homo sapiens} | Back alignment and structure |
|---|
| >1ez3_A Syntaxin-1A; three helix bundle, endocytosis/exocytosis complex; 1.90A {Rattus norvegicus} SCOP: a.47.2.1 PDB: 1br0_A 3lg7_A* | Back alignment and structure |
|---|
| >1cii_A Colicin IA; bacteriocin, ION channel formation, transmembrane protein; 3.00A {Escherichia coli} SCOP: f.1.1.1 h.4.3.1 | Back alignment and structure |
|---|
| >3l4q_C Phosphatidylinositol 3-kinase regulatory subunit beta; PI3K, phosphoinositide-3-kinase, influenza virus, NS1; 2.30A {Bos taurus} PDB: 2v1y_B | Back alignment and structure |
|---|
| >3pdy_A Plectin; cytoskeleton, plakin, intermediate filament, spectrin repeat structural protein, crosslinking; 2.22A {Homo sapiens} | Back alignment and structure |
|---|
| >3ghg_B Fibrinogen beta chain; triple-stranded coiled coil, beta sheets, alpha helices, AMY amyloidosis, blood coagulation, disease mutation, glycoprot phosphoprotein; HET: NAG NDG BMA MAN GAL SIA; 2.90A {Homo sapiens} PDB: 3h32_B* 1deq_B 2a45_H* | Back alignment and structure |
|---|
| >3fb2_A Spectrin alpha chain, brain spectrin; non-erythroid alpha chain alpha-II spectrin, fordrin alpha chain, sptan1, SPTA2_human, NESG, HR5563A; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >3kbt_A Beta-I spectrin, spectrin beta chain, erythrocyte; complex, spectrin, spectrin repeat, three helix bundle, ANKY binding, disease mutation, structural protein, ZU5 sandwich; 2.75A {Homo sapiens} PDB: 3kbu_A | Back alignment and structure |
|---|
| >2zdi_C Prefoldin subunit alpha; chaperone, cytoplasm; 3.00A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >3fpp_A Macrolide-specific efflux protein MACA; hexameric assembly, membrane fusion protein, drug efflux pump, periplasmic protein; 2.99A {Escherichia coli} | Back alignment and structure |
|---|
| >3lay_A Zinc resistance-associated protein; salmonella typhimurium L structural genomics, center for structural genomics of INFE diseases; 2.70A {Salmonella enterica subsp} | Back alignment and structure |
|---|
| >3edv_A Spectrin beta chain, brain 1; spectrin repeat, coiled coil, actin capping, actin-binding, alternative splicing, calmodulin-binding, cytoplasm; 1.95A {Homo sapiens} | Back alignment and structure |
|---|
| >2i1j_A Moesin; FERM, coiled-coil, C-ermad, ERM, radixin, ezrin, MER actin binding, masking, regulation, SELF-inhibition, cell A membrane protein; 2.10A {Spodoptera frugiperda} PDB: 2i1k_A 1e5w_A | Back alignment and structure |
|---|
| >3abh_A Pacsin2, protein kinase C and casein kinase substrate in neurons protein 2; helix bundle, coiled-coil, endocytosis; 2.00A {Homo sapiens} PDB: 3q0k_A 3lll_A 3hah_A 3qni_A 3hai_A 3q84_A | Back alignment and structure |
|---|
| >2xzr_A Immunoglobulin-binding protein EIBD; cell adhesion, trimeric autotransporter adhesin, TAA; 2.80A {Enterobacteria phage p-eibd} | Back alignment and structure |
|---|
| >2xnx_M M protein, M1-BC1; cell adhesion, virulence factor, streptococcal toxic shock S; 3.30A {Streptococcus pyogenes} | Back alignment and structure |
|---|
| >2b5u_A Colicin E3; high resolution colicin E3, ribosome inactivation, ribosome inhibitor, hydrolase; HET: CIT; 2.30A {Escherichia coli} SCOP: b.101.1.1 b.110.1.1 h.4.9.1 PDB: 1jch_A* 1ujw_B* 2ysu_B 1e44_B 2xfz_Y* 2xg1_Y* | Back alignment and structure |
|---|
| >3lbx_A Spectrin alpha chain, erythrocyte; tetramer, complex, three-helix bundle, alpha helix repeat, helical linker, actin capping; 2.80A {Homo sapiens} PDB: 1owa_A | Back alignment and structure |
|---|
| >2w83_C C-JUN-amino-terminal kinase-interacting protein 4; golgi apparatus, protein transport, ER-golgi transport, ARF, GTPase, effector, myristate; HET: GTP; 1.93A {Homo sapiens} | Back alignment and structure |
|---|
| >4emc_A Monopolin complex subunit CSM1; RWD domain, kinetochore-binding, kinetoch replication-replication complex; 3.05A {Saccharomyces cerevisiae} PDB: 3n7n_A 3n4x_A | Back alignment and structure |
|---|
| >2x3v_A Syndapin I, protein kinase C and casein kinase substrate in N protein 1; BAR, N-WAsp, dynamin, pacsin 1, endocytosis; 2.45A {Mus musculus} PDB: 2x3w_A 2x3x_A | Back alignment and structure |
|---|
| >3r6n_A Desmoplakin; spectrin repeat, SH3 domain, cell adhesion, desmosome; 2.95A {Homo sapiens} | Back alignment and structure |
|---|
| >2lw1_A ABC transporter ATP-binding protein UUP; ABC REG subfamily, DNA binding protein; NMR {Escherichia coli} | Back alignment and structure |
|---|
| >2a01_A Apolipoprotein A-I; four-helix bundle, lipid transport; HET: AC9; 2.40A {Homo sapiens} PDB: 3k2s_A* 1av1_A 3j00_0* | Back alignment and structure |
|---|
| >2odv_A Plectin 1, HD1; plakin domain, spectrin repeat, cytoskeleton, hemidesmosomes epidermolysis bullosa, structural protein; 2.05A {Homo sapiens} PDB: 2odu_A | Back alignment and structure |
|---|
| >3cvf_A Homer-3, homer protein homolog 3; coiled coil, alternative splicing, cell junction, cytoplasm, membrane, phosphoprotein, polymorphism; 2.90A {Homo sapiens} | Back alignment and structure |
|---|
| >2b5u_A Colicin E3; high resolution colicin E3, ribosome inactivation, ribosome inhibitor, hydrolase; HET: CIT; 2.30A {Escherichia coli} SCOP: b.101.1.1 b.110.1.1 h.4.9.1 PDB: 1jch_A* 1ujw_B* 2ysu_B 1e44_B 2xfz_Y* 2xg1_Y* | Back alignment and structure |
|---|
| >4h22_A Leucine-rich repeat flightless-interacting protei; nucleic acid sensor, transcription; 2.89A {Homo sapiens} | Back alignment and structure |
|---|
| >3f31_A Spectrin alpha chain, brain; LONE helix followed by A triple helical bundle, actin cappin binding, alternative splicing, calcium; 2.30A {Homo sapiens} SCOP: a.7.1.0 | Back alignment and structure |
|---|
| >3bas_A Myosin heavy chain, striated muscle/general control protein GCN4 chimera; alpha-helical coiled coil, disorder, salt links; 2.30A {Argopecten irradians} SCOP: h.1.26.1 PDB: 1nkn_A 3bat_A | Back alignment and structure |
|---|
| >4fla_A Regulation of nuclear PRE-mRNA domain-containing 1B; structural genomics consortium, SGC, transcription; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >1cii_A Colicin IA; bacteriocin, ION channel formation, transmembrane protein; 3.00A {Escherichia coli} SCOP: f.1.1.1 h.4.3.1 | Back alignment and structure |
|---|
| >4dyl_A Tyrosine-protein kinase FES/FPS; structural genomics, structural genomics consortium, BCR, CR associated substrate, transferase; 2.18A {Homo sapiens} | Back alignment and structure |
|---|
| >1bf5_A Signal transducer and activator of transcription 1-alpha/beta; complex (SH2 domain/DNA), SH2 domain, transcription factor; HET: DNA PTR; 2.90A {Homo sapiens} SCOP: a.47.1.1 b.2.5.5 d.93.1.1 | Back alignment and structure |
|---|
| >3caz_A BAR protein; thermo-acidophilic RED ALGA, protein structure initiative, PSI, center for eukaryotic structural genomics, signaling protein; 3.34A {Galdieria sulphuraria} | Back alignment and structure |
|---|
| >1quu_A Human skeletal muscle alpha-actinin 2; triple-helix coiled coil, contractIle protein; 2.50A {Homo sapiens} SCOP: a.7.1.1 a.7.1.1 | Back alignment and structure |
|---|
| >1fxk_C Protein (prefoldin); archaeal protein, chaperone; 2.30A {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: a.2.5.1 | Back alignment and structure |
|---|
| >4h22_A Leucine-rich repeat flightless-interacting protei; nucleic acid sensor, transcription; 2.89A {Homo sapiens} | Back alignment and structure |
|---|
| >2v0o_A FCHO2, FCH domain only protein 2; lipid-binding protein, EFC domain, vesicle trafficking, membrane curvature, endocytosis, exocytosis, F-BAR domain; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >2v4h_A NF-kappa-B essential modulator; transcription, metal-binding, NEMO - IKK gamma - NFKB pathwa darpin, transcription regulation; 2.9A {Mus musculus} | Back alignment and structure |
|---|
| >3uun_A Dystrophin; triple helical, cell structure and stability, cytoskeletal, structural protein; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >2ch7_A Methyl-accepting chemotaxis protein; receptor, four-helix bundle, signal transduction, methyl-accepting receptor; 2.5A {Thermotoga maritima} SCOP: h.4.5.1 PDB: 2ch7_B | Back alignment and structure |
|---|
| >1wle_A Seryl-tRNA synthetase; ligase; HET: SRP; 1.65A {Bos taurus} | Back alignment and structure |
|---|
| >1pul_A Hypothetical protein C32E8.3 in chromosome I; alpha helical, northeast structural genomics consortium, PSI, protein structure initiative; NMR {Caenorhabditis elegans} SCOP: a.39.1.11 | Back alignment and structure |
|---|
| >1nfn_A Apolipoprotein E3; lipid transport, heparin-binding, plasma protein, HDL, VLDL; 1.80A {Homo sapiens} SCOP: a.24.1.1 PDB: 1h7i_A 1ea8_A 1b68_A 1nfo_A 2kc3_A 1ya9_A | Back alignment and structure |
|---|
| >3aco_A Pacsin2, protein kinase C and casein kinase substrate in neurons protein 2; helix bundle, coiled-coil, endocytosis; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >2x3v_A Syndapin I, protein kinase C and casein kinase substrate in N protein 1; BAR, N-WAsp, dynamin, pacsin 1, endocytosis; 2.45A {Mus musculus} PDB: 2x3w_A 2x3x_A | Back alignment and structure |
|---|
| >3ghg_C Fibrinogen gamma chain; triple-stranded coiled coil, beta sheets, alpha helices, AMY amyloidosis, blood coagulation, disease mutation, glycoprot phosphoprotein; HET: NAG NDG BMA MAN GAL SIA; 2.90A {Homo sapiens} PDB: 1deq_C | Back alignment and structure |
|---|
| >1bg1_A Protein (transcription factor STAT3B); protein-DNA complex, cytokine activation, complex (transcription factor/DNA), transcription/DNA complex; HET: DNA PTR; 2.25A {Mus musculus} SCOP: a.47.1.1 b.2.5.5 d.93.1.1 PDB: 3cwg_A | Back alignment and structure |
|---|
| >3etw_A Adhesin A; antiparallel helix-loop-helix, leucine chain, cell adhesin, cell adhesion; 2.00A {Fusobacterium nucleatum} PDB: 3ety_A 3etx_A 3etz_A 2gl2_A | Back alignment and structure |
|---|
| >1y1u_A Signal transducer and activator of transcription; STAT, DNA-binding, SH2 domain, transcription REGU signaling protein; 3.21A {Mus musculus} | Back alignment and structure |
|---|
| >2p22_C Protein SRN2; endosome, trafficking complex, VPS23, VPS28, VPS37, MVB12; 2.70A {Saccharomyces cerevisiae} PDB: 2caz_C 2f66_C | Back alignment and structure |
|---|
| >2nrj_A HBL B protein; enterotoxin, hemolysis, transmembrane, structural genomics, PSI-2, protein structure initiative; 2.03A {Bacillus cereus} SCOP: h.4.4.2 | Back alignment and structure |
|---|
| >2qih_A Protein USPA1; trimeric, parallel alpha-helical coiled-coil, cell adhesion; 1.90A {Moraxella catarrhalis} | Back alignment and structure |
|---|
| >3fpp_A Macrolide-specific efflux protein MACA; hexameric assembly, membrane fusion protein, drug efflux pump, periplasmic protein; 2.99A {Escherichia coli} | Back alignment and structure |
|---|
| >3ni0_A Bone marrow stromal antigen 2; coiled-coil, antiviral defense, immune system, GPI anchor; 1.60A {Mus musculus} | Back alignment and structure |
|---|
| >3c9i_A Tail needle protein GP26; xenon, coiled-coil, protein fiber, coiled coil, late protein, viral protein; 1.95A {Bacteriophage P22} PDB: 2poh_A | Back alignment and structure |
|---|
| >3okq_A BUD site selection protein 6; coiled-coil, protein binding; 2.04A {Saccharomyces cerevisiae} PDB: 3onx_A | Back alignment and structure |
|---|
| >3etw_A Adhesin A; antiparallel helix-loop-helix, leucine chain, cell adhesin, cell adhesion; 2.00A {Fusobacterium nucleatum} PDB: 3ety_A 3etx_A 3etz_A 2gl2_A | Back alignment and structure |
|---|
| >1go4_E MAD1 (mitotic arrest deficient)-like 1; mitotic spindle checkpoint, cell cycle, mitosis, nuclear Pro; 2.05A {Homo sapiens} SCOP: h.1.22.1 | Back alignment and structure |
|---|
| >2efk_A CDC42-interacting protein 4; EFC domain, structural genomics, NPPSFA, national project on structural and functional analyses; 2.30A {Homo sapiens} SCOP: a.238.1.4 | Back alignment and structure |
|---|
| >1quu_A Human skeletal muscle alpha-actinin 2; triple-helix coiled coil, contractIle protein; 2.50A {Homo sapiens} SCOP: a.7.1.1 a.7.1.1 | Back alignment and structure |
|---|
| >1nfn_A Apolipoprotein E3; lipid transport, heparin-binding, plasma protein, HDL, VLDL; 1.80A {Homo sapiens} SCOP: a.24.1.1 PDB: 1h7i_A 1ea8_A 1b68_A 1nfo_A 2kc3_A 1ya9_A | Back alignment and structure |
|---|
| >4hpq_C ATG17, KLTH0D15642P; autophagy, protein transport; 3.06A {Lachancea thermotolerans cbs 6340} | Back alignment and structure |
|---|
| >3r6n_A Desmoplakin; spectrin repeat, SH3 domain, cell adhesion, desmosome; 2.95A {Homo sapiens} | Back alignment and structure |
|---|
| >3plt_A Sphingolipid long chain base-responsive protein L; eisosomes, LSP1, PIL1, BAR domain, plasma membrane, SELF-ASS phosphoprotein; 2.90A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST
Original result of RPS-BLAST against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
E-value |
| 1216 | ||||
| d1iq3a_ | 110 | a.39.1.6 (A:) Pob1 {Human (Homo sapiens) [TaxId: 9 | 1e-23 | |
| d1iq3a_ | 110 | a.39.1.6 (A:) Pob1 {Human (Homo sapiens) [TaxId: 9 | 2e-09 | |
| d1fi6a_ | 92 | a.39.1.6 (A:) Reps1 {Mouse (Mus musculus) [TaxId: | 2e-22 | |
| d1fi6a_ | 92 | a.39.1.6 (A:) Reps1 {Mouse (Mus musculus) [TaxId: | 7e-12 | |
| d2jxca1 | 95 | a.39.1.6 (A:121-215) Eps15 {Human (Homo sapiens) [ | 7e-22 | |
| d2jxca1 | 95 | a.39.1.6 (A:121-215) Eps15 {Human (Homo sapiens) [ | 8e-13 | |
| d1c07a_ | 95 | a.39.1.6 (A:) Eps15 {Human (Homo sapiens) [TaxId: | 2e-20 | |
| d1c07a_ | 95 | a.39.1.6 (A:) Eps15 {Human (Homo sapiens) [TaxId: | 4e-12 | |
| d1qjta_ | 99 | a.39.1.6 (A:) Eps15 {Mouse (Mus musculus) [TaxId: | 5e-18 | |
| d1qjta_ | 99 | a.39.1.6 (A:) Eps15 {Mouse (Mus musculus) [TaxId: | 1e-15 | |
| d2opoa1 | 81 | a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Che | 7e-08 | |
| d2opoa1 | 81 | a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Che | 5e-05 | |
| d1s6ja_ | 87 | a.39.1.5 (A:) Calcium-dependent protein kinase sk5 | 8e-08 | |
| d1s6ja_ | 87 | a.39.1.5 (A:) Calcium-dependent protein kinase sk5 | 0.001 | |
| d1avsa_ | 81 | a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) | 3e-07 | |
| d1avsa_ | 81 | a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) | 0.002 | |
| d1ij5a_ | 321 | a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-bind | 3e-07 | |
| d2pq3a1 | 73 | a.39.1.5 (A:3-75) Calmodulin {Rattus norvegicus [T | 8e-07 | |
| d1oqpa_ | 77 | a.39.1.5 (A:) Caltractin (centrin 2) {Green algae | 1e-06 | |
| d1oqpa_ | 77 | a.39.1.5 (A:) Caltractin (centrin 2) {Green algae | 3e-05 | |
| d1tiza_ | 67 | a.39.1.5 (A:) Calmodulin-related protein T21P5.17 | 2e-06 | |
| d1tiza_ | 67 | a.39.1.5 (A:) Calmodulin-related protein T21P5.17 | 7e-04 | |
| d1f54a_ | 77 | a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharom | 3e-06 | |
| d1c7va_ | 68 | a.39.1.5 (A:) Calcium vector protein {Amphioxus (B | 5e-06 | |
| d1c7va_ | 68 | a.39.1.5 (A:) Calcium vector protein {Amphioxus (B | 4e-04 | |
| d1exra_ | 146 | a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetr | 1e-05 | |
| d1exra_ | 146 | a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetr | 8e-05 | |
| d1topa_ | 162 | a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) | 1e-05 | |
| d1topa_ | 162 | a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) | 0.004 | |
| d1rwya_ | 109 | a.39.1.4 (A:) Parvalbumin {Rat (Rattus rattus) [Ta | 2e-05 | |
| d1rwya_ | 109 | a.39.1.4 (A:) Parvalbumin {Rat (Rattus rattus) [Ta | 0.001 | |
| d1g8ia_ | 187 | a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1 | 2e-05 | |
| d1wrka1 | 82 | a.39.1.5 (A:4-85) Troponin C {Human (Homo sapiens) | 3e-05 | |
| d1fi5a_ | 81 | a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), | 4e-05 | |
| d1fi5a_ | 81 | a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), | 8e-04 | |
| d1rroa_ | 108 | a.39.1.4 (A:) Oncomodulin {Rat (Rattus norvegicus) | 5e-05 | |
| d1rroa_ | 108 | a.39.1.4 (A:) Oncomodulin {Rat (Rattus norvegicus) | 0.001 | |
| d1bjfa_ | 181 | a.39.1.5 (A:) Neurocalcin {Cow (Bos taurus) [TaxId | 6e-05 | |
| d1s6ca_ | 178 | a.39.1.5 (A:) Kchip1, Kv4 potassium channel-intera | 7e-05 | |
| d1jc2a_ | 75 | a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) | 8e-05 | |
| d1jc2a_ | 75 | a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) | 0.002 | |
| d1fw4a_ | 65 | a.39.1.5 (A:) Calmodulin {Cow (Bos taurus) [TaxId: | 9e-05 | |
| d1dtla_ | 156 | a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) | 1e-04 | |
| d2pvba_ | 107 | a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [Tax | 2e-04 | |
| d2pvba_ | 107 | a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [Tax | 0.003 | |
| d2fcea1 | 61 | a.39.1.5 (A:84-144) Calmodulin {Cow (Bos taurus) [ | 2e-04 | |
| d1pvaa_ | 109 | a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [Tax | 2e-04 | |
| d1xo5a_ | 180 | a.39.1.5 (A:) Calcium- and integrin-binding protei | 2e-04 | |
| d5pala_ | 109 | a.39.1.4 (A:) Parvalbumin {Leopard shark (Triakis | 3e-04 | |
| d1snla_ | 99 | a.39.1.7 (A:) Nucleobindin 1 (CALNUC) {Human (Homo | 4e-04 | |
| d1wlza1 | 83 | a.39.1.7 (A:229-311) DJ-1-binding protein, DJBP {H | 4e-04 | |
| d2obha1 | 141 | a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapien | 4e-04 | |
| d2obha1 | 141 | a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapien | 0.004 | |
| d1nyaa_ | 176 | a.39.1.5 (A:) Calerythrin {Saccharopolyspora eryth | 5e-04 | |
| d2zfda1 | 183 | a.39.1.5 (A:32-214) Calcineurin B-like protein 2 { | 5e-04 | |
| d2sasa_ | 185 | a.39.1.5 (A:) Sarcoplasmic calcium-binding protein | 0.001 | |
| d1fxka_ | 107 | a.2.5.1 (A:) Prefoldin beta subunit {Archaeon Meth | 0.001 | |
| d1fpwa_ | 190 | a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1 | 0.001 | |
| d1xk4a1 | 87 | a.39.1.2 (A:1-87) Calcyclin (S100) {Human (Homo sa | 0.002 | |
| d2ap3a1 | 185 | a.24.27.1 (A:12-196) Hypothetical protein MW0975 ( | 0.003 | |
| d1lkja_ | 146 | a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharom | 0.004 |
| >d1iq3a_ a.39.1.6 (A:) Pob1 {Human (Homo sapiens) [TaxId: 9606]} Length = 110 | Back information, alignment and structure |
|---|
class: All alpha proteins fold: EF Hand-like superfamily: EF-hand family: Eps15 homology domain (EH domain) domain: Pob1 species: Human (Homo sapiens) [TaxId: 9606]
Score = 94.4 bits (234), Expect = 1e-23
Identities = 39/106 (36%), Positives = 55/106 (51%), Gaps = 1/106 (0%)
Query: 417 GALNSTSSQSHVPWPKMTHSEVQKYTKVFVQVDIDRDGKITGEQAYNLFLSWRLPREVLK 476
G+L SS PW ++T + + Y F + D I+G A N F +L L
Sbjct: 1 GSLQDNSSYPDEPW-RITEEQREYYVNQFRSLQPDPSSFISGSVAKNFFTKSKLSIPELS 59
Query: 477 QVWDLSDQDNDGMLSLKEFCTALYLMERYREGRPLPTMLPSTIMPD 522
+W+LSD D DG L+L EFC A +L+ + G PLP LP T+ P+
Sbjct: 60 YIWELSDADCDGALTLPEFCAAFHLIVARKNGYPLPEGLPPTLQPE 105
|
| >d1iq3a_ a.39.1.6 (A:) Pob1 {Human (Homo sapiens) [TaxId: 9606]} Length = 110 | Back information, alignment and structure |
|---|
| >d1fi6a_ a.39.1.6 (A:) Reps1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 92 | Back information, alignment and structure |
|---|
| >d1fi6a_ a.39.1.6 (A:) Reps1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 92 | Back information, alignment and structure |
|---|
| >d2jxca1 a.39.1.6 (A:121-215) Eps15 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 | Back information, alignment and structure |
|---|
| >d2jxca1 a.39.1.6 (A:121-215) Eps15 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 | Back information, alignment and structure |
|---|
| >d1c07a_ a.39.1.6 (A:) Eps15 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 | Back information, alignment and structure |
|---|
| >d1c07a_ a.39.1.6 (A:) Eps15 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 | Back information, alignment and structure |
|---|
| >d1qjta_ a.39.1.6 (A:) Eps15 {Mouse (Mus musculus) [TaxId: 10090]} Length = 99 | Back information, alignment and structure |
|---|
| >d1qjta_ a.39.1.6 (A:) Eps15 {Mouse (Mus musculus) [TaxId: 10090]} Length = 99 | Back information, alignment and structure |
|---|
| >d2opoa1 a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Chenopodium album) [TaxId: 3559]} Length = 81 | Back information, alignment and structure |
|---|
| >d2opoa1 a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Chenopodium album) [TaxId: 3559]} Length = 81 | Back information, alignment and structure |
|---|
| >d1s6ja_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} Length = 87 | Back information, alignment and structure |
|---|
| >d1s6ja_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} Length = 87 | Back information, alignment and structure |
|---|
| >d1avsa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Length = 81 | Back information, alignment and structure |
|---|
| >d1avsa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Length = 81 | Back information, alignment and structure |
|---|
| >d1ij5a_ a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-binding protein LAV1-2) {Physarum polycephalum [TaxId: 5791]} Length = 321 | Back information, alignment and structure |
|---|
| >d2pq3a1 a.39.1.5 (A:3-75) Calmodulin {Rattus norvegicus [TaxId: 10116]} Length = 73 | Back information, alignment and structure |
|---|
| >d1oqpa_ a.39.1.5 (A:) Caltractin (centrin 2) {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Length = 77 | Back information, alignment and structure |
|---|
| >d1oqpa_ a.39.1.5 (A:) Caltractin (centrin 2) {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Length = 77 | Back information, alignment and structure |
|---|
| >d1tiza_ a.39.1.5 (A:) Calmodulin-related protein T21P5.17 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 67 | Back information, alignment and structure |
|---|
| >d1tiza_ a.39.1.5 (A:) Calmodulin-related protein T21P5.17 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 67 | Back information, alignment and structure |
|---|
| >d1f54a_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 77 | Back information, alignment and structure |
|---|
| >d1c7va_ a.39.1.5 (A:) Calcium vector protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Length = 68 | Back information, alignment and structure |
|---|
| >d1c7va_ a.39.1.5 (A:) Calcium vector protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Length = 68 | Back information, alignment and structure |
|---|
| >d1exra_ a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetraurelia) [TaxId: 5888]} Length = 146 | Back information, alignment and structure |
|---|
| >d1exra_ a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetraurelia) [TaxId: 5888]} Length = 146 | Back information, alignment and structure |
|---|
| >d1topa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Length = 162 | Back information, alignment and structure |
|---|
| >d1topa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Length = 162 | Back information, alignment and structure |
|---|
| >d1rwya_ a.39.1.4 (A:) Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} Length = 109 | Back information, alignment and structure |
|---|
| >d1rwya_ a.39.1.4 (A:) Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} Length = 109 | Back information, alignment and structure |
|---|
| >d1g8ia_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Human (Homo sapiens) [TaxId: 9606]} Length = 187 | Back information, alignment and structure |
|---|
| >d1wrka1 a.39.1.5 (A:4-85) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} Length = 82 | Back information, alignment and structure |
|---|
| >d1fi5a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), cardiac isoform [TaxId: 9031]} Length = 81 | Back information, alignment and structure |
|---|
| >d1fi5a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), cardiac isoform [TaxId: 9031]} Length = 81 | Back information, alignment and structure |
|---|
| >d1rroa_ a.39.1.4 (A:) Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 108 | Back information, alignment and structure |
|---|
| >d1rroa_ a.39.1.4 (A:) Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 108 | Back information, alignment and structure |
|---|
| >d1bjfa_ a.39.1.5 (A:) Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} Length = 181 | Back information, alignment and structure |
|---|
| >d1s6ca_ a.39.1.5 (A:) Kchip1, Kv4 potassium channel-interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 178 | Back information, alignment and structure |
|---|
| >d1jc2a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Length = 75 | Back information, alignment and structure |
|---|
| >d1jc2a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Length = 75 | Back information, alignment and structure |
|---|
| >d1fw4a_ a.39.1.5 (A:) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Length = 65 | Back information, alignment and structure |
|---|
| >d1dtla_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Length = 156 | Back information, alignment and structure |
|---|
| >d2pvba_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Length = 107 | Back information, alignment and structure |
|---|
| >d2pvba_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Length = 107 | Back information, alignment and structure |
|---|
| >d2fcea1 a.39.1.5 (A:84-144) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Length = 61 | Back information, alignment and structure |
|---|
| >d1pvaa_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Length = 109 | Back information, alignment and structure |
|---|
| >d1xo5a_ a.39.1.5 (A:) Calcium- and integrin-binding protein, CIB {Human (Homo sapiens) [TaxId: 9606]} Length = 180 | Back information, alignment and structure |
|---|
| >d5pala_ a.39.1.4 (A:) Parvalbumin {Leopard shark (Triakis semifasciata) [TaxId: 30493]} Length = 109 | Back information, alignment and structure |
|---|
| >d1snla_ a.39.1.7 (A:) Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [TaxId: 9606]} Length = 99 | Back information, alignment and structure |
|---|
| >d1wlza1 a.39.1.7 (A:229-311) DJ-1-binding protein, DJBP {Human (Homo sapiens) [TaxId: 9606]} Length = 83 | Back information, alignment and structure |
|---|
| >d2obha1 a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapiens) [TaxId: 9606]} Length = 141 | Back information, alignment and structure |
|---|
| >d2obha1 a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapiens) [TaxId: 9606]} Length = 141 | Back information, alignment and structure |
|---|
| >d1nyaa_ a.39.1.5 (A:) Calerythrin {Saccharopolyspora erythraea [TaxId: 1836]} Length = 176 | Back information, alignment and structure |
|---|
| >d2zfda1 a.39.1.5 (A:32-214) Calcineurin B-like protein 2 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 183 | Back information, alignment and structure |
|---|
| >d2sasa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Length = 185 | Back information, alignment and structure |
|---|
| >d1fxka_ a.2.5.1 (A:) Prefoldin beta subunit {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Length = 107 | Back information, alignment and structure |
|---|
| >d1fpwa_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 190 | Back information, alignment and structure |
|---|
| >d1xk4a1 a.39.1.2 (A:1-87) Calcyclin (S100) {Human (Homo sapiens), calgranulin s100a8, MRP8 [TaxId: 9606]} Length = 87 | Back information, alignment and structure |
|---|
| >d2ap3a1 a.24.27.1 (A:12-196) Hypothetical protein MW0975 (SA0943) {Staphylococcus aureus [TaxId: 1280]} Length = 185 | Back information, alignment and structure |
|---|
| >d1lkja_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 146 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch
Original result of HHsearch against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 1216 | |||
| d1iq3a_ | 110 | Pob1 {Human (Homo sapiens) [TaxId: 9606]} | 99.86 | |
| d1c07a_ | 95 | Eps15 {Human (Homo sapiens) [TaxId: 9606]} | 99.85 | |
| d2jxca1 | 95 | Eps15 {Human (Homo sapiens) [TaxId: 9606]} | 99.85 | |
| d1fi6a_ | 92 | Reps1 {Mouse (Mus musculus) [TaxId: 10090]} | 99.85 | |
| d2jxca1 | 95 | Eps15 {Human (Homo sapiens) [TaxId: 9606]} | 99.82 | |
| d1qjta_ | 99 | Eps15 {Mouse (Mus musculus) [TaxId: 10090]} | 99.82 | |
| d1c07a_ | 95 | Eps15 {Human (Homo sapiens) [TaxId: 9606]} | 99.81 | |
| d1iq3a_ | 110 | Pob1 {Human (Homo sapiens) [TaxId: 9606]} | 99.8 | |
| d1fi6a_ | 92 | Reps1 {Mouse (Mus musculus) [TaxId: 10090]} | 99.8 | |
| d1qjta_ | 99 | Eps15 {Mouse (Mus musculus) [TaxId: 10090]} | 99.68 | |
| d2pq3a1 | 73 | Calmodulin {Rattus norvegicus [TaxId: 10116]} | 99.24 | |
| d1f54a_ | 77 | Calmodulin {Baker's yeast (Saccharomyces cerevisia | 99.22 | |
| d1avsa_ | 81 | Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | 99.21 | |
| d2opoa1 | 81 | Polcalcin Che a 3 {Pigweed (Chenopodium album) [Ta | 99.17 | |
| d1wrka1 | 82 | Troponin C {Human (Homo sapiens), cardiac isoform | 99.13 | |
| d1s6ja_ | 87 | Calcium-dependent protein kinase sk5 CLD {Soybean | 99.12 | |
| d1oqpa_ | 77 | Caltractin (centrin 2) {Green algae (Chlamydomonas | 99.05 | |
| d1jc2a_ | 75 | Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | 99.04 | |
| d1fw4a_ | 65 | Calmodulin {Cow (Bos taurus) [TaxId: 9913]} | 99.03 | |
| d1tiza_ | 67 | Calmodulin-related protein T21P5.17 {Thale cress ( | 99.01 | |
| d1fi5a_ | 81 | Troponin C {Chicken (Gallus gallus), cardiac isofo | 98.99 | |
| d1c7va_ | 68 | Calcium vector protein {Amphioxus (Branchiostoma l | 98.97 | |
| d2fcea1 | 61 | Calmodulin {Cow (Bos taurus) [TaxId: 9913]} | 98.94 | |
| d1s6ja_ | 87 | Calcium-dependent protein kinase sk5 CLD {Soybean | 98.92 | |
| d5pala_ | 109 | Parvalbumin {Leopard shark (Triakis semifasciata) | 98.89 | |
| d1pvaa_ | 109 | Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} | 98.84 | |
| d2opoa1 | 81 | Polcalcin Che a 3 {Pigweed (Chenopodium album) [Ta | 98.83 | |
| d2pvba_ | 107 | Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} | 98.82 | |
| d1rwya_ | 109 | Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} | 98.82 | |
| d1rroa_ | 108 | Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116 | 98.81 | |
| d1qx2a_ | 76 | Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} | 98.76 | |
| d2pq3a1 | 73 | Calmodulin {Rattus norvegicus [TaxId: 10116]} | 98.76 | |
| d1f54a_ | 77 | Calmodulin {Baker's yeast (Saccharomyces cerevisia | 98.74 | |
| d1wlza1 | 83 | DJ-1-binding protein, DJBP {Human (Homo sapiens) [ | 98.71 | |
| d1lkja_ | 146 | Calmodulin {Baker's yeast (Saccharomyces cerevisia | 98.7 | |
| d1exra_ | 146 | Calmodulin {Ciliate (Paramecium tetraurelia) [TaxI | 98.69 | |
| d1avsa_ | 81 | Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | 98.68 | |
| d1nyaa_ | 176 | Calerythrin {Saccharopolyspora erythraea [TaxId: 1 | 98.66 | |
| d1zfsa1 | 93 | Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 | 98.65 | |
| d1tiza_ | 67 | Calmodulin-related protein T21P5.17 {Thale cress ( | 98.62 | |
| d1wdcb_ | 142 | Myosin Essential Chain {Bay scallop (Aequipecten i | 98.62 | |
| d1dtla_ | 156 | Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | 98.61 | |
| d1a4pa_ | 92 | Calcyclin (S100) {Human (Homo sapiens), P11 s100a1 | 98.6 | |
| d1exra_ | 146 | Calmodulin {Ciliate (Paramecium tetraurelia) [TaxI | 98.6 | |
| d1wrka1 | 82 | Troponin C {Human (Homo sapiens), cardiac isoform | 98.6 | |
| d1topa_ | 162 | Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | 98.59 | |
| d1ggwa_ | 140 | Cdc4p {Fission yeast (Schizosaccharomyces pombe) [ | 98.59 | |
| d1m45a_ | 146 | Myosin Light Chain Mlc1p {Baker's yeast (Saccharom | 98.56 | |
| d1fi5a_ | 81 | Troponin C {Chicken (Gallus gallus), cardiac isofo | 98.56 | |
| d1oqpa_ | 77 | Caltractin (centrin 2) {Green algae (Chlamydomonas | 98.56 | |
| d1yuta1 | 98 | Calcyclin (S100) {Human (Homo sapiens), s100a13 [T | 98.55 | |
| d3c1va1 | 93 | Calcyclin (S100) {Human (Homo sapiens), s100a4 [Ta | 98.55 | |
| d1cb1a_ | 78 | Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]} | 98.54 | |
| d1nyaa_ | 176 | Calerythrin {Saccharopolyspora erythraea [TaxId: 1 | 98.54 | |
| d2obha1 | 141 | Calmodulin {Human (Homo sapiens) [TaxId: 9606]} | 98.53 | |
| d1qv0a_ | 189 | Calcium-regulated photoprotein {Hydrozoa (Obelia l | 98.53 | |
| d1uhka1 | 187 | Calcium-regulated photoprotein {Jellyfish (Aequore | 98.52 | |
| d2sasa_ | 185 | Sarcoplasmic calcium-binding protein {Amphioxus (B | 98.52 | |
| d2scpa_ | 174 | Sarcoplasmic calcium-binding protein {Sandworm (Ne | 98.49 | |
| d1ksoa_ | 93 | Calcyclin (S100) {Human (Homo sapiens), s100a3 [Ta | 98.48 | |
| d1wdcc_ | 152 | Myosin Regulatory Chain {Bay scallop (Aequipecten | 98.48 | |
| d2mysb_ | 145 | Myosin Essential Chain {Chicken (Gallus gallus) [T | 98.48 | |
| d1jc2a_ | 75 | Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | 98.47 | |
| d1fw4a_ | 65 | Calmodulin {Cow (Bos taurus) [TaxId: 9913]} | 98.46 | |
| d2mysc_ | 145 | Myosin Regulatory Chain {Chicken (Gallus gallus) [ | 98.45 | |
| d1rwya_ | 109 | Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} | 98.43 | |
| d1c7va_ | 68 | Calcium vector protein {Amphioxus (Branchiostoma l | 98.42 | |
| d1jfja_ | 134 | EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: | 98.42 | |
| d1snla_ | 99 | Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [Tax | 98.41 | |
| d2obha1 | 141 | Calmodulin {Human (Homo sapiens) [TaxId: 9606]} | 98.41 | |
| d2pvba_ | 107 | Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} | 98.41 | |
| d1hqva_ | 181 | Apoptosis-linked protein alg-2 {Mouse (Mus musculu | 98.4 | |
| d1y1xa_ | 182 | Programmed cell death 6 protein-like protein {Leis | 98.39 | |
| d1rroa_ | 108 | Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116 | 98.39 | |
| d1pvaa_ | 109 | Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} | 98.38 | |
| d1topa_ | 162 | Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | 98.38 | |
| d2fcea1 | 61 | Calmodulin {Cow (Bos taurus) [TaxId: 9913]} | 98.37 | |
| d5pala_ | 109 | Parvalbumin {Leopard shark (Triakis semifasciata) | 98.36 | |
| d1xk4a1 | 87 | Calcyclin (S100) {Human (Homo sapiens), calgranuli | 98.35 | |
| d1k8ua_ | 89 | Calcyclin (S100) {Human (Homo sapiens), s100a6 [Ta | 98.34 | |
| d1psra_ | 100 | Calcyclin (S100) {Human (Homo sapiens), psoriasin | 98.33 | |
| d1k94a_ | 165 | Grancalcin {Human (Homo sapiens) [TaxId: 9606]} | 98.33 | |
| d2sasa_ | 185 | Sarcoplasmic calcium-binding protein {Amphioxus (B | 98.32 | |
| d1s6ia_ | 182 | Calcium-dependent protein kinase sk5 CLD {Soybean | 98.32 | |
| d1w7jb1 | 139 | Myosin Essential Chain {Human (Homo sapiens) [TaxI | 98.32 | |
| d1wdcb_ | 142 | Myosin Essential Chain {Bay scallop (Aequipecten i | 98.32 | |
| d2scpa_ | 174 | Sarcoplasmic calcium-binding protein {Sandworm (Ne | 98.3 | |
| d1y1xa_ | 182 | Programmed cell death 6 protein-like protein {Leis | 98.29 | |
| d1qxpa2 | 188 | Calpain large subunit, C-terminal domain (domain I | 98.27 | |
| d1snla_ | 99 | Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [Tax | 98.26 | |
| d1wdcc_ | 152 | Myosin Regulatory Chain {Bay scallop (Aequipecten | 98.25 | |
| d1lkja_ | 146 | Calmodulin {Baker's yeast (Saccharomyces cerevisia | 98.24 | |
| d1ij5a_ | 321 | Cbp40 (plasmodial specific CaII-binding protein LA | 98.23 | |
| d1wlza1 | 83 | DJ-1-binding protein, DJBP {Human (Homo sapiens) [ | 98.23 | |
| d1hqva_ | 181 | Apoptosis-linked protein alg-2 {Mouse (Mus musculu | 98.22 | |
| d1e8aa_ | 87 | Calcyclin (S100) {Human (Homo sapiens), calgranuli | 98.21 | |
| d1qv0a_ | 189 | Calcium-regulated photoprotein {Hydrozoa (Obelia l | 98.2 | |
| d1zfsa1 | 93 | Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 | 98.2 | |
| d1ij5a_ | 321 | Cbp40 (plasmodial specific CaII-binding protein LA | 98.19 | |
| d2mysc_ | 145 | Myosin Regulatory Chain {Chicken (Gallus gallus) [ | 98.19 | |
| d1auib_ | 165 | Calcineurin regulatory subunit (B-chain) {Human (H | 98.18 | |
| d1s6ia_ | 182 | Calcium-dependent protein kinase sk5 CLD {Soybean | 98.14 | |
| d1df0a1 | 186 | Calpain large subunit, C-terminal domain (domain I | 98.14 | |
| d1jfja_ | 134 | EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: | 98.14 | |
| d1uhka1 | 187 | Calcium-regulated photoprotein {Jellyfish (Aequore | 98.13 | |
| d1alva_ | 173 | Calpain small (regulatory) subunit (domain VI) {Pi | 98.13 | |
| d1yuta1 | 98 | Calcyclin (S100) {Human (Homo sapiens), s100a13 [T | 98.12 | |
| d1xo5a_ | 180 | Calcium- and integrin-binding protein, CIB {Human | 98.1 | |
| d1qx2a_ | 76 | Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} | 98.1 | |
| d1dtla_ | 156 | Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | 98.08 | |
| d1g8ia_ | 187 | Frequenin (neuronal calcium sensor 1) {Human (Homo | 98.08 | |
| d1a4pa_ | 92 | Calcyclin (S100) {Human (Homo sapiens), P11 s100a1 | 98.07 | |
| d1bjfa_ | 181 | Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} | 98.07 | |
| d3c1va1 | 93 | Calcyclin (S100) {Human (Homo sapiens), s100a4 [Ta | 98.05 | |
| d1jbaa_ | 189 | Guanylate cyclase activating protein 2, GCAP-2 {Co | 98.03 | |
| d1m45a_ | 146 | Myosin Light Chain Mlc1p {Baker's yeast (Saccharom | 98.01 | |
| d1ggwa_ | 140 | Cdc4p {Fission yeast (Schizosaccharomyces pombe) [ | 97.94 | |
| d1auib_ | 165 | Calcineurin regulatory subunit (B-chain) {Human (H | 97.93 | |
| d1fpwa_ | 190 | Frequenin (neuronal calcium sensor 1) {Baker's yea | 97.93 | |
| d1juoa_ | 172 | Sorcin {Human (Homo sapiens) [TaxId: 9606]} | 97.93 | |
| d2zfda1 | 183 | Calcineurin B-like protein 2 {Thale cress (Arabido | 97.92 | |
| d1ksoa_ | 93 | Calcyclin (S100) {Human (Homo sapiens), s100a3 [Ta | 97.92 | |
| d1cb1a_ | 78 | Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]} | 97.92 | |
| d1psra_ | 100 | Calcyclin (S100) {Human (Homo sapiens), psoriasin | 97.9 | |
| d2mysb_ | 145 | Myosin Essential Chain {Chicken (Gallus gallus) [T | 97.88 | |
| d1alva_ | 173 | Calpain small (regulatory) subunit (domain VI) {Pi | 97.86 | |
| d1juoa_ | 172 | Sorcin {Human (Homo sapiens) [TaxId: 9606]} | 97.85 | |
| d2zfda1 | 183 | Calcineurin B-like protein 2 {Thale cress (Arabido | 97.85 | |
| d1df0a1 | 186 | Calpain large subunit, C-terminal domain (domain I | 97.8 | |
| d1w7jb1 | 139 | Myosin Essential Chain {Human (Homo sapiens) [TaxI | 97.77 | |
| d1omra_ | 201 | Recoverin {Cow (Bos taurus) [TaxId: 9913]} | 97.76 | |
| d1qxpa2 | 188 | Calpain large subunit, C-terminal domain (domain I | 97.72 | |
| d3cr5x1 | 90 | Calcyclin (S100) {Cow (Bos taurus), s100b [TaxId: | 97.68 | |
| d1g8ia_ | 187 | Frequenin (neuronal calcium sensor 1) {Human (Homo | 97.65 | |
| d1fpwa_ | 190 | Frequenin (neuronal calcium sensor 1) {Baker's yea | 97.62 | |
| d1k8ua_ | 89 | Calcyclin (S100) {Human (Homo sapiens), s100a6 [Ta | 97.6 | |
| d1xk4a1 | 87 | Calcyclin (S100) {Human (Homo sapiens), calgranuli | 97.6 | |
| d1qlsa_ | 95 | Calcyclin (S100) {Pig (Sus scrofa), calgizzarin s1 | 97.59 | |
| d1k94a_ | 165 | Grancalcin {Human (Homo sapiens) [TaxId: 9606]} | 97.56 | |
| d1xo5a_ | 180 | Calcium- and integrin-binding protein, CIB {Human | 97.56 | |
| d1bjfa_ | 181 | Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} | 97.55 | |
| d1s6ca_ | 178 | Kchip1, Kv4 potassium channel-interacting protein | 97.53 | |
| d1jbaa_ | 189 | Guanylate cyclase activating protein 2, GCAP-2 {Co | 97.51 | |
| d1e8aa_ | 87 | Calcyclin (S100) {Human (Homo sapiens), calgranuli | 97.51 | |
| d1omra_ | 201 | Recoverin {Cow (Bos taurus) [TaxId: 9913]} | 97.5 | |
| d2hf5a1 | 33 | Troponin C {Human (Homo sapiens), cardiac isoform | 97.44 | |
| d1s6ca_ | 178 | Kchip1, Kv4 potassium channel-interacting protein | 97.36 | |
| d1j55a_ | 94 | Calcyclin (S100) {Human (Homo sapiens), s100p [Tax | 97.22 | |
| d1xk4c1 | 83 | Calcyclin (S100) {Human (Homo sapiens), s100a9 (mr | 97.06 | |
| d3cr5x1 | 90 | Calcyclin (S100) {Cow (Bos taurus), s100b [TaxId: | 96.69 | |
| d1fxkc_ | 133 | Prefoldin alpha subunit {Archaeon Methanobacterium | 96.63 | |
| d1qlsa_ | 95 | Calcyclin (S100) {Pig (Sus scrofa), calgizzarin s1 | 96.54 | |
| d2zkmx1 | 170 | Phospholipase C-beta-2 {Human (Homo sapiens) [TaxI | 96.27 | |
| d1ctda_ | 34 | Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | 96.21 | |
| d2ap3a1 | 185 | Hypothetical protein MW0975 (SA0943) {Staphylococc | 96.2 | |
| d2zkmx1 | 170 | Phospholipase C-beta-2 {Human (Homo sapiens) [TaxI | 95.9 | |
| d1j55a_ | 94 | Calcyclin (S100) {Human (Homo sapiens), s100p [Tax | 95.84 | |
| d2hf5a1 | 33 | Troponin C {Human (Homo sapiens), cardiac isoform | 95.55 | |
| d1tuza_ | 118 | Diacylglycerol kinase alpha, N-terminal domain {Hu | 95.54 | |
| d1fxka_ | 107 | Prefoldin beta subunit {Archaeon Methanobacterium | 95.52 | |
| d1ctda_ | 34 | Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | 95.06 | |
| d2efla1 | 288 | Formin-binding protein 1, FNBP1 {Human (Homo sapie | 95.02 | |
| d2ap3a1 | 185 | Hypothetical protein MW0975 (SA0943) {Staphylococc | 94.93 | |
| d1fxkc_ | 133 | Prefoldin alpha subunit {Archaeon Methanobacterium | 94.34 | |
| d1xk4c1 | 83 | Calcyclin (S100) {Human (Homo sapiens), s100a9 (mr | 94.2 | |
| d2efka1 | 279 | CDC42-interacting protein 4, CIP4 {Human (Homo sap | 93.91 | |
| d1qvra2 | 387 | ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 | 93.79 | |
| d1sraa_ | 151 | C-terminal (EC) domain of BM-40/SPARC/osteonectin | 93.72 | |
| d1tuza_ | 118 | Diacylglycerol kinase alpha, N-terminal domain {Hu | 93.67 | |
| d1fxka_ | 107 | Prefoldin beta subunit {Archaeon Methanobacterium | 93.05 | |
| d1sraa_ | 151 | C-terminal (EC) domain of BM-40/SPARC/osteonectin | 92.25 | |
| d1ez3a_ | 124 | Syntaxin 1A N-terminal domain {Rat (Rattus norvegi | 92.16 | |
| d1gqea_ | 362 | Polypeptide chain release factor 2 (RF2) {Escheric | 91.97 | |
| d1owaa_ | 156 | Spectrin alpha chain {Human (Homo sapiens) [TaxId: | 91.97 | |
| d1gqea_ | 362 | Polypeptide chain release factor 2 (RF2) {Escheric | 91.96 | |
| d1f5na1 | 300 | Interferon-induced guanylate-binding protein 1 (GB | 90.89 | |
| d1u5pa1 | 110 | Spectrin alpha chain {Chicken (Gallus gallus) [Tax | 90.68 | |
| d1i4da_ | 200 | Arfaptin, Rac-binding fragment {Human (Homo sapien | 89.95 | |
| d1gs9a_ | 144 | Apolipoprotein E {Human (Homo sapiens), E4 [TaxId: | 89.86 | |
| d1seta1 | 110 | Seryl-tRNA synthetase (SerRS) {Thermus thermophilu | 89.81 | |
| d1quua1 | 124 | alpha-actinin {Human (Homo sapiens) [TaxId: 9606]} | 89.77 | |
| d2spca_ | 107 | Spectrin alpha chain {Drosophila sp. [TaxId: 7242] | 89.0 | |
| d1ez3a_ | 124 | Syntaxin 1A N-terminal domain {Rat (Rattus norvegi | 88.44 | |
| d1f5na1 | 300 | Interferon-induced guanylate-binding protein 1 (GB | 88.37 | |
| d1s35a2 | 105 | Spectrin beta chain {Human (Homo sapiens) [TaxId: | 88.25 | |
| d1u5pa2 | 101 | Spectrin alpha chain {Chicken (Gallus gallus) [Tax | 85.8 | |
| d1fioa_ | 196 | Sso1 {Baker's yeast (Saccharomyces cerevisiae) [Ta | 84.67 | |
| d1vcsa1 | 89 | Vesicle transport v-SNARE protein Vti1-like 2 {Mou | 84.64 | |
| d1qasa1 | 94 | Phosphoinositide-specific phospholipase C, isozyme | 84.24 | |
| d1qvra2 | 387 | ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 | 84.24 | |
| d1cuna2 | 104 | Spectrin alpha chain {Chicken (Gallus gallus) [Tax | 83.73 | |
| d1seta1 | 110 | Seryl-tRNA synthetase (SerRS) {Thermus thermophilu | 83.32 | |
| d1urua_ | 217 | Amphiphysin {Fruit fly (Drosophila melanogaster) [ | 83.01 | |
| d1hcia4 | 114 | alpha-actinin {Human (Homo sapiens) [TaxId: 9606]} | 82.22 | |
| d1gs9a_ | 144 | Apolipoprotein E {Human (Homo sapiens), E4 [TaxId: | 82.02 |
| >d1iq3a_ a.39.1.6 (A:) Pob1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: All alpha proteins fold: EF Hand-like superfamily: EF-hand family: Eps15 homology domain (EH domain) domain: Pob1 species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.86 E-value=1.1e-22 Score=192.44 Aligned_cols=103 Identities=37% Similarity=0.665 Sum_probs=98.2
Q ss_pred cCCCCCCCCCCCCCCCHHHHHHHHHHHHHhCCCCCCcccHHHHHHHHHcCCCCHHHHHHHHHHhCCCCCCccCHHHHHHH
Q 000940 419 LNSTSSQSHVPWPKMTHSEVQKYTKVFVQVDIDRDGKITGEQAYNLFLSWRLPREVLKQVWDLSDQDNDGMLSLKEFCTA 498 (1216)
Q Consensus 419 ~~~~~~~~~~~Wp~LS~eEk~ey~eaF~~fDkDgDG~ISgdELr~~flgs~LpeeeL~qIW~LaDiD~DGkLdfdEFvvA 498 (1216)
.+.+.+.+..+| .|+++++++|+++|+.+|+|++|+|+++|++.+|++++|+.++|.+||+++|.|++|+|+++||++|
T Consensus 3 ~~~~~~~~~~~~-~lt~ee~~~y~~lF~~~D~d~~G~Is~~e~~~~l~~s~L~~~~L~~Iw~l~D~d~dG~l~~~EF~~a 81 (110)
T d1iq3a_ 3 LQDNSSYPDEPW-RITEEQREYYVNQFRSLQPDPSSFISGSVAKNFFTKSKLSIPELSYIWELSDADCDGALTLPEFCAA 81 (110)
T ss_dssp SCCCCCCCCSSC-CCSSSSHHHHHHHHHHHCCSSSSEEEHHHHHHHCCSSSCSSCCHHHHHHHHCSSSCSEEEHHHHHHH
T ss_pred CCCCCCCCCCCC-ccCHHHHHHHHHHHHHhCCCcccchhHHHHHHHHHhhccchHHHHHHHHHhccCCCCeECHHHHHHH
Confidence 344567788899 8999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred HHHHHHHhcCCCCCCCCCCCCCCC
Q 000940 499 LYLMERYREGRPLPTMLPSTIMPD 522 (1216)
Q Consensus 499 M~LI~~~l~G~~LP~~LPp~L~Pp 522 (1216)
||||.++++|++||..||+.|+|.
T Consensus 82 m~Li~~~~~G~~lP~~LP~~l~p~ 105 (110)
T d1iq3a_ 82 FHLIVARKNGYPLPEGLPPTLQPE 105 (110)
T ss_dssp HHHHHHHHHTCCCCCCSSCCSCSS
T ss_pred HHHHHHHHcCCCCCcccCcccCcc
Confidence 999999999999999999999986
|
| >d1c07a_ a.39.1.6 (A:) Eps15 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2jxca1 a.39.1.6 (A:121-215) Eps15 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fi6a_ a.39.1.6 (A:) Reps1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2jxca1 a.39.1.6 (A:121-215) Eps15 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qjta_ a.39.1.6 (A:) Eps15 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1c07a_ a.39.1.6 (A:) Eps15 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1iq3a_ a.39.1.6 (A:) Pob1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fi6a_ a.39.1.6 (A:) Reps1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1qjta_ a.39.1.6 (A:) Eps15 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2pq3a1 a.39.1.5 (A:3-75) Calmodulin {Rattus norvegicus [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1f54a_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1avsa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d2opoa1 a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Chenopodium album) [TaxId: 3559]} | Back information, alignment and structure |
|---|
| >d1wrka1 a.39.1.5 (A:4-85) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1s6ja_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} | Back information, alignment and structure |
|---|
| >d1oqpa_ a.39.1.5 (A:) Caltractin (centrin 2) {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} | Back information, alignment and structure |
|---|
| >d1jc2a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1fw4a_ a.39.1.5 (A:) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1tiza_ a.39.1.5 (A:) Calmodulin-related protein T21P5.17 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1fi5a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), cardiac isoform [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1c7va_ a.39.1.5 (A:) Calcium vector protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} | Back information, alignment and structure |
|---|
| >d2fcea1 a.39.1.5 (A:84-144) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1s6ja_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} | Back information, alignment and structure |
|---|
| >d5pala_ a.39.1.4 (A:) Parvalbumin {Leopard shark (Triakis semifasciata) [TaxId: 30493]} | Back information, alignment and structure |
|---|
| >d1pvaa_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} | Back information, alignment and structure |
|---|
| >d2opoa1 a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Chenopodium album) [TaxId: 3559]} | Back information, alignment and structure |
|---|
| >d2pvba_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} | Back information, alignment and structure |
|---|
| >d1rwya_ a.39.1.4 (A:) Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} | Back information, alignment and structure |
|---|
| >d1rroa_ a.39.1.4 (A:) Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1qx2a_ a.39.1.1 (A:) Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d2pq3a1 a.39.1.5 (A:3-75) Calmodulin {Rattus norvegicus [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1f54a_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1wlza1 a.39.1.7 (A:229-311) DJ-1-binding protein, DJBP {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lkja_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1exra_ a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetraurelia) [TaxId: 5888]} | Back information, alignment and structure |
|---|
| >d1avsa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1nyaa_ a.39.1.5 (A:) Calerythrin {Saccharopolyspora erythraea [TaxId: 1836]} | Back information, alignment and structure |
|---|
| >d1zfsa1 a.39.1.2 (A:1-93) Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1tiza_ a.39.1.5 (A:) Calmodulin-related protein T21P5.17 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1wdcb_ a.39.1.5 (B:) Myosin Essential Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} | Back information, alignment and structure |
|---|
| >d1dtla_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1a4pa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), P11 s100a10, calpactin [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1exra_ a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetraurelia) [TaxId: 5888]} | Back information, alignment and structure |
|---|
| >d1wrka1 a.39.1.5 (A:4-85) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1topa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1ggwa_ a.39.1.5 (A:) Cdc4p {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1m45a_ a.39.1.5 (A:) Myosin Light Chain Mlc1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1fi5a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), cardiac isoform [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1oqpa_ a.39.1.5 (A:) Caltractin (centrin 2) {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} | Back information, alignment and structure |
|---|
| >d1yuta1 a.39.1.2 (A:1-98) Calcyclin (S100) {Human (Homo sapiens), s100a13 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3c1va1 a.39.1.2 (A:2-94) Calcyclin (S100) {Human (Homo sapiens), s100a4 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1cb1a_ a.39.1.1 (A:) Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1nyaa_ a.39.1.5 (A:) Calerythrin {Saccharopolyspora erythraea [TaxId: 1836]} | Back information, alignment and structure |
|---|
| >d2obha1 a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qv0a_ a.39.1.5 (A:) Calcium-regulated photoprotein {Hydrozoa (Obelia longissima), obelin [TaxId: 32570]} | Back information, alignment and structure |
|---|
| >d1uhka1 a.39.1.5 (A:3-189) Calcium-regulated photoprotein {Jellyfish (Aequorea aequorea), aequorin [TaxId: 168712]} | Back information, alignment and structure |
|---|
| >d2sasa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} | Back information, alignment and structure |
|---|
| >d2scpa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Sandworm (Nereis diversicolor) [TaxId: 126592]} | Back information, alignment and structure |
|---|
| >d1ksoa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a3 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wdcc_ a.39.1.5 (C:) Myosin Regulatory Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} | Back information, alignment and structure |
|---|
| >d2mysb_ a.39.1.5 (B:) Myosin Essential Chain {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1jc2a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1fw4a_ a.39.1.5 (A:) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d2mysc_ a.39.1.5 (C:) Myosin Regulatory Chain {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1rwya_ a.39.1.4 (A:) Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} | Back information, alignment and structure |
|---|
| >d1c7va_ a.39.1.5 (A:) Calcium vector protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} | Back information, alignment and structure |
|---|
| >d1jfja_ a.39.1.5 (A:) EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 5759]} | Back information, alignment and structure |
|---|
| >d1snla_ a.39.1.7 (A:) Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2obha1 a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2pvba_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} | Back information, alignment and structure |
|---|
| >d1hqva_ a.39.1.8 (A:) Apoptosis-linked protein alg-2 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1y1xa_ a.39.1.8 (A:) Programmed cell death 6 protein-like protein {Leishmania major [TaxId: 5664]} | Back information, alignment and structure |
|---|
| >d1rroa_ a.39.1.4 (A:) Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1pvaa_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} | Back information, alignment and structure |
|---|
| >d1topa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d2fcea1 a.39.1.5 (A:84-144) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d5pala_ a.39.1.4 (A:) Parvalbumin {Leopard shark (Triakis semifasciata) [TaxId: 30493]} | Back information, alignment and structure |
|---|
| >d1xk4a1 a.39.1.2 (A:1-87) Calcyclin (S100) {Human (Homo sapiens), calgranulin s100a8, MRP8 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1k8ua_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a6 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1psra_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), psoriasin s100a7 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1k94a_ a.39.1.8 (A:) Grancalcin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2sasa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} | Back information, alignment and structure |
|---|
| >d1s6ia_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} | Back information, alignment and structure |
|---|
| >d1w7jb1 a.39.1.5 (B:11-149) Myosin Essential Chain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wdcb_ a.39.1.5 (B:) Myosin Essential Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} | Back information, alignment and structure |
|---|
| >d2scpa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Sandworm (Nereis diversicolor) [TaxId: 126592]} | Back information, alignment and structure |
|---|
| >d1y1xa_ a.39.1.8 (A:) Programmed cell death 6 protein-like protein {Leishmania major [TaxId: 5664]} | Back information, alignment and structure |
|---|
| >d1qxpa2 a.39.1.8 (A:515-702) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), mu-type [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1snla_ a.39.1.7 (A:) Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wdcc_ a.39.1.5 (C:) Myosin Regulatory Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} | Back information, alignment and structure |
|---|
| >d1lkja_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1ij5a_ a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-binding protein LAV1-2) {Physarum polycephalum [TaxId: 5791]} | Back information, alignment and structure |
|---|
| >d1wlza1 a.39.1.7 (A:229-311) DJ-1-binding protein, DJBP {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hqva_ a.39.1.8 (A:) Apoptosis-linked protein alg-2 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1e8aa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), calgranulin C, s100a12 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qv0a_ a.39.1.5 (A:) Calcium-regulated photoprotein {Hydrozoa (Obelia longissima), obelin [TaxId: 32570]} | Back information, alignment and structure |
|---|
| >d1zfsa1 a.39.1.2 (A:1-93) Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1ij5a_ a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-binding protein LAV1-2) {Physarum polycephalum [TaxId: 5791]} | Back information, alignment and structure |
|---|
| >d2mysc_ a.39.1.5 (C:) Myosin Regulatory Chain {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1auib_ a.39.1.5 (B:) Calcineurin regulatory subunit (B-chain) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1s6ia_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} | Back information, alignment and structure |
|---|
| >d1df0a1 a.39.1.8 (A:515-700) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), M-type [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1jfja_ a.39.1.5 (A:) EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 5759]} | Back information, alignment and structure |
|---|
| >d1uhka1 a.39.1.5 (A:3-189) Calcium-regulated photoprotein {Jellyfish (Aequorea aequorea), aequorin [TaxId: 168712]} | Back information, alignment and structure |
|---|
| >d1alva_ a.39.1.8 (A:) Calpain small (regulatory) subunit (domain VI) {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1yuta1 a.39.1.2 (A:1-98) Calcyclin (S100) {Human (Homo sapiens), s100a13 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xo5a_ a.39.1.5 (A:) Calcium- and integrin-binding protein, CIB {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qx2a_ a.39.1.1 (A:) Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1dtla_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1g8ia_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a4pa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), P11 s100a10, calpactin [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bjfa_ a.39.1.5 (A:) Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d3c1va1 a.39.1.2 (A:2-94) Calcyclin (S100) {Human (Homo sapiens), s100a4 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jbaa_ a.39.1.5 (A:) Guanylate cyclase activating protein 2, GCAP-2 {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1m45a_ a.39.1.5 (A:) Myosin Light Chain Mlc1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1ggwa_ a.39.1.5 (A:) Cdc4p {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1auib_ a.39.1.5 (B:) Calcineurin regulatory subunit (B-chain) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fpwa_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1juoa_ a.39.1.8 (A:) Sorcin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2zfda1 a.39.1.5 (A:32-214) Calcineurin B-like protein 2 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1ksoa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a3 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1cb1a_ a.39.1.1 (A:) Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1psra_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), psoriasin s100a7 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2mysb_ a.39.1.5 (B:) Myosin Essential Chain {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1alva_ a.39.1.8 (A:) Calpain small (regulatory) subunit (domain VI) {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1juoa_ a.39.1.8 (A:) Sorcin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2zfda1 a.39.1.5 (A:32-214) Calcineurin B-like protein 2 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1df0a1 a.39.1.8 (A:515-700) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), M-type [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1w7jb1 a.39.1.5 (B:11-149) Myosin Essential Chain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1omra_ a.39.1.5 (A:) Recoverin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1qxpa2 a.39.1.8 (A:515-702) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), mu-type [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d3cr5x1 a.39.1.2 (X:0-89) Calcyclin (S100) {Cow (Bos taurus), s100b [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1g8ia_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fpwa_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1k8ua_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a6 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xk4a1 a.39.1.2 (A:1-87) Calcyclin (S100) {Human (Homo sapiens), calgranulin s100a8, MRP8 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qlsa_ a.39.1.2 (A:) Calcyclin (S100) {Pig (Sus scrofa), calgizzarin s100c (s100a11) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1k94a_ a.39.1.8 (A:) Grancalcin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xo5a_ a.39.1.5 (A:) Calcium- and integrin-binding protein, CIB {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bjfa_ a.39.1.5 (A:) Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1s6ca_ a.39.1.5 (A:) Kchip1, Kv4 potassium channel-interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1jbaa_ a.39.1.5 (A:) Guanylate cyclase activating protein 2, GCAP-2 {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1e8aa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), calgranulin C, s100a12 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1omra_ a.39.1.5 (A:) Recoverin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d2hf5a1 a.39.1.5 (A:81-113) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1s6ca_ a.39.1.5 (A:) Kchip1, Kv4 potassium channel-interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1j55a_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100p [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xk4c1 a.39.1.2 (C:4-86) Calcyclin (S100) {Human (Homo sapiens), s100a9 (mrp14) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3cr5x1 a.39.1.2 (X:0-89) Calcyclin (S100) {Cow (Bos taurus), s100b [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1fxkc_ a.2.5.1 (C:) Prefoldin alpha subunit {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d1qlsa_ a.39.1.2 (A:) Calcyclin (S100) {Pig (Sus scrofa), calgizzarin s100c (s100a11) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d2zkmx1 a.39.1.7 (X:142-311) Phospholipase C-beta-2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ctda_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d2ap3a1 a.24.27.1 (A:12-196) Hypothetical protein MW0975 (SA0943) {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d2zkmx1 a.39.1.7 (X:142-311) Phospholipase C-beta-2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1j55a_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100p [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2hf5a1 a.39.1.5 (A:81-113) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tuza_ a.39.1.7 (A:) Diacylglycerol kinase alpha, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fxka_ a.2.5.1 (A:) Prefoldin beta subunit {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d1ctda_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d2efla1 a.238.1.4 (A:1-288) Formin-binding protein 1, FNBP1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ap3a1 a.24.27.1 (A:12-196) Hypothetical protein MW0975 (SA0943) {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1fxkc_ a.2.5.1 (C:) Prefoldin alpha subunit {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d1xk4c1 a.39.1.2 (C:4-86) Calcyclin (S100) {Human (Homo sapiens), s100a9 (mrp14) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2efka1 a.238.1.4 (A:10-288) CDC42-interacting protein 4, CIP4 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1sraa_ a.39.1.3 (A:) C-terminal (EC) domain of BM-40/SPARC/osteonectin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tuza_ a.39.1.7 (A:) Diacylglycerol kinase alpha, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fxka_ a.2.5.1 (A:) Prefoldin beta subunit {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d1sraa_ a.39.1.3 (A:) C-terminal (EC) domain of BM-40/SPARC/osteonectin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ez3a_ a.47.2.1 (A:) Syntaxin 1A N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1gqea_ e.38.1.1 (A:) Polypeptide chain release factor 2 (RF2) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1owaa_ a.7.1.1 (A:) Spectrin alpha chain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gqea_ e.38.1.1 (A:) Polypeptide chain release factor 2 (RF2) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1f5na1 a.114.1.1 (A:284-583) Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u5pa1 a.7.1.1 (A:1662-1771) Spectrin alpha chain {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1i4da_ a.238.1.2 (A:) Arfaptin, Rac-binding fragment {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gs9a_ a.24.1.1 (A:) Apolipoprotein E {Human (Homo sapiens), E4 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1seta1 a.2.7.1 (A:1-110) Seryl-tRNA synthetase (SerRS) {Thermus thermophilus, strain hb27 [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1quua1 a.7.1.1 (A:1-124) alpha-actinin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2spca_ a.7.1.1 (A:) Spectrin alpha chain {Drosophila sp. [TaxId: 7242]} | Back information, alignment and structure |
|---|
| >d1ez3a_ a.47.2.1 (A:) Syntaxin 1A N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1f5na1 a.114.1.1 (A:284-583) Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1s35a2 a.7.1.1 (A:1169-1273) Spectrin beta chain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u5pa2 a.7.1.1 (A:1772-1872) Spectrin alpha chain {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1fioa_ a.47.2.1 (A:) Sso1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1vcsa1 a.47.2.1 (A:8-96) Vesicle transport v-SNARE protein Vti1-like 2 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1qasa1 a.39.1.7 (A:205-298) Phosphoinositide-specific phospholipase C, isozyme D1 (PLC-D!) {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1cuna2 a.7.1.1 (A:116-219) Spectrin alpha chain {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1seta1 a.2.7.1 (A:1-110) Seryl-tRNA synthetase (SerRS) {Thermus thermophilus, strain hb27 [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1urua_ a.238.1.1 (A:) Amphiphysin {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1hcia4 a.7.1.1 (A:633-746) alpha-actinin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gs9a_ a.24.1.1 (A:) Apolipoprotein E {Human (Homo sapiens), E4 [TaxId: 9606]} | Back information, alignment and structure |
|---|