Citrus Sinensis ID: 000991

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------1000------1010------1020------1030------1040------1050------1060------1070------1080------1090------1100------1110------1120------1130------1140------1150------1160------1170------1180------1190------120
MPFSFIFIRSGTTMTMALRPTSLNFYRAPKALLKPSPLSLLVVKNQAVAFRLLHHYHYHLPFHLSRRRHAVVTCSGAVTRTRRLDWKAVSYPLLEQQTSNYGRYAYQDESSDDSDREFGSTQQQMCGSTLDNIDEWRWKLTMLLRNKDEQEVVSRAKKDRRDFEQLSALATRMGLHSRQYAKVVVFSKAPLPNYRSDLDEKRPQREVILPFGLLREVDAHLKAYLSQKYINASMSSLSNVGSTTNDEGLYEQQEQLVQNSVVRERILRQRSLQMHEKQQAWQESPEGQKMLEFRRSLPSYKERDALLKAISENQVVVVSGETGCGKTTQLPQYILESETEAARGAACSIICTQPRRISAMAVSERVAAERGEKLGESVGYKVRLEGMKGRDTRLMFCTTGILLRRLLVDRSLRGVTHVIVDEIHERGMNEDFLLIVLKELLPRRPELRLILMSATLNAELFSSYFGGAPMLHIPGFTYPVRAYFLENILEMTRYRLNTYNQIDDYGQEKSWKMQKQALALRKRKSSIASAVEDALEAADFREYSVQTQQSLSCWNPDSIGFNLIEHVLCHIVKKERPGAVLVFMTGWDDINSLKDQLQAHPLLGDPSRVLLLACHGSMASSEQRLIFDKPEDGVRKIVLATNMAETSITINDVVFVIDCGKAKETSYDALNNTPCLLPSWISKAAARQRRGRAGRVQPGECYHLYPRYVYDAFADYQLPELLRTPLQSLCLQIKSLQLGSISEFLSRALQPPEPLSVKNAIEYLQIIGALDENENLTVLGRNLSMLPVEPKLGKMLILGAIFNCLDPVMTVVAGLSVRDPFLMPFDKKDLAESAKAQFSARDYSDHLALVRAYDGWKDAERHQSGYEYCWKNFLSAQTLKAIDSLRKQFLFLLKDAGLVDRNTENCNKWSHDEHLIRAVICAGLFPGLCSVVNKEKSIALKTMEDGQVLLYSNSVNAGVPKIPYPWLVFNEKIKVNSVFLRDSTGVSDSVLLLFGGNISRGGLDGHLKMLGGYLEFFMKPELADTYLSLKREIEELTQQKLLNPELGIEVQNELLLAVRLLVSEDRCEGRFVFGRQIPAPSKKSAKVALPEMVSKGGMVSKGGGDNPKTDLQTVLARAGHGAPAYKTKQLKNNQFRSTVIFNGLNFVGQPCGNKKLAEKDAAAEALLWLRGDRHSSARDLDHVSMLLKRKNRSKKRT
cccEEEEEEccccEEEEEcccccccccccccccccccccHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccHHHHHHccccccccccccccccHHHcccccccccccccccHHHHHHHHHHHHHcccccEEEEEcccccHHHHHHHHHHHHHccccccccccEEEEEEccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHccccHHHHHHHHHHHHcccEEEEEccccccccccccHHHHHcHHHHcccccEEEEEEccHHHHHHHHHHHHHHHHccccccccEEEEEcccccccccEEEEEccHHHHHHHcccccccccccccccccccccccHHHHHHHHHHHcccccccEEEEEEccccHHHHHHHcccccEEEEcccccccEEEEHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHccccccccccHHHHHHHHHHHHHccccccEEEEcccHHHHHHHHHHHHccccccccccEEEEEcccccccHHHHHHccccccccEEEEEEEcccccccccccEEEEEEcccccEEEEcccccccccccEEccccHHHHHcccccccccccEEEcccHHHHHHccccccccEEEccHHHHHHHHHHcccccHHHHHHcccccccHHHHHHHHHHHHHccccccccccccHHHHHcccccccccHHHHHHHHHccccHHHHHHHHHcccccccccccccHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHcccHHHHHHHccccHHHHHHHHHHHHHHHHHHHHcccccccccccccccccHHHHHHHHHHHcccccEEEcccccccEEEEcccccEEEcccccccccccccccEEEEEEEEEcccEEEEccccccHHHHHHHcccEEcccccccEEEEccEEEEEEcHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHccccccccccccccccccccccccccccHHcccccccccccccccccHHHHHHHcccccccccccccccccccEEEEEEccccccccccccHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHccccccccc
ccEEEEEEEcccHHHEEEccccccccccccHcccccccEHHHEHHHHHHHHHHHHHccccccccccEEEEEEEccccccccccccccccccHHHHHHHccccHHHHHccccccccccHccHHHHHHHHHHccccHHHHHHHHHHHcccccEEEEEcccccccHHHHHHHHHHHHHHHcccccEEEEEccccccccccHHHHccccEEEccHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccHHccccccHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHccHHHHHHHHHHHHHcccEEEEEEcccccccccccHHHHHHHHcccccccEEEEEccHHHHHHHHHHHHHHHHHcccccccEEEEEEEccccccccEEEEEccHHHHHHHHccccccccEEEEEEcHHHccccHHHHHHHHHHHHHHccccEEEEEEEEccHHHHHHHHccccEEEEccccccHHHHHHHHHHHHHcccccccHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHcccccccHHHHHHHHHcccccccHHHHHHHHHHHHcccccccEEEEEccHHHHHHHHHHHHHccccccccEEEEEEccccccHHHHHHHHcccccccEEEEEEEccEEEEEEEccEEEEEccccEEEEccccccccccccccHHHHHHHHHHccccccccccEEEEEccHHHHHHHHcccccHHHcccHHHHHHHHHHcccccHHHHHHHHcccccHHHHHHHHHHHHHHccccccccccHHHHHHHcccccHHHHHHHHHHHHHcccHHHHHHHHHHcccccccccccHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHccccHHHHHHHcccHHHHHHHHHHHHHHHHHHHHcccccccccccccccccHHHHHHHHHHccccccEEEcccccEEEEEEccccEEEEcccccccccccccccEEEEEEEEEEcEEEEEccccccccEEEEEcccEEEEccccEEEEEccEEEEEccHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHccccccccEEEcccccccccccccccccccccccccccccccccHHHHHHHHHHHcccccccEcEEEcccccEEEEEEEccccEcccccHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHcccccccccc
MPFSFIFIrsgttmtmalrptslnfyrapkallkpsplsllVVKNQAVAFRLLHHYhyhlpfhlsrRRHAVvtcsgavtrtrrldwkavsyplleqqtsnygryayqdessddsdrefgstqqqmcgstldNIDEWRWKLTMLLRNKDEQEVVSRAKKDRRDFEQLSALATRMGLHSRQYAKVVVFskaplpnyrsdldekrpqrevilpfglLREVDAHLKAYLSQKYINASMSSlsnvgsttndegLYEQQEQLVQNSVVRERILRQRSLQMHEKQQAwqespegqkmLEFRRSLPSYKERDALLKAISENQVVVVSgetgcgkttqlpqYILESETEAARGAACSIictqprriSAMAVSERVAAERGEKLGESVGYKVRlegmkgrdtrlMFCTTGILLRRLLVDRSLRGVTHVIVDEIHERGMNEDFLLIVLKELLPRRPELRLILMSATLNAELFssyfggapmlhipgftypVRAYFLENILEMTRYRLNTYnqiddygqeKSWKMQKQALALRKRKSSIASAVEDALEAADFREYSVQTQqslscwnpdsigfNLIEHVLCHivkkerpgAVLVFMTGWDDINSLKDqlqahpllgdpsRVLLLACHgsmasseqrlifdkpedgVRKIVLATNmaetsitiNDVVFVIDCGKaketsydalnntpcllpsWISKAAARQRrgragrvqpgecyhlypryvydafadyqlpellrtPLQSLCLQIKSLQLGSISEFLsralqppeplsvKNAIEYLQIIGaldenenltvlgrnlsmlpvepklGKMLILGAIFNCLDPVMTVVAglsvrdpflmpfdkkDLAESAKAQFSARDYSDHLALVRAYDgwkdaerhqsgYEYCWKNFLSAQTLKAIDSLRKQFLFLLKDaglvdrntencnkwshdeHLIRAVICAglfpglcsVVNKEKSIALKTMEDGQVLLYsnsvnagvpkipypwlvfnekikvnsvflrdstgvsdsVLLLFGgnisrggldgHLKMLGGYLEffmkpelaDTYLSLKREIEELTQqkllnpelgiEVQNELLLAVRLLVSedrcegrfvfgrqipapskksakVALPemvskggmvskgggdnpktdLQTVLARaghgapayktkqlknnqFRSTVIFNglnfvgqpcgnkklAEKDAAAEALLWLRgdrhssardLDHVSMLLKRknrskkrt
MPFSFIFirsgttmtmalrPTSLNFYRAPKALLKPSPLSLLVVKNQAVAFRLLHHYHYHLpfhlsrrrhAVVTCSgavtrtrrldwkavsyplleqqtsnygRYAYQDESSDDSDREFGSTQQQMCGSTLDNIDEWRWKLTMllrnkdeqevvsrakkdrrdFEQLSALAtrmglhsrqyAKVVVFSKAPlpnyrsdldekrpqREVILPFGLLREVDAHLKAYLSQKYINASMSSLSNVGSTTNDEGLYEQQEQLVQNSVVRERILRQRSLQMHEKqqawqespegqkmLEFRRSLPSYKERDALLKAISENQVVVVSgetgcgkttQLPQYILESETEAARGAACSIICTQPRRISAMAVSERVAaergeklgesvgykvrlegmkgrdtrlMFCTTGILLrrllvdrslrGVTHVIvdeihergmneDFLLIVLKELLPRRPELRLILMSATLNAELFSSYFGGAPMLHIPGFTYPVRAYFLENILEMTRYRLNTYNQIDDYGQEKSWKMQKQALALRKRKSSIASAVEDALEAADFREYSVQTQQSLSCWNPDSIGFNLIEHVLCHIVKKERPGAVLVFMTGWDDINSLKDQLQAHPLLGDPSRVLLLACHGSMASseqrlifdkpedGVRKIVLAtnmaetsitindVVFVIDCGKAKETSYDAlnntpcllpsWISKAAARQRrgragrvqpgecyHLYPRYVYDAFADYQLPELLRTPLQSLCLQIKSLQLGSISEFLSRALQPPEPLSVKNAIEYLQIIGALDENENLTVLGRNLSMLPVEPKLGKMLILGAIFNCLDPVMTVVAGLSVRDPFLMPFDKKDLAESAKAqfsardysdHLALVRAYDGWKDAERHQSGYEYCWKNFLSAQTLKAIDSLRKQFLFLLKDAGLVDRNTENCNKWSHDEHLIRAVICAGLFPGLCSVVNKEKSIALKTMEDGQVLLYSNSVNAGVPKIPYPWLVFNEKIKVNSVFLRDSTGVSDSVLLLFGGNISRGGLDGHLKMLGGYLEFFMKPELADTYLSLKREIEELTQqkllnpelgIEVQNELLLAVRLLVSEDRCEGRfvfgrqipapskksakvALPEMVSKGgmvskgggdnPKTDLQTVLARAGHGapayktkqlknNQFRSTVIFNGLNFVGQPCGNKKLAEKDAAAEALLWLRgdrhssardldhvsmllkrknrskkrt
MPFSFIFIRSGTTMTMALRPTSLNFYRapkallkpsplsllvvkNQAVAFRllhhyhyhlpfhlSRRRHAVVTCSGAVTRTRRLDWKAVSYPLLEQQTSNYGRYAYQDESSDDSDREFGSTQQQMCGSTLDNIDEWRWKLTMLLRNKDEQEVVSRAKKDRRDFEQLSALATRMGLHSRQYAKVVVFSKAPLPNYRSDLDEKRPQREVILPFGLLREVDAHLKAYLSQKYINASMSSLSNVGSTTNDEGLYEQQEQLVQNSVVRERILRQRSLQMHEKQQAWQESPEGQKMLEFRRSLPSYKERDALLKAISENQVVVVSGETGCGKTTQLPQYILESETEAARGAACSIICTQPRRISAMAVSERVAAERGEKLGESVGYKVRLEGMKGRDTRLMFCTTGIllrrllvdrslrGVTHVIVDEIHERGMNEDFLLIVlkellprrpelrlilMSATLNAELFSSYFGGAPMLHIPGFTYPVRAYFLENILEMTRYRLNTYNQIDDYGQEKSWKMQKQALALRKRKSSIASAVEDALEAADFREYSVQTQQSLSCWNPDSIGFNLIEHVLCHIVKKERPGAVLVFMTGWDDINSLKDQLQAHPLLGDPSRVLLLACHGSMASSEQRLIFDKPEDGVRKIVLATNMAETSITINDVVFVIDCGKAKETSYDALNNTPCLLPSWISKaaarqrrgragrVQPGECYHLYPRYVYDAFADYQLPELLRTPLQSLCLQIKSLQLGSISEFLSRALQPPEPLSVKNAIEYLQIIGALDENENLTVLGRNLSMLPVEPKLGKMLILGAIFNCLDPVMTVVAGLSVRDPFLMPFDKKDLAESAKAQFSARDYSDHLALVRAYDGWKDAERHQSGYEYCWKNFLSAQTLKAIDSLRKQFLFLLKDAGLVDRNTENCNKWSHDEHLIRAVICAGLFPGLCSVVNKEKSIALKTMEDGQVLLYSNSVNAGVPKIPYPWLVFNEKIKVNSVFLRDSTGVSDSVLLLFGGNISRGGLDGHLKMLGGYLEFFMKPELADTYLSLKREIEELTQQKLLNPELGIEVQNELLLAVRLLVSEDRCEGRFVFGRQIPAPSKKSAKVALPEmvskggmvskgggDNPKTDLQTVLARAGHGAPAYKTKQLKNNQFRSTVIFNGLNFVGQPCGNkklaekdaaaeallWLRGDRHSSARDLDHVSMLLKRKNRSKKRT
***SFIFIRSGTTMTMALRPTSLNFYRAPKALLKPSPLSLLVVKNQAVAFRLLHHYHYHLPFHLSRRRHAVVTCSGAVTRTRRLDWKAVSYPLLEQQTSNYGRYA********************CGSTLDNIDEWRWKLTMLLR**********************ALATRMGLHSRQYAKVVVFSKAPLP************REVILPFGLLREVDAHLKAYLSQKYINA************************************************************************ALLKAISENQVVVVSGETGCGKTTQLPQYILESETEAARGAACSIICTQPRRISAMAVSERV*******LGESVGYKVRLEGMKGRDTRLMFCTTGILLRRLLVDRSLRGVTHVIVDEIHERGMNEDFLLIVLKELLPRRPELRLILMSATLNAELFSSYFGGAPMLHIPGFTYPVRAYFLENILEMTRYRLNTYNQIDDYGQEKSWK*********************ALEAADFREYSVQTQQSLSCWNPDSIGFNLIEHVLCHIVKKERPGAVLVFMTGWDDINSLKDQLQAHPLLGDPSRVLLLACHGSMASSEQRLIFDKPEDGVRKIVLATNMAETSITINDVVFVIDCGKAKETSYDALNNTPCLLPSWISKAAARQRRGRAGRVQPGECYHLYPRYVYDAFADYQLPELLRTPLQSLCLQIKSLQLGSISEFLSRALQPPEPLSVKNAIEYLQIIGALDENENLTVLGRNLSMLPVEPKLGKMLILGAIFNCLDPVMTVVAGLSVRDPFLMPFDKKDLAE*AKAQFSARDYSDHLALVRAYDGWKDAERHQSGYEYCWKNFLSAQTLKAIDSLRKQFLFLLKDAGLVDRNTENCNKWSHDEHLIRAVICAGLFPGLCSVVNKEKSIALKTMEDGQVLLYSNSVNAGVPKIPYPWLVFNEKIKVNSVFLRDSTGVSDSVLLLFGGNISRGGLDGHLKMLGGYLEFFMKPELADTYLSLKREIEELTQQKLLNPELGIEVQNELLLAVRLLVSEDRCEGRFVFGRQI**********************************************AYKTKQLKNNQFRSTVIFNGLNFVGQPCGNKKLAEKDAAAEALLWLRG**************************
*PFSFIFIRSGTTMTMALRP*************KPSPLSL*V*********************LSRR*********************VSY*****************************************IDEWRWKLTMLLRNKDEQEVVSRAKKDRRDFEQLSALATRMGLHSRQYAKVVVFSKAPLPNYRSDLDEKRP*******FGLLREVDAH**************************************************************************RSLPSYKERDALLKAISENQVVVVSGETGCGKTTQLPQYILESETEAARGAACSIICTQPRRISAMAVSERVAAERGEKLGESVGYKVRLEGMKGRDTRLMFCTTGILLRRLLVDRSLRGVTHVIVDEIHERGMNEDFLLIVLKELLPRRPELRLILMSATLNAELFSSYFGGAPMLHIPGFTYPVRAYFLENILEMTRYRLNTYNQIDDY********************SIASAVEDAL****************SCWNPDSIGFNLIEHVLCHIVKKERPGAVLVFMTGWDDINSLKDQLQA****GDPSRVLLLACHGSMASSEQRLIFDKPEDGVRKIVLATNMAETSITINDVVFVIDCGKAKETSYDALNNTPCLLPSWISKAAARQRRGRAGRVQPGECYHLYPRYVYDAFADYQLPELLRTPLQSLCLQIKSLQLGSISEFLSRALQPPEPLSVKNAIEYLQIIGALDENENLTVLGRNLSMLPVEPKLGKMLILGAIFNCLDPVMTVVAGLSVRDPFLM***************SARDYSDHLALVRAYDGWKDAERHQSGYEYCWKNFLSAQTLKAIDSLRKQFLFLLKDAGLVDRNT****KWSHDEHLIRAVICAGLFPGLCSVVNKEKSIALKTMEDGQVLLYSNSVNAGVPKIPYPWLVFNEKIKVNSVFLRDSTGVSDSVLLLFGGNISRGGLDGHLKMLGGYLEFFMKPELADTYLSLKREIEELTQQKLLN********NELLLAVRLLVSEDRC********************************************************************RSTVIFNGLNFV**************AAEALLWLR***************************
MPFSFIFIRSGTTMTMALRPTSLNFYRAPKALLKPSPLSLLVVKNQAVAFRLLHHYHYHLPFHLSRRRHAVVTCSGAVTRTRRLDWKAVSYPLLEQQTSNYGRYA********************CGSTLDNIDEWRWKLTMLLRNK*************RDFEQLSALATRMGLHSRQYAKVVVFSKAPLPNYRSDLDEKRPQREVILPFGLLREVDAHLKAYLSQKYINASMSSLSNVGSTTNDEGLYEQQEQLVQNSVVRERILRQRS**************EGQKMLEFRRSLPSYKERDALLKAISENQVVVVSGETGCGKTTQLPQYILESETEAARGAACSIICTQPRRISAMAVSERVAAERGEKLGESVGYKVRLEGMKGRDTRLMFCTTGILLRRLLVDRSLRGVTHVIVDEIHERGMNEDFLLIVLKELLPRRPELRLILMSATLNAELFSSYFGGAPMLHIPGFTYPVRAYFLENILEMTRYRLNTYNQIDDYGQEKSWKMQK*************SAVEDALEAADFREYSVQTQQSLSCWNPDSIGFNLIEHVLCHIVKKERPGAVLVFMTGWDDINSLKDQLQAHPLLGDPSRVLLLACHGSMASSEQRLIFDKPEDGVRKIVLATNMAETSITINDVVFVIDCGKAKETSYDALNNTPCLLPSWISKA***********VQPGECYHLYPRYVYDAFADYQLPELLRTPLQSLCLQIKSLQLGSISEFLSRALQPPEPLSVKNAIEYLQIIGALDENENLTVLGRNLSMLPVEPKLGKMLILGAIFNCLDPVMTVVAGLSVRDPFLMPFDKKDLAESAKAQFSARDYSDHLALVRAYDGWKDAERHQSGYEYCWKNFLSAQTLKAIDSLRKQFLFLLKDAGLVDRNTENCNKWSHDEHLIRAVICAGLFPGLCSVVNKEKSIALKTMEDGQVLLYSNSVNAGVPKIPYPWLVFNEKIKVNSVFLRDSTGVSDSVLLLFGGNISRGGLDGHLKMLGGYLEFFMKPELADTYLSLKREIEELTQQKLLNPELGIEVQNELLLAVRLLVSEDRCEGRFVFGRQIPA********ALPEMVSKGGMVSKGGGDNPKTDLQTVLARAGHGAPAYKTKQLKNNQFRSTVIFNGLNFVGQPCGNKKLAEKDAAAEALLWLRGDRHSSARDLDHVSMLLK*********
MPFSFIFIRSGTTMTMALRPTSLNFYRAPKALLKPSPLSLLVVKNQAVAFRLLHHYHYHLPFHLSRRRHAVVTCSGAVTRTRRLDWKAVSYPLLEQQTSNYGRYAYQDE*********GSTQQQMCGSTLDNIDEWRWKLTMLLRNKDEQEVVSRAKKDRRDFEQLSALATRMGLHSRQYAKVVVFSKAPLPNYRSDLDEKRPQREVILPFGLLREVDAHLKAYLSQKYIN***********************QLVQNSVVRERILRQRSLQMHEKQQAWQESPEGQKMLEFRRSLPSYKERDALLKAISENQVVVVSGETGCGKTTQLPQYILESETEAARGAACSIICTQPRRISAMAVSERVAAERGEKLGESVGYKVRLEGMKGRDTRLMFCTTGILLRRLLVDRSLRGVTHVIVDEIHERGMNEDFLLIVLKELLPRRPELRLILMSATLNAELFSSYFGGAPMLHIPGFTYPVRAYFLENILEMTRYRLNTYNQIDDYGQE******KQALA**KRKSSIASAVEDALEAADFREYSVQTQQSLSCWNPDSIGFNLIEHVLCHIVKKERPGAVLVFMTGWDDINSLKDQLQAHPLLGDPSRVLLLACHGSMASSEQRLIFDKPEDGVRKIVLATNMAETSITINDVVFVIDCGKAKETSYDALNNTPCLLPSWISKAAARQRRGRAGRVQPGECYHLYPRYVYDAFADYQLPELLRTPLQSLCLQIKSLQLGSISEFLSRALQPPEPLSVKNAIEYLQIIGALDENENLTVLGRNLSMLPVEPKLGKMLILGAIFNCLDPVMTVVAGLSVRDPFLMPFDKKDLAESAKAQFSARDYSDHLALVRAYDGWKDAERHQSGYEYCWKNFLSAQTLKAIDSLRKQFLFLLKDAGLVDRNTENCNKWSHDEHLIRAVICAGLFPGLCSVVNKEKSIALKTMEDGQVLLYSNSVNAGVPKIPYPWLVFNEKIKVNSVFLRDSTGVSDSVLLLFGGNISRGGLDGHLKMLGGYLEFFMKPELADTYLSLKREIEELTQQKLLNPELGIEVQNELLLAVRLLVSEDRCEGRFVFGRQ***************************GDNPKTDLQTVLARAGHGAPAYKTKQLKNNQFRSTVIFNGLNFVGQPCGNKKLAEKDAAAEALLWLRGDRHSSARDLD**SMLLK*********
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPFSFIFIRSGTTMTMALRPTSLNFYRAPKALLKPSPLSLLVVKNQAVAFRLLHHYHYHLPFHLSRRRHAVVTCSGAVTRTRRLDWKAVSYPLLEQQTSNYGRYAYQDESSDDSDREFGSTQQQMCGSTLDNIDEWRWKLTMLLRNKDEQEVVSRAKKDRRDFEQLSALATRMGLHSRQYAKVVVFSKAPLPNYRSDLDEKRPQREVILPFGLLREVDAHLKAYLSQKYINASMSSLSNVGSTTNDEGLYEQQEQLVQNSVVRERILRQRSLQMHEKQQAWQESPEGQKMLEFRRSLPSYKERDALLKAISENQVVVVSGETGCGKTTQLPQYILESETEAARGAACSIICTQPRRISAMAVSERVAAERGEKLGESVGYKVRLEGMKGRDTRLMFCTTGILLRRLLVDRSLRGVTHVIVDEIHERGMNEDFLLIVLKELLPRRPELRLILMSATLNAELFSSYFGGAPMLHIPGFTYPVRAYFLENILEMTRYRLNTYNQIDDYGQEKSWKMQKQALALRKRKSSIASAVEDALEAADFREYSVQTQQSLSCWNPDSIGFNLIEHVLCHIVKKERPGAVLVFMTGWDDINSLKDQLQAHPLLGDPSRVLLLACHGSMASSEQRLIFDKPEDGVRKIVLATNMAETSITINDVVFVIDCGKAKETSYDALNNTPCLLPSWISKAAARQRRGRAGRVQPGECYHLYPRYVYDAFADYQLPELLRTPLQSLCLQIKSLQLGSISEFLSRALQPPEPLSVKNAIEYLQIIGALDENENLTVLGRNLSMLPVEPKLGKMLILGAIFNCLDPVMTVVAGLSVRDPFLMPFDKKDLAESAKAQFSARDYSDHLALVRAYDGWKDAERHQSGYEYCWKNFLSAQTLKAIDSLRKQFLFLLKDAGLVDRNTENCNKWSHDEHLIRAVICAGLFPGLCSVVNKEKSIALKTMEDGQVLLYSNSVNAGVPKIPYPWLVFNEKIKVNSVFLRDSTGVSDSVLLLFGGNISRGGLDGHLKMLGGYLEFFMxxxxxxxxxxxxxxxxxxxxxKLLNPELGIEVQNELLLAVRLLVSEDRCEGRFVFGRQIPAPSKKSAKVALPEMVSKGGMVSKGGGDNPKTDLQTVLARAGHGAPAYKTKQLKNNQFRSTVIFNGLNFVGQPCGNKKLAEKDAAAEALLWLRGDRHSSARDLDHVSMLLKRKNRSKKRT
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query1197 2.2.26 [Sep-21-2011]
Q8VHK91001 Probable ATP-dependent RN yes no 0.640 0.766 0.432 0.0
Q9H2U11008 Probable ATP-dependent RN yes no 0.628 0.746 0.438 1e-179
Q6P1581386 Putative ATP-dependent RN no no 0.635 0.549 0.395 1e-163
Q6P5D31388 Putative ATP-dependent RN no no 0.639 0.551 0.399 1e-162
Q7Z4781369 ATP-dependent RNA helicas no no 0.647 0.566 0.384 1e-150
Q6PGC11365 ATP-dependent RNA helicas no no 0.650 0.570 0.386 1e-150
A3KMI01362 ATP-dependent RNA helicas N/A no 0.644 0.566 0.378 1e-147
P247851293 Dosage compensation regul no no 0.626 0.580 0.393 1e-142
Q7L2E31194 Putative ATP-dependent RN no no 0.550 0.551 0.404 1e-141
Q5R6071194 Putative ATP-dependent RN no no 0.550 0.551 0.404 1e-141
>sp|Q8VHK9|DHX36_MOUSE Probable ATP-dependent RNA helicase DHX36 OS=Mus musculus GN=Dhx36 PE=2 SV=2 Back     alignment and function desciption
 Score =  641 bits (1654), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 343/793 (43%), Positives = 496/793 (62%), Gaps = 26/793 (3%)

Query: 271  SLQMH--EKQQAWQESPEGQKMLEFRRSLPSYKERDALLKAISENQVVVVSGETGCGKTT 328
            SL  H  E  Q  +  P   +M  FR+ LPSY  +  L+  I+ +QV V+SGETGCGKTT
Sbjct: 172  SLDQHLLEDLQRKKTDPRYIEMQRFRKKLPSYGMQKELVNLINNHQVTVISGETGCGKTT 231

Query: 329  QLPQYILESETEAARGAACSIICTQPRRISAMAVSERVAAERGEKLGE--SVGYKVRLEG 386
            Q+ Q+IL++  E  +G+AC I+CTQPRRISA++V+ERVA ER E  G   S GY++RL+ 
Sbjct: 232  QVTQFILDNYIERGKGSACRIVCTQPRRISAISVAERVATERAESCGNGNSTGYQIRLQS 291

Query: 387  -MKGRDTRLMFCTTGILLRRLLVDRSLRGVTHVIVDEIHERGMNEDFLLIVLKELLPRRP 445
             +  +   +++CTTGI+L+ L  D  L  V+H+++DEIHER +  D L+ V+K+LL  R 
Sbjct: 292  RLPRKQGSILYCTTGIILQWLQSDSRLSSVSHIVLDEIHERNLQSDVLMTVIKDLLHFRS 351

Query: 446  ELRLILMSATLNAELFSSYFGGAPMLHIPGFTYPVRAYFLENILEMTRYRLNTYNQIDDY 505
            +L++ILMSATLNAE FS YFG  PM+HIPGFT+PV  Y LE+I+E  RY     +Q +  
Sbjct: 352  DLKVILMSATLNAEKFSEYFGNCPMIHIPGFTFPVVEYLLEDIIEKIRY---VPDQKEHR 408

Query: 506  GQEKSWKMQKQALALRKRKSSIASAVEDALEAADFRE----YSVQTQQSLSCWNPDSIGF 561
             Q K   MQ     + +++     A+      A  +E    YS  T   L   + D +  
Sbjct: 409  SQFKRGFMQGH---VNRQEKEEKEAIYKERWPAYIKELRTRYSASTVDVLQMMDDDKVDL 465

Query: 562  NLIEHVLCHIVKKERPGAVLVFMTGWDDINSLKDQLQAHPLLGDPSRVLLLACHGSMASS 621
            NLI  ++ +IV +E  GA+LVF+ GWD+I++L D L +  +     + L++  H  M + 
Sbjct: 466  NLIAALIRYIVLEEEDGAILVFLPGWDNISTLHDLLMSQVMFKS-DKFLIIPLHSLMPTV 524

Query: 622  EQRLIFDKPEDGVRKIVLATNMAETSITINDVVFVIDCGKAKETSYDALNNTPCLLPSWI 681
             Q  +F K   GVRKIV+ATN+AETSITI+DVV+VID GK KET +D  NN   +   W+
Sbjct: 525  NQTQVFKKTPPGVRKIVIATNIAETSITIDDVVYVIDGGKIKETHFDTQNNISTMSAEWV 584

Query: 682  SKAAARQRRGRAGRVQPGECYHLYPRYVYDAFADYQLPELLRTPLQSLCLQIKSLQLGSI 741
            SKA A+QR+GRAGRVQPG CYHLY         DYQLPE+LRTPL+ LCLQIK L+LG I
Sbjct: 585  SKANAKQRKGRAGRVQPGHCYHLYNGLRASLLDDYQLPEILRTPLEELCLQIKILRLGGI 644

Query: 742  SEFLSRALQPPEPLSVKNAIEYLQIIGALDENENLTVLGRNLSMLPVEPKLGKMLILGAI 801
            + FLSR + PP   +V  +I++L  + ALD+ E LT LG +L+ LPVEP +GKM++ GA+
Sbjct: 645  AYFLSRLMDPPSNEAVVLSIKHLMELSALDKQEELTPLGVHLARLPVEPHIGKMILFGAL 704

Query: 802  FNCLDPVMTVVAGLSVRDPFLMPFDKKDLAESAKAQFSARDYSDHLALVRAYDGWKDAER 861
            F CLDPV+T+ A LS +DPF++P  K+ +A++ + + +    SDHL +V A++GW++A+R
Sbjct: 705  FCCLDPVLTIAASLSFKDPFVIPLGKEKIADARRKELAKETRSDHLTVVNAFEGWEEAKR 764

Query: 862  HQSGYE--YCWKNFLSAQTLKAIDSLRKQFLFLLKDAGLVDRNT---ENCNKWSHDEHLI 916
                YE  YCW+ FLS+ TL+ + +++ QF   L  AG V   +      N  S +E +I
Sbjct: 765  RGFRYEKDYCWEYFLSSNTLQMLHNMKGQFAEHLLGAGFVSSRSPKDPKANINSDNEKII 824

Query: 917  RAVICAGLFPGLCSVV----NKEKSIALKTMEDGQVLLYSNSVNAGVPKIPYPWLVFNEK 972
            +AVICAGL+P +  +      K K + + T  DG V ++  SVN       Y WL+++ K
Sbjct: 825  KAVICAGLYPKVAKIRLNLGKKRKMVKVHTKSDGLVSIHPKSVNVEQTDFHYNWLIYHLK 884

Query: 973  IKVNSVFLRDSTGVSDSVLLLFGGNIS-RGGLDGHLKMLGGYLEFFMKPELADTYLSLKR 1031
            ++ +S++L D T VS   LL FGG+IS +   D  +  +  ++ F     +A     L++
Sbjct: 885  MRTSSIYLYDCTEVSPYCLLFFGGDISIQKDKDQEIIAVDEWIVFQSPERIAHLVKGLRK 944

Query: 1032 EIEELTQQKLLNP 1044
            E++ L Q+K+ +P
Sbjct: 945  ELDSLLQEKIESP 957
Plays a role in degradation and deadenylation of mRNAs containing in their 3'-UTR the consensus ARE sequence element. May function in sex development and spermatogenesis.
Mus musculus (taxid: 10090)
EC: 3EC: .EC: 6EC: .EC: 4EC: .EC: 1EC: 3
>sp|Q9H2U1|DHX36_HUMAN Probable ATP-dependent RNA helicase DHX36 OS=Homo sapiens GN=DHX36 PE=1 SV=2 Back     alignment and function description
>sp|Q6P158|DHX57_HUMAN Putative ATP-dependent RNA helicase DHX57 OS=Homo sapiens GN=DHX57 PE=1 SV=2 Back     alignment and function description
>sp|Q6P5D3|DHX57_MOUSE Putative ATP-dependent RNA helicase DHX57 OS=Mus musculus GN=Dhx57 PE=2 SV=2 Back     alignment and function description
>sp|Q7Z478|DHX29_HUMAN ATP-dependent RNA helicase DHX29 OS=Homo sapiens GN=DHX29 PE=1 SV=2 Back     alignment and function description
>sp|Q6PGC1|DHX29_MOUSE ATP-dependent RNA helicase Dhx29 OS=Mus musculus GN=Dhx29 PE=2 SV=1 Back     alignment and function description
>sp|A3KMI0|DHX29_XENLA ATP-dependent RNA helicase DHX29 OS=Xenopus laevis GN=dhx29 PE=2 SV=1 Back     alignment and function description
>sp|P24785|MLE_DROME Dosage compensation regulator OS=Drosophila melanogaster GN=mle PE=2 SV=2 Back     alignment and function description
>sp|Q7L2E3|DHX30_HUMAN Putative ATP-dependent RNA helicase DHX30 OS=Homo sapiens GN=DHX30 PE=1 SV=1 Back     alignment and function description
>sp|Q5R607|DHX30_PONAB Putative ATP-dependent RNA helicase DHX30 OS=Pongo abelii GN=DHX30 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1197
3594914761178 PREDICTED: probable ATP-dependent RNA he 0.959 0.974 0.797 0.0
4494975951231 PREDICTED: probable ATP-dependent RNA he 0.983 0.956 0.749 0.0
4494395511168 PREDICTED: probable ATP-dependent RNA he 0.919 0.942 0.796 0.0
2977342691057 unnamed protein product [Vitis vinifera] 0.868 0.982 0.837 0.0
2978524841197 helicase domain-containing protein [Arab 0.968 0.968 0.742 0.0
3565278701177 PREDICTED: probable ATP-dependent RNA he 0.955 0.971 0.752 0.0
306943791197 DEA(D/H)-box RNA helicase family protein 0.967 0.967 0.741 0.0
3565112711180 PREDICTED: probable ATP-dependent RNA he 0.933 0.946 0.779 0.0
2384787991206 DEA(D/H)-box RNA helicase family protein 0.969 0.962 0.737 0.0
3575215271214 ATP-dependent RNA helicase A-like protei 0.912 0.899 0.748 0.0
>gi|359491476|ref|XP_002277625.2| PREDICTED: probable ATP-dependent RNA helicase DHX36-like [Vitis vinifera] Back     alignment and taxonomy information
 Score = 1865 bits (4832), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 935/1172 (79%), Positives = 1016/1172 (86%), Gaps = 24/1172 (2%)

Query: 33   LKPSPLSLLV--VKNQAVAFR--LLHHYHYHLPFHLSRRRHAVVTCS---GAVTRTRRLD 85
            LKP PL   +         FR  L      H+    S    +VV CS   GA  R+  LD
Sbjct: 3    LKPVPLQFHIRPYHKTPKMFRPLLFTPMRAHVSAGGSLYLRSVVACSASSGACARSLELD 62

Query: 86   WKA--VSYPLLEQQTSNYGRYAYQDESSDDSDREFGSTQQQ-MCGSTLDNIDEWRWKLTM 142
            W+   V+ P L  Q S YGR+AY D S  DSDRE  S QQQ M  ST +NIDEW+WKLTM
Sbjct: 63   WRQRNVALPYLFHQNSRYGRFAYDDFSEYDSDREVESAQQQQMRASTHENIDEWKWKLTM 122

Query: 143  LLRNKDEQEVVSRAKKDRRDFEQLSALATRMGLHSRQYAKVVVFSKAPLPNYRSDLDEKR 202
            L+RNKDEQEVVS  KKDRRDFEQ+SALATRMGL+S QY++VVVFSK PLPNYRSDLD+KR
Sbjct: 123  LIRNKDEQEVVSTEKKDRRDFEQISALATRMGLYSCQYSRVVVFSKVPLPNYRSDLDDKR 182

Query: 203  PQREVILPFGLLREVDAHLKAYLSQKYINA---SMSSLS-NVG-STTNDEGLYEQQEQLV 257
            PQREV+LPFGL REV AHLK YLSQK ++    S  +LS ++G S+  +EG YEQQE L 
Sbjct: 183  PQREVVLPFGLQREVHAHLKEYLSQKSMSRESFSDKTLSRSIGNSSVTEEGFYEQQEPLT 242

Query: 258  QNSVVRERILRQRSLQMHEKQQAWQESPEGQKMLEFRRSLPSYKERDALLKAISENQVVV 317
            Q SVV ERIL+++SLQ+  +QQ WQES EGQKM EFRRSLP+YKER+ALL AIS+NQVVV
Sbjct: 243  QTSVVMERILKRKSLQIRNQQQDWQESSEGQKMQEFRRSLPAYKEREALLNAISQNQVVV 302

Query: 318  VSGETGCGKTTQLPQYILESETEAARGAACSIICTQPRRISAMAVSERVAAERGEKLGES 377
            VSGETGCGKTTQLPQYILESE EAARGA CSIICTQPRRISAM+VSERVAAERGEKLGES
Sbjct: 303  VSGETGCGKTTQLPQYILESEIEAARGAFCSIICTQPRRISAMSVSERVAAERGEKLGES 362

Query: 378  VGYKVRLEGMKGRDTRLMFCTTGILLRRLLVDRSLRGVTHVIVDEIHERGMNEDFLLIVL 437
            VGYKVRLEGMKGRDTRL+FCTTGILLRRLLVDR+L+GVTHVIVDEIHERGMNEDFLLIVL
Sbjct: 363  VGYKVRLEGMKGRDTRLLFCTTGILLRRLLVDRNLKGVTHVIVDEIHERGMNEDFLLIVL 422

Query: 438  KELLPRRPELRLILMSATLNAELFSSYFGGAPMLHIPGFTYPVRAYFLENILEMTRYRLN 497
            K+LLPRRPELRLILMSATLNAELFSSYFGGAP +HIPGFTYPVR +FLENILEMT YRL 
Sbjct: 423  KDLLPRRPELRLILMSATLNAELFSSYFGGAPSIHIPGFTYPVRTHFLENILEMTGYRLT 482

Query: 498  TYNQIDDYGQEKSWKMQKQALALRKRKSSIASAVEDALEAADFREYSVQTQQSLSCWNPD 557
             YNQIDDYGQEK WKMQKQAL  RKRKS IAS+VEDALE A+F  YS +TQ SLSCWNPD
Sbjct: 483  PYNQIDDYGQEKVWKMQKQAL--RKRKSQIASSVEDALEVANFDAYSPRTQDSLSCWNPD 540

Query: 558  SIGFNLIEHVLCHIVKKERPGAVLVFMTGWDDINSLKDQLQAHPLLGDPSRVLLLACHGS 617
            SIGFNLIEH LCHIVKKERPGAVLVFMTGWDDINSLKDQL+AHPLLGDPSRVLLLACHGS
Sbjct: 541  SIGFNLIEHALCHIVKKERPGAVLVFMTGWDDINSLKDQLEAHPLLGDPSRVLLLACHGS 600

Query: 618  MASSEQRLIFDKPEDGVRKIVLATNMAETSITINDVVFVIDCGKAKETSYDALNNTPCLL 677
            MASSEQRLIFDKPEDGVRKIVLATNMAETSITINDVVFV+DCGKAKETSYDALNNTPCLL
Sbjct: 601  MASSEQRLIFDKPEDGVRKIVLATNMAETSITINDVVFVVDCGKAKETSYDALNNTPCLL 660

Query: 678  PSWISKAAARQRRGRAGRVQPGECYHLYPRYVYDAFADYQLPELLRTPLQSLCLQIKSLQ 737
            PSWISKA+ARQRRGRAGRVQPGECYHLYP+ VYDAF+DYQLPELLRTPLQSLCLQIKSLQ
Sbjct: 661  PSWISKASARQRRGRAGRVQPGECYHLYPKCVYDAFSDYQLPELLRTPLQSLCLQIKSLQ 720

Query: 738  LGSISEFLSRALQPPEPLSVKNAIEYLQIIGALDENENLTVLGRNLSMLPVEPKLGKMLI 797
            LGSISEFL+RALQPPEPLSV+NAIEYL+ IGALDENENLTVLGRNLSMLPVEPKLGKMLI
Sbjct: 721  LGSISEFLARALQPPEPLSVQNAIEYLKTIGALDENENLTVLGRNLSMLPVEPKLGKMLI 780

Query: 798  LGAIFNCLDPVMTVVAGLSVRDPFLMPFDKKDLAESAKAQFSARDYSDHLALVRAYDGWK 857
             G++FNCL+P+MTVVAGLSVRDPFLMPFDKKDLAESAKA FS R +SDHLALV+AY+GWK
Sbjct: 781  FGSLFNCLNPIMTVVAGLSVRDPFLMPFDKKDLAESAKALFSGRTFSDHLALVQAYEGWK 840

Query: 858  DAERHQSGYEYCWKNFLSAQTLKAIDSLRKQFLFLLKDAGLVDRNTENCNKWSHDEHLIR 917
            +AER QSGYEYCW+NFLSAQTLKAIDSLR+QF +LLKDAGLV+ NTE CNKWSHDEHLIR
Sbjct: 841  EAERQQSGYEYCWRNFLSAQTLKAIDSLRRQFFYLLKDAGLVENNTEACNKWSHDEHLIR 900

Query: 918  AVICAGLFPGLCSVVNKEKSIALKTMEDGQVLLYSNSVNAGVPKIPYPWLVFNEKIKVNS 977
            AVICAGLFPG+CSVVNKEKSI+LKTMEDGQVLLYSNSVNA  PKIPYPWLVFNEK+KVNS
Sbjct: 901  AVICAGLFPGICSVVNKEKSISLKTMEDGQVLLYSNSVNAREPKIPYPWLVFNEKVKVNS 960

Query: 978  VFLRDSTGVSDSVLLLFGGNISRGGLDGHLKMLGGYLEFFMKPELADTYLSLKREIEELT 1037
            VFLRDST VSDS+LLLFGG ISRGG+DGHLKMLGGYLEFFMKP+LADTYLSLK+E+EEL 
Sbjct: 961  VFLRDSTAVSDSMLLLFGGRISRGGIDGHLKMLGGYLEFFMKPDLADTYLSLKKELEELI 1020

Query: 1038 QQKLLNPELGIEVQNELLLAVRLLVSEDRCEGRFVFGRQIPAPSKKSAKVALPEMVSKGG 1097
            QQKLLNP L +   NELL AVRLLVSED C GRFVFGRQ+P    KS+K A+ E  S G 
Sbjct: 1021 QQKLLNPTLDVHTNNELLSAVRLLVSEDECNGRFVFGRQLP----KSSKQAIKE-TSAGA 1075

Query: 1098 MVSKG--GGDNPKTDLQTVLARAGHGAPAYKTKQLKNNQFRSTVIFNGLNFVGQPCGNKK 1155
            ++  G  GGDN K  LQTVL R GH AP YKT+QLKNN FRSTVIFNGL F GQPC +KK
Sbjct: 1076 LLRSGGAGGDNAKGRLQTVLIRGGHQAPVYKTRQLKNNMFRSTVIFNGLQFAGQPCSSKK 1135

Query: 1156 LAEKDAAAEALLWLRGDRHSSARDLDHVSMLL 1187
            LAEKDAAA+AL WL G+R SS  D+DH+SMLL
Sbjct: 1136 LAEKDAAAKALEWLMGERQSSTEDIDHMSMLL 1167

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|449497595|ref|XP_004160445.1| PREDICTED: probable ATP-dependent RNA helicase DHX36-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449439551|ref|XP_004137549.1| PREDICTED: probable ATP-dependent RNA helicase DHX36-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|297734269|emb|CBI15516.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|297852484|ref|XP_002894123.1| helicase domain-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297339965|gb|EFH70382.1| helicase domain-containing protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|356527870|ref|XP_003532529.1| PREDICTED: probable ATP-dependent RNA helicase DHX36-like [Glycine max] Back     alignment and taxonomy information
>gi|30694379|ref|NP_175298.2| DEA(D/H)-box RNA helicase family protein [Arabidopsis thaliana] gi|332194212|gb|AEE32333.1| DEA(D/H)-box RNA helicase family protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|356511271|ref|XP_003524350.1| PREDICTED: probable ATP-dependent RNA helicase DHX36-like [Glycine max] Back     alignment and taxonomy information
>gi|238478799|ref|NP_001154411.1| DEA(D/H)-box RNA helicase family protein [Arabidopsis thaliana] gi|332194213|gb|AEE32334.1| DEA(D/H)-box RNA helicase family protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|357521527|ref|XP_003631052.1| ATP-dependent RNA helicase A-like protein [Medicago truncatula] gi|355525074|gb|AET05528.1| ATP-dependent RNA helicase A-like protein [Medicago truncatula] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1197
TAIR|locus:20081441206 AT1G48650 [Arabidopsis thalian 0.924 0.917 0.723 0.0
TAIR|locus:20387961113 AT2G01130 [Arabidopsis thalian 0.894 0.962 0.630 0.0
TAIR|locus:5049549041161 ABO6 "ABA overly sensitive 6" 0.873 0.900 0.607 0.0
TAIR|locus:2039280995 AT2G35920 [Arabidopsis thalian 0.776 0.934 0.445 2.5e-216
MGI|MGI:19194121001 Dhx36 "DEAH (Asp-Glu-Ala-His) 0.642 0.768 0.412 1.5e-154
UNIPROTKB|F6V8H11122 DHX36 "Uncharacterized protein 0.685 0.731 0.398 5.1e-154
RGD|13087671000 Dhx36 "DEAH (Asp-Glu-Ala-His) 0.640 0.767 0.416 1.7e-153
UNIPROTKB|Q9H2U11008 DHX36 "Probable ATP-dependent 0.627 0.745 0.415 1.4e-151
UNIPROTKB|E1C550985 DHX36 "Uncharacterized protein 0.640 0.778 0.406 2.9e-151
UNIPROTKB|Q05B791010 DHX36 "Uncharacterized protein 0.660 0.783 0.398 9.8e-151
TAIR|locus:2008144 AT1G48650 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 4188 (1479.3 bits), Expect = 0., P = 0.
 Identities = 812/1123 (72%), Positives = 934/1123 (83%)

Query:    77 AVTRTRRLDWKAVSYPLLEQQTSNYGRYAYQD-ESSDDSDREFGSTQ-QQMCGSTLDNID 134
             A + T  ++W+A + P  ++Q S YGR AY D ESSD+SDR+ GS+Q QQM GSTLDNID
Sbjct:    76 ASSSTLGIEWRAANLPYFQRQNSGYGRIAYNDYESSDESDRDVGSSQSQQMAGSTLDNID 135

Query:   135 EWRWKLTMLLRNKDEQEVVSRAKKDRRDFEQLSALATRMGLHSRQYAKVVVFSKAPLPNY 194
             +WR+KLTMLLRNK++QEVVSR +KDRRDF+ +SALATRMGLHSRQY+K+VV SKAPLPNY
Sbjct:   136 QWRFKLTMLLRNKEDQEVVSRERKDRRDFDHISALATRMGLHSRQYSKIVVISKAPLPNY 195

Query:   195 RSDLDEKRPQREVILPFGLLREVDAHLKAYLSQKY-INASMSSLSNVGSTTNDEGLYEQQ 253
             R DLD+KRPQREV+LPFGL  EVDAHL ++L QK  +   M   ++  S  N  G YE  
Sbjct:   196 RPDLDDKRPQREVVLPFGLQSEVDAHLHSFLDQKKTLIPEMPRQNSSESLANGYGNYETP 255

Query:   254 EQLVQNSVVRERILRQRSLQMHEKQQAWQESPEGQKMLEFRRSLPSYKERDALLKAISEN 313
             E ++QNS+ RERILR RSLQ+  KQQ W +SPEGQKM+ FR++LP+YKE+DALLKAI+ N
Sbjct:   256 ETVMQNSLARERILRPRSLQLKSKQQQWVDSPEGQKMVGFRKTLPAYKEKDALLKAIAAN 315

Query:   314 QVVVVSGETGCGKTTQLPQYILESETEAARGAACSIICTQPRRISAMAVSERVAAERGEK 373
             QVVVVSGETGCGKTTQLPQYILESE EAARGA CSIICTQPRRISA++VSERVAAERGE+
Sbjct:   316 QVVVVSGETGCGKTTQLPQYILESEIEAARGATCSIICTQPRRISAISVSERVAAERGEQ 375

Query:   374 LGESVGYKVRLEGMKGRDTRLMFCTTGIXXXXXXXXXXXXGVTHVIVDEIHERGMNEDFL 433
             +GESVGYKVRLEGM+GRDTRL+FCTTG+            GVTHV+VDEIHERGMNEDFL
Sbjct:   376 IGESVGYKVRLEGMRGRDTRLLFCTTGVLLRRLLVDRSLKGVTHVVVDEIHERGMNEDFL 435

Query:   434 LIVXXXXXXXXXXXXXXXMSATLNAELFSSYFGGAPMLHIPGFTYPVRAYFLENILEMTR 493
             LIV               MSATLNAELFSSYFGGAP +HIPGFTYPVRA+FLE+ LE + 
Sbjct:   436 LIVLKDLLPRRPDLKLILMSATLNAELFSSYFGGAPAMHIPGFTYPVRAHFLEDYLETSG 495

Query:   494 YRLNTYNQIDDYGQEKSWKMQKQALALRKRKSSIASAVEDALEAADFREYSVQTQQSLSC 553
             YRL TYNQIDDYG+EK+WKMQKQA   +KRKS I+SAVEDALEAADF+ Y+ +T+ SLSC
Sbjct:   496 YRLTTYNQIDDYGEEKTWKMQKQA-QFKKRKSLISSAVEDALEAADFKGYNFRTRDSLSC 554

Query:   554 WNPDSIGFNLIEHVLCHIVKKERPGAVLVFMTGWDDINSLKDQLQAHPLLGDPSRVLLLA 613
             W+PDSIGFNLIE+VLCHIVK ERPGAVLVFMTGWDDINSLK+QL+AH LLGDP++VLLLA
Sbjct:   555 WSPDSIGFNLIENVLCHIVKGERPGAVLVFMTGWDDINSLKNQLEAHSLLGDPNKVLLLA 614

Query:   614 CHGSMASSEQRLIFDKPEDGVRKIVLATNMAETSITINDVVFVIDCGKAKETSYDALNNT 673
             CHGSMASSEQRLIFD+P +G+RKIVLATNMAETSITINDVV+VIDCGKAKETSYDALNNT
Sbjct:   615 CHGSMASSEQRLIFDRPPEGIRKIVLATNMAETSITINDVVYVIDCGKAKETSYDALNNT 674

Query:   674 PCLLPSWISKXXXXXXXXXXXXVQPGECYHLYPRYVYDAFADYQLPELLRTPLQSLCLQI 733
             PCLLPSWISK            V PGECYHLYPR VY+AFADYQ PELLRTPLQSLCLQI
Sbjct:   675 PCLLPSWISKAAARQRRGRAGRVMPGECYHLYPRCVYEAFADYQQPELLRTPLQSLCLQI 734

Query:   734 KSLQLGSISEFLSRALQPPEPLSVKNAIEYLQIIGALDENENLTVLGRNLSMLPVEPKLG 793
             KSL LGSISEFLSRALQPPE LSV+NA+EYL+IIGALD++ENLT LG+NLSMLPVEPKLG
Sbjct:   735 KSLGLGSISEFLSRALQPPEALSVQNAVEYLKIIGALDDDENLTPLGKNLSMLPVEPKLG 794

Query:   794 KMLILGAIFNCLDPVMTVVAGLSVRDPFLMPFDKKDLAESAKAQFSARDYSDHLALVRAY 853
             KMLILGAIFNCLDPVMTVVAGLSVRDPFLMPFDKKDLAE+A+++FS RDYSDHL LVRAY
Sbjct:   795 KMLILGAIFNCLDPVMTVVAGLSVRDPFLMPFDKKDLAETARSKFSGRDYSDHLTLVRAY 854

Query:   854 DGWKDAERHQSGYEYCWKNFLSAQTLKAIDSLRKQFLFLLKDAGLVDRNTENCNKWSHDE 913
             +GWKDAER  SGY+YCWKNFLS+QTLKA+DS+RKQF  LLK+A L+D N E C+K SHDE
Sbjct:   855 NGWKDAERTHSGYDYCWKNFLSSQTLKAMDSMRKQFFNLLKEASLID-NIEGCSKLSHDE 913

Query:   914 HLIRAVICAGLFPGLCSVVNKEKSIALKTMEDGQVLLYSNSVNAGVPKIPYPWLVFNEKI 973
             HL+RA+ICAG+FPG+CSVVNKEKSI LKTMEDGQVLLYS+SVN  VP IP+PWLVFN+K+
Sbjct:   914 HLVRAIICAGMFPGVCSVVNKEKSITLKTMEDGQVLLYSSSVNGNVPMIPFPWLVFNDKV 973

Query:   974 KVNSVFLRDSTGVSDSVLLLFGGNISRGGLDGHLKMLGGYLEFFMKPELADTYLSLKREI 1033
             KVNSVFLRDST VSDSVLLLFG  IS GG DGHLKMLGGYLEFFMKP LA TYLSLKRE+
Sbjct:   974 KVNSVFLRDSTAVSDSVLLLFGDKISSGGFDGHLKMLGGYLEFFMKPTLAYTYLSLKREL 1033

Query:  1034 EELTQQKLLNPELGIEVQNELLLAVRLLVSEDRCEGRFVFGRQI--PAPSKKSAKVALPE 1091
             +EL Q KL+NP+L I++ ++L+ A+RLLVSED+CEGRFV+GR+   P P+KK   V    
Sbjct:  1034 DELIQNKLVNPKLDIQLYDKLMTAIRLLVSEDQCEGRFVYGRKALSPTPAKKLKDVG--- 1090

Query:  1092 XXXXXXXXXXXXXDNPKTDLQTVLARAGHGAPAYKTKQLKNNQFRSTVIFNGLNFVGQPC 1151
                          +N K  LQT+LARAGHG+P YKT+QLKNNQFRS V FNGL+F+G+PC
Sbjct:  1091 -----AQLQNSGGENNKNQLQTLLARAGHGSPVYKTRQLKNNQFRSMVTFNGLDFMGKPC 1145

Query:  1152 GNXXXXXXXXXXXXXXWLRGDRHSSARDLDHVSMLLKRKNRSK 1194
             G+              WL+G+  SS  DL+H+SMLLK KN+ +
Sbjct:  1146 GSKKNAEKDAAHEALLWLQGESKSSLNDLNHMSMLLK-KNKKR 1187
GO:0003676 "nucleic acid binding" evidence=IEA;ISS
GO:0003723 "RNA binding" evidence=IEA
GO:0003725 "double-stranded RNA binding" evidence=IEA
GO:0004386 "helicase activity" evidence=IEA;ISS
GO:0005524 "ATP binding" evidence=IEA;ISS
GO:0005622 "intracellular" evidence=IEA
GO:0008026 "ATP-dependent helicase activity" evidence=IEA
TAIR|locus:2038796 AT2G01130 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:504954904 ABO6 "ABA overly sensitive 6" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2039280 AT2G35920 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
MGI|MGI:1919412 Dhx36 "DEAH (Asp-Glu-Ala-His) box polypeptide 36" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|F6V8H1 DHX36 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
RGD|1308767 Dhx36 "DEAH (Asp-Glu-Ala-His) box polypeptide 36" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q9H2U1 DHX36 "Probable ATP-dependent RNA helicase DHX36" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E1C550 DHX36 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q05B79 DHX36 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.6.4.13LOW CONFIDENCE prediction!
3rd Layer3.6.40.691

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
scaffold_104485.1
annotation not avaliable (1197 aa)
(Arabidopsis lyrata)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1197
COG1643845 COG1643, HrpA, HrpA-like helicases [DNA replicatio 1e-167
TIGR01967 1283 TIGR01967, DEAH_box_HrpA, ATP-dependent helicase H 1e-106
PRK11131 1294 PRK11131, PRK11131, ATP-dependent RNA helicase Hrp 1e-98
PRK11664812 PRK11664, PRK11664, ATP-dependent RNA helicase Hrp 3e-60
TIGR01970819 TIGR01970, DEAH_box_HrpB, ATP-dependent helicase H 9e-37
pfam0440891 pfam04408, HA2, Helicase associated domain (HA2) 2e-33
TIGR01970819 TIGR01970, DEAH_box_HrpB, ATP-dependent helicase H 8e-32
smart00487201 smart00487, DEXDc, DEAD-like helicases superfamily 9e-26
pfam07717109 pfam07717, OB_NTP_bind, Oligonucleotide/oligosacch 3e-25
cd00046144 cd00046, DEXDc, DEAD-like helicases superfamily 2e-23
smart0084782 smart00847, HA2, Helicase associated domain (HA2) 2e-23
smart0049082 smart00490, HELICc, helicase superfamily c-termina 7e-12
pfam0027178 pfam00271, Helicase_C, Helicase conserved C-termin 1e-11
cd00079131 cd00079, HELICc, Helicase superfamily c-terminal d 2e-10
pfam00270169 pfam00270, DEAD, DEAD/DEAH box helicase 3e-08
pfam0003566 pfam00035, dsrm, Double-stranded RNA binding motif 1e-06
cd0004868 cd00048, DSRM, Double-stranded RNA binding motif 5e-06
TIGR02191220 TIGR02191, RNaseIII, ribonuclease III, bacterial 6e-06
PHA02653675 PHA02653, PHA02653, RNA helicase NPH-II; Provision 6e-06
PHA02653675 PHA02653, PHA02653, RNA helicase NPH-II; Provision 2e-04
COG0571235 COG0571, Rnc, dsRNA-specific ribonuclease [Transcr 0.001
PRK00102229 PRK00102, rnc, ribonuclease III; Reviewed 0.001
COG1111542 COG1111, MPH1, ERCC4-like helicases [DNA replicati 0.002
>gnl|CDD|224557 COG1643, HrpA, HrpA-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information 
 Score =  515 bits (1329), Expect = e-167
 Identities = 252/743 (33%), Positives = 357/743 (48%), Gaps = 118/743 (15%)

Query: 276 EKQQAWQESPEGQKMLEFRRSLPSYKERDALLKAISENQVVVVSGETGCGKTTQLPQYIL 335
               A   S     +LE+R  LP    RD +LKAI +NQVV++ GETG GKTTQLPQ++L
Sbjct: 28  SGMDARSRSANVPDILEYRSGLPVTAVRDEILKAIEQNQVVIIVGETGSGKTTQLPQFLL 87

Query: 336 ESETEAARGAACSIICTQPRRISAMAVSERVAAERGEKLGESVGYKVRLEGMKGRDTRLM 395
           E       G A  I CTQPRR++A +V+ERVA E GEKLGE+VGY +R E      TR+ 
Sbjct: 88  E----EGLGIAGKIGCTQPRRLAARSVAERVAEELGEKLGETVGYSIRFESKVSPRTRIK 143

Query: 396 FCTTGILLRRLLVDRSLRGVTHVIVDEIHERGMNEDFLLIVLKELLP-RRPELRLILMSA 454
             T GILLR +  D  L G + VI+DE HER +N D LL +LK+LL  RR +L+LI+MSA
Sbjct: 144 VMTDGILLREIQNDPLLSGYSVVIIDEAHERSLNTDILLGLLKDLLARRRDDLKLIIMSA 203

Query: 455 TLNAELFSSYFGGAPMLHIPGFTYPVRAYFLENILEMTRYRLNT-YNQIDDYGQEKSWKM 513
           TL+AE FS+YFG AP++ I G     R Y +E      RY      + I           
Sbjct: 204 TLDAERFSAYFGNAPVIEIEG-----RTYPVE-----IRYLPEAEADYI----------- 242

Query: 514 QKQALALRKRKSSIASAVEDALEAADFREYSVQTQQSLSCWNPDSIGFNLIEHVLCHIVK 573
                            + DA+ AA                                I  
Sbjct: 243 -----------------LLDAIVAA------------------------------VDIHL 255

Query: 574 KERPGAVLVFMTGWDDINSLKDQLQAHPLLGDPSRVLLLACHGSMASSEQRLIFDKPEDG 633
           +E  G++LVF+ G  +I    + L+   L GD   +L L  +G++++ EQ  +F+    G
Sbjct: 256 REGSGSILVFLPGQREIERTAEWLEKAEL-GDDLEILPL--YGALSAEEQVRVFEPAPGG 312

Query: 634 VRKIVLATNMAETSITINDVVFVIDCGKAKETSYDALNNTPCLLPSWISKAAARQRRGRA 693
            RK+VLATN+AETS+TI  + +VID G AKE  YD       L    ISKA+A QR GRA
Sbjct: 313 KRKVVLATNIAETSLTIPGIRYVIDSGLAKEKRYDPRTGLTRLETEPISKASADQRAGRA 372

Query: 694 GRVQPGECYHLYPRYVYDAFADYQLPELLRTPLQSLCLQIKSLQLGS-ISEFLSRALQPP 752
           GR  PG CY LY    + AF ++ LPE+LRT L  L LQ+KSL +G  I+ F    L PP
Sbjct: 373 GRTGPGICYRLYSEEDFLAFPEFTLPEILRTDLSGLVLQLKSLGIGQDIAPF--PFLDPP 430

Query: 753 EPLSVKNAIEYLQIIGALDENENLTVLGRNLSMLPVEPKLGKMLILGAIFNCLDPVMTVV 812
              +++ A+  LQ +GALD++  LT LG+ +S+LP++P+L +ML+      CL    T+ 
Sbjct: 431 PEAAIQAALTLLQELGALDDSGKLTPLGKQMSLLPLDPRLARMLLTAPEGGCLGEAATIA 490

Query: 813 AGLSVRD---PFLMPFDKK------DLAESAKAQFSARDYSDHLALVRAYDGWKDAERHQ 863
           + LS +D    F      +      DL +  K + +A    DHL L+ A+      +R +
Sbjct: 491 SMLSEQDRESDFSRDVKLRKQRTAQDLLKRLKRRNAADPRGDHLLLLEAFPDRIARKRAK 550

Query: 864 SGY---EYCWKNFLSAQTLKAIDSLRKQ------------FLFLLKD-----AGLVDRNT 903
             Y     C       + L     +                     D     A  +  + 
Sbjct: 551 GEYLRANGCRAMLFPTKALSRAPWIIAALLVQTSALAGRILAAAEIDEDEWAAQHLPEHC 610

Query: 904 ENCNKWSHDEHLIRAVICAGLFPGLCSVVNKEKSIALKTMEDGQ-VLLYSNSVNAGVPKI 962
            +   W      IR  + AG    +  +    +     T+ D   V  + +SV  G   +
Sbjct: 611 YSEPIWD----DIRGALAAGRKLNIAQLQLDGR--PYVTLSDNTPVFAHPSSVRLG--LV 662

Query: 963 PYPWLVFNEKIKVNSVFLRDSTG 985
              W+ + E ++    +LR+  G
Sbjct: 663 LLEWIKYAEFLRTRKGYLREGRG 685

Length = 845
>gnl|CDD|233659 TIGR01967, DEAH_box_HrpA, ATP-dependent helicase HrpA Back     alignment and domain information
>gnl|CDD|182986 PRK11131, PRK11131, ATP-dependent RNA helicase HrpA; Provisional Back     alignment and domain information
>gnl|CDD|236950 PRK11664, PRK11664, ATP-dependent RNA helicase HrpB; Provisional Back     alignment and domain information
>gnl|CDD|233660 TIGR01970, DEAH_box_HrpB, ATP-dependent helicase HrpB Back     alignment and domain information
>gnl|CDD|218070 pfam04408, HA2, Helicase associated domain (HA2) Back     alignment and domain information
>gnl|CDD|233660 TIGR01970, DEAH_box_HrpB, ATP-dependent helicase HrpB Back     alignment and domain information
>gnl|CDD|214692 smart00487, DEXDc, DEAD-like helicases superfamily Back     alignment and domain information
>gnl|CDD|219532 pfam07717, OB_NTP_bind, Oligonucleotide/oligosaccharide-binding (OB)-fold Back     alignment and domain information
>gnl|CDD|238005 cd00046, DEXDc, DEAD-like helicases superfamily Back     alignment and domain information
>gnl|CDD|214852 smart00847, HA2, Helicase associated domain (HA2) Add an annotation Back     alignment and domain information
>gnl|CDD|197757 smart00490, HELICc, helicase superfamily c-terminal domain Back     alignment and domain information
>gnl|CDD|201125 pfam00271, Helicase_C, Helicase conserved C-terminal domain Back     alignment and domain information
>gnl|CDD|238034 cd00079, HELICc, Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may not be an autonomously folding unit, but an integral part of the helicase; 4 helicase superfamilies at present according to the organization of their signature motifs; all helicases share the ability to unwind nucleic acid duplexes with a distinct directional polarity; they utilize the free energy from nucleoside triphosphate hydrolysis to fuel their translocation along DNA, unwinding the duplex in the process Back     alignment and domain information
>gnl|CDD|215832 pfam00270, DEAD, DEAD/DEAH box helicase Back     alignment and domain information
>gnl|CDD|215670 pfam00035, dsrm, Double-stranded RNA binding motif Back     alignment and domain information
>gnl|CDD|238007 cd00048, DSRM, Double-stranded RNA binding motif Back     alignment and domain information
>gnl|CDD|233772 TIGR02191, RNaseIII, ribonuclease III, bacterial Back     alignment and domain information
>gnl|CDD|177443 PHA02653, PHA02653, RNA helicase NPH-II; Provisional Back     alignment and domain information
>gnl|CDD|177443 PHA02653, PHA02653, RNA helicase NPH-II; Provisional Back     alignment and domain information
>gnl|CDD|223644 COG0571, Rnc, dsRNA-specific ribonuclease [Transcription] Back     alignment and domain information
>gnl|CDD|234633 PRK00102, rnc, ribonuclease III; Reviewed Back     alignment and domain information
>gnl|CDD|224036 COG1111, MPH1, ERCC4-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 1197
KOG0920924 consensus ATP-dependent RNA helicase A [RNA proces 100.0
KOG0922674 consensus DEAH-box RNA helicase [RNA processing an 100.0
KOG09241042 consensus mRNA splicing factor ATP-dependent RNA h 100.0
KOG0923902 consensus mRNA splicing factor ATP-dependent RNA h 100.0
KOG0925699 consensus mRNA splicing factor ATP-dependent RNA h 100.0
PRK11131 1294 ATP-dependent RNA helicase HrpA; Provisional 100.0
TIGR01967 1283 DEAH_box_HrpA ATP-dependent helicase HrpA. This mo 100.0
COG1643845 HrpA HrpA-like helicases [DNA replication, recombi 100.0
KOG09261172 consensus DEAH-box RNA helicase [RNA processing an 100.0
KOG09211282 consensus Dosage compensation complex, subunit MLE 100.0
TIGR01970819 DEAH_box_HrpB ATP-dependent helicase HrpB. This mo 100.0
PRK11664812 ATP-dependent RNA helicase HrpB; Provisional 100.0
PHA02653675 RNA helicase NPH-II; Provisional 100.0
PRK01172674 ski2-like helicase; Provisional 100.0
PRK02362737 ski2-like helicase; Provisional 100.0
KOG0330476 consensus ATP-dependent RNA helicase [RNA processi 100.0
PRK00254720 ski2-like helicase; Provisional 100.0
PRK11776460 ATP-dependent RNA helicase DbpA; Provisional 100.0
KOG0331519 consensus ATP-dependent RNA helicase [RNA processi 100.0
PRK11192434 ATP-dependent RNA helicase SrmB; Provisional 100.0
PRK04837423 ATP-dependent RNA helicase RhlB; Provisional 100.0
PRK10590456 ATP-dependent RNA helicase RhlE; Provisional 100.0
PTZ00110545 helicase; Provisional 100.0
PRK11634629 ATP-dependent RNA helicase DeaD; Provisional 100.0
PRK01297475 ATP-dependent RNA helicase RhlB; Provisional 100.0
PRK04537572 ATP-dependent RNA helicase RhlB; Provisional 100.0
PLN00206518 DEAD-box ATP-dependent RNA helicase; Provisional 100.0
TIGR03817742 DECH_helic helicase/secretion neighborhood putativ 100.0
COG0513513 SrmB Superfamily II DNA and RNA helicases [DNA rep 100.0
PTZ00424401 helicase 45; Provisional 100.0
COG1204766 Superfamily II helicase [General function predicti 100.0
COG1202830 Superfamily II helicase, archaea-specific [General 100.0
KOG0338691 consensus ATP-dependent RNA helicase [RNA processi 100.0
KOG0333673 consensus U5 snRNP-like RNA helicase subunit [RNA 100.0
KOG0345567 consensus ATP-dependent RNA helicase [RNA processi 100.0
TIGR00614470 recQ_fam ATP-dependent DNA helicase, RecQ family. 100.0
KOG0342543 consensus ATP-dependent RNA helicase pitchoune [RN 100.0
KOG0328400 consensus Predicted ATP-dependent RNA helicase FAL 100.0
PRK13767876 ATP-dependent helicase; Provisional 100.0
KOG0343758 consensus RNA Helicase [RNA processing and modific 100.0
PRK11057607 ATP-dependent DNA helicase RecQ; Provisional 100.0
PLN031371195 ATP-dependent DNA helicase; Q4-like; Provisional 100.0
KOG0340442 consensus ATP-dependent RNA helicase [RNA processi 99.98
KOG0348708 consensus ATP-dependent RNA helicase [RNA processi 99.97
COG1201814 Lhr Lhr-like helicases [General function predictio 99.97
PRK09751 1490 putative ATP-dependent helicase Lhr; Provisional 99.97
KOG0335482 consensus ATP-dependent RNA helicase [RNA processi 99.97
TIGR01389591 recQ ATP-dependent DNA helicase RecQ. The ATP-depe 99.97
KOG09491330 consensus Predicted helicase, DEAD-box superfamily 99.97
COG1111542 MPH1 ERCC4-like helicases [DNA replication, recomb 99.97
KOG0347731 consensus RNA helicase [RNA processing and modific 99.97
TIGR00580926 mfd transcription-repair coupling factor (mfd). Al 99.97
KOG0326459 consensus ATP-dependent RNA helicase [RNA processi 99.97
KOG0336629 consensus ATP-dependent RNA helicase [RNA processi 99.96
KOG0339731 consensus ATP-dependent RNA helicase [RNA processi 99.96
TIGR01587358 cas3_core CRISPR-associated helicase Cas3. This mo 99.96
KOG0332477 consensus ATP-dependent RNA helicase [RNA processi 99.96
PRK106891147 transcription-repair coupling factor; Provisional 99.96
KOG09211282 consensus Dosage compensation complex, subunit MLE 99.96
KOG0354746 consensus DEAD-box like helicase [General function 99.96
PRK10917681 ATP-dependent DNA helicase RecG; Provisional 99.96
TIGR00643630 recG ATP-dependent DNA helicase RecG. 99.96
KOG0952 1230 consensus DNA/RNA helicase MER3/SLH1, DEAD-box sup 99.96
TIGR02621844 cas3_GSU0051 CRISPR-associated helicase Cas3, Anae 99.96
KOG0350620 consensus DEAD-box ATP-dependent RNA helicase [RNA 99.95
KOG0341610 consensus DEAD-box protein abstrakt [RNA processin 99.95
KOG09471248 consensus Cytoplasmic exosomal RNA helicase SKI2, 99.95
KOG09481041 consensus Nuclear exosomal RNA helicase MTR4, DEAD 99.95
KOG0346569 consensus RNA helicase [RNA processing and modific 99.95
KOG0327397 consensus Translation initiation factor 4F, helica 99.95
PRK13766773 Hef nuclease; Provisional 99.95
KOG0344593 consensus ATP-dependent RNA helicase [RNA processi 99.94
PHA02558501 uvsW UvsW helicase; Provisional 99.94
TIGR03158357 cas3_cyano CRISPR-associated helicase, Cyano-type. 99.94
KOG0334997 consensus RNA helicase [RNA processing and modific 99.94
COG1205851 Distinct helicase family with a unique C-terminal 99.94
KOG4284 980 consensus DEAD box protein [Transcription] 99.94
COG45811041 Superfamily II RNA helicase [DNA replication, reco 99.93
COG0514590 RecQ Superfamily II DNA helicase [DNA replication, 99.93
KOG0951 1674 consensus RNA helicase BRR2, DEAD-box superfamily 99.92
PRK09401 1176 reverse gyrase; Reviewed 99.91
PRK14701 1638 reverse gyrase; Provisional 99.9
TIGR00603732 rad25 DNA repair helicase rad25. All proteins in t 99.9
KOG0337529 consensus ATP-dependent RNA helicase [RNA processi 99.9
TIGR01054 1171 rgy reverse gyrase. Generally, these gyrases are e 99.89
PRK05580679 primosome assembly protein PriA; Validated 99.88
PRK09694878 helicase Cas3; Provisional 99.88
TIGR03714762 secA2 accessory Sec system translocase SecA2. Memb 99.87
PRK12898656 secA preprotein translocase subunit SecA; Reviewed 99.87
PRK09200790 preprotein translocase subunit SecA; Reviewed 99.87
KOG0352641 consensus ATP-dependent DNA helicase [Replication, 99.87
COG1061442 SSL2 DNA or RNA helicases of superfamily II [Trans 99.87
TIGR00963745 secA preprotein translocase, SecA subunit. The pro 99.87
TIGR00595505 priA primosomal protein N'. All proteins in this f 99.87
COG4098441 comFA Superfamily II DNA/RNA helicase required for 99.86
KOG09501008 consensus DNA polymerase theta/eta, DEAD-box super 99.86
PRK114481123 hsdR type I restriction enzyme EcoKI subunit R; Pr 99.85
KOG0351941 consensus ATP-dependent DNA helicase [Replication, 99.85
COG1200677 RecG RecG-like helicase [DNA replication, recombin 99.83
COG11971139 Mfd Transcription-repair coupling factor (superfam 99.82
PRK04914956 ATP-dependent helicase HepA; Validated 99.79
KOG0353695 consensus ATP-dependent DNA helicase [General func 99.77
PF07717114 OB_NTP_bind: Oligonucleotide/oligosaccharide-bindi 99.77
KOG0349725 consensus Putative DEAD-box RNA helicase DDX1 [RNA 99.76
COG1203733 CRISPR-associated helicase Cas3 [Defense mechanism 99.74
PRK13104896 secA preprotein translocase subunit SecA; Reviewed 99.74
KOG0329387 consensus ATP-dependent RNA helicase [RNA processi 99.72
PF00270169 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 99.68
PRK12906796 secA preprotein translocase subunit SecA; Reviewed 99.67
cd00268203 DEADc DEAD-box helicases. A diverse family of prot 99.67
PRK12904830 preprotein translocase subunit SecA; Reviewed 99.67
PF04408102 HA2: Helicase associated domain (HA2); InterPro: I 99.67
COG4096875 HsdR Type I site-specific restriction-modification 99.65
TIGR00348667 hsdR type I site-specific deoxyribonuclease, HsdR 99.65
PRK13107908 preprotein translocase subunit SecA; Reviewed 99.62
PRK12899970 secA preprotein translocase subunit SecA; Reviewed 99.58
COG1110 1187 Reverse gyrase [DNA replication, recombination, an 99.54
smart0084792 HA2 Helicase associated domain (HA2) Add an annota 99.53
COG1198730 PriA Primosomal protein N' (replication factor Y) 99.5
KOG0953700 consensus Mitochondrial RNA helicase SUV3, DEAD-bo 99.49
PLN031421033 Probable chromatin-remodeling complex ATPase chain 99.48
TIGR01407850 dinG_rel DnaQ family exonuclease/DinG family helic 99.47
smart00487201 DEXDc DEAD-like helicases superfamily. 99.43
cd00046144 DEXDc DEAD-like helicases superfamily. A diverse f 99.4
KOG41501034 consensus Predicted ATP-dependent RNA helicase [RN 99.38
TIGR025621110 cas3_yersinia CRISPR-associated helicase Cas3. The 99.34
cd00079131 HELICc Helicase superfamily c-terminal domain; ass 99.33
TIGR00631655 uvrb excinuclease ABC, B subunit. This family is b 99.3
PF0027178 Helicase_C: Helicase conserved C-terminal domain; 99.27
PF04851184 ResIII: Type III restriction enzyme, res subunit; 99.24
PRK07246820 bifunctional ATP-dependent DNA helicase/DNA polyme 99.23
PRK05298652 excinuclease ABC subunit B; Provisional 99.22
PF07652148 Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR 99.2
PRK12326764 preprotein translocase subunit SecA; Reviewed 99.18
KOG0385971 consensus Chromatin remodeling complex WSTF-ISWI, 99.16
PRK13103913 secA preprotein translocase subunit SecA; Reviewed 99.13
KOG1123776 consensus RNA polymerase II transcription initiati 99.11
KOG09511674 consensus RNA helicase BRR2, DEAD-box superfamily 99.1
PRK129001025 secA preprotein translocase subunit SecA; Reviewed 99.1
smart0049082 HELICc helicase superfamily c-terminal domain. 99.09
PRK08074928 bifunctional ATP-dependent DNA helicase/DNA polyme 99.03
PRK12903925 secA preprotein translocase subunit SecA; Reviewed 98.96
CHL00122870 secA preprotein translocase subunit SecA; Validate 98.94
COG0556663 UvrB Helicase subunit of the DNA excision repair c 98.82
PF02399824 Herpes_ori_bp: Origin of replication binding prote 98.8
KOG0387923 consensus Transcription-coupled repair protein CSB 98.79
PRK14873665 primosome assembly protein PriA; Provisional 98.79
KOG0390776 consensus DNA repair protein, SNF2 family [Replica 98.64
KOG03841373 consensus Chromodomain-helicase DNA-binding protei 98.63
PRK12902939 secA preprotein translocase subunit SecA; Reviewed 98.62
PRK11747697 dinG ATP-dependent DNA helicase DinG; Provisional 98.62
COG1199654 DinG Rad3-related DNA helicases [Transcription / D 98.52
TIGR00604705 rad3 DNA repair helicase (rad3). All proteins in t 98.51
COG4889 1518 Predicted helicase [General function prediction on 98.41
TIGR03117636 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase 98.34
cd0004868 DSRM Double-stranded RNA binding motif. Binding is 98.31
KOG03921549 consensus SNF2 family DNA-dependent ATPase domain- 98.2
smart0035867 DSRM Double-stranded RNA binding motif. 98.2
PF0003567 dsrm: Double-stranded RNA binding motif; InterPro: 98.17
KOG1000689 consensus Chromatin remodeling protein HARP/SMARCA 98.16
PHA02701183 ORF020 dsRNA-binding PKR inhibitor; Provisional 98.14
PF00176299 SNF2_N: SNF2 family N-terminal domain; InterPro: I 98.11
PHA03103183 double-strand RNA-binding protein; Provisional 98.11
COG0610962 Type I site-specific restriction-modification syst 97.99
TIGR00596814 rad1 DNA repair protein (rad1). This family is bas 97.95
PF13401131 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S 97.87
PRK12371235 ribonuclease III; Reviewed 97.83
KOG0389941 consensus SNF2 family DNA-dependent ATPase [Chroma 97.82
PF1324576 AAA_19: Part of AAA domain 97.81
PRK00102229 rnc ribonuclease III; Reviewed 97.74
KOG09521230 consensus DNA/RNA helicase MER3/SLH1, DEAD-box sup 97.72
PF00448196 SRP54: SRP54-type protein, GTPase domain; InterPro 97.7
PRK12723388 flagellar biosynthesis regulator FlhF; Provisional 97.68
PRK12372 413 ribonuclease III; Reviewed 97.63
PRK14718 467 ribonuclease III; Provisional 97.63
PF06862442 DUF1253: Protein of unknown function (DUF1253); In 97.6
PRK129011112 secA preprotein translocase subunit SecA; Reviewed 97.59
COG0653822 SecA Preprotein translocase subunit SecA (ATPase, 97.52
PF13604196 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL 97.45
PF02562205 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH 97.4
TIGR01447586 recD exodeoxyribonuclease V, alpha subunit. This f 97.4
KOG1002791 consensus Nucleotide excision repair protein RAD16 97.38
KOG1803649 consensus DNA helicase [Replication, recombination 97.38
TIGR02191220 RNaseIII ribonuclease III, bacterial. This family 97.34
COG0571235 Rnc dsRNA-specific ribonuclease [Transcription] 97.32
PF1470980 DND1_DSRM: double strand RNA binding domain from D 97.32
KOG03861157 consensus Chromatin remodeling complex SWI/SNF, co 97.31
PRK14722374 flhF flagellar biosynthesis regulator FlhF; Provis 97.31
PRK10875615 recD exonuclease V subunit alpha; Provisional 97.28
PRK05703424 flhF flagellar biosynthesis regulator FlhF; Valida 97.28
PRK11889436 flhF flagellar biosynthesis regulator FlhF; Provis 97.28
COG1419407 FlhF Flagellar GTP-binding protein [Cell motility 97.26
PRK10536262 hypothetical protein; Provisional 97.21
COG0553866 HepA Superfamily II DNA/RNA helicases, SNF2 family 97.18
cd00009151 AAA The AAA+ (ATPases Associated with a wide varie 97.14
PRK06526254 transposase; Provisional 97.08
PF09848352 DUF2075: Uncharacterized conserved protein (DUF207 97.08
PF05729166 NACHT: NACHT domain 97.06
TIGR01448720 recD_rel helicase, putative, RecD/TraA family. Thi 97.04
PRK12726407 flagellar biosynthesis regulator FlhF; Provisional 97.01
PRK12727559 flagellar biosynthesis regulator FlhF; Provisional 96.93
KOG2340698 consensus Uncharacterized conserved protein [Funct 96.89
PRK12724432 flagellar biosynthesis regulator FlhF; Provisional 96.87
PF13307167 Helicase_C_2: Helicase C-terminal domain; PDB: 4A1 96.84
PRK15483986 type III restriction-modification system StyLTI en 96.8
PF05970364 PIF1: PIF1-like helicase; InterPro: IPR010285 This 96.78
smart00489289 DEXDc3 DEAD-like helicases superfamily. 96.78
smart00488289 DEXDc2 DEAD-like helicases superfamily. 96.78
PRK14974336 cell division protein FtsY; Provisional 96.75
PRK08181269 transposase; Validated 96.65
PF13086236 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV 96.61
KOG1802935 consensus RNA helicase nonsense mRNA reducing fact 96.59
PF07517266 SecA_DEAD: SecA DEAD-like domain; InterPro: IPR011 96.53
TIGR02768744 TraA_Ti Ti-type conjugative transfer relaxase TraA 96.53
PRK04296190 thymidine kinase; Provisional 96.52
PF00580315 UvrD-helicase: UvrD/REP helicase N-terminal domain 96.43
PHA03333752 putative ATPase subunit of terminase; Provisional 96.41
PRK09183259 transposase/IS protein; Provisional 96.31
PRK14723767 flhF flagellar biosynthesis regulator FlhF; Provis 96.22
PRK14721420 flhF flagellar biosynthesis regulator FlhF; Provis 96.19
PRK13889988 conjugal transfer relaxase TraA; Provisional 96.19
PRK07003830 DNA polymerase III subunits gamma and tau; Validat 96.11
PF12340229 DUF3638: Protein of unknown function (DUF3638); In 96.1
smart00382148 AAA ATPases associated with a variety of cellular 96.09
KOG4439901 consensus RNA polymerase II transcription terminat 96.08
PRK06731270 flhF flagellar biosynthesis regulator FlhF; Valida 95.99
PF13173128 AAA_14: AAA domain 95.95
PRK14956484 DNA polymerase III subunits gamma and tau; Provisi 95.92
PRK06995484 flhF flagellar biosynthesis regulator FlhF; Valida 95.88
PRK06835329 DNA replication protein DnaC; Validated 95.87
PRK10416318 signal recognition particle-docking protein FtsY; 95.84
PF13872303 AAA_34: P-loop containing NTP hydrolase pore-1 95.83
PF05127177 Helicase_RecD: Helicase; InterPro: IPR007807 This 95.83
PRK07994647 DNA polymerase III subunits gamma and tau; Validat 95.74
PRK00771437 signal recognition particle protein Srp54; Provisi 95.71
PRK14949944 DNA polymerase III subunits gamma and tau; Provisi 95.65
TIGR03015269 pepcterm_ATPase putative secretion ATPase, PEP-CTE 95.63
TIGR03499282 FlhF flagellar biosynthetic protein FlhF. 95.63
TIGR00376637 DNA helicase, putative. The gene product may repre 95.61
PRK08727233 hypothetical protein; Validated 95.58
PRK12323700 DNA polymerase III subunits gamma and tau; Provisi 95.55
PRK08691709 DNA polymerase III subunits gamma and tau; Validat 95.45
TIGR03420226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Me 95.45
PRK14961363 DNA polymerase III subunits gamma and tau; Provisi 95.42
TIGR00064272 ftsY signal recognition particle-docking protein F 95.41
PRK08903227 DnaA regulatory inactivator Hda; Validated 95.4
PRK14957546 DNA polymerase III subunits gamma and tau; Provisi 95.38
TIGR02640262 gas_vesic_GvpN gas vesicle protein GvpN. Members o 95.38
KOG03911958 consensus SNF2 family DNA-dependent ATPase [Genera 95.38
PRK138261102 Dtr system oriT relaxase; Provisional 95.37
PRK14964491 DNA polymerase III subunits gamma and tau; Provisi 95.29
PF01695178 IstB_IS21: IstB-like ATP binding protein; InterPro 95.28
PRK09112351 DNA polymerase III subunit delta'; Validated 95.27
PRK07952244 DNA replication protein DnaC; Validated 95.2
PRK14960702 DNA polymerase III subunits gamma and tau; Provisi 95.19
TIGR01425429 SRP54_euk signal recognition particle protein SRP5 95.09
PRK14958509 DNA polymerase III subunits gamma and tau; Provisi 95.09
PRK08116268 hypothetical protein; Validated 95.02
PRK07764824 DNA polymerase III subunits gamma and tau; Validat 95.01
PRK12402337 replication factor C small subunit 2; Reviewed 94.99
TIGR00678188 holB DNA polymerase III, delta' subunit. At positi 94.9
PRK10867433 signal recognition particle protein; Provisional 94.9
PRK00411394 cdc6 cell division control protein 6; Reviewed 94.82
PRK00149450 dnaA chromosomal replication initiation protein; R 94.81
cd01124187 KaiC KaiC is a circadian clock protein primarily f 94.79
PRK14952584 DNA polymerase III subunits gamma and tau; Provisi 94.76
PRK06893229 DNA replication initiation factor; Validated 94.75
PRK14969527 DNA polymerase III subunits gamma and tau; Provisi 94.7
TIGR02928365 orc1/cdc6 family replication initiation protein. M 94.65
PRK05642234 DNA replication initiation factor; Validated 94.64
PHA02244383 ATPase-like protein 94.55
PRK09111598 DNA polymerase III subunits gamma and tau; Validat 94.47
PRK14963504 DNA polymerase III subunits gamma and tau; Provisi 94.47
PRK11331459 5-methylcytosine-specific restriction enzyme subun 94.46
cd03115173 SRP The signal recognition particle (SRP) mediates 94.44
TIGR00959428 ffh signal recognition particle protein. This mode 94.41
COG1444758 Predicted P-loop ATPase fused to an acetyltransfer 94.41
PTZ001121164 origin recognition complex 1 protein; Provisional 94.41
PF03354477 Terminase_1: Phage Terminase ; InterPro: IPR005021 94.41
PRK14087450 dnaA chromosomal replication initiation protein; P 94.39
PRK14951618 DNA polymerase III subunits gamma and tau; Provisi 94.31
PRK14962472 DNA polymerase III subunits gamma and tau; Provisi 94.31
PRK07471365 DNA polymerase III subunit delta'; Validated 94.18
PRK08084235 DNA replication initiation factor; Provisional 94.17
TIGR00362405 DnaA chromosomal replication initiator protein Dna 94.12
PRK14965576 DNA polymerase III subunits gamma and tau; Provisi 94.11
TIGR02881261 spore_V_K stage V sporulation protein K. Members o 94.1
PHA03368738 DNA packaging terminase subunit 1; Provisional 94.09
PRK06645507 DNA polymerase III subunits gamma and tau; Validat 94.07
PRK08451535 DNA polymerase III subunits gamma and tau; Validat 94.07
TIGR02782299 TrbB_P P-type conjugative transfer ATPase TrbB. Th 94.05
COG1875436 NYN ribonuclease and ATPase of PhoH family domains 94.05
PRK13833323 conjugal transfer protein TrbB; Provisional 94.05
PF01637234 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 94.04
TIGR02760 1960 TraI_TIGR conjugative transfer relaxase protein Tr 94.03
KOG3732 339 consensus Staufen and related double-stranded-RNA- 94.02
PRK11054684 helD DNA helicase IV; Provisional 94.01
PF13177162 DNA_pol3_delta2: DNA polymerase III, delta subunit 94.01
PRK14959624 DNA polymerase III subunits gamma and tau; Provisi 93.89
COG1474366 CDC6 Cdc6-related protein, AAA superfamily ATPase 93.87
cd01120165 RecA-like_NTPases RecA-like NTPases. This family i 93.86
COG1484254 DnaC DNA replication protein [DNA replication, rec 93.79
PRK08939306 primosomal protein DnaI; Reviewed 93.76
PRK12377248 putative replication protein; Provisional 93.75
PRK08533230 flagellar accessory protein FlaH; Reviewed 93.69
PHA02533534 17 large terminase protein; Provisional 93.68
PRK05563559 DNA polymerase III subunits gamma and tau; Validat 93.62
PRK05896605 DNA polymerase III subunits gamma and tau; Validat 93.61
PF05621302 TniB: Bacterial TniB protein; InterPro: IPR008868 93.58
PRK14950585 DNA polymerase III subunits gamma and tau; Provisi 93.55
PF00004132 AAA: ATPase family associated with various cellula 93.53
PRK00440319 rfc replication factor C small subunit; Reviewed 93.5
COG3421812 Uncharacterized protein conserved in bacteria [Fun 93.49
COG2804500 PulE Type II secretory pathway, ATPase PulE/Tfp pi 93.49
PRK129001025 secA preprotein translocase subunit SecA; Reviewed 93.48
PRK06921266 hypothetical protein; Provisional 93.41
PF05496233 RuvB_N: Holliday junction DNA helicase ruvB N-term 93.33
PHA02544316 44 clamp loader, small subunit; Provisional 93.24
COG2256436 MGS1 ATPase related to the helicase subunit of the 93.14
PRK14948620 DNA polymerase III subunits gamma and tau; Provisi 93.12
KOG18051100 consensus DNA replication helicase [Replication, r 93.09
PRK05707328 DNA polymerase III subunit delta'; Validated 93.05
PRK07133725 DNA polymerase III subunits gamma and tau; Validat 93.05
PF00308219 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013 93.05
PRK14955397 DNA polymerase III subunits gamma and tau; Provisi 93.04
TIGR02397355 dnaX_nterm DNA polymerase III, subunit gamma and t 92.99
KOG0391 1958 consensus SNF2 family DNA-dependent ATPase [Genera 92.96
TIGR02880284 cbbX_cfxQ probable Rubsico expression protein CbbX 92.96
PRK14953486 DNA polymerase III subunits gamma and tau; Provisi 92.94
TIGR03878259 thermo_KaiC_2 KaiC domain protein, AF_0795 family. 92.93
KOG2373514 consensus Predicted mitochondrial DNA helicase twi 92.91
TIGR03345852 VI_ClpV1 type VI secretion ATPase, ClpV1 family. M 92.9
KOG1131755 consensus RNA polymerase II transcription initiati 92.89
KOG2777 542 consensus tRNA-specific adenosine deaminase 1 [RNA 92.83
PRK14088440 dnaA chromosomal replication initiation protein; P 92.74
PF01443234 Viral_helicase1: Viral (Superfamily 1) RNA helicas 92.7
TIGR01547396 phage_term_2 phage terminase, large subunit, PBSX 92.68
KOG0989346 consensus Replication factor C, subunit RFC4 [Repl 92.64
PRK07940394 DNA polymerase III subunit delta'; Validated 92.5
COG3587985 Restriction endonuclease [Defense mechanisms] 92.5
CHL00181287 cbbX CbbX; Provisional 92.49
PRK06067234 flagellar accessory protein FlaH; Validated 92.44
COG0470325 HolB ATPase involved in DNA replication [DNA repli 92.43
PRK14954620 DNA polymerase III subunits gamma and tau; Provisi 92.37
PRK129011112 secA preprotein translocase subunit SecA; Reviewed 92.3
PRK13342413 recombination factor protein RarA; Reviewed 92.27
COG3973747 Superfamily I DNA and RNA helicases [General funct 92.23
KOG03881185 consensus SNF2 family DNA-dependent ATPase [Replic 92.19
PRK10919672 ATP-dependent DNA helicase Rep; Provisional 92.18
PRK13894319 conjugal transfer ATPase TrbB; Provisional 92.15
PF00437270 T2SE: Type II/IV secretion system protein; InterPr 92.11
PRK06620214 hypothetical protein; Validated 92.07
PRK14971614 DNA polymerase III subunits gamma and tau; Provisi 92.04
PRK147121623 conjugal transfer nickase/helicase TraI; Provision 92.04
PRK06647563 DNA polymerase III subunits gamma and tau; Validat 92.03
PRK12422445 chromosomal replication initiation protein; Provis 91.92
PRK09087226 hypothetical protein; Validated 91.87
PRK13851344 type IV secretion system protein VirB11; Provision 91.79
TIGR02639731 ClpA ATP-dependent Clp protease ATP-binding subuni 91.75
PRK10865857 protein disaggregation chaperone; Provisional 91.72
PRK13900332 type IV secretion system ATPase VirB11; Provisiona 91.69
PF00931287 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is 91.66
PLN03025319 replication factor C subunit; Provisional 91.66
PRK14970367 DNA polymerase III subunits gamma and tau; Provisi 91.63
PRK07399314 DNA polymerase III subunit delta'; Validated 91.61
PRK11823446 DNA repair protein RadA; Provisional 91.34
KOG1132945 consensus Helicase of the DEAD superfamily [Replic 91.23
PRK06871325 DNA polymerase III subunit delta'; Validated 91.0
PRK04195482 replication factor C large subunit; Provisional 90.96
cd01130186 VirB11-like_ATPase Type IV secretory pathway compo 90.9
PRK08058329 DNA polymerase III subunit delta'; Validated 90.87
COG1435201 Tdk Thymidine kinase [Nucleotide transport and met 90.72
PRK137091747 conjugal transfer nickase/helicase TraI; Provision 90.71
PRK14086617 dnaA chromosomal replication initiation protein; P 90.67
COG0556663 UvrB Helicase subunit of the DNA excision repair c 90.6
TIGR01074664 rep ATP-dependent DNA helicase Rep. Designed to id 90.56
PF06745226 KaiC: KaiC; InterPro: IPR014774 This entry represe 90.42
TIGR02524358 dot_icm_DotB Dot/Icm secretion system ATPase DotB. 90.36
PRK08769319 DNA polymerase III subunit delta'; Validated 90.3
PRK13341725 recombination factor protein RarA/unknown domain f 90.16
COG4626546 Phage terminase-like protein, large subunit [Gener 90.15
TIGR02655484 circ_KaiC circadian clock protein KaiC. Members of 90.07
KOG3732 339 consensus Staufen and related double-stranded-RNA- 89.93
TIGR01075715 uvrD DNA helicase II. Designed to identify uvrD me 89.84
PTZ00293211 thymidine kinase; Provisional 89.67
PRK11773721 uvrD DNA-dependent helicase II; Provisional 89.4
TIGR027601960 TraI_TIGR conjugative transfer relaxase protein Tr 89.25
cd01393226 recA_like RecA is a bacterial enzyme which has rol 89.24
PRK04841903 transcriptional regulator MalT; Provisional 89.17
COG0552340 FtsY Signal recognition particle GTPase [Intracell 89.17
PF03237384 Terminase_6: Terminase-like family; InterPro: IPR0 88.97
COG1618179 Predicted nucleotide kinase [Nucleotide transport 88.77
TIGR00763775 lon ATP-dependent protease La. This protein is ind 88.7
TIGR03877237 thermo_KaiC_1 KaiC domain protein, Ph0284 family. 88.67
PRK06305451 DNA polymerase III subunits gamma and tau; Validat 88.63
TIGR02525372 plasmid_TraJ plasmid transfer ATPase TraJ. Members 88.58
cd01129264 PulE-GspE PulE/GspE The type II secretory pathway 88.51
COG1221403 PspF Transcriptional regulators containing an AAA- 88.36
TIGR00767415 rho transcription termination factor Rho. Members 88.33
PRK06964342 DNA polymerase III subunit delta'; Validated 88.25
COG4962355 CpaF Flp pilus assembly protein, ATPase CpaF [Intr 88.24
cd01121372 Sms Sms (bacterial radA) DNA repair protein. This 87.92
PHA00729226 NTP-binding motif containing protein 87.9
COG2255332 RuvB Holliday junction resolvasome, helicase subun 87.88
TIGR01420343 pilT_fam pilus retraction protein PilT. This model 87.84
PRK11034758 clpA ATP-dependent Clp protease ATP-binding subuni 87.79
PF1355562 AAA_29: P-loop containing region of AAA domain 87.79
PRK10787784 DNA-binding ATP-dependent protease La; Provisional 87.76
COG2805353 PilT Tfp pilus assembly protein, pilus retraction 87.72
PF0336890 Dicer_dimer: Dicer dimerisation domain; InterPro: 87.71
PF13207121 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6 87.63
PRK05973237 replicative DNA helicase; Provisional 87.58
PHA00149331 DNA encapsidation protein 87.53
TIGR02974329 phageshock_pspF psp operon transcriptional activat 87.5
KOG2028554 consensus ATPase related to the helicase subunit o 87.49
COG3267269 ExeA Type II secretory pathway, component ExeA (pr 87.43
TIGR00635305 ruvB Holliday junction DNA helicase, RuvB subunit. 87.42
PF12846304 AAA_10: AAA-like domain 87.4
PRK07993334 DNA polymerase III subunit delta'; Validated 87.37
PRK05564313 DNA polymerase III subunit delta'; Validated 87.25
TIGR03346852 chaperone_ClpB ATP-dependent chaperone ClpB. Membe 87.14
COG0467260 RAD55 RecA-superfamily ATPases implicated in signa 87.06
cd01131198 PilT Pilus retraction ATPase PilT. PilT is a nucle 87.04
PRK04328249 hypothetical protein; Provisional 86.99
PRK03992389 proteasome-activating nucleotidase; Provisional 86.87
PRK00080328 ruvB Holliday junction DNA helicase RuvB; Reviewed 86.84
COG2812515 DnaX DNA polymerase III, gamma/tau subunits [DNA r 86.74
TIGR02688449 conserved hypothetical protein TIGR02688. Members 86.56
PLN03187344 meiotic recombination protein DMC1 homolog; Provis 86.4
COG0541451 Ffh Signal recognition particle GTPase [Intracellu 86.34
TIGR02788308 VirB11 P-type DNA transfer ATPase VirB11. The VirB 86.24
KOG2228408 consensus Origin recognition complex, subunit 4 [R 85.85
KOG0741744 consensus AAA+-type ATPase [Posttranslational modi 85.8
cd01128249 rho_factor Transcription termination factor rho is 85.7
TIGR00602637 rad24 checkpoint protein rad24. This family is bas 85.55
CHL00176638 ftsH cell division protein; Validated 85.45
PRK06090319 DNA polymerase III subunit delta'; Validated 85.32
CHL00095821 clpC Clp protease ATP binding subunit 85.31
TIGR01243733 CDC48 AAA family ATPase, CDC48 subfamily. This sub 85.28
PRK13695174 putative NTPase; Provisional 85.22
PF13671143 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1 85.2
PRK10436462 hypothetical protein; Provisional 85.19
KOG0733802 consensus Nuclear AAA ATPase (VCP subfamily) [Post 85.11
COG1126240 GlnQ ABC-type polar amino acid transport system, A 85.07
PF05894333 Podovirus_Gp16: Podovirus DNA encapsidation protei 84.94
TIGR01073726 pcrA ATP-dependent DNA helicase PcrA. Designed to 84.94
cd00267157 ABC_ATPase ABC (ATP-binding cassette) transporter 84.79
cd00984242 DnaB_C DnaB helicase C terminal domain. The hexame 84.69
COG3598402 RepA RecA-family ATPase [DNA replication, recombin 84.68
PF12775272 AAA_7: P-loop containing dynein motor region D3; P 84.64
COG1074 1139 RecB ATP-dependent exoDNAse (exonuclease V) beta s 84.64
TIGR02538564 type_IV_pilB type IV-A pilus assembly ATPase PilB. 84.62
TIGR02655484 circ_KaiC circadian clock protein KaiC. Members of 84.58
PF13238129 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB 84.5
cd03247178 ABCC_cytochrome_bd The CYD subfamily implicated in 84.5
TIGR02785 1232 addA_Gpos recombination helicase AddA, Firmicutes 84.41
TIGR03881229 KaiC_arch_4 KaiC domain protein, PAE1156 family. M 84.37
KOG1969877 consensus DNA replication checkpoint protein CHL12 84.23
TIGR03689512 pup_AAA proteasome ATPase. In the Actinobacteria, 84.22
PRK13764602 ATPase; Provisional 84.18
COG0630312 VirB11 Type IV secretory pathway, VirB11 component 84.12
cd02034116 CooC The accessory protein CooC, which contains a 84.06
TIGR02639731 ClpA ATP-dependent Clp protease ATP-binding subuni 83.93
PF05876557 Terminase_GpA: Phage terminase large subunit (GpA) 83.91
TIGR03263180 guanyl_kin guanylate kinase. Members of this famil 83.91
cd03221144 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is 83.88
PF10443431 RNA12: RNA12 protein; InterPro: IPR018850 Mitochon 83.87
TIGR02237209 recomb_radB DNA repair and recombination protein R 83.72
KOG20361011 consensus Predicted P-loop ATPase fused to an acet 83.48
COG0593408 DnaA ATPase involved in DNA replication initiation 83.22
PF03969362 AFG1_ATPase: AFG1-like ATPase; InterPro: IPR005654 82.84
TIGR02533486 type_II_gspE general secretory pathway protein E. 82.52
cd01394218 radB RadB. The archaeal protein radB shares simila 82.32
PRK00300205 gmk guanylate kinase; Provisional 82.23
PF01580205 FtsK_SpoIIIE: FtsK/SpoIIIE family; InterPro: IPR00 82.23
KOG0738491 consensus AAA+-type ATPase [Posttranslational modi 82.18
CHL00095821 clpC Clp protease ATP binding subunit 81.74
PF00265176 TK: Thymidine kinase; InterPro: IPR001267 Thymidin 81.73
cd03228171 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein 81.7
TIGR03880224 KaiC_arch_3 KaiC domain protein, AF_0351 family. T 81.63
TIGR03345852 VI_ClpV1 type VI secretion ATPase, ClpV1 family. M 81.62
TIGR01650327 PD_CobS cobaltochelatase, CobS subunit. This model 81.36
PRK08233182 hypothetical protein; Provisional 81.26
cd03281213 ABC_MSH5_euk MutS5 homolog in eukaryotes. The MutS 81.2
PF07728139 AAA_5: AAA domain (dynein-related subfamily); Inte 81.12
PRK10917681 ATP-dependent DNA helicase RecG; Provisional 81.09
TIGR01817534 nifA Nif-specific regulatory protein. This model r 81.08
COG1110 1187 Reverse gyrase [DNA replication, recombination, an 81.05
COG1222406 RPT1 ATP-dependent 26S proteasome regulatory subun 81.0
PRK05917290 DNA polymerase III subunit delta'; Validated 81.0
COG3839338 MalK ABC-type sugar transport systems, ATPase comp 81.0
COG2909894 MalT ATP-dependent transcriptional regulator [Tran 80.99
KOG0733802 consensus Nuclear AAA ATPase (VCP subfamily) [Post 80.71
PRK11034758 clpA ATP-dependent Clp protease ATP-binding subuni 80.57
cd00071137 GMPK Guanosine monophosphate kinase (GMPK, EC 2.7. 80.48
PRK05580679 primosome assembly protein PriA; Validated 80.45
COG1219408 ClpX ATP-dependent protease Clp, ATPase subunit [P 80.44
KOG0744423 consensus AAA+-type ATPase [Posttranslational modi 80.35
TIGR00750300 lao LAO/AO transport system ATPase. Mutations have 80.3
PRK08699325 DNA polymerase III subunit delta'; Validated 80.28
>KOG0920 consensus ATP-dependent RNA helicase A [RNA processing and modification] Back     alignment and domain information 
Probab=100.00  E-value=8.9e-149  Score=1360.85  Aligned_cols=874  Identities=47%  Similarity=0.761  Sum_probs=775.3

Q ss_pred             chhHHHHHHHhhhcCCCccceecccccCcccHHHHHHHHHHhcccccccc--eEEEeecCCCCCCccCCCcCC--Ccccc
Q 000991          132 NIDEWRWKLTMLLRNKDEQEVVSRAKKDRRDFEQLSALATRMGLHSRQYA--KVVVFSKAPLPNYRSDLDEKR--PQREV  207 (1197)
Q Consensus       132 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~--~~~~~~~~~~~~~~~~~~~~~--~~~~~  207 (1197)
                      ++..|.++.++.......+|++....+++.+++.|+++...++.++..+.  ...++++.+.|++..+++...  ++.+.
T Consensus        23 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~  102 (924)
T KOG0920|consen   23 DSHAWLRDSSSSKEMTDDDEVIRALTQSRLPKNLLEKLIQIARSSSTAKNLMKFHTVSKITEPSRLLDLSPKPMTLQAKL  102 (924)
T ss_pred             cccccccCccccccccCcceeehhccccCcccccchHHHHHHHhhhhhhhcccceeeeccCCCCceeeecccccchhhhh
Confidence            78888777775445566689999999999999999999999999866664  578999999999999988875  77788


Q ss_pred             ccCccchHHHHHHHHHHHhhhhhcccccccccCCCCCCCCcchhhhhhhhcchHHHHHHHHHHHHHHHHHHHHHhcChhh
Q 000991          208 ILPFGLLREVDAHLKAYLSQKYINASMSSLSNVGSTTNDEGLYEQQEQLVQNSVVRERILRQRSLQMHEKQQAWQESPEG  287 (1197)
Q Consensus       208 ~~~~~~~~r~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~s~~l~~~~~~~~~s~~~  287 (1197)
                      ....+...+...++..+.+... .. ....... .....+    ..++.....          +..   .+..+..+..|
T Consensus       103 ~~~~~~~~~~~~~~~~~~~~~~-~~-~~~~~~~-~~~~~~----~~d~~~~~~----------s~~---~~~~~~~s~~~  162 (924)
T KOG0920|consen  103 KLKAEAENKAAALVCKLLESLK-LV-DRNNENL-LLPTTG----QKDEPLLKK----------SIS---RQSEPKKSESY  162 (924)
T ss_pred             eecccccchhHHHHHHHHHHhc-cC-CCccccc-cccccc----ccccccCcc----------hhh---hhchhhhhhHH
Confidence            8888888888888777765543 10 0000000 111100    010000000          000   55677889999


Q ss_pred             HHHHHHhhcCCCHHHHHHHHHHHHcCCeEEEEecCCChHHHHHHHHHHHHHHHHccCCceEEEecchHHHHHHHHHHHHH
Q 000991          288 QKMLEFRRSLPSYKERDALLKAISENQVVVVSGETGCGKTTQLPQYILESETEAARGAACSIICTQPRRISAMAVSERVA  367 (1197)
Q Consensus       288 ~~~~~~R~~LPi~~~q~~Il~~I~~~~vvII~apTGSGKTtq~pq~ILe~~~~~~~g~~~~IivtqPrR~LA~qva~rVa  367 (1197)
                      +++++.|.+||+|+++++|+++|.++++++|+|+||||||||+|||||+..+..+  +.|+|+||||||++|+++|+||+
T Consensus       163 ~~~~~~R~~LPa~~~r~~Il~~i~~~qVvvIsGeTGcGKTTQvpQfiLd~~~~~~--~~~~IicTQPRRIsAIsvAeRVa  240 (924)
T KOG0920|consen  163 KEMLRFRESLPAYKMRDTILDAIEENQVVVISGETGCGKTTQVPQFILDEAIESG--AACNIICTQPRRISAISVAERVA  240 (924)
T ss_pred             HHHHHHHHhCccHHHHHHHHHHHHhCceEEEeCCCCCCchhhhhHHHHHHHHhcC--CCCeEEecCCchHHHHHHHHHHH
Confidence            9999999999999999999999999999999999999999999999999998765  78999999999999999999999


Q ss_pred             HHhCCcccceeeeEeeeccccCCCceEEEEcchHHHHHHhcCCCCCCccEEEEecCCCCCCChhHHHHHHHHHcccCccc
Q 000991          368 AERGEKLGESVGYKVRLEGMKGRDTRLMFCTTGILLRRLLVDRSLRGVTHVIVDEIHERGMNEDFLLIVLKELLPRRPEL  447 (1197)
Q Consensus       368 ~e~g~~lg~~VGy~ir~e~~~~~~t~Ilv~Tpg~LLr~L~~d~~L~~is~VIIDEaHeR~~~~D~Ll~lLr~ll~~r~~l  447 (1197)
                      .|+++.+|..|||+||.++..+..+.|+|||+|+||+.|+.++.+.+++|||+||||||++++||++.+++.++..+|++
T Consensus       241 ~ER~~~~g~~VGYqvrl~~~~s~~t~L~fcTtGvLLr~L~~~~~l~~vthiivDEVHER~i~~DflLi~lk~lL~~~p~L  320 (924)
T KOG0920|consen  241 KERGESLGEEVGYQVRLESKRSRETRLLFCTTGVLLRRLQSDPTLSGVTHIIVDEVHERSINTDFLLILLKDLLPRNPDL  320 (924)
T ss_pred             HHhccccCCeeeEEEeeecccCCceeEEEecHHHHHHHhccCcccccCceeeeeeEEEccCCcccHHHHHHHHhhhCCCc
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             eEEEecccCCHHHHHhhhCCCCccccCCcccceeeeehHhHHHHhhhccCcccccccchhhhhHHHHHHHHHHHhhhhhh
Q 000991          448 RLILMSATLNAELFSSYFGGAPMLHIPGFTYPVRAYFLENILEMTRYRLNTYNQIDDYGQEKSWKMQKQALALRKRKSSI  527 (1197)
Q Consensus       448 klIlmSATl~~~~f~~yf~~~pvi~i~gr~~PV~~~yledi~~l~~~~l~~~~~i~~~~~e~~~~~~~~~~~~~~~~~~~  527 (1197)
                      |+|+||||+|++.|++||++||+++|+|++|||..+|+||++..++|........  .+.+..                 
T Consensus       321 kvILMSAT~dae~fs~YF~~~pvi~i~grtfpV~~~fLEDil~~~~~~~~~~~~~--~~~~~~-----------------  381 (924)
T KOG0920|consen  321 KVILMSATLDAELFSDYFGGCPVITIPGRTFPVKEYFLEDILSKTGYVSEDDSAR--SGPERS-----------------  381 (924)
T ss_pred             eEEEeeeecchHHHHHHhCCCceEeecCCCcchHHHHHHHHHHHhcccccccccc--cccccC-----------------
Confidence            9999999999999999999999999999999999999999999998776543322  000000                 


Q ss_pred             HHHHHHHHHhhhhcchhhhhhhccccCCCCCCchhhHHHHHHHHHhhcCCCcEEEEeCCHHHHHHHHHHHHcCCCCCCCC
Q 000991          528 ASAVEDALEAADFREYSVQTQQSLSCWNPDSIGFNLIEHVLCHIVKKERPGAVLVFMTGWDDINSLKDQLQAHPLLGDPS  607 (1197)
Q Consensus       528 ~~~ve~~l~~~~~~~~~~~~~~~l~~~~~~~i~~~li~~ll~~i~~~~~~g~iLVFl~~~~ei~~l~~~L~~~~~~~~~~  607 (1197)
                            .+.           ...+..|.++ ++++++..++.+|+.....|+||||+||+++|..+.+.|.....+.+..
T Consensus       382 ------~~~-----------~~~~~~~~~~-id~~Li~~li~~I~~~~~~GaILVFLPG~~eI~~~~~~L~~~~~f~~~~  443 (924)
T KOG0920|consen  382 ------QLR-----------LARLKLWEPE-IDYDLIEDLIEYIDEREFEGAILVFLPGWEEILQLKELLEVNLPFADSL  443 (924)
T ss_pred             ------ccc-----------cccchhcccc-ccHHHHHHHHHhcccCCCCceEEEEcCCHHHHHHHHHHhhhcccccccc
Confidence                  000           0003334444 9999999999999999889999999999999999999999877777777


Q ss_pred             ceEEEeccCCCCHHHHHHhcCCCCCCceEEEEeecccccccccCCEEEEEeCCCCCcccccCCCCCCCccccccCHhhHH
Q 000991          608 RVLLLACHGSMASSEQRLIFDKPEDGVRKIVLATNMAETSITINDVVFVIDCGKAKETSYDALNNTPCLLPSWISKAAAR  687 (1197)
Q Consensus       608 ~~~I~~lHs~L~~~er~~v~~~f~~G~~kVLVATniaEtGIdIPdV~~VId~G~~k~~~yD~~~~~~~l~~~~iSkas~~  687 (1197)
                      ++.+.++||.|+..||+.||..++.|.+|||+||||||+|||||||.||||+|+.|++.||+.++++++...|+|+|++.
T Consensus       444 ~~~ilplHs~~~s~eQ~~VF~~pp~g~RKIIlaTNIAETSITIdDVvyVIDsG~~Ke~~yD~~~~~s~l~~~wvSkAna~  523 (924)
T KOG0920|consen  444 KFAILPLHSSIPSEEQQAVFKRPPKGTRKIILATNIAETSITIDDVVYVIDSGLVKEKSYDPERKVSCLLLSWVSKANAK  523 (924)
T ss_pred             ceEEEeccccCChHHHHHhcCCCCCCcchhhhhhhhHhhcccccCeEEEEecCeeeeeeecccCCcchhheeeccccchH
Confidence            89999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             hhhcccCCCCCCeEEEeccccchhhhhh-cCCccccccchhhhhHHhhhcCCCCHHHHHhhhcCCCChhhHHHHHHHHHH
Q 000991          688 QRRGRAGRVQPGECYHLYPRYVYDAFAD-YQLPELLRTPLQSLCLQIKSLQLGSISEFLSRALQPPEPLSVKNAIEYLQI  766 (1197)
Q Consensus       688 QR~GRAGR~~~G~cy~Lys~~~~~~l~~-~~~PEIlr~~L~~l~L~lk~l~~~~i~~fL~~~ldpP~~~~v~~Al~~L~~  766 (1197)
                      ||+|||||+++|.||+||++..|+.+.. +++|||+|.+|+++||++|.++.+++.+||+++++||+..++..|+..|..
T Consensus       524 QR~GRAGRv~~G~cy~L~~~~~~~~~~~~~q~PEilR~pL~~l~L~iK~l~~~~~~~fLskaldpP~~~~v~~a~~~L~~  603 (924)
T KOG0920|consen  524 QRRGRAGRVRPGICYHLYTRSRYEKLMLAYQLPEILRTPLEELCLHIKVLEQGSIKAFLSKALDPPPADAVDLAIERLKQ  603 (924)
T ss_pred             HhcccccCccCCeeEEeechhhhhhcccccCChHHHhChHHHhhheeeeccCCCHHHHHHHhcCCCChHHHHHHHHHHHH
Confidence            9999999999999999999999999777 999999999999999999999999999999999999999999999999999


Q ss_pred             hcccccCCccccccccccccCCchhhHHHHHHhhhcCCcchHHHHHHhhcCCCCcccCcchHHHHHHHHhhcccCChhhH
Q 000991          767 IGALDENENLTVLGRNLSMLPVEPKLGKMLILGAIFNCLDPVMTVVAGLSVRDPFLMPFDKKDLAESAKAQFSARDYSDH  846 (1197)
Q Consensus       767 lGaLd~~~~lT~LG~~ls~lPvdp~lgK~ll~g~~~~Cl~~~ltIaA~ls~~~pF~~p~~~~~~a~~~r~~f~~~~~SDh  846 (1197)
                      +|||+.+++||+||++|+.||+||++|||+++|++|+|+||+++|||+|+.++||+.|.++++.++++++.|+.+..|||
T Consensus       604 igaL~~~e~LT~LG~~la~lPvd~~igK~ll~g~if~cLdp~l~iaa~Ls~k~PF~~~~~~~~~~~~~~~~~~~~~~SD~  683 (924)
T KOG0920|consen  604 IGALDESEELTPLGLHLASLPVDVRIGKLLLFGAIFGCLDPALTIAAALSFKSPFVSPLGKREEADKAKKLLALDSISDH  683 (924)
T ss_pred             hccccCcccchHHHHHHHhCCCccccchhheehhhccccchhhhHHHHhccCCCcccCCCchhHHHHHHHHhccCCcchH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999997778999


Q ss_pred             HHHHHHHHHHHHHhhc--ccchhhHhhhccchhhHHHHHHHHHHHHHHHHHcCCCCC------CCCCCCCCCCCHHHHHH
Q 000991          847 LALVRAYDGWKDAERH--QSGYEYCWKNFLSAQTLKAIDSLRKQFLFLLKDAGLVDR------NTENCNKWSHDEHLIRA  918 (1197)
Q Consensus       847 l~~l~af~~w~~~~~~--~~~~~~c~~~~Ls~~~l~~i~~~r~ql~~~l~~~gl~~~------~~~~~n~~s~~~~lira  918 (1197)
                      ||+++||+.|++....  ....+||++||||..+|+++.++|.||.+.|.++||++.      ....+|.|+.|++++++
T Consensus       684 la~~~ay~~w~~~~~~~~~~~~~fc~~~fLs~~~l~~i~~l~~q~~~~l~~~g~~~~~~~~~~~~~~~n~~s~~~~~ira  763 (924)
T KOG0920|consen  684 LAVVRAYAGWREILRSGPSAEKDFCEENFLSSNTLQEISSLRVQFLELLSDIGLIPISSTAALTDSECNHNSQNPELVRA  763 (924)
T ss_pred             HHHHHHHHHHHHHHhccchHHHHHHHHhhccHHHHHHHHHHHHHHHHHhhhcccccCCcccccCchhhhhcCCCHHHHHH
Confidence            9999999999999876  467899999999999999999999999999999999875      34568889999999999


Q ss_pred             HHHhccCCCcccccc---ccccceeEeecCCEEEEecCCcCCCCCCCCCCEEEEEeeeeccc-cccccCCCCChHHHHHh
Q 000991          919 VICAGLFPGLCSVVN---KEKSIALKTMEDGQVLLYSNSVNAGVPKIPYPWLVFNEKIKVNS-VFLRDSTGVSDSVLLLF  994 (1197)
Q Consensus       919 ~L~aGlypnva~~~~---~~~~~~~~t~~~~~v~iHPsSv~~~~~~~~~~~lvy~E~v~tsk-~yir~~T~V~p~~LlLF  994 (1197)
                      +||||||||++.+..   ..+...|.|..++.|+|||+|||+....+.+||++|+|+++|++ +|+||+|+|++++++||
T Consensus       764 vl~a~lyP~i~~~~~~~~~~~~~~~~~~~~~~v~i~~~sv~~~~~~~~~p~l~~~~k~~t~~~~~~rd~T~v~~~~~llf  843 (924)
T KOG0920|consen  764 VLCAGLYPNIAFVRRMEPKSKSVTFVTKADGRVIIHPSSVNEQSTGFQSPFLVFPEKVKSTRLVSLRDTTSVSSSALLLF  843 (924)
T ss_pred             HHhccCCCceeeeecccCCcCcceeecCCceeEEEecchhhccccccCCcceEEeeecccCCcceeeecCCCCcHHheee
Confidence            999999999998875   45566788888889999999999998888889999999999999 99999999999999999


Q ss_pred             hCccc-ccccCCcEEEe--CcEEEEEechhHHHHHHHHHHHHHHHHHHHHcCCCCCC----ccchHHHHHHHHHhcc
Q 000991          995 GGNIS-RGGLDGHLKML--GGYLEFFMKPELADTYLSLKREIEELTQQKLLNPELGI----EVQNELLLAVRLLVSE 1064 (1197)
Q Consensus       995 gg~~~-~~~~~~~~~~~--d~~~~~~~~~~~~~~~~~lr~~l~~~l~~k~~~p~~~~----~~~~~~~~ai~~ll~~ 1064 (1197)
                      ||.+. +...+|+..++  |+|+.|.+++++|.+++.||.+||++|++++++|....    ..+.+....+..++..
T Consensus       844 gg~~~~~~~~~~~~~~~~~d~~~~~~~~~~~~~~~~~Lr~~l~~~l~~~~~~p~~~~~~~~~~~~~~~~~~~~~~~~  920 (924)
T KOG0920|consen  844 GGGISTVRMKSGSLALLLPDGWLRFKALPKTARLLKELRRELDSLLSKKIRSPCASLPDSSGKGSESPSLIANLLVG  920 (924)
T ss_pred             cCCceeecCCCCccceecCCceEEeecchhHHHHHHHHHHHHHHHHHHhccCccccccccccccccchhhhhhhhhh
Confidence            99887 55666776554  99999999999999999999999999999999999765    1223466666666654

>KOG0922 consensus DEAH-box RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0924 consensus mRNA splicing factor ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0923 consensus mRNA splicing factor ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0925 consensus mRNA splicing factor ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PRK11131 ATP-dependent RNA helicase HrpA; Provisional Back     alignment and domain information
>TIGR01967 DEAH_box_HrpA ATP-dependent helicase HrpA Back     alignment and domain information
>COG1643 HrpA HrpA-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0926 consensus DEAH-box RNA helicase [RNA processing and modification; Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0921 consensus Dosage compensation complex, subunit MLE [Transcription] Back     alignment and domain information
>TIGR01970 DEAH_box_HrpB ATP-dependent helicase HrpB Back     alignment and domain information
>PRK11664 ATP-dependent RNA helicase HrpB; Provisional Back     alignment and domain information
>PHA02653 RNA helicase NPH-II; Provisional Back     alignment and domain information
>PRK01172 ski2-like helicase; Provisional Back     alignment and domain information
>PRK02362 ski2-like helicase; Provisional Back     alignment and domain information
>KOG0330 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PRK00254 ski2-like helicase; Provisional Back     alignment and domain information
>PRK11776 ATP-dependent RNA helicase DbpA; Provisional Back     alignment and domain information
>KOG0331 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PRK11192 ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>PRK04837 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PRK10590 ATP-dependent RNA helicase RhlE; Provisional Back     alignment and domain information
>PTZ00110 helicase; Provisional Back     alignment and domain information
>PRK11634 ATP-dependent RNA helicase DeaD; Provisional Back     alignment and domain information
>PRK01297 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PRK04537 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PLN00206 DEAD-box ATP-dependent RNA helicase; Provisional Back     alignment and domain information
>TIGR03817 DECH_helic helicase/secretion neighborhood putative DEAH-box helicase Back     alignment and domain information
>COG0513 SrmB Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PTZ00424 helicase 45; Provisional Back     alignment and domain information
>COG1204 Superfamily II helicase [General function prediction only] Back     alignment and domain information
>COG1202 Superfamily II helicase, archaea-specific [General function prediction only] Back     alignment and domain information
>KOG0338 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0333 consensus U5 snRNP-like RNA helicase subunit [RNA processing and modification] Back     alignment and domain information
>KOG0345 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>TIGR00614 recQ_fam ATP-dependent DNA helicase, RecQ family Back     alignment and domain information
>KOG0342 consensus ATP-dependent RNA helicase pitchoune [RNA processing and modification] Back     alignment and domain information
>KOG0328 consensus Predicted ATP-dependent RNA helicase FAL1, involved in rRNA maturation, DEAD-box superfamily [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK13767 ATP-dependent helicase; Provisional Back     alignment and domain information
>KOG0343 consensus RNA Helicase [RNA processing and modification] Back     alignment and domain information
>PRK11057 ATP-dependent DNA helicase RecQ; Provisional Back     alignment and domain information
>PLN03137 ATP-dependent DNA helicase; Q4-like; Provisional Back     alignment and domain information
>KOG0340 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0348 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>COG1201 Lhr Lhr-like helicases [General function prediction only] Back     alignment and domain information
>PRK09751 putative ATP-dependent helicase Lhr; Provisional Back     alignment and domain information
>KOG0335 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>TIGR01389 recQ ATP-dependent DNA helicase RecQ Back     alignment and domain information
>KOG0949 consensus Predicted helicase, DEAD-box superfamily [General function prediction only] Back     alignment and domain information
>COG1111 MPH1 ERCC4-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0347 consensus RNA helicase [RNA processing and modification] Back     alignment and domain information
>TIGR00580 mfd transcription-repair coupling factor (mfd) Back     alignment and domain information
>KOG0326 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0336 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0339 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>TIGR01587 cas3_core CRISPR-associated helicase Cas3 Back     alignment and domain information
>KOG0332 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PRK10689 transcription-repair coupling factor; Provisional Back     alignment and domain information
>KOG0921 consensus Dosage compensation complex, subunit MLE [Transcription] Back     alignment and domain information
>KOG0354 consensus DEAD-box like helicase [General function prediction only] Back     alignment and domain information
>PRK10917 ATP-dependent DNA helicase RecG; Provisional Back     alignment and domain information
>TIGR00643 recG ATP-dependent DNA helicase RecG Back     alignment and domain information
>KOG0952 consensus DNA/RNA helicase MER3/SLH1, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>TIGR02621 cas3_GSU0051 CRISPR-associated helicase Cas3, Anaes-subtype Back     alignment and domain information
>KOG0350 consensus DEAD-box ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0341 consensus DEAD-box protein abstrakt [RNA processing and modification] Back     alignment and domain information
>KOG0947 consensus Cytoplasmic exosomal RNA helicase SKI2, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>KOG0948 consensus Nuclear exosomal RNA helicase MTR4, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>KOG0346 consensus RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0327 consensus Translation initiation factor 4F, helicase subunit (eIF-4A) and related helicases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK13766 Hef nuclease; Provisional Back     alignment and domain information
>KOG0344 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PHA02558 uvsW UvsW helicase; Provisional Back     alignment and domain information
>TIGR03158 cas3_cyano CRISPR-associated helicase, Cyano-type Back     alignment and domain information
>KOG0334 consensus RNA helicase [RNA processing and modification] Back     alignment and domain information
>COG1205 Distinct helicase family with a unique C-terminal domain including a metal-binding cysteine cluster [General function prediction only] Back     alignment and domain information
>KOG4284 consensus DEAD box protein [Transcription] Back     alignment and domain information
>COG4581 Superfamily II RNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>COG0514 RecQ Superfamily II DNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0951 consensus RNA helicase BRR2, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>PRK09401 reverse gyrase; Reviewed Back     alignment and domain information
>PRK14701 reverse gyrase; Provisional Back     alignment and domain information
>TIGR00603 rad25 DNA repair helicase rad25 Back     alignment and domain information
>KOG0337 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>TIGR01054 rgy reverse gyrase Back     alignment and domain information
>PRK05580 primosome assembly protein PriA; Validated Back     alignment and domain information
>PRK09694 helicase Cas3; Provisional Back     alignment and domain information
>TIGR03714 secA2 accessory Sec system translocase SecA2 Back     alignment and domain information
>PRK12898 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK09200 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0352 consensus ATP-dependent DNA helicase [Replication, recombination and repair] Back     alignment and domain information
>COG1061 SSL2 DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR00963 secA preprotein translocase, SecA subunit Back     alignment and domain information
>TIGR00595 priA primosomal protein N' Back     alignment and domain information
>COG4098 comFA Superfamily II DNA/RNA helicase required for DNA uptake (late competence protein) [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0950 consensus DNA polymerase theta/eta, DEAD-box superfamily [General function prediction only] Back     alignment and domain information
>PRK11448 hsdR type I restriction enzyme EcoKI subunit R; Provisional Back     alignment and domain information
>KOG0351 consensus ATP-dependent DNA helicase [Replication, recombination and repair] Back     alignment and domain information
>COG1200 RecG RecG-like helicase [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>COG1197 Mfd Transcription-repair coupling factor (superfamily II helicase) [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>PRK04914 ATP-dependent helicase HepA; Validated Back     alignment and domain information
>KOG0353 consensus ATP-dependent DNA helicase [General function prediction only] Back     alignment and domain information
>PF07717 OB_NTP_bind: Oligonucleotide/oligosaccharide-binding (OB)-fold; InterPro: IPR011709 This domain is found towards the C terminus of the DEAD-box helicases (IPR011545 from INTERPRO) Back     alignment and domain information
>KOG0349 consensus Putative DEAD-box RNA helicase DDX1 [RNA processing and modification] Back     alignment and domain information
>COG1203 CRISPR-associated helicase Cas3 [Defense mechanisms] Back     alignment and domain information
>PRK13104 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0329 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PF00270 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 Members of this family include the DEAD and DEAH box helicases Back     alignment and domain information
>PRK12906 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>cd00268 DEADc DEAD-box helicases Back     alignment and domain information
>PRK12904 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PF04408 HA2: Helicase associated domain (HA2); InterPro: IPR007502 This presumed domain is about 90 amino acid residues in length Back     alignment and domain information
>COG4096 HsdR Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms] Back     alignment and domain information
>TIGR00348 hsdR type I site-specific deoxyribonuclease, HsdR family Back     alignment and domain information
>PRK13107 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK12899 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>COG1110 Reverse gyrase [DNA replication, recombination, and repair] Back     alignment and domain information
>smart00847 HA2 Helicase associated domain (HA2) Add an annotation Back     alignment and domain information
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0953 consensus Mitochondrial RNA helicase SUV3, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>PLN03142 Probable chromatin-remodeling complex ATPase chain; Provisional Back     alignment and domain information
>TIGR01407 dinG_rel DnaQ family exonuclease/DinG family helicase, putative Back     alignment and domain information
>smart00487 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>cd00046 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>KOG4150 consensus Predicted ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>TIGR02562 cas3_yersinia CRISPR-associated helicase Cas3 Back     alignment and domain information
>cd00079 HELICc Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may not be an autonomously folding unit, but an integral part of the helicase; 4 helicase superfamilies at present according to the organization of their signature motifs; all helicases share the ability to unwind nucleic acid duplexes with a distinct directional polarity; they utilize the free energy from nucleoside triphosphate hydrolysis to fuel their translocation along DNA, unwinding the duplex in the process Back     alignment and domain information
>TIGR00631 uvrb excinuclease ABC, B subunit Back     alignment and domain information
>PF00271 Helicase_C: Helicase conserved C-terminal domain; InterPro: IPR001650 The domain, which defines this group of proteins is found in a wide variety of helicases and helicase related proteins Back     alignment and domain information
>PF04851 ResIII: Type III restriction enzyme, res subunit; InterPro: IPR006935 This entry represents a domain found in the N terminus of several proteins, including helicases, the R subunit (HsdR) of type I restriction endonucleases (3 Back     alignment and domain information
>PRK07246 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>PRK05298 excinuclease ABC subunit B; Provisional Back     alignment and domain information
>PF07652 Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR011492 This is the Flavivirus DEAD domain Back     alignment and domain information
>PRK12326 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0385 consensus Chromatin remodeling complex WSTF-ISWI, small subunit [Transcription] Back     alignment and domain information
>PRK13103 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG1123 consensus RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, 3'-5' helicase subunit SSL2 [Transcription; Replication, recombination and repair] Back     alignment and domain information
>KOG0951 consensus RNA helicase BRR2, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>PRK12900 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>smart00490 HELICc helicase superfamily c-terminal domain Back     alignment and domain information
>PRK08074 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>PRK12903 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>CHL00122 secA preprotein translocase subunit SecA; Validated Back     alignment and domain information
>COG0556 UvrB Helicase subunit of the DNA excision repair complex [DNA replication, recombination, and repair] Back     alignment and domain information
>PF02399 Herpes_ori_bp: Origin of replication binding protein; InterPro: IPR003450 This entry represents replication origin binding protein Back     alignment and domain information
>KOG0387 consensus Transcription-coupled repair protein CSB/RAD26 (contains SNF2 family DNA-dependent ATPase domain) [Transcription; Replication, recombination and repair] Back     alignment and domain information
>PRK14873 primosome assembly protein PriA; Provisional Back     alignment and domain information
>KOG0390 consensus DNA repair protein, SNF2 family [Replication, recombination and repair] Back     alignment and domain information
>KOG0384 consensus Chromodomain-helicase DNA-binding protein [Transcription] Back     alignment and domain information
>PRK12902 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK11747 dinG ATP-dependent DNA helicase DinG; Provisional Back     alignment and domain information
>COG1199 DinG Rad3-related DNA helicases [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR00604 rad3 DNA repair helicase (rad3) Back     alignment and domain information
>COG4889 Predicted helicase [General function prediction only] Back     alignment and domain information
>TIGR03117 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase Csf4 Back     alignment and domain information
>cd00048 DSRM Double-stranded RNA binding motif Back     alignment and domain information
>KOG0392 consensus SNF2 family DNA-dependent ATPase domain-containing protein [Transcription] Back     alignment and domain information
>smart00358 DSRM Double-stranded RNA binding motif Back     alignment and domain information
>PF00035 dsrm: Double-stranded RNA binding motif; InterPro: IPR001159 The DsRBD domain is found in a variety of RNA-binding proteins with different structures and exhibiting a diversity of functions [] Back     alignment and domain information
>KOG1000 consensus Chromatin remodeling protein HARP/SMARCAL1, DEAD-box superfamily [Chromatin structure and dynamics] Back     alignment and domain information
>PHA02701 ORF020 dsRNA-binding PKR inhibitor; Provisional Back     alignment and domain information
>PF00176 SNF2_N: SNF2 family N-terminal domain; InterPro: IPR000330 This domain is found in proteins involved in a variety of processes including transcription regulation (e Back     alignment and domain information
>PHA03103 double-strand RNA-binding protein; Provisional Back     alignment and domain information
>COG0610 Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms] Back     alignment and domain information
>TIGR00596 rad1 DNA repair protein (rad1) Back     alignment and domain information
>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B Back     alignment and domain information
>PRK12371 ribonuclease III; Reviewed Back     alignment and domain information
>KOG0389 consensus SNF2 family DNA-dependent ATPase [Chromatin structure and dynamics] Back     alignment and domain information
>PF13245 AAA_19: Part of AAA domain Back     alignment and domain information
>PRK00102 rnc ribonuclease III; Reviewed Back     alignment and domain information
>KOG0952 consensus DNA/RNA helicase MER3/SLH1, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] Back     alignment and domain information
>PRK12723 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK12372 ribonuclease III; Reviewed Back     alignment and domain information
>PRK14718 ribonuclease III; Provisional Back     alignment and domain information
>PF06862 DUF1253: Protein of unknown function (DUF1253); InterPro: IPR010678 This family is defined by a C-terminal region of approximately 500 residues, Digestive organ expansion factor (DEF) is thought to Regulate the p53 pathway to control the expansion growth of digestive organs and is required for the expansion growth of intestine, liver and exocrine pancreas, but not endocrine pancreas [, ] Back     alignment and domain information
>PRK12901 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>COG0653 SecA Preprotein translocase subunit SecA (ATPase, RNA helicase) [Intracellular trafficking and secretion] Back     alignment and domain information
>PF13604 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL_A 3E1S_A 3GP8_A Back     alignment and domain information
>PF02562 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH is a cytoplasmic protein and predicted ATPase that is induced by phosphate starvation and belongings to the phosphate regulon (pho) in Escherichia coli [] Back     alignment and domain information
>TIGR01447 recD exodeoxyribonuclease V, alpha subunit Back     alignment and domain information
>KOG1002 consensus Nucleotide excision repair protein RAD16 [Replication, recombination and repair] Back     alignment and domain information
>KOG1803 consensus DNA helicase [Replication, recombination and repair] Back     alignment and domain information
>TIGR02191 RNaseIII ribonuclease III, bacterial Back     alignment and domain information
>COG0571 Rnc dsRNA-specific ribonuclease [Transcription] Back     alignment and domain information
>PF14709 DND1_DSRM: double strand RNA binding domain from DEAD END PROTEIN 1 Back     alignment and domain information
>KOG0386 consensus Chromatin remodeling complex SWI/SNF, component SWI2 and related ATPases (DNA/RNA helicase superfamily) [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK10875 recD exonuclease V subunit alpha; Provisional Back     alignment and domain information
>PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>COG1419 FlhF Flagellar GTP-binding protein [Cell motility and secretion] Back     alignment and domain information
>PRK10536 hypothetical protein; Provisional Back     alignment and domain information
>COG0553 HepA Superfamily II DNA/RNA helicases, SNF2 family [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>PRK06526 transposase; Provisional Back     alignment and domain information
>PF09848 DUF2075: Uncharacterized conserved protein (DUF2075); InterPro: IPR018647 This domain, found in putative ATP/GTP binding proteins, has no known function Back     alignment and domain information
>PF05729 NACHT: NACHT domain Back     alignment and domain information
>TIGR01448 recD_rel helicase, putative, RecD/TraA family Back     alignment and domain information
>PRK12726 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK12727 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>KOG2340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK12724 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PF13307 Helicase_C_2: Helicase C-terminal domain; PDB: 4A15_A 2VSF_A 3CRV_A 3CRW_1 2VL7_A Back     alignment and domain information
>PRK15483 type III restriction-modification system StyLTI enzyme res; Provisional Back     alignment and domain information
>PF05970 PIF1: PIF1-like helicase; InterPro: IPR010285 This entry represents PIF1 helicase and related proteins Back     alignment and domain information
>smart00489 DEXDc3 DEAD-like helicases superfamily Back     alignment and domain information
>smart00488 DEXDc2 DEAD-like helicases superfamily Back     alignment and domain information
>PRK14974 cell division protein FtsY; Provisional Back     alignment and domain information
>PRK08181 transposase; Validated Back     alignment and domain information
>PF13086 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV_A 2XZP_A 2GK6_A 2GK7_A 2GJK_A Back     alignment and domain information
>KOG1802 consensus RNA helicase nonsense mRNA reducing factor (pNORF1) [RNA processing and modification] Back     alignment and domain information
>PF07517 SecA_DEAD: SecA DEAD-like domain; InterPro: IPR011115 SecA protein binds to the plasma membrane where it interacts with proOmpA to support translocation of proOmpA through the membrane Back     alignment and domain information
>TIGR02768 TraA_Ti Ti-type conjugative transfer relaxase TraA Back     alignment and domain information
>PRK04296 thymidine kinase; Provisional Back     alignment and domain information
>PF00580 UvrD-helicase: UvrD/REP helicase N-terminal domain; InterPro: IPR000212 Members of this family are helicases that catalyse ATP dependent unwinding of double stranded DNA to single stranded DNA Back     alignment and domain information
>PHA03333 putative ATPase subunit of terminase; Provisional Back     alignment and domain information
>PRK09183 transposase/IS protein; Provisional Back     alignment and domain information
>PRK14723 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK14721 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK13889 conjugal transfer relaxase TraA; Provisional Back     alignment and domain information
>PRK07003 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PF12340 DUF3638: Protein of unknown function (DUF3638); InterPro: IPR022099 This domain family is found in eukaryotes, and is approximately 230 amino acids in length Back     alignment and domain information
>smart00382 AAA ATPases associated with a variety of cellular activities Back     alignment and domain information
>KOG4439 consensus RNA polymerase II transcription termination factor TTF2/lodestar, DEAD-box superfamily [Transcription; Replication, recombination and repair] Back     alignment and domain information
>PRK06731 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>PF13173 AAA_14: AAA domain Back     alignment and domain information
>PRK14956 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK06995 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>PRK06835 DNA replication protein DnaC; Validated Back     alignment and domain information
>PRK10416 signal recognition particle-docking protein FtsY; Provisional Back     alignment and domain information
>PF13872 AAA_34: P-loop containing NTP hydrolase pore-1 Back     alignment and domain information
>PF05127 Helicase_RecD: Helicase; InterPro: IPR007807 This domain is about 350 amino acid residues long and appears to have a P-loop motif, suggesting this is an ATPase Back     alignment and domain information
>PRK07994 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK00771 signal recognition particle protein Srp54; Provisional Back     alignment and domain information
>PRK14949 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily Back     alignment and domain information
>TIGR03499 FlhF flagellar biosynthetic protein FlhF Back     alignment and domain information
>TIGR00376 DNA helicase, putative Back     alignment and domain information
>PRK08727 hypothetical protein; Validated Back     alignment and domain information
>PRK12323 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK08691 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda Back     alignment and domain information
>PRK14961 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR00064 ftsY signal recognition particle-docking protein FtsY Back     alignment and domain information
>PRK08903 DnaA regulatory inactivator Hda; Validated Back     alignment and domain information
>PRK14957 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN Back     alignment and domain information
>KOG0391 consensus SNF2 family DNA-dependent ATPase [General function prediction only] Back     alignment and domain information
>PRK13826 Dtr system oriT relaxase; Provisional Back     alignment and domain information
>PRK14964 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif Back     alignment and domain information
>PRK09112 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK07952 DNA replication protein DnaC; Validated Back     alignment and domain information
>PRK14960 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR01425 SRP54_euk signal recognition particle protein SRP54 Back     alignment and domain information
>PRK14958 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK08116 hypothetical protein; Validated Back     alignment and domain information
>PRK07764 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK12402 replication factor C small subunit 2; Reviewed Back     alignment and domain information
>TIGR00678 holB DNA polymerase III, delta' subunit Back     alignment and domain information
>PRK10867 signal recognition particle protein; Provisional Back     alignment and domain information
>PRK00411 cdc6 cell division control protein 6; Reviewed Back     alignment and domain information
>PRK00149 dnaA chromosomal replication initiation protein; Reviewed Back     alignment and domain information
>cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs Back     alignment and domain information
>PRK14952 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK06893 DNA replication initiation factor; Validated Back     alignment and domain information
>PRK14969 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR02928 orc1/cdc6 family replication initiation protein Back     alignment and domain information
>PRK05642 DNA replication initiation factor; Validated Back     alignment and domain information
>PHA02244 ATPase-like protein Back     alignment and domain information
>PRK09111 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14963 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK11331 5-methylcytosine-specific restriction enzyme subunit McrB; Provisional Back     alignment and domain information
>cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes Back     alignment and domain information
>TIGR00959 ffh signal recognition particle protein Back     alignment and domain information
>COG1444 Predicted P-loop ATPase fused to an acetyltransferase [General function prediction only] Back     alignment and domain information
>PTZ00112 origin recognition complex 1 protein; Provisional Back     alignment and domain information
>PF03354 Terminase_1: Phage Terminase ; InterPro: IPR005021 This entry is represented by Lactococcus phage bIL285, Orf41 (terminase) Back     alignment and domain information
>PRK14087 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK14951 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14962 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK07471 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK08084 DNA replication initiation factor; Provisional Back     alignment and domain information
>TIGR00362 DnaA chromosomal replication initiator protein DnaA Back     alignment and domain information
>PRK14965 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR02881 spore_V_K stage V sporulation protein K Back     alignment and domain information
>PHA03368 DNA packaging terminase subunit 1; Provisional Back     alignment and domain information
>PRK06645 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK08451 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR02782 TrbB_P P-type conjugative transfer ATPase TrbB Back     alignment and domain information
>COG1875 NYN ribonuclease and ATPase of PhoH family domains [General function prediction only] Back     alignment and domain information
>PRK13833 conjugal transfer protein TrbB; Provisional Back     alignment and domain information
>PF01637 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 This domain has been found in a number of bacterial and archaeal proteins, all of which contain a conserved P-loop motif that is involved in binding ATP Back     alignment and domain information
>TIGR02760 TraI_TIGR conjugative transfer relaxase protein TraI Back     alignment and domain information
>KOG3732 consensus Staufen and related double-stranded-RNA-binding proteins [Intracellular trafficking, secretion, and vesicular transport; Transcription] Back     alignment and domain information
>PRK11054 helD DNA helicase IV; Provisional Back     alignment and domain information
>PF13177 DNA_pol3_delta2: DNA polymerase III, delta subunit; PDB: 1NJF_B 3GLG_G 1XXH_I 1NJG_A 3GLF_B 3GLI_G 1IQP_E 2GNO_A 1SXJ_E 1A5T_A Back     alignment and domain information
>PRK14959 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd01120 RecA-like_NTPases RecA-like NTPases Back     alignment and domain information
>COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK08939 primosomal protein DnaI; Reviewed Back     alignment and domain information
>PRK12377 putative replication protein; Provisional Back     alignment and domain information
>PRK08533 flagellar accessory protein FlaH; Reviewed Back     alignment and domain information
>PHA02533 17 large terminase protein; Provisional Back     alignment and domain information
>PRK05563 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK05896 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PF05621 TniB: Bacterial TniB protein; InterPro: IPR008868 This family consists of several bacterial TniB NTP-binding proteins Back     alignment and domain information
>PRK14950 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport Back     alignment and domain information
>PRK00440 rfc replication factor C small subunit; Reviewed Back     alignment and domain information
>COG3421 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG2804 PulE Type II secretory pathway, ATPase PulE/Tfp pilus assembly pathway, ATPase PilB [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PRK12900 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK06921 hypothetical protein; Provisional Back     alignment and domain information
>PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair Back     alignment and domain information
>PHA02544 44 clamp loader, small subunit; Provisional Back     alignment and domain information
>COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK14948 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>KOG1805 consensus DNA replication helicase [Replication, recombination and repair] Back     alignment and domain information
>PRK05707 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK07133 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication Back     alignment and domain information
>PRK14955 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR02397 dnaX_nterm DNA polymerase III, subunit gamma and tau Back     alignment and domain information
>KOG0391 consensus SNF2 family DNA-dependent ATPase [General function prediction only] Back     alignment and domain information
>TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX Back     alignment and domain information
>PRK14953 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR03878 thermo_KaiC_2 KaiC domain protein, AF_0795 family Back     alignment and domain information
>KOG2373 consensus Predicted mitochondrial DNA helicase twinkle [Replication, recombination and repair] Back     alignment and domain information
>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family Back     alignment and domain information
>KOG1131 consensus RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, 5'-3' helicase subunit RAD3 [Transcription; Replication, recombination and repair] Back     alignment and domain information
>KOG2777 consensus tRNA-specific adenosine deaminase 1 [RNA processing and modification] Back     alignment and domain information
>PRK14088 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PF01443 Viral_helicase1: Viral (Superfamily 1) RNA helicase; InterPro: IPR000606 This entry includes RNA and DNA helicases Back     alignment and domain information
>TIGR01547 phage_term_2 phage terminase, large subunit, PBSX family Back     alignment and domain information
>KOG0989 consensus Replication factor C, subunit RFC4 [Replication, recombination and repair] Back     alignment and domain information
>PRK07940 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>COG3587 Restriction endonuclease [Defense mechanisms] Back     alignment and domain information
>CHL00181 cbbX CbbX; Provisional Back     alignment and domain information
>PRK06067 flagellar accessory protein FlaH; Validated Back     alignment and domain information
>COG0470 HolB ATPase involved in DNA replication [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK14954 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK12901 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK13342 recombination factor protein RarA; Reviewed Back     alignment and domain information
>COG3973 Superfamily I DNA and RNA helicases [General function prediction only] Back     alignment and domain information
>KOG0388 consensus SNF2 family DNA-dependent ATPase [Replication, recombination and repair] Back     alignment and domain information
>PRK10919 ATP-dependent DNA helicase Rep; Provisional Back     alignment and domain information
>PRK13894 conjugal transfer ATPase TrbB; Provisional Back     alignment and domain information
>PF00437 T2SE: Type II/IV secretion system protein; InterPro: IPR001482 A number of bacterial proteins, some of which are involved in a general secretion pathway (GSP) for the export of proteins (also called the type II pathway) belong to this group [, ] Back     alignment and domain information
>PRK06620 hypothetical protein; Validated Back     alignment and domain information
>PRK14971 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14712 conjugal transfer nickase/helicase TraI; Provisional Back     alignment and domain information
>PRK06647 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK12422 chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK09087 hypothetical protein; Validated Back     alignment and domain information
>PRK13851 type IV secretion system protein VirB11; Provisional Back     alignment and domain information
>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA Back     alignment and domain information
>PRK10865 protein disaggregation chaperone; Provisional Back     alignment and domain information
>PRK13900 type IV secretion system ATPase VirB11; Provisional Back     alignment and domain information
>PF00931 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is the NB-ARC domain, a novel signalling motif found in bacteria and eukaryotes, shared by plant resistance gene products and regulators of cell death in animals [] Back     alignment and domain information
>PLN03025 replication factor C subunit; Provisional Back     alignment and domain information
>PRK14970 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK07399 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK11823 DNA repair protein RadA; Provisional Back     alignment and domain information
>KOG1132 consensus Helicase of the DEAD superfamily [Replication, recombination and repair] Back     alignment and domain information
>PRK06871 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK04195 replication factor C large subunit; Provisional Back     alignment and domain information
>cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases Back     alignment and domain information
>PRK08058 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>COG1435 Tdk Thymidine kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK13709 conjugal transfer nickase/helicase TraI; Provisional Back     alignment and domain information
>PRK14086 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>COG0556 UvrB Helicase subunit of the DNA excision repair complex [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR01074 rep ATP-dependent DNA helicase Rep Back     alignment and domain information
>PF06745 KaiC: KaiC; InterPro: IPR014774 This entry represents a domain within bacterial and archaeal proteins, most of which are hypothetical Back     alignment and domain information
>TIGR02524 dot_icm_DotB Dot/Icm secretion system ATPase DotB Back     alignment and domain information
>PRK08769 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed Back     alignment and domain information
>COG4626 Phage terminase-like protein, large subunit [General function prediction only] Back     alignment and domain information
>TIGR02655 circ_KaiC circadian clock protein KaiC Back     alignment and domain information
>KOG3732 consensus Staufen and related double-stranded-RNA-binding proteins [Intracellular trafficking, secretion, and vesicular transport; Transcription] Back     alignment and domain information
>TIGR01075 uvrD DNA helicase II Back     alignment and domain information
>PTZ00293 thymidine kinase; Provisional Back     alignment and domain information
>PRK11773 uvrD DNA-dependent helicase II; Provisional Back     alignment and domain information
>TIGR02760 TraI_TIGR conjugative transfer relaxase protein TraI Back     alignment and domain information
>cd01393 recA_like RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>COG0552 FtsY Signal recognition particle GTPase [Intracellular trafficking and secretion] Back     alignment and domain information
>PF03237 Terminase_6: Terminase-like family; InterPro: IPR004921 The terminase is a component of the molecular motor that translocates genomic DNA into empty capsids during DNA packaging [] Back     alignment and domain information
>COG1618 Predicted nucleotide kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>TIGR00763 lon ATP-dependent protease La Back     alignment and domain information
>TIGR03877 thermo_KaiC_1 KaiC domain protein, Ph0284 family Back     alignment and domain information
>PRK06305 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR02525 plasmid_TraJ plasmid transfer ATPase TraJ Back     alignment and domain information
>cd01129 PulE-GspE PulE/GspE The type II secretory pathway is the main terminal branch of the general secretory pathway (GSP) Back     alignment and domain information
>COG1221 PspF Transcriptional regulators containing an AAA-type ATPase domain and a DNA-binding domain [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>TIGR00767 rho transcription termination factor Rho Back     alignment and domain information
>PRK06964 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>COG4962 CpaF Flp pilus assembly protein, ATPase CpaF [Intracellular trafficking and secretion] Back     alignment and domain information
>cd01121 Sms Sms (bacterial radA) DNA repair protein Back     alignment and domain information
>PHA00729 NTP-binding motif containing protein Back     alignment and domain information
>COG2255 RuvB Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR01420 pilT_fam pilus retraction protein PilT Back     alignment and domain information
>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional Back     alignment and domain information
>PF13555 AAA_29: P-loop containing region of AAA domain Back     alignment and domain information
>PRK10787 DNA-binding ATP-dependent protease La; Provisional Back     alignment and domain information
>COG2805 PilT Tfp pilus assembly protein, pilus retraction ATPase PilT [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PF03368 Dicer_dimer: Dicer dimerisation domain; InterPro: IPR005034 This domain is found in members of the Dicer protein family of dsRNA nucleases Back     alignment and domain information
>PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A Back     alignment and domain information
>PRK05973 replicative DNA helicase; Provisional Back     alignment and domain information
>PHA00149 DNA encapsidation protein Back     alignment and domain information
>TIGR02974 phageshock_pspF psp operon transcriptional activator PspF Back     alignment and domain information
>KOG2028 consensus ATPase related to the helicase subunit of the Holliday junction resolvase [Replication, recombination and repair] Back     alignment and domain information
>COG3267 ExeA Type II secretory pathway, component ExeA (predicted ATPase) [Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit Back     alignment and domain information
>PF12846 AAA_10: AAA-like domain Back     alignment and domain information
>PRK07993 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK05564 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB Back     alignment and domain information
>COG0467 RAD55 RecA-superfamily ATPases implicated in signal transduction [Signal transduction mechanisms] Back     alignment and domain information
>cd01131 PilT Pilus retraction ATPase PilT Back     alignment and domain information
>PRK04328 hypothetical protein; Provisional Back     alignment and domain information
>PRK03992 proteasome-activating nucleotidase; Provisional Back     alignment and domain information
>PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed Back     alignment and domain information
>COG2812 DnaX DNA polymerase III, gamma/tau subunits [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR02688 conserved hypothetical protein TIGR02688 Back     alignment and domain information
>PLN03187 meiotic recombination protein DMC1 homolog; Provisional Back     alignment and domain information
>COG0541 Ffh Signal recognition particle GTPase [Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR02788 VirB11 P-type DNA transfer ATPase VirB11 Back     alignment and domain information
>KOG2228 consensus Origin recognition complex, subunit 4 [Replication, recombination and repair] Back     alignment and domain information
>KOG0741 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd01128 rho_factor Transcription termination factor rho is a bacterial ATP-dependent RNA/DNA helicase Back     alignment and domain information
>TIGR00602 rad24 checkpoint protein rad24 Back     alignment and domain information
>CHL00176 ftsH cell division protein; Validated Back     alignment and domain information
>PRK06090 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>CHL00095 clpC Clp protease ATP binding subunit Back     alignment and domain information
>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>PRK13695 putative NTPase; Provisional Back     alignment and domain information
>PF13671 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B Back     alignment and domain information
>PRK10436 hypothetical protein; Provisional Back     alignment and domain information
>KOG0733 consensus Nuclear AAA ATPase (VCP subfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>PF05894 Podovirus_Gp16: Podovirus DNA encapsidation protein (Gp16); InterPro: IPR008784 This family consists of several DNA encapsidation protein (Gp16) sequences from the phi-29-like viruses Back     alignment and domain information
>TIGR01073 pcrA ATP-dependent DNA helicase PcrA Back     alignment and domain information
>cd00267 ABC_ATPase ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>cd00984 DnaB_C DnaB helicase C terminal domain Back     alignment and domain information
>COG3598 RepA RecA-family ATPase [DNA replication, recombination, and repair] Back     alignment and domain information
>PF12775 AAA_7: P-loop containing dynein motor region D3; PDB: 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A 3VKH_A 3VKG_A Back     alignment and domain information
>COG1074 RecB ATP-dependent exoDNAse (exonuclease V) beta subunit (contains helicase and exonuclease domains) [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR02538 type_IV_pilB type IV-A pilus assembly ATPase PilB Back     alignment and domain information
>TIGR02655 circ_KaiC circadian clock protein KaiC Back     alignment and domain information
>PF13238 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB_A 3IIM_A 2AXP_A 3KB2_A 1KHT_A 1NKS_A 3H86_C Back     alignment and domain information
>cd03247 ABCC_cytochrome_bd The CYD subfamily implicated in cytochrome bd biogenesis Back     alignment and domain information
>TIGR02785 addA_Gpos recombination helicase AddA, Firmicutes type Back     alignment and domain information
>TIGR03881 KaiC_arch_4 KaiC domain protein, PAE1156 family Back     alignment and domain information
>KOG1969 consensus DNA replication checkpoint protein CHL12/CTF18 [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] Back     alignment and domain information
>TIGR03689 pup_AAA proteasome ATPase Back     alignment and domain information
>PRK13764 ATPase; Provisional Back     alignment and domain information
>COG0630 VirB11 Type IV secretory pathway, VirB11 components, and related ATPases involved in archaeal flagella biosynthesis [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>cd02034 CooC The accessory protein CooC, which contains a nucleotide-binding domain (P-loop) near the N-terminus, participates in the maturation of the nickel center of carbon monoxide dehydrogenase (CODH) Back     alignment and domain information
>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA Back     alignment and domain information
>PF05876 Terminase_GpA: Phage terminase large subunit (GpA); InterPro: IPR008866 This entry is represented by Bacteriophage lambda, GpA Back     alignment and domain information
>TIGR03263 guanyl_kin guanylate kinase Back     alignment and domain information
>cd03221 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth Back     alignment and domain information
>PF10443 RNA12: RNA12 protein; InterPro: IPR018850 Mitochondrial escape protein 2 (also known as RNA12) plays a role in maintaining the mitochondrial genome and in controlling mtDNA escape [, ] Back     alignment and domain information
>TIGR02237 recomb_radB DNA repair and recombination protein RadB Back     alignment and domain information
>KOG2036 consensus Predicted P-loop ATPase fused to an acetyltransferase [General function prediction only] Back     alignment and domain information
>COG0593 DnaA ATPase involved in DNA replication initiation [DNA replication, recombination, and repair] Back     alignment and domain information
>PF03969 AFG1_ATPase: AFG1-like ATPase; InterPro: IPR005654 ATPase family gene 1 (AFG1) ATPase is a 377 amino acid putative protein with an ATPase motif typical of the protein family including SEC18p PAS1, CDC48-VCP and TBP Back     alignment and domain information
>TIGR02533 type_II_gspE general secretory pathway protein E Back     alignment and domain information
>cd01394 radB RadB Back     alignment and domain information
>PRK00300 gmk guanylate kinase; Provisional Back     alignment and domain information
>PF01580 FtsK_SpoIIIE: FtsK/SpoIIIE family; InterPro: IPR002543 The FtsK/SpoIIIE domain is found extensively in a wide variety of proteins from prokaryotes and plasmids [] some of which contain up to three copies Back     alignment and domain information
>KOG0738 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>CHL00095 clpC Clp protease ATP binding subunit Back     alignment and domain information
>PF00265 TK: Thymidine kinase; InterPro: IPR001267 Thymidine kinase (TK) (2 Back     alignment and domain information
>cd03228 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-like transporters are involved in drug, peptide, and lipid export Back     alignment and domain information
>TIGR03880 KaiC_arch_3 KaiC domain protein, AF_0351 family Back     alignment and domain information
>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family Back     alignment and domain information
>TIGR01650 PD_CobS cobaltochelatase, CobS subunit Back     alignment and domain information
>PRK08233 hypothetical protein; Provisional Back     alignment and domain information
>cd03281 ABC_MSH5_euk MutS5 homolog in eukaryotes Back     alignment and domain information
>PF07728 AAA_5: AAA domain (dynein-related subfamily); InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] Back     alignment and domain information
>PRK10917 ATP-dependent DNA helicase RecG; Provisional Back     alignment and domain information
>TIGR01817 nifA Nif-specific regulatory protein Back     alignment and domain information
>COG1110 Reverse gyrase [DNA replication, recombination, and repair] Back     alignment and domain information
>COG1222 RPT1 ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK05917 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>COG3839 MalK ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG2909 MalT ATP-dependent transcriptional regulator [Transcription] Back     alignment and domain information
>KOG0733 consensus Nuclear AAA ATPase (VCP subfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional Back     alignment and domain information
>cd00071 GMPK Guanosine monophosphate kinase (GMPK, EC 2 Back     alignment and domain information
>PRK05580 primosome assembly protein PriA; Validated Back     alignment and domain information
>COG1219 ClpX ATP-dependent protease Clp, ATPase subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0744 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00750 lao LAO/AO transport system ATPase Back     alignment and domain information
>PRK08699 DNA polymerase III subunit delta'; Validated Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1197
3kx2_B767 Crystal Structure Of Prp43p In Complex With Adp Len 5e-44
2xau_A773 Crystal Structure Of The Prp43p Deah-Box Rna Helica 5e-44
3llm_A235 Crystal Structure Analysis Of A Rna Helicase Length 4e-39
3i4u_A270 Crystal Structure Analysis Of A Helicase Associated 4e-26
>pdb|3KX2|B Chain B, Crystal Structure Of Prp43p In Complex With Adp Length = 767 Back     alignment and structure 
Iteration: 1

 Score =  176 bits (447), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 136/438 (31%), Positives = 219/438 (50%), Gaps = 35/438 (7%)
Query: 567 VLCHIVKKERPGAVLVFMTGWDDINSLKDQLQAHPLLGD---------PSRVLLLACHGS 617
            +  I   E  G +L+F+TG D+I   +D ++   L GD         P  V  L  +GS
Sbjct: 293 TVLQIHATEEAGDILLFLTGEDEI---EDAVRKISLEGDQLVREEGCGPLSVYPL--YGS 347
Query: 618 MASSEQRLIFD-KPEDGV----RKIVLATNMAETSITINDVVFVIDCGKAKETSYDALNN 672
           +   +Q+ IF+  PE       RK+V++TN+AETS+TI+ +V+V+D G +K+  Y+    
Sbjct: 348 LPPHQQQRIFEPAPESHNGRPGRKVVISTNIAETSLTIDGIVYVVDPGFSKQKVYNPRIR 407
Query: 673 TPCLLPSWISKXXXXXXXXXXXXVQPGECYHLYPRYVYDA-FADYQLPELLRTPLQSLCL 731
              LL S ISK             +PG+C+ LY    +     +   PE+LR+ L S  L
Sbjct: 408 VESLLVSPISKASAQQRAGRAGRTRPGKCFRLYTEEAFQKELIEQSYPEILRSNLSSTVL 467
Query: 732 QIKSLQLGSISEFLSRALQPPEPLSVKNAIEYLQIIGALDENENLTVLGRNLSMLPVEPK 791
           ++K L +  +  F    + PP P ++  A+E L  +  LD+  NLT LGR  S  P++P 
Sbjct: 468 ELKKLGIDDLVHF--DFMDPPAPETMMRALEELNYLACLDDEGNLTPLGRLASQFPLDPM 525
Query: 792 LGKMLILGAIFNCLDPVMTVVAGLSVRDPFLMPFDKKDLAESAKAQFSARDYSDHLALVR 851
           L  MLI    F C   ++T+VA LSV + F+ P   K  A+ AK  F+  D  DH+ L+ 
Sbjct: 526 LAVMLIGSFEFQCSQEILTIVAMLSVPNVFIRPTKDKKRADDAKNIFAHPD-GDHITLLN 584
Query: 852 AYDGWKDAERHQSG-YEYCWKNFLSAQTLKAIDSLRKQFLFLLKDAGLVDRNTENCNKWS 910
            Y  +K  E ++ G +++C  ++L+ ++L A D++R Q   L+    L    T+  +   
Sbjct: 585 VYHAFKSDEAYEYGIHKWCRDHYLNYRSLSAADNIRSQLERLMNRYNLELNTTDYESPKY 644
Query: 911 HDEHLIRAVICAGLFPGLCSVVNKEKSIA--LKTMEDGQVLLYSNSVNAGVPKIPYPWLV 968
            D   IR  + +G F      V K++S A    T++D Q +L   S   G       W++
Sbjct: 645 FDN--IRKALASGFF----MQVAKKRSGAKGYITVKDNQDVLIHPSTVLGHDA---EWVI 695
Query: 969 FNEKIKVNSVFLRDSTGV 986
           +NE +  +  ++R  T V
Sbjct: 696 YNEFVLTSKNYIRTVTSV 713
>pdb|2XAU|A Chain A, Crystal Structure Of The Prp43p Deah-Box Rna Helicase In Complex With Adp Length = 773 Back     alignment and structure
>pdb|3LLM|A Chain A, Crystal Structure Analysis Of A Rna Helicase Length = 235 Back     alignment and structure
>pdb|3I4U|A Chain A, Crystal Structure Analysis Of A Helicase Associated Domain Length = 270 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1197
2xau_A773 PRE-mRNA-splicing factor ATP-dependent RNA helica; 1e-172
3llm_A235 ATP-dependent RNA helicase A; alpha-beta-alpha, st 1e-114
3i4u_A270 ATP-dependent RNA helicase DHX8; splicing, ATP-bin 7e-42
2z83_A459 Helicase/nucleoside triphosphatase; hydrolase, mem 4e-34
2z83_A459 Helicase/nucleoside triphosphatase; hydrolase, mem 6e-27
2jlq_A451 Serine protease subunit NS3; ribonucleoprotein, nu 8e-33
2jlq_A451 Serine protease subunit NS3; ribonucleoprotein, nu 4e-30
3o8b_A666 HCV NS3 protease/helicase; ntpase, RNA, translocat 3e-32
3o8b_A666 HCV NS3 protease/helicase; ntpase, RNA, translocat 4e-28
2v6i_A431 RNA helicase; membrane, hydrolase, transmembrane, 5e-32
2v6i_A431 RNA helicase; membrane, hydrolase, transmembrane, 4e-27
1yks_A440 Genome polyprotein [contains: flavivirin protease 2e-30
1yks_A440 Genome polyprotein [contains: flavivirin protease 8e-25
2whx_A618 Serine protease/ntpase/helicase NS3; transcription 8e-29
2whx_A618 Serine protease/ntpase/helicase NS3; transcription 1e-28
2wv9_A673 Flavivirin protease NS2B regulatory subunit, FLAV 2e-26
2wv9_A673 Flavivirin protease NS2B regulatory subunit, FLAV 5e-26
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-20
1vt4_I1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-14
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-14
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-13
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-11
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-06
3adj_A76 F21M12.9 protein; HYL1, miRNA processing, RNA bind 2e-15
1whn_A128 Hypothetical protein riken cDNA 2310016K04; double 6e-11
3adg_A73 F21M12.9 protein; HYL1, miRNA processing mechanism 5e-09
1uhz_A89 Staufen (RNA binding protein) homolog 2; DSRM, sta 4e-08
1x47_A98 DGCR8 protein; structural genomics, DSRM domain, N 2e-07
1qu6_A179 Protein kinase PKR; dsRNA-binding domain, solution 3e-07
1qu6_A179 Protein kinase PKR; dsRNA-binding domain, solution 1e-05
2l2n_A103 Hyponastic leave 1; DSRBD, miRNA, RNA binding prot 9e-07
1whq_A99 RNA helicase A; double-stranded RNA binding domain 1e-06
2yt4_A 232 Protein DGCR8; DSRBD, RNA binding domain, RNA bind 2e-06
3llh_A90 RISC-loading complex subunit tarbp2; DSRBD, DSRM, 8e-06
2dix_A84 Interferon-inducible double stranded RNA- dependen 1e-05
2zj8_A720 DNA helicase, putative SKI2-type helicase; RECA fo 1e-05
1x49_A97 Interferon-induced, double-stranded RNA- activated 2e-05
1o0w_A252 Ribonuclease III, RNAse III; TM1102, structural ge 2e-05
3adl_A88 RISC-loading complex subunit tarbp2; TRBP2, miRNA 2e-05
1di2_A69 XLRBPA, double stranded RNA binding protein A; pro 3e-05
2cpn_A89 TAR RNA-binding protein 2; double-stranded RNA bin 3e-05
2p6r_A702 Afuhel308 helicase; protein-DNA complex, SF2 helic 1e-04
2nug_A221 Ribonuclease III, RNAse III; dsRNA, RNA interferen 2e-04
2va8_A715 SSO2462, SKI2-type helicase; hydrolase, DNA repair 2e-04
3n3w_A248 Ribonuclease III; nuclease domain, ribonuclase III 6e-04
1ekz_A76 DSRBDIII, maternal effect protein (staufen); struc 8e-04
>2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B* Length = 773 Back     alignment and structure
 Score =  526 bits (1358), Expect = e-172
 Identities = 230/759 (30%), Positives = 364/759 (47%), Gaps = 107/759 (14%)

Query: 251 EQQEQLVQNSVVRERILRQRSLQMHEKQQAWQESPEG--------QKMLEFRRSLPSYKE 302
           E+          +       S +  +K +  + +P            +L+ RR LP + +
Sbjct: 39  EEPLVHHDAGEFKGLQRHHTSAEEAQKLEDGKINPFTGREFTPKYVDILKIRRELPVHAQ 98

Query: 303 RDALLKAISENQVVVVSGETGCGKTTQLPQYILESETEAARGAACSIICTQPRRISAMAV 362
           RD  LK    NQ++V  GETG GKTTQ+PQ++L  E          + CTQPRR++AM+V
Sbjct: 99  RDEFLKLYQNNQIMVFVGETGSGKTTQIPQFVLFDE--MPHLENTQVACTQPRRVAAMSV 156

Query: 363 SERVAAERGEKLGESVGYKVRLEGMKGRDTRLMFCTTGILLRRLLVDRSLRGVTHVIVDE 422
           ++RVA E   KLGE VGY +R E      T L + T G+LLR  + D  L   + +I+DE
Sbjct: 157 AQRVAEEMDVKLGEEVGYSIRFENKTSNKTILKYMTDGMLLREAMEDHDLSRYSCIILDE 216

Query: 423 IHERGMNEDFLLIVLKELLPRRPELRLILMSATLNAELFSSYFGGAPMLHIPGFTYPVRA 482
            HER +  D L+ +LK+++ RRP+L++I+MSATL+AE F  YF  A     P    P R 
Sbjct: 217 AHERTLATDILMGLLKQVVKRRPDLKIIIMSATLDAEKFQRYFNDA-----PLLAVPGRT 271

Query: 483 YFLENILEMTRYRLNTYNQIDDYGQEKSWKMQKQALALRKRKSSIASAVEDALEAADFRE 542
           Y +E       Y                                      D L++A    
Sbjct: 272 YPVE-----LYYT--------------------------------PEFQRDYLDSA---- 290

Query: 543 YSVQTQQSLSCWNPDSIGFNLIEHVLCHIVKKERPGAVLVFMTGWDDINS----LKDQLQ 598
             ++T                    +  I   E  G +L+F+TG D+I      +  +  
Sbjct: 291 --IRT--------------------VLQIHATEEAGDILLFLTGEDEIEDAVRKISLEGD 328

Query: 599 AHPLLGDPSRVLLLACHGSMASSEQRLIFDKPEDGV-----RKIVLATNMAETSITINDV 653
                     + +   +GS+   +Q+ IF+   +       RK+V++TN+AETS+TI+ +
Sbjct: 329 QLVREEGCGPLSVYPLYGSLPPHQQQRIFEPAPESHNGRPGRKVVISTNIAETSLTIDGI 388

Query: 654 VFVIDCGKAKETSYDALNNTPCLLPSWISKAAARQRRGRAGRVQPGECYHLYPRYVYDA- 712
           V+V+D G +K+  Y+       LL S ISKA+A+QR GRAGR +PG+C+ LY    +   
Sbjct: 389 VYVVDPGFSKQKVYNPRIRVESLLVSPISKASAQQRAGRAGRTRPGKCFRLYTEEAFQKE 448

Query: 713 FADYQLPELLRTPLQSLCLQIKSLQLGSIS--EFLSRALQPPEPLSVKNAIEYLQIIGAL 770
             +   PE+LR+ L S  L++K L +  +   +F+     PP P ++  A+E L  +  L
Sbjct: 449 LIEQSYPEILRSNLSSTVLELKKLGIDDLVHFDFMD----PPAPETMMRALEELNYLACL 504

Query: 771 DENENLTVLGRNLSMLPVEPKLGKMLILGAIFNCLDPVMTVVAGLSVRDPFLMPFDKKDL 830
           D+  NLT LGR  S  P++P L  MLI    F C   ++T+VA LSV + F+ P   K  
Sbjct: 505 DDEGNLTPLGRLASQFPLDPMLAVMLIGSFEFQCSQEILTIVAMLSVPNVFIRPTKDKKR 564

Query: 831 AESAKAQFSARDYSDHLALVRAYDGWKDAERHQSGY-EYCWKNFLSAQTLKAIDSLRKQF 889
           A+ AK  F+  D  DH+ L+  Y  +K  E ++ G  ++C  ++L+ ++L A D++R Q 
Sbjct: 565 ADDAKNIFAHPD-GDHITLLNVYHAFKSDEAYEYGIHKWCRDHYLNYRSLSAADNIRSQL 623

Query: 890 LFLLKDAGLVDRNTENCNKWSHDEHLIRAVICAGLFPGLCSVVNKEKSIAL-KTMEDGQ- 947
             L+    L    T+  +    D   IR  + +G F     V  K        T++D Q 
Sbjct: 624 ERLMNRYNLELNTTDYESPKYFDN--IRKALASGFFM---QVAKKRSGAKGYITVKDNQD 678

Query: 948 VLLYSNSVNAGVPKIPYPWLVFNEKIKVNSVFLRDSTGV 986
           VL++ ++V     +    W+++NE +  +  ++R  T V
Sbjct: 679 VLIHPSTVLGHDAE----WVIYNEFVLTSKNYIRTVTSV 713
>3llm_A ATP-dependent RNA helicase A; alpha-beta-alpha, structural genomics, structural genomics consortium, SGC, activator, ATP-binding, DNA-binding; HET: ADP; 2.80A {Homo sapiens} Length = 235 Back     alignment and structure
>3i4u_A ATP-dependent RNA helicase DHX8; splicing, ATP-binding, hydrolase, mRNA processing, splicing, nucleotide-binding, nucleus, phosphoprotein, SPLI; 2.10A {Homo sapiens} Length = 270 Back     alignment and structure
>2z83_A Helicase/nucleoside triphosphatase; hydrolase, membrane, nucleotide-binding, RNA replication, transmembrane, viral protein; 1.80A {Japanese encephalitis virus} PDB: 2v8o_A 2qeq_A Length = 459 Back     alignment and structure
>2z83_A Helicase/nucleoside triphosphatase; hydrolase, membrane, nucleotide-binding, RNA replication, transmembrane, viral protein; 1.80A {Japanese encephalitis virus} PDB: 2v8o_A 2qeq_A Length = 459 Back     alignment and structure
>2jlq_A Serine protease subunit NS3; ribonucleoprotein, nucleotide-binding, viral nucleoprotein, endoplasmic reticulum, helicase, hydrolase; 1.67A {Dengue virus 4} PDB: 2jly_A* 2jls_A* 2jlu_A 2jlv_A* 2jlw_A 2jlx_A* 2jlz_A* 2jlr_A* 2bmf_A 2bhr_A Length = 451 Back     alignment and structure
>2jlq_A Serine protease subunit NS3; ribonucleoprotein, nucleotide-binding, viral nucleoprotein, endoplasmic reticulum, helicase, hydrolase; 1.67A {Dengue virus 4} PDB: 2jly_A* 2jls_A* 2jlu_A 2jlv_A* 2jlw_A 2jlx_A* 2jlz_A* 2jlr_A* 2bmf_A 2bhr_A Length = 451 Back     alignment and structure
>3o8b_A HCV NS3 protease/helicase; ntpase, RNA, translocation, protein-RNA compl protease/ntpase/helicase, hydrolase; 1.95A {Hepatitis c virus} PDB: 3o8c_A* 3o8d_A* 3o8r_A* 4a92_A* 1cu1_A 2zjo_A* 1a1v_A* 1hei_A 3kqn_A* 3kql_A* 3kqu_A* 3kqh_A 3kqk_A 8ohm_A 2f55_A 1jr6_A 1onb_A Length = 666 Back     alignment and structure
>3o8b_A HCV NS3 protease/helicase; ntpase, RNA, translocation, protein-RNA compl protease/ntpase/helicase, hydrolase; 1.95A {Hepatitis c virus} PDB: 3o8c_A* 3o8d_A* 3o8r_A* 4a92_A* 1cu1_A 2zjo_A* 1a1v_A* 1hei_A 3kqn_A* 3kql_A* 3kqu_A* 3kqh_A 3kqk_A 8ohm_A 2f55_A 1jr6_A 1onb_A Length = 666 Back     alignment and structure
>2v6i_A RNA helicase; membrane, hydrolase, transmembrane, RNA replication, viral replication, nucleotide-binding; 2.10A {Kokobera virus} PDB: 2v6j_A Length = 431 Back     alignment and structure
>2v6i_A RNA helicase; membrane, hydrolase, transmembrane, RNA replication, viral replication, nucleotide-binding; 2.10A {Kokobera virus} PDB: 2v6j_A Length = 431 Back     alignment and structure
>1yks_A Genome polyprotein [contains: flavivirin protease NS3 catalytic subunit]; helicase, flavivirus, DEAD-BOX, ATPase, rtpase, hydrolase; 1.80A {Yellow fever virus} SCOP: c.37.1.14 c.37.1.14 PDB: 1ymf_A* Length = 440 Back     alignment and structure
>1yks_A Genome polyprotein [contains: flavivirin protease NS3 catalytic subunit]; helicase, flavivirus, DEAD-BOX, ATPase, rtpase, hydrolase; 1.80A {Yellow fever virus} SCOP: c.37.1.14 c.37.1.14 PDB: 1ymf_A* Length = 440 Back     alignment and structure
>2whx_A Serine protease/ntpase/helicase NS3; transcription, hydrolase, ATP-binding, reticulum, nucleotidyltransferase, multifunctional enzyme; HET: ADP; 2.20A {Dengue virus 4} PDB: 2vbc_A 2wzq_A Length = 618 Back     alignment and structure
>2whx_A Serine protease/ntpase/helicase NS3; transcription, hydrolase, ATP-binding, reticulum, nucleotidyltransferase, multifunctional enzyme; HET: ADP; 2.20A {Dengue virus 4} PDB: 2vbc_A 2wzq_A Length = 618 Back     alignment and structure
>2wv9_A Flavivirin protease NS2B regulatory subunit, FLAV protease NS3 catalytic subunit; nucleotide-binding, capsid protein; 2.75A {Murray valley encephalitis virus} Length = 673 Back     alignment and structure
>2wv9_A Flavivirin protease NS2B regulatory subunit, FLAV protease NS3 catalytic subunit; nucleotide-binding, capsid protein; 2.75A {Murray valley encephalitis virus} Length = 673 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3adj_A F21M12.9 protein; HYL1, miRNA processing, RNA binding protein, gene regulation; 3.00A {Arabidopsis thaliana} PDB: 2l2m_A Length = 76 Back     alignment and structure
>1whn_A Hypothetical protein riken cDNA 2310016K04; double-stranded RNA binding domain, DSRBD, DSRM, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.50.1.1 Length = 128 Back     alignment and structure
>3adg_A F21M12.9 protein; HYL1, miRNA processing mechanism, RNA binding protein, gene regulation; 1.70A {Arabidopsis thaliana} PDB: 3adi_A Length = 73 Back     alignment and structure
>1uhz_A Staufen (RNA binding protein) homolog 2; DSRM, staufen homolog 2, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.50.1.1 Length = 89 Back     alignment and structure
>1x47_A DGCR8 protein; structural genomics, DSRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.50.1.1 Length = 98 Back     alignment and structure
>1qu6_A Protein kinase PKR; dsRNA-binding domain, solution structure, transferase; NMR {Homo sapiens} SCOP: d.50.1.1 d.50.1.1 Length = 179 Back     alignment and structure
>1qu6_A Protein kinase PKR; dsRNA-binding domain, solution structure, transferase; NMR {Homo sapiens} SCOP: d.50.1.1 d.50.1.1 Length = 179 Back     alignment and structure
>2l2n_A Hyponastic leave 1; DSRBD, miRNA, RNA binding protein, plant protein; NMR {Arabidopsis thaliana} Length = 103 Back     alignment and structure
>1whq_A RNA helicase A; double-stranded RNA binding domain, DSRBD, DSRM, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Mus musculus} SCOP: d.50.1.1 PDB: 2rs6_A Length = 99 Back     alignment and structure
>2yt4_A Protein DGCR8; DSRBD, RNA binding domain, RNA binding protein; 2.60A {Homo sapiens} Length = 232 Back     alignment and structure
>3llh_A RISC-loading complex subunit tarbp2; DSRBD, DSRM, microrna, RNA binding protein; 2.14A {Homo sapiens} Length = 90 Back     alignment and structure
>2dix_A Interferon-inducible double stranded RNA- dependent protein kinase activator A; structure genomics, DSRM domain, hypothetical protein PRKRA; NMR {Homo sapiens} SCOP: d.50.1.1 Length = 84 Back     alignment and structure
>2zj8_A DNA helicase, putative SKI2-type helicase; RECA fold, ATP-binding, hydrolase, nucleotide- binding; 2.00A {Pyrococcus furiosus} PDB: 2zj5_A* 2zj2_A 2zja_A* Length = 720 Back     alignment and structure
>1x49_A Interferon-induced, double-stranded RNA- activated protein kinase; structure genomics, DSRM domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.50.1.1 Length = 97 Back     alignment and structure
>1o0w_A Ribonuclease III, RNAse III; TM1102, structural genomics, JCSG, PSI, protein structure initiative, joint center for structural genomics; 2.00A {Thermotoga maritima} SCOP: a.149.1.1 d.50.1.1 Length = 252 Back     alignment and structure
>3adl_A RISC-loading complex subunit tarbp2; TRBP2, miRNA processing, gene regulation-RNA complex; 2.20A {Homo sapiens} Length = 88 Back     alignment and structure
>1di2_A XLRBPA, double stranded RNA binding protein A; protein-RNA complex, protein-RNA interactions, RNA-bining protein; 1.90A {Xenopus laevis} SCOP: d.50.1.1 Length = 69 Back     alignment and structure
>2cpn_A TAR RNA-binding protein 2; double-stranded RNA binding domain, DSRBD, DSRM., structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.50.1.1 Length = 89 Back     alignment and structure
>2p6r_A Afuhel308 helicase; protein-DNA complex, SF2 helicase, archaeal helicase, DNA repair,, DNA binding protein/DNA complex; 3.00A {Archaeoglobus fulgidus} SCOP: a.4.5.43 a.289.1.2 c.37.1.19 c.37.1.19 PDB: 2p6u_A Length = 702 Back     alignment and structure
>2nug_A Ribonuclease III, RNAse III; dsRNA, RNA interference, endonucleolytic cleavage, hydrolase/RNA complex; 1.70A {Aquifex aeolicus} SCOP: a.149.1.1 d.50.1.1 PDB: 1yyw_A 2nue_A 2nuf_A 1yyk_A 1yz9_A 1yyo_A 2ez6_A 1rc7_A 1i4s_A 1jfz_A 1rc5_A Length = 221 Back     alignment and structure
>2va8_A SSO2462, SKI2-type helicase; hydrolase, DNA repair, ATP-bindin nucleotide-binding; 2.30A {Sulfolobus solfataricus} Length = 715 Back     alignment and structure
>3n3w_A Ribonuclease III; nuclease domain, ribonuclase III, IDP90862, csgid, structura genomics; 2.21A {Campylobacter jejuni subsp} Length = 248 Back     alignment and structure
>1ekz_A DSRBDIII, maternal effect protein (staufen); structure, protein/RNA, protein DSRBD, RNA hairpin; NMR {Drosophila melanogaster} SCOP: d.50.1.1 PDB: 1stu_A Length = 76 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query1197
2xau_A773 PRE-mRNA-splicing factor ATP-dependent RNA helica; 100.0
2va8_A715 SSO2462, SKI2-type helicase; hydrolase, DNA repair 100.0
2p6r_A702 Afuhel308 helicase; protein-DNA complex, SF2 helic 100.0
2zj8_A720 DNA helicase, putative SKI2-type helicase; RECA fo 100.0
3i4u_A270 ATP-dependent RNA helicase DHX8; splicing, ATP-bin 100.0
3eiq_A414 Eukaryotic initiation factor 4A-I; PDCD4, anti-onc 100.0
3l9o_A1108 ATP-dependent RNA helicase DOB1; REC-A fold, winge 100.0
2z83_A459 Helicase/nucleoside triphosphatase; hydrolase, mem 100.0
3fht_A412 ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box 100.0
3pey_A395 ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A 100.0
4f92_B1724 U5 small nuclear ribonucleoprotein 200 kDa helica; 100.0
3o8b_A666 HCV NS3 protease/helicase; ntpase, RNA, translocat 100.0
4f92_B 1724 U5 small nuclear ribonucleoprotein 200 kDa helica; 100.0
2jlq_A451 Serine protease subunit NS3; ribonucleoprotein, nu 100.0
2db3_A434 ATP-dependent RNA helicase VASA; DEAD-BOX, protein 100.0
2i4i_A417 ATP-dependent RNA helicase DDX3X; DEAD, structural 100.0
1hv8_A367 Putative ATP-dependent RNA helicase MJ0669; RNA-bi 100.0
1s2m_A400 Putative ATP-dependent RNA helicase DHH1; ATP-bind 100.0
4a4z_A997 Antiviral helicase SKI2; hydrolase, ATPase, mRNA d 100.0
2j0s_A410 ATP-dependent RNA helicase DDX48; mRNA processing, 100.0
2ykg_A696 Probable ATP-dependent RNA helicase DDX58; hydrola 100.0
1xti_A391 Probable ATP-dependent RNA helicase P47; alpha-bet 100.0
3fmp_B479 ATP-dependent RNA helicase DDX19B; nuclear porin, 100.0
2xgj_A1010 ATP-dependent RNA helicase DOB1; hydrolase-RNA com 100.0
3i5x_A563 ATP-dependent RNA helicase MSS116; protein-RNA com 100.0
2whx_A618 Serine protease/ntpase/helicase NS3; transcription 100.0
3rc3_A677 ATP-dependent RNA helicase SUPV3L1, mitochondrial; 100.0
4a2p_A556 RIG-I, retinoic acid inducible protein I; hydrolas 100.0
1fuu_A394 Yeast initiation factor 4A; IF4A, helicase, DEAD-b 100.0
2z0m_A337 337AA long hypothetical ATP-dependent RNA helicase 100.0
3fho_A508 ATP-dependent RNA helicase DBP5; mRNA export, ATPa 100.0
2v1x_A591 ATP-dependent DNA helicase Q1; DNA strand annealin 100.0
3sqw_A579 ATP-dependent RNA helicase MSS116, mitochondrial; 100.0
3tbk_A555 RIG-I helicase domain; DECH helicase, ATP binding, 100.0
4gl2_A699 Interferon-induced helicase C domain-containing P; 100.0
3oiy_A414 Reverse gyrase helicase domain; topoisomerase, DNA 100.0
1oyw_A523 RECQ helicase, ATP-dependent DNA helicase; winged 100.0
1wp9_A494 ATP-dependent RNA helicase, putative; ATPase, DNA 100.0
2v6i_A431 RNA helicase; membrane, hydrolase, transmembrane, 100.0
1yks_A440 Genome polyprotein [contains: flavivirin protease 100.0
4a2q_A797 RIG-I, retinoic acid inducible protein I; hydrolas 99.98
2wv9_A673 Flavivirin protease NS2B regulatory subunit, FLAV 99.97
4a2w_A936 RIG-I, retinoic acid inducible protein I; hydrolas 99.97
1gm5_A780 RECG; helicase, replication restart; HET: DNA ADP; 99.96
3llm_A235 ATP-dependent RNA helicase A; alpha-beta-alpha, st 99.96
4ddu_A 1104 Reverse gyrase; topoisomerase, DNA supercoiling, a 99.96
2fwr_A472 DNA repair protein RAD25; DNA unwinding, XPB, DNA 99.95
2eyq_A1151 TRCF, transcription-repair coupling factor; MFD, S 99.95
2oca_A510 DAR protein, ATP-dependent DNA helicase UVSW; ATP- 99.95
1gku_B 1054 Reverse gyrase, TOP-RG; topoisomerase, DNA superco 99.95
3h1t_A590 Type I site-specific restriction-modification syst 99.93
1tf5_A844 Preprotein translocase SECA subunit; ATPase, helic 99.93
2fsf_A853 Preprotein translocase SECA subunit; ATPase, DNA-R 99.92
1nkt_A922 Preprotein translocase SECA 1 subunit; preprotein 99.9
3dmq_A968 RNA polymerase-associated protein RAPA; SWF2/SNF2, 99.89
3eaq_A212 Heat resistant RNA dependent ATPase; DEAD box RNA 99.89
3i32_A300 Heat resistant RNA dependent ATPase; RNA helicase, 99.87
1z63_A500 Helicase of the SNF2/RAD54 hamily; protein-DNA com 99.85
2w00_A1038 HSDR, R.ECOR124I; ATP-binding, DNA-binding, restri 99.85
3jux_A822 Protein translocase subunit SECA; protein transloc 99.79
1z3i_X644 Similar to RAD54-like; recombination ATPase helica 99.79
1qde_A224 EIF4A, translation initiation factor 4A; DEAD box 99.79
3ber_A249 Probable ATP-dependent RNA helicase DDX47; DEAD, A 99.78
3iuy_A228 Probable ATP-dependent RNA helicase DDX53; REC-A-l 99.78
3mwy_W800 Chromo domain-containing protein 1; SWI2/SNF2 ATPa 99.78
1c4o_A664 DNA nucleotide excision repair enzyme UVRB; uvrabc 99.77
2pl3_A236 Probable ATP-dependent RNA helicase DDX10; DEAD, s 99.77
3fmo_B300 ATP-dependent RNA helicase DDX19B; nuclear porin, 99.77
1q0u_A219 Bstdead; DEAD protein, RNA binding protein; 1.85A 99.76
1vec_A206 ATP-dependent RNA helicase P54; DEAD-box protein, 99.76
2oxc_A230 Probable ATP-dependent RNA helicase DDX20; DEAD, s 99.76
3dkp_A245 Probable ATP-dependent RNA helicase DDX52; DEAD, A 99.76
3bor_A237 Human initiation factor 4A-II; translation initiat 99.75
2gxq_A207 Heat resistant RNA dependent ATPase; RNA helicase, 99.74
3fe2_A242 Probable ATP-dependent RNA helicase DDX5; DEAD, AD 99.74
3ly5_A262 ATP-dependent RNA helicase DDX18; alpha-beta, stru 99.74
1t6n_A220 Probable ATP-dependent RNA helicase; RECA-like fol 99.74
2hjv_A163 ATP-dependent RNA helicase DBPA; parallel alpha-be 99.73
2rb4_A175 ATP-dependent RNA helicase DDX25; rossmann fold, s 99.73
1fuk_A165 Eukaryotic initiation factor 4A; helicase, DEAD-bo 99.72
1wrb_A253 DJVLGB; RNA helicase, DEAD BOX, VASA, structural g 99.71
1t5i_A172 C_terminal domain of A probable ATP-dependent RNA 99.7
2jgn_A185 DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosp 99.69
2d7d_A661 Uvrabc system protein B; helicase, protein-DNA-ADP 99.67
3b6e_A216 Interferon-induced helicase C domain-containing P; 99.66
2p6n_A191 ATP-dependent RNA helicase DDX41; DEAD, structural 99.66
2yjt_D170 ATP-dependent RNA helicase SRMB, regulator of ribo 99.47
2vl7_A540 XPD; helicase, unknown function; 2.25A {Sulfolobus 99.56
2ipc_A997 Preprotein translocase SECA subunit; nucleotide bi 99.52
1rif_A282 DAR protein, DNA helicase UVSW; bacteriophage, REC 99.51
2fz4_A237 DNA repair protein RAD25; RECA-like domain, DNA da 99.41
3crv_A551 XPD/RAD3 related DNA helicase; XPD helicase DNA re 99.33
1z5z_A271 Helicase of the SNF2/RAD54 family; hydrolase, reco 99.12
3adg_A73 F21M12.9 protein; HYL1, miRNA processing mechanism 99.03
4a15_A620 XPD helicase, ATP-dependent DNA helicase TA0057; h 98.98
1uhz_A89 Staufen (RNA binding protein) homolog 2; DSRM, sta 98.9
2cpn_A89 TAR RNA-binding protein 2; double-stranded RNA bin 98.87
3adl_A88 RISC-loading complex subunit tarbp2; TRBP2, miRNA 98.87
3adj_A76 F21M12.9 protein; HYL1, miRNA processing, RNA bind 98.85
1whn_A128 Hypothetical protein riken cDNA 2310016K04; double 98.82
1whq_A99 RNA helicase A; double-stranded RNA binding domain 98.82
2l2n_A103 Hyponastic leave 1; DSRBD, miRNA, RNA binding prot 98.81
1ekz_A76 DSRBDIII, maternal effect protein (staufen); struc 98.8
2b7t_A73 Double-stranded RNA-specific editase 1; RNA editin 98.77
2dix_A84 Interferon-inducible double stranded RNA- dependen 98.76
3llh_A90 RISC-loading complex subunit tarbp2; DSRBD, DSRM, 98.72
1di2_A69 XLRBPA, double stranded RNA binding protein A; pro 98.71
2b7v_A71 Double-stranded RNA-specific editase 1; RNA editin 98.69
1x47_A98 DGCR8 protein; structural genomics, DSRM domain, N 98.67
2khx_A85 Ribonuclease 3; drosha, RNA binding domain, hydrol 98.57
2dmy_A97 Spermatid perinuclear RNA-binding protein; DSRM do 98.57
2l33_A91 Interleukin enhancer-binding factor 3; structural 98.52
1uil_A113 Double-stranded RNA-binding motif; structural geno 98.5
1x49_A97 Interferon-induced, double-stranded RNA- activated 98.49
1x48_A88 Interferon-induced, double-stranded RNA- activated 98.48
2ljh_A114 Double-stranded RNA-specific editase ADAR; DSRBD, 98.31
3p1x_A75 Interleukin enhancer-binding factor 3; structural 98.24
1qu6_A179 Protein kinase PKR; dsRNA-binding domain, solution 98.14
1t4n_A94 Ribonuclease III; DSRBD, RNA-binding, hydrolase; N 98.13
1qu6_A179 Protein kinase PKR; dsRNA-binding domain, solution 98.08
1t4o_A117 Ribonuclease III; RNT1P, DSRBD, RNA-binding, hydro 98.05
2yt4_A 232 Protein DGCR8; DSRBD, RNA binding domain, RNA bind 97.97
1w36_D608 RECD, exodeoxyribonuclease V alpha chain; recombin 97.94
2nug_A221 Ribonuclease III, RNAse III; dsRNA, RNA interferen 97.91
1o0w_A252 Ribonuclease III, RNAse III; TM1102, structural ge 97.87
2yt4_A232 Protein DGCR8; DSRBD, RNA binding domain, RNA bind 97.85
2l3j_A236 Double-stranded RNA-specific editase 1; editing, d 97.78
2a11_A242 Ribonuclease III, RNAse III; nuclease domain, stru 97.68
2l3j_A 236 Double-stranded RNA-specific editase 1; editing, d 97.59
3n3w_A248 Ribonuclease III; nuclease domain, ribonuclase III 97.56
3e1s_A574 Exodeoxyribonuclease V, subunit RECD; alpha and be 97.42
4b3f_X646 DNA-binding protein smubp-2; hydrolase, helicase; 97.39
3upu_A459 ATP-dependent DNA helicase DDA; RECA-like domain, 97.31
2gk6_A624 Regulator of nonsense transcripts 1; UPF1, helicas 97.03
3rv0_A341 K. polysporus DCR1; RNAse III enzyme, RNA binding 96.9
2b8t_A223 Thymidine kinase; deoxyribonucleoside kinase, zinc 96.78
2o0j_A385 Terminase, DNA packaging protein GP17; nucleotide- 96.64
3lfu_A647 DNA helicase II; SF1 helicase, ATP-binding, DNA da 96.62
3cpe_A592 Terminase, DNA packaging protein GP17; large termi 96.53
3ec2_A180 DNA replication protein DNAC; helicase loader, rep 96.39
2orw_A184 Thymidine kinase; TMTK, TP4A, transferase; HET: 4T 96.31
3te6_A318 Regulatory protein SIR3; heterochromatin, gene sil 96.17
3kl4_A433 SRP54, signal recognition 54 kDa protein; signal r 96.17
1xx6_A191 Thymidine kinase; NESG, northeast structural genom 96.08
1njg_A250 DNA polymerase III subunit gamma; rossman-like fol 95.61
3vkw_A446 Replicase large subunit; alpha/beta domain, helica 95.57
2chg_A226 Replication factor C small subunit; DNA-binding pr 95.52
2px0_A296 Flagellar biosynthesis protein FLHF; SRP GTPase, f 95.44
2w58_A202 DNAI, primosome component (helicase loader); ATP-b 95.42
3c4b_A265 Endoribonuclease dicer; RNAse, dsRNA binding prote 95.42
3dm5_A443 SRP54, signal recognition 54 kDa protein; protein- 95.39
3n70_A145 Transport activator; sigma-54, ntpase, PSI, MCSG, 95.13
3e2i_A219 Thymidine kinase; Zn-binding, ATP-binding, DNA syn 95.07
2xzl_A802 ATP-dependent helicase NAM7; hydrolase-RNA complex 95.01
3bos_A242 Putative DNA replication factor; P-loop containing 94.92
1a5t_A334 Delta prime, HOLB; zinc finger, DNA replication; 2 94.89
2v1u_A387 Cell division control protein 6 homolog; DNA repli 94.75
1fnn_A389 CDC6P, cell division control protein 6; ORC1, AAA 94.75
2orv_A234 Thymidine kinase; TP4A (P1-(5'-adenosyl)P4-(5'- (2 94.66
2zpa_A671 Uncharacterized protein YPFI; RNA modification enz 94.64
2db2_A119 KIAA0890 protein; DSRM domain, structural genomics 94.64
3syl_A309 Protein CBBX; photosynthesis, rubisco activase, AA 94.5
1jr3_A373 DNA polymerase III subunit gamma; processivity, pr 94.47
2wjy_A800 Regulator of nonsense transcripts 1; nonsense medi 94.38
2qby_B384 CDC6 homolog 3, cell division control protein 6 ho 94.34
2qgz_A308 Helicase loader, putative primosome component; str 94.15
2j9r_A214 Thymidine kinase; TK1, DNK, lasso, transferase, AT 93.93
1iqp_A327 RFCS; clamp loader, extended AAA-ATPase domain, co 93.92
1vma_A306 Cell division protein FTSY; TM0570, structural gen 93.89
1l8q_A324 Chromosomal replication initiator protein DNAA; AA 93.69
2kjq_A149 DNAA-related protein; solution structure, NESG, st 93.56
2qby_A386 CDC6 homolog 1, cell division control protein 6 ho 93.29
2bjv_A265 PSP operon transcriptional activator; AAA, transcr 93.24
3u61_B324 DNA polymerase accessory protein 44; AAA+, ATP hyd 93.09
1sxj_D353 Activator 1 41 kDa subunit; clamp loader, processi 92.72
1d2n_A272 N-ethylmaleimide-sensitive fusion protein; hexamer 92.69
1ojl_A304 Transcriptional regulatory protein ZRAR; response 92.61
2qen_A350 Walker-type ATPase; unknown function; HET: ADP; 2. 92.53
3pfi_A338 Holliday junction ATP-dependent DNA helicase RUVB; 92.52
3b9p_A297 CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc 92.42
1ls1_A295 Signal recognition particle protein; FFH, SRP54, S 92.42
2gno_A305 DNA polymerase III, gamma subunit-related protein; 92.27
1uaa_A673 REP helicase, protein (ATP-dependent DNA helicase 92.18
1sxj_A516 Activator 1 95 kDa subunit; clamp loader, processi 92.17
3vfd_A389 Spastin; ATPase, microtubule severing, hydrolase; 92.01
1sxj_B323 Activator 1 37 kDa subunit; clamp loader, processi 91.81
1w4r_A195 Thymidine kinase; type II, human, cytosolic, phosp 91.56
3pvs_A447 Replication-associated recombination protein A; ma 91.48
2qp9_X355 Vacuolar protein sorting-associated protein 4; ATP 91.46
3u4q_A 1232 ATP-dependent helicase/nuclease subunit A; helicas 91.43
1pjr_A724 PCRA; DNA repair, DNA replication, SOS response, h 91.39
2qz4_A262 Paraplegin; AAA+, SPG7, protease, ADP, structural 91.36
1w5s_A412 Origin recognition complex subunit 2 ORC2; replica 91.13
1hqc_A324 RUVB; extended AAA-ATPase domain, complex with nuc 91.13
2z4s_A440 Chromosomal replication initiator protein DNAA; AA 90.88
3eie_A322 Vacuolar protein sorting-associated protein 4; AAA 90.49
1sxj_E354 Activator 1 40 kDa subunit; clamp loader, processi 90.43
2fna_A357 Conserved hypothetical protein; structural genomic 90.3
3cf0_A301 Transitional endoplasmic reticulum ATPase; AAA, P9 90.28
2w0m_A235 SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus 89.92
2v3c_C432 SRP54, signal recognition 54 kDa protein; nucleoti 89.75
3hgt_A328 HDA1 complex subunit 3; RECA-like domain, SWI2/SNF 89.48
1xwi_A322 SKD1 protein; VPS4B, AAA ATPase, protein transport 89.16
3k1j_A604 LON protease, ATP-dependent protease LON; ATP-bind 89.07
2chq_A319 Replication factor C small subunit; DNA-binding pr 89.05
2r6a_A454 DNAB helicase, replicative helicase; replication, 88.91
2ffh_A425 Protein (FFH); SRP54, signal recognition particle, 88.57
3t15_A293 Ribulose bisphosphate carboxylase/oxygenase activ 88.47
3pxi_A758 Negative regulator of genetic competence CLPC/MEC; 88.34
2zan_A444 Vacuolar protein sorting-associating protein 4B; S 88.22
2xxa_A433 Signal recognition particle protein; protein trans 87.89
3co5_A143 Putative two-component system transcriptional RES 87.62
3e70_C328 DPA, signal recognition particle receptor; FTSY, S 87.43
2q6t_A444 DNAB replication FORK helicase; hydrolase; 2.90A { 87.03
1j8m_F297 SRP54, signal recognition 54 kDa protein; signalin 86.95
4b4t_J405 26S protease regulatory subunit 8 homolog; hydrola 86.54
1kgd_A180 CASK, peripheral plasma membrane CASK; maguk, guan 86.34
3b85_A208 Phosphate starvation-inducible protein; PHOH2, ATP 86.11
4b4t_M434 26S protease regulatory subunit 6A; hydrolase, AAA 85.67
4b4t_H467 26S protease regulatory subunit 7 homolog; hydrola 85.66
3cmu_A2050 Protein RECA, recombinase A; homologous recombinat 85.6
2gza_A361 Type IV secretion system protein VIRB11; ATPase, h 85.11
1g5t_A196 COB(I)alamin adenosyltransferase; P-loop protein, 85.1
2dr3_A247 UPF0273 protein PH0284; RECA superfamily ATPase, h 85.05
2eyu_A261 Twitching motility protein PILT; pilus retraction 84.97
2oap_1511 GSPE-2, type II secretion system protein; hexameri 84.79
2j41_A207 Guanylate kinase; GMP, GMK, transferase, ATP-bindi 84.71
1jbk_A195 CLPB protein; beta barrel, chaperone; 1.80A {Esche 84.7
3tr0_A205 Guanylate kinase, GMP kinase; purines, pyrimidines 84.68
3tau_A208 Guanylate kinase, GMP kinase; structural genomics, 84.6
2kou_A102 Dicer-like protein 4; ATP-binding, endonuclease, h 84.3
2zts_A251 Putative uncharacterized protein PH0186; KAIC like 83.99
1zu4_A320 FTSY; GTPase, signal recognition particle, SRP, re 83.52
3vaa_A199 Shikimate kinase, SK; structural genomics, center 83.51
1lvg_A198 Guanylate kinase, GMP kinase; transferase; HET: AD 83.21
2p65_A187 Hypothetical protein PF08_0063; CLPB, malaria, str 83.04
3lw7_A179 Adenylate kinase related protein (ADKA-like); AMP, 82.87
4b4t_L437 26S protease subunit RPT4; hydrolase, AAA-atpases, 82.77
2pt7_A330 CAG-ALFA; ATPase, protein-protein complex, type IV 82.72
1zp6_A191 Hypothetical protein ATU3015; alpha-beta protein., 82.69
1xp8_A366 RECA protein, recombinase A; recombination, radior 82.48
1z6g_A218 Guanylate kinase; structural genomics, SGC, struct 82.47
2yhs_A503 FTSY, cell division protein FTSY; cell cycle, prot 82.43
3ney_A197 55 kDa erythrocyte membrane protein; structural ge 82.13
2j37_W504 Signal recognition particle 54 kDa protein (SRP54) 82.02
4gp7_A171 Metallophosphoesterase; polynucleotide kinase phos 81.99
3a00_A186 Guanylate kinase, GMP kinase; domain movement, dim 81.77
1kht_A192 Adenylate kinase; phosphotransferase, signaling pr 81.67
1znw_A207 Guanylate kinase, GMP kinase; ATP:GMP-phosphotrans 81.41
4b4t_K428 26S protease regulatory subunit 6B homolog; hydrol 81.4
3umf_A217 Adenylate kinase; rossmann fold, transferase; 2.05 81.35
3trf_A185 Shikimate kinase, SK; amino acid biosynthesis, tra 81.22
4b4t_I437 26S protease regulatory subunit 4 homolog; hydrola 81.09
2ehv_A251 Hypothetical protein PH0186; KAIC, RECA ATPase, un 80.96
3a8t_A339 Adenylate isopentenyltransferase; rossmann fold pr 80.92
2qor_A204 Guanylate kinase; phosphotransferase, purine metab 80.84
1qvr_A854 CLPB protein; coiled coil, AAA ATPase, chaperone; 80.77
3jvv_A356 Twitching mobility protein; hexameric P-loop ATPas 80.47
1qhx_A178 CPT, protein (chloramphenicol phosphotransferase); 80.36
3exa_A322 TRNA delta(2)-isopentenylpyrophosphate transferase 80.35
>2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B* Back     alignment and structure
Probab=100.00  E-value=7.7e-99  Score=954.94  Aligned_cols=638  Identities=35%  Similarity=0.588  Sum_probs=563.1

Q ss_pred             hcChhhHHHHHHhhcCCCHHHHHHHHHHHHcCCeEEEEecCCChHHHHHHHHHHHHHHHHccCCceEEEecchHHHHHHH
Q 000991          282 QESPEGQKMLEFRRSLPSYKERDALLKAISENQVVVVSGETGCGKTTQLPQYILESETEAARGAACSIICTQPRRISAMA  361 (1197)
Q Consensus       282 ~~s~~~~~~~~~R~~LPi~~~q~~Il~~I~~~~vvII~apTGSGKTtq~pq~ILe~~~~~~~g~~~~IivtqPrR~LA~q  361 (1197)
                      ..++.+.++++.|..+|++.|+++|+.++..+++++|+|||||||||++|+++++.....+  ....|+|++|+|++|.|
T Consensus        78 ~l~~~~~~~l~~r~~lP~~~q~~~i~~~l~~~~~vii~gpTGSGKTtllp~ll~~~~~~~~--~g~~ilvl~P~r~La~q  155 (773)
T 2xau_A           78 EFTPKYVDILKIRRELPVHAQRDEFLKLYQNNQIMVFVGETGSGKTTQIPQFVLFDEMPHL--ENTQVACTQPRRVAAMS  155 (773)
T ss_dssp             BCCHHHHHHHHHHTTSGGGGGHHHHHHHHHHCSEEEEECCTTSSHHHHHHHHHHHHHCGGG--GTCEEEEEESCHHHHHH
T ss_pred             CCCHHHHHHHHHhhcCChHHHHHHHHHHHhCCCeEEEECCCCCCHHHHHHHHHHHhccccC--CCceEEecCchHHHHHH
Confidence            3466788889999999999999999999999999999999999999999999876543222  24578899999999999


Q ss_pred             HHHHHHHHhCCcccceeeeEeeeccccCCCceEEEEcchHHHHHHhcCCCCCCccEEEEecCCCCCCChhHHHHHHHHHc
Q 000991          362 VSERVAAERGEKLGESVGYKVRLEGMKGRDTRLMFCTTGILLRRLLVDRSLRGVTHVIVDEIHERGMNEDFLLIVLKELL  441 (1197)
Q Consensus       362 va~rVa~e~g~~lg~~VGy~ir~e~~~~~~t~Ilv~Tpg~LLr~L~~d~~L~~is~VIIDEaHeR~~~~D~Ll~lLr~ll  441 (1197)
                      ++++++.+++..++..+||.++++.....+++|+|+|||++++.+..+..+.++++|||||+|+|+++.|+++.+++.+.
T Consensus       156 ~~~~l~~~~~~~v~~~vG~~i~~~~~~~~~~~I~v~T~G~l~r~l~~~~~l~~~~~lIlDEah~R~ld~d~~~~~l~~l~  235 (773)
T 2xau_A          156 VAQRVAEEMDVKLGEEVGYSIRFENKTSNKTILKYMTDGMLLREAMEDHDLSRYSCIILDEAHERTLATDILMGLLKQVV  235 (773)
T ss_dssp             HHHHHHHHTTCCBTTTEEEEETTEEECCTTCSEEEEEHHHHHHHHHHSTTCTTEEEEEECSGGGCCHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHhCCchhheecceeccccccCCCCCEEEECHHHHHHHHhhCccccCCCEEEecCccccccchHHHHHHHHHHH
Confidence            99999999999999999999998888778899999999999999998889999999999999999999999999999998


Q ss_pred             ccCccceEEEecccCCHHHHHhhhCCCCccccCCcccceeeeehHhHHHHhhhccCcccccccchhhhhHHHHHHHHHHH
Q 000991          442 PRRPELRLILMSATLNAELFSSYFGGAPMLHIPGFTYPVRAYFLENILEMTRYRLNTYNQIDDYGQEKSWKMQKQALALR  521 (1197)
Q Consensus       442 ~~r~~lklIlmSATl~~~~f~~yf~~~pvi~i~gr~~PV~~~yledi~~l~~~~l~~~~~i~~~~~e~~~~~~~~~~~~~  521 (1197)
                      ..+++.++|+||||++.+.|++||++++++.++|+.+||+.+|....             ..++                
T Consensus       236 ~~~~~~~iIl~SAT~~~~~l~~~~~~~~vi~v~gr~~pv~~~~~~~~-------------~~~~----------------  286 (773)
T 2xau_A          236 KRRPDLKIIIMSATLDAEKFQRYFNDAPLLAVPGRTYPVELYYTPEF-------------QRDY----------------  286 (773)
T ss_dssp             HHCTTCEEEEEESCSCCHHHHHHTTSCCEEECCCCCCCEEEECCSSC-------------CSCH----------------
T ss_pred             HhCCCceEEEEeccccHHHHHHHhcCCCcccccCcccceEEEEecCC-------------chhH----------------
Confidence            88899999999999999999999999999999999999999886420             0000                


Q ss_pred             hhhhhhHHHHHHHHHhhhhcchhhhhhhccccCCCCCCchhhHHHHHHHHHhhcCCCcEEEEeCCHHHHHHHHHHHHcCC
Q 000991          522 KRKSSIASAVEDALEAADFREYSVQTQQSLSCWNPDSIGFNLIEHVLCHIVKKERPGAVLVFMTGWDDINSLKDQLQAHP  601 (1197)
Q Consensus       522 ~~~~~~~~~ve~~l~~~~~~~~~~~~~~~l~~~~~~~i~~~li~~ll~~i~~~~~~g~iLVFl~~~~ei~~l~~~L~~~~  601 (1197)
                               ++                              .....+..++.....+++||||+++++|+.+++.|....
T Consensus       287 ---------~~------------------------------~~l~~l~~~~~~~~~g~iLVF~~~~~~i~~l~~~L~~~~  327 (773)
T 2xau_A          287 ---------LD------------------------------SAIRTVLQIHATEEAGDILLFLTGEDEIEDAVRKISLEG  327 (773)
T ss_dssp             ---------HH------------------------------HHHHHHHHHHHHSCSCEEEEECSCHHHHHHHHHHHHHHH
T ss_pred             ---------HH------------------------------HHHHHHHHHHHhcCCCCEEEECCCHHHHHHHHHHHHHHH
Confidence                     00                              011123344455568999999999999999999997410


Q ss_pred             --C--CCCCCceEEEeccCCCCHHHHHHhcCCCC-----CCceEEEEeecccccccccCCEEEEEeCCCCCcccccCCCC
Q 000991          602 --L--LGDPSRVLLLACHGSMASSEQRLIFDKPE-----DGVRKIVLATNMAETSITINDVVFVIDCGKAKETSYDALNN  672 (1197)
Q Consensus       602 --~--~~~~~~~~I~~lHs~L~~~er~~v~~~f~-----~G~~kVLVATniaEtGIdIPdV~~VId~G~~k~~~yD~~~~  672 (1197)
                        .  .....++.+.++||+|+.++|..+++.|+     +|.++||||||+||+|||||+|++|||+|+++.+.||+..+
T Consensus       328 ~~l~~~~~~~~~~v~~lhg~l~~~eR~~v~~~f~~~~~~~g~~kVlVAT~iae~GidIp~v~~VId~g~~k~~~yd~~~g  407 (773)
T 2xau_A          328 DQLVREEGCGPLSVYPLYGSLPPHQQQRIFEPAPESHNGRPGRKVVISTNIAETSLTIDGIVYVVDPGFSKQKVYNPRIR  407 (773)
T ss_dssp             HHHHHHHCCCCEEEEEECTTCCHHHHGGGGSCCCCCSSSSCCEEEEEECTHHHHTCCCTTEEEEEECSEEEEEEEETTTT
T ss_pred             HhhcccccCCCeEEEEeCCCCCHHHHHHHHhhcccccCCCCceEEEEeCcHHHhCcCcCCeEEEEeCCCccceeeccccC
Confidence              0  00113678999999999999999999999     99999999999999999999999999999999999999999


Q ss_pred             CCCccccccCHhhHHhhhcccCCCCCCeEEEeccccch-hhhhhcCCccccccchhhhhHHhhhcCCCCHHHHHhhhcCC
Q 000991          673 TPCLLPSWISKAAARQRRGRAGRVQPGECYHLYPRYVY-DAFADYQLPELLRTPLQSLCLQIKSLQLGSISEFLSRALQP  751 (1197)
Q Consensus       673 ~~~l~~~~iSkas~~QR~GRAGR~~~G~cy~Lys~~~~-~~l~~~~~PEIlr~~L~~l~L~lk~l~~~~i~~fL~~~ldp  751 (1197)
                      +..|...|+|+++|.||+|||||.++|.||+||++..+ +.+.++..|||++.+|.+++|+++.++++++..|  .+++|
T Consensus       408 ~~~L~~~p~S~~s~~QR~GRaGR~~~G~~~~l~~~~~~~~~l~~~~~pEi~r~~L~~~~L~l~~~gi~~~~~f--~~~~~  485 (773)
T 2xau_A          408 VESLLVSPISKASAQQRAGRAGRTRPGKCFRLYTEEAFQKELIEQSYPEILRSNLSSTVLELKKLGIDDLVHF--DFMDP  485 (773)
T ss_dssp             EEEEEEEECCHHHHHHHHHGGGSSSSEEEEESSCHHHHHHTSCSSCCCGGGGSCCHHHHHHHHHTTCCCGGGC--CCSSC
T ss_pred             ccccccccCCHHHHHhhccccCCCCCCEEEEEecHHHhcccccccCCCccccCcHHHHHHHHHHcCCCChhhc--cccCC
Confidence            99999999999999999999999999999999999998 5699999999999999999999999999999988  89999


Q ss_pred             CChhhHHHHHHHHHHhcccccCCccccccccccccCCchhhHHHHHHhhhcCCcchHHHHHHhhcCCCCcccCcchHHHH
Q 000991          752 PEPLSVKNAIEYLQIIGALDENENLTVLGRNLSMLPVEPKLGKMLILGAIFNCLDPVMTVVAGLSVRDPFLMPFDKKDLA  831 (1197)
Q Consensus       752 P~~~~v~~Al~~L~~lGaLd~~~~lT~LG~~ls~lPvdp~lgK~ll~g~~~~Cl~~~ltIaA~ls~~~pF~~p~~~~~~a  831 (1197)
                      |+.+++..|++.|..+||||.+|+||++|+.|+.||+||++||||+.|+.++|++++++|||+|++++||+.|.++++++
T Consensus       486 p~~~~i~~a~~~L~~lgald~~~~lT~lG~~~a~~pl~p~~~~~l~~~~~~~c~~~~l~i~a~ls~~~~f~~~~~~~~~~  565 (773)
T 2xau_A          486 PAPETMMRALEELNYLACLDDEGNLTPLGRLASQFPLDPMLAVMLIGSFEFQCSQEILTIVAMLSVPNVFIRPTKDKKRA  565 (773)
T ss_dssp             CCHHHHHHHHHHHHHTTSBCTTSCBCHHHHHHTTSSSCHHHHHHHHHGGGGTCHHHHHHHHHHHTSCCCBCCCTTCHHHH
T ss_pred             CcHHHHHHHHHHHHHcCCcccCCCcChhhhhhccccCCHHHHHHHHhhcccCchhHHHHHHHhcccCCcccCChHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHhhcccCChhhHHHHHHHHHHHHHHhhcccc-hhhHhhhccchhhHHHHHHHHHHHHHHHHHcCCCCCCCCCCCCCC
Q 000991          832 ESAKAQFSARDYSDHLALVRAYDGWKDAERHQSG-YEYCWKNFLSAQTLKAIDSLRKQFLFLLKDAGLVDRNTENCNKWS  910 (1197)
Q Consensus       832 ~~~r~~f~~~~~SDhl~~l~af~~w~~~~~~~~~-~~~c~~~~Ls~~~l~~i~~~r~ql~~~l~~~gl~~~~~~~~n~~s  910 (1197)
                      +.+|+.|+ +..|||++++|+|++|......+.. .+||++||||+.+|+++.++|.||.++|.+.|+...... .+ ..
T Consensus       566 ~~~~~~f~-~~~~D~~~~l~~~~~~~~~~~~~~~~~~~c~~~~l~~~~l~~~~~~~~ql~~~~~~~~~~~~~~~-~~-~~  642 (773)
T 2xau_A          566 DDAKNIFA-HPDGDHITLLNVYHAFKSDEAYEYGIHKWCRDHYLNYRSLSAADNIRSQLERLMNRYNLELNTTD-YE-SP  642 (773)
T ss_dssp             HHHHHTTC-CTTBHHHHHHHHHHHHTSHHHHHHCHHHHHHHTTBCHHHHHHHHHHHHHHHHHHHHTTCCCCCCC-TT-ST
T ss_pred             HHHHHhcc-CCCCcHHHHHHHHHHHHHhccccchHHHHHHHhCCCHHHHHHHHHHHHHHHHHHHhcCCCcCCCC-CC-ch
Confidence            99999998 6779999999999999876532233 689999999999999999999999999999998543211 11 22


Q ss_pred             CCHHHHHHHHHhccCCCccccccccccceeEeecCC-EEEEecCCcCCCCCCCCCCEEEEEeeeeccccccccCCCCChH
Q 000991          911 HDEHLIRAVICAGLFPGLCSVVNKEKSIALKTMEDG-QVLLYSNSVNAGVPKIPYPWLVFNEKIKVNSVFLRDSTGVSDS  989 (1197)
Q Consensus       911 ~~~~lira~L~aGlypnva~~~~~~~~~~~~t~~~~-~v~iHPsSv~~~~~~~~~~~lvy~E~v~tsk~yir~~T~V~p~  989 (1197)
                      .++..|++|||+|||||||+....  ...|.++.++ .|+|||+|++..    .++||||+|++.|++.|||++|+|+|.
T Consensus       643 ~~~~~i~~~l~~g~~~~~a~~~~~--~~~y~~~~~~~~~~ihp~s~l~~----~~~~~v~~e~~~t~~~~~~~~~~i~~~  716 (773)
T 2xau_A          643 KYFDNIRKALASGFFMQVAKKRSG--AKGYITVKDNQDVLIHPSTVLGH----DAEWVIYNEFVLTSKNYIRTVTSVRPE  716 (773)
T ss_dssp             THHHHHHHHHHHHHTTSEEEECCC----CEEETTTCCEEEECTTCCCCT----TCSEEEEEEEEESSSEEEEEEEECCHH
T ss_pred             hhHHHHHHHHHHhChHhheeeccC--CCcceEeeCCCEEEECCCcccCC----CCCEEEEEEeeccchhheeecccCCHH
Confidence            456789999999999999987532  1238887655 599999999953    268999999999999999999999999


Q ss_pred             HHHHhhCcccc
Q 000991          990 VLLLFGGNISR 1000 (1197)
Q Consensus       990 ~LlLFgg~~~~ 1000 (1197)
                      ||..+++....
T Consensus       717 ~l~~~~~~~~~  727 (773)
T 2xau_A          717 WLIEIAPAYYD  727 (773)
T ss_dssp             HHHHHCTTTSC
T ss_pred             HHHHHHHHhee
Confidence            99999987653
>2va8_A SSO2462, SKI2-type helicase; hydrolase, DNA repair, ATP-bindin nucleotide-binding; 2.30A {Sulfolobus solfataricus} Back     alignment and structure
>2p6r_A Afuhel308 helicase; protein-DNA complex, SF2 helicase, archaeal helicase, DNA repair,, DNA binding protein/DNA complex; 3.00A {Archaeoglobus fulgidus} SCOP: a.4.5.43 a.289.1.2 c.37.1.19 c.37.1.19 PDB: 2p6u_A Back     alignment and structure
>2zj8_A DNA helicase, putative SKI2-type helicase; RECA fold, ATP-binding, hydrolase, nucleotide- binding; 2.00A {Pyrococcus furiosus} PDB: 2zj5_A* 2zj2_A 2zja_A* Back     alignment and structure
>3i4u_A ATP-dependent RNA helicase DHX8; splicing, ATP-binding, hydrolase, mRNA processing, splicing, nucleotide-binding, nucleus, phosphoprotein, SPLI; 2.10A {Homo sapiens} Back     alignment and structure
>3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens} Back     alignment and structure
>3l9o_A ATP-dependent RNA helicase DOB1; REC-A fold, winged-helix-turn-helix, antiparallel-coiled-COI domain, ATP-binding, helicase, hydrolase; 3.39A {Saccharomyces cerevisiae} Back     alignment and structure
>2z83_A Helicase/nucleoside triphosphatase; hydrolase, membrane, nucleotide-binding, RNA replication, transmembrane, viral protein; 1.80A {Japanese encephalitis virus} PDB: 2v8o_A 2qeq_A Back     alignment and structure
>3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B Back     alignment and structure
>3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* Back     alignment and structure
>4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B Back     alignment and structure
>3o8b_A HCV NS3 protease/helicase; ntpase, RNA, translocation, protein-RNA compl protease/ntpase/helicase, hydrolase; 1.95A {Hepatitis c virus} PDB: 3o8c_A* 3o8d_A* 3o8r_A* 4b71_A* 4b73_A* 4b74_A* 4b76_A* 4b75_A* 4a92_A* 1cu1_A 4b6e_A* 4b6f_A* 2zjo_A* 1a1v_A* 1hei_A 3kqn_A* 3kql_A* 3kqu_A* 3kqh_A 3kqk_A ... Back     alignment and structure
>4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B Back     alignment and structure
>2jlq_A Serine protease subunit NS3; ribonucleoprotein, nucleotide-binding, viral nucleoprotein, endoplasmic reticulum, helicase, hydrolase; 1.67A {Dengue virus 4} PDB: 2jly_A* 2jls_A* 2jlu_A 2jlv_A* 2jlw_A 2jlx_A* 2jlz_A* 2jlr_A* 2bmf_A 2bhr_A Back     alignment and structure
>2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster} Back     alignment and structure
>2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} Back     alignment and structure
>1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A Back     alignment and structure
>4a4z_A Antiviral helicase SKI2; hydrolase, ATPase, mRNA degradation, exosome; HET: ANP; 2.40A {Saccharomyces cerevisiae} PDB: 4a4k_A Back     alignment and structure
>2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A Back     alignment and structure
>2ykg_A Probable ATP-dependent RNA helicase DDX58; hydrolase, innate immunity; 2.50A {Homo sapiens} PDB: 3tmi_A* Back     alignment and structure
>1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A Back     alignment and structure
>3fmp_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 3.19A {Homo sapiens} Back     alignment and structure
>2xgj_A ATP-dependent RNA helicase DOB1; hydrolase-RNA complex, hydrolase, tramp, exosome, DEAD, nucleotide-binding; HET: ADP; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>3i5x_A ATP-dependent RNA helicase MSS116; protein-RNA complex, RNA helicase, DEAD-BOX, ATP-binding, HE hydrolase, mitochondrion; HET: ANP; 1.90A {Saccharomyces cerevisiae} PDB: 3i5y_A* 3i61_A* 3i62_A* 3sqx_A* 4db2_A 4db4_A Back     alignment and structure
>2whx_A Serine protease/ntpase/helicase NS3; transcription, hydrolase, ATP-binding, reticulum, nucleotidyltransferase, multifunctional enzyme; HET: ADP; 2.20A {Dengue virus 4} PDB: 2vbc_A 2wzq_A Back     alignment and structure
>3rc3_A ATP-dependent RNA helicase SUPV3L1, mitochondrial; SUV3, nucleus, hydrolase; HET: ANP; 2.08A {Homo sapiens} PDB: 3rc8_A Back     alignment and structure
>4a2p_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.00A {Anas platyrhynchos} PDB: 4a36_A* Back     alignment and structure
>1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A* Back     alignment and structure
>2z0m_A 337AA long hypothetical ATP-dependent RNA helicase DEAD; ATP-binding, hydrolase, nucleotide-binding, RNA binding protein, structural genomics; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>2v1x_A ATP-dependent DNA helicase Q1; DNA strand annealing, mismatch repair, nucleotide-binding, DNA-binding, polymorphism, nuclear protein, ATPase; HET: ADP; 2.00A {Homo sapiens} PDB: 2wwy_A* Back     alignment and structure
>3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>3tbk_A RIG-I helicase domain; DECH helicase, ATP binding, hydrolase; HET: ANP; 2.14A {Mus musculus} Back     alignment and structure
>4gl2_A Interferon-induced helicase C domain-containing P; MDA5, dsRNA, anti-viral signaling, RIG-I, MAVS, oligomerizat helicase, ATPase; HET: ANP; 3.56A {Homo sapiens} Back     alignment and structure
>3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* Back     alignment and structure
>1oyw_A RECQ helicase, ATP-dependent DNA helicase; winged helix, helix-turn-helix, ATP binding, Zn(2+) binding, hydrolase; 1.80A {Escherichia coli} SCOP: a.4.5.43 c.37.1.19 c.37.1.19 PDB: 1oyy_A* Back     alignment and structure
>1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>2v6i_A RNA helicase; membrane, hydrolase, transmembrane, RNA replication, viral replication, nucleotide-binding; 2.10A {Kokobera virus} PDB: 2v6j_A Back     alignment and structure
>1yks_A Genome polyprotein [contains: flavivirin protease NS3 catalytic subunit]; helicase, flavivirus, DEAD-BOX, ATPase, rtpase, hydrolase; 1.80A {Yellow fever virus} SCOP: c.37.1.14 c.37.1.14 PDB: 1ymf_A* Back     alignment and structure
>4a2q_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.40A {Anas platyrhynchos} Back     alignment and structure
>2wv9_A Flavivirin protease NS2B regulatory subunit, FLAV protease NS3 catalytic subunit; nucleotide-binding, capsid protein; 2.75A {Murray valley encephalitis virus} Back     alignment and structure
>4a2w_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.70A {Anas platyrhynchos} Back     alignment and structure
>1gm5_A RECG; helicase, replication restart; HET: DNA ADP; 3.24A {Thermotoga maritima} SCOP: a.24.21.1 b.40.4.9 c.37.1.19 c.37.1.19 Back     alignment and structure
>3llm_A ATP-dependent RNA helicase A; alpha-beta-alpha, structural genomics, structural genomics consortium, SGC, activator, ATP-binding, DNA-binding; HET: ADP; 2.80A {Homo sapiens} Back     alignment and structure
>4ddu_A Reverse gyrase; topoisomerase, DNA supercoiling, archaea, helicase, hydrolas; 3.00A {Thermotoga maritima} PDB: 4ddt_A 4ddv_A 4ddw_A 4ddx_A Back     alignment and structure
>2fwr_A DNA repair protein RAD25; DNA unwinding, XPB, DNA binding protein; HET: DNA; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.19 c.37.1.19 PDB: 2fzl_A* Back     alignment and structure
>2eyq_A TRCF, transcription-repair coupling factor; MFD, SF2 ATPase, hydrolase; HET: EPE; 3.20A {Escherichia coli} SCOP: b.34.18.1 c.37.1.19 c.37.1.19 c.37.1.19 c.37.1.19 d.315.1.1 Back     alignment and structure
>2oca_A DAR protein, ATP-dependent DNA helicase UVSW; ATP-dependant helicase, T4-bacteriophage, recombination, hydrolase; 2.70A {Enterobacteria phage T4} Back     alignment and structure
>1gku_B Reverse gyrase, TOP-RG; topoisomerase, DNA supercoiling, archaea, helicase; 2.7A {Archaeoglobus fulgidus} SCOP: c.37.1.16 c.37.1.16 e.10.1.1 PDB: 1gl9_B* Back     alignment and structure
>3h1t_A Type I site-specific restriction-modification system, R (restriction) subunit; hydrolase, restriction enzyme HSDR, ATP-binding; 2.30A {Vibrio vulnificus} Back     alignment and structure
>1tf5_A Preprotein translocase SECA subunit; ATPase, helicase, translocation, secretion, protein transport; 2.18A {Bacillus subtilis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1tf2_A 3iqy_A 1m6n_A 1m74_A* 3iqm_A 3jv2_A* 2ibm_A* 3dl8_A 1sx0_A 1sx1_A 1tm6_A Back     alignment and structure
>2fsf_A Preprotein translocase SECA subunit; ATPase, DNA-RNA helicase, protein translocation, protein transport; 2.00A {Escherichia coli} PDB: 2fsg_A* 2fsh_A* 2fsi_A* 2vda_A 3bxz_A* Back     alignment and structure
>1nkt_A Preprotein translocase SECA 1 subunit; preprotein translocation, ATPase, transmembrane transport, helicase-like motor domain; HET: ADP; 2.60A {Mycobacterium tuberculosis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1nl3_A Back     alignment and structure
>3dmq_A RNA polymerase-associated protein RAPA; SWF2/SNF2, transcription factor, RNA polymerase recycling, activator, ATP-binding, DNA-binding; 3.20A {Escherichia coli K12} Back     alignment and structure
>3eaq_A Heat resistant RNA dependent ATPase; DEAD box RNA helicase, dimer, ATP-binding, helicase, hydrolase, nucleotide-binding; 2.30A {Thermus thermophilus} PDB: 3ear_A 3eas_A Back     alignment and structure
>3i32_A Heat resistant RNA dependent ATPase; RNA helicase, dimer, RNA recognition motif, ATP-BIND helicase, nucleotide-binding; 2.80A {Thermus thermophilus} Back     alignment and structure
>1z63_A Helicase of the SNF2/RAD54 hamily; protein-DNA complex, hydrolase/DNA complex complex; 3.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 c.37.1.19 PDB: 1z6a_A Back     alignment and structure
>2w00_A HSDR, R.ECOR124I; ATP-binding, DNA-binding, restriction system, helicase, HYDR R.ECOR124I, nucleotide-binding; HET: ATP; 2.6A {Escherichia coli} PDB: 2y3t_A* 2w74_B* Back     alignment and structure
>3jux_A Protein translocase subunit SECA; protein translocation, ATPase, conformational change, peptide binding, ATP-binding, cell inner membrane; HET: ADP; 3.10A {Thermotoga maritima} PDB: 3din_A* Back     alignment and structure
>1z3i_X Similar to RAD54-like; recombination ATPase helicase, recombination-DNA binding COM; 3.00A {Danio rerio} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>1qde_A EIF4A, translation initiation factor 4A; DEAD box protein family, gene regulation; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 1qva_A Back     alignment and structure
>3ber_A Probable ATP-dependent RNA helicase DDX47; DEAD, AMP, structural genomics, structural GEN consortium, SGC, ATP-binding, hydrolase; HET: AMP PGE; 1.40A {Homo sapiens} Back     alignment and structure
>3iuy_A Probable ATP-dependent RNA helicase DDX53; REC-A-like, DEAD-BOX, structural genomics, structural genomi consortium, SGC, ATP-binding, hydrolase; HET: AMP; 2.40A {Homo sapiens} Back     alignment and structure
>3mwy_W Chromo domain-containing protein 1; SWI2/SNF2 ATPase, double chromodomains, hydrolase; HET: ATG; 3.70A {Saccharomyces cerevisiae} Back     alignment and structure
>1c4o_A DNA nucleotide excision repair enzyme UVRB; uvrabc, helicase, hypertherm protein, replication; HET: DNA BOG; 1.50A {Thermus thermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1d2m_A* Back     alignment and structure
>2pl3_A Probable ATP-dependent RNA helicase DDX10; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; HET: ADP; 2.15A {Homo sapiens} Back     alignment and structure
>3fmo_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 2.51A {Homo sapiens} Back     alignment and structure
>1q0u_A Bstdead; DEAD protein, RNA binding protein; 1.85A {Geobacillus stearothermophilus} SCOP: c.37.1.19 Back     alignment and structure
>1vec_A ATP-dependent RNA helicase P54; DEAD-box protein, RNA binding protein; HET: TLA; 2.01A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>2oxc_A Probable ATP-dependent RNA helicase DDX20; DEAD, structural genomics, structural genomics consortium, SGC, hydrolase; HET: ADP; 1.30A {Homo sapiens} PDB: 3b7g_A* Back     alignment and structure
>3dkp_A Probable ATP-dependent RNA helicase DDX52; DEAD, ADP, structural genomics, structural GEN consortium, SGC, rRNA, ATP-binding, hydrolase; HET: ADP; 2.10A {Homo sapiens} Back     alignment and structure
>3bor_A Human initiation factor 4A-II; translation initiation, DEAD BOX, structural genomics, helic binding, HOST-virus interaction, hydrolase; 1.85A {Homo sapiens} PDB: 2g9n_A* Back     alignment and structure
>2gxq_A Heat resistant RNA dependent ATPase; RNA helicase, atomic resolution, AMP complex, ribosome biogenesis, thermophilic, hydrolase; HET: AMP; 1.20A {Thermus thermophilus HB27} PDB: 2gxs_A* 2gxu_A 3mwj_A 3mwk_A* 3mwl_A* 3nbf_A* 3nej_A Back     alignment and structure
>3fe2_A Probable ATP-dependent RNA helicase DDX5; DEAD, ADP, ATP-binding, hydrolase, nucleotide- RNA-binding, methylation, mRNA processing, mRNA S nucleus; HET: ADP; 2.60A {Homo sapiens} PDB: 4a4d_A Back     alignment and structure
>3ly5_A ATP-dependent RNA helicase DDX18; alpha-beta, structural genomics, structural genomics consort ATP-binding, hydrolase, nucleotide-binding, RNA-B; 2.80A {Homo sapiens} Back     alignment and structure
>1t6n_A Probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; HET: FLC; 1.94A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>2hjv_A ATP-dependent RNA helicase DBPA; parallel alpha-beta, hydrolase; 1.95A {Bacillus subtilis} Back     alignment and structure
>2rb4_A ATP-dependent RNA helicase DDX25; rossmann fold, structural genomics, structural consortium, SGC, alternative initiation, ATP-binding, devel protein; 2.80A {Homo sapiens} Back     alignment and structure
>1fuk_A Eukaryotic initiation factor 4A; helicase, DEAD-box protein, translation; 1.75A {Saccharomyces cerevisiae} SCOP: c.37.1.19 Back     alignment and structure
>1wrb_A DJVLGB; RNA helicase, DEAD BOX, VASA, structural genomics, NPPSFA, N project on protein structural and functional analyses; 2.40A {Dugesia japonica} SCOP: c.37.1.19 Back     alignment and structure
>1t5i_A C_terminal domain of A probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; 1.90A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>2jgn_A DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosphorylation, nucleotide-binding, hydrolase, RNA-binding, ATP-binding, DNA-binding, nuclear protein; 1.91A {Homo sapiens} Back     alignment and structure
>2d7d_A Uvrabc system protein B; helicase, protein-DNA-ADP ternary complex, hydrolase/DNA complex; HET: ADP; 2.10A {Bacillus subtilis} PDB: 2nmv_A* 2fdc_A* 1t5l_A 3uwx_B 1d9z_A* 1d9x_A 2d7d_B* 2nmv_B* Back     alignment and structure
>3b6e_A Interferon-induced helicase C domain-containing P; DECH, DEXD/H RNA-binding helicase, innate immunity, IFIH1, S genomics; 1.60A {Homo sapiens} Back     alignment and structure
>2p6n_A ATP-dependent RNA helicase DDX41; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; 2.60A {Homo sapiens} Back     alignment and structure
>2yjt_D ATP-dependent RNA helicase SRMB, regulator of ribonuclease activity A; hydrolase inhibitor-hydrolase complex, DEAD box RNA helicase; 2.90A {Escherichia coli} Back     alignment and structure
>2vl7_A XPD; helicase, unknown function; 2.25A {Sulfolobus tokodaii} Back     alignment and structure
>2ipc_A Preprotein translocase SECA subunit; nucleotide binding fold, ATPase, parallel dimer; 2.80A {Thermus thermophilus} Back     alignment and structure
>1rif_A DAR protein, DNA helicase UVSW; bacteriophage, RECG, SF2, DNA binding protein; HET: DNA; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.23 Back     alignment and structure
>2fz4_A DNA repair protein RAD25; RECA-like domain, DNA damage recognition domain, DNA binding; HET: DNA; 2.40A {Archaeoglobus fulgidus} SCOP: c.37.1.19 Back     alignment and structure
>3crv_A XPD/RAD3 related DNA helicase; XPD helicase DNA repair cancer aging, hydrolase; HET: FLC; 2.00A {Sulfolobus acidocaldarius} PDB: 3crw_1* Back     alignment and structure
>1z5z_A Helicase of the SNF2/RAD54 family; hydrolase, recombination, hydrolase-recombination complex; 2.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 Back     alignment and structure
>3adg_A F21M12.9 protein; HYL1, miRNA processing mechanism, RNA binding protein, gene regulation; 1.70A {Arabidopsis thaliana} PDB: 3adi_A Back     alignment and structure
>4a15_A XPD helicase, ATP-dependent DNA helicase TA0057; hydrolase, nucleotide excision repair,; 2.20A {Thermoplasma acidophilum} PDB: 2vsf_A* Back     alignment and structure
>1uhz_A Staufen (RNA binding protein) homolog 2; DSRM, staufen homolog 2, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.50.1.1 Back     alignment and structure
>2cpn_A TAR RNA-binding protein 2; double-stranded RNA binding domain, DSRBD, DSRM., structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.50.1.1 Back     alignment and structure
>3adl_A RISC-loading complex subunit tarbp2; TRBP2, miRNA processing, gene regulation-RNA complex; 2.20A {Homo sapiens} Back     alignment and structure
>3adj_A F21M12.9 protein; HYL1, miRNA processing, RNA binding protein, gene regulation; 3.00A {Arabidopsis thaliana} PDB: 2l2m_A Back     alignment and structure
>1whn_A Hypothetical protein riken cDNA 2310016K04; double-stranded RNA binding domain, DSRBD, DSRM, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.50.1.1 Back     alignment and structure
>1whq_A RNA helicase A; double-stranded RNA binding domain, DSRBD, DSRM, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Mus musculus} SCOP: d.50.1.1 PDB: 2rs6_A Back     alignment and structure
>2l2n_A Hyponastic leave 1; DSRBD, miRNA, RNA binding protein, plant protein; NMR {Arabidopsis thaliana} Back     alignment and structure
>1ekz_A DSRBDIII, maternal effect protein (staufen); structure, protein/RNA, protein DSRBD, RNA hairpin; NMR {Drosophila melanogaster} SCOP: d.50.1.1 PDB: 1stu_A Back     alignment and structure
>2b7t_A Double-stranded RNA-specific editase 1; RNA editing, RNA-binding protein, hydrolase; NMR {Rattus norvegicus} SCOP: d.50.1.1 PDB: 2l3c_A Back     alignment and structure
>2dix_A Interferon-inducible double stranded RNA- dependent protein kinase activator A; structure genomics, DSRM domain, hypothetical protein PRKRA; NMR {Homo sapiens} SCOP: d.50.1.1 Back     alignment and structure
>3llh_A RISC-loading complex subunit tarbp2; DSRBD, DSRM, microrna, RNA binding protein; 2.14A {Homo sapiens} Back     alignment and structure
>1di2_A XLRBPA, double stranded RNA binding protein A; protein-RNA complex, protein-RNA interactions, RNA-bining protein; 1.90A {Xenopus laevis} SCOP: d.50.1.1 Back     alignment and structure
>2b7v_A Double-stranded RNA-specific editase 1; RNA editing, RNA-binding protein, hydrolase; NMR {Rattus norvegicus} SCOP: d.50.1.1 PDB: 2l2k_B Back     alignment and structure
>1x47_A DGCR8 protein; structural genomics, DSRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.50.1.1 Back     alignment and structure
>2khx_A Ribonuclease 3; drosha, RNA binding domain, hydrolase, gene regulation, NUCL protein, gene regulation,nuclear protein; NMR {Homo sapiens} Back     alignment and structure
>2dmy_A Spermatid perinuclear RNA-binding protein; DSRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.50.1.1 Back     alignment and structure
>2l33_A Interleukin enhancer-binding factor 3; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, DRBM; NMR {Homo sapiens} Back     alignment and structure
>1uil_A Double-stranded RNA-binding motif; structural genomics, DSRM, riken structural genomics/proteomics initiative, RSGI RNA binding protein; NMR {Mus musculus} SCOP: d.50.1.1 PDB: 2rs7_A Back     alignment and structure
>1x49_A Interferon-induced, double-stranded RNA- activated protein kinase; structure genomics, DSRM domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.50.1.1 Back     alignment and structure
>1x48_A Interferon-induced, double-stranded RNA- activated protein kinase; structure genomics, DSRM domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.50.1.1 Back     alignment and structure
>2ljh_A Double-stranded RNA-specific editase ADAR; DSRBD, DSRBM, editing, hydrolase; NMR {Drosophila melanogaster} Back     alignment and structure
>3p1x_A Interleukin enhancer-binding factor 3; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; 1.90A {Homo sapiens} Back     alignment and structure
>1qu6_A Protein kinase PKR; dsRNA-binding domain, solution structure, transferase; NMR {Homo sapiens} SCOP: d.50.1.1 d.50.1.1 Back     alignment and structure
>1t4n_A Ribonuclease III; DSRBD, RNA-binding, hydrolase; NMR {Saccharomyces cerevisiae} SCOP: d.50.1.1 Back     alignment and structure
>1qu6_A Protein kinase PKR; dsRNA-binding domain, solution structure, transferase; NMR {Homo sapiens} SCOP: d.50.1.1 d.50.1.1 Back     alignment and structure
>1t4o_A Ribonuclease III; RNT1P, DSRBD, RNA-binding, hydrolase; 2.50A {Saccharomyces cerevisiae} SCOP: d.50.1.1 PDB: 1t4l_B 2lbs_B Back     alignment and structure
>2yt4_A Protein DGCR8; DSRBD, RNA binding domain, RNA binding protein; 2.60A {Homo sapiens} Back     alignment and structure
>1w36_D RECD, exodeoxyribonuclease V alpha chain; recombination, helicase, hydrolase, DNA repair; HET: DNA; 3.1A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 PDB: 3k70_D* Back     alignment and structure
>2nug_A Ribonuclease III, RNAse III; dsRNA, RNA interference, endonucleolytic cleavage, hydrolase/RNA complex; 1.70A {Aquifex aeolicus} SCOP: a.149.1.1 d.50.1.1 PDB: 1yyw_A 2nue_A 2nuf_A 1yyk_A 1yz9_A 1yyo_A 2ez6_A 1rc7_A 1i4s_A 1jfz_A 1rc5_A Back     alignment and structure
>1o0w_A Ribonuclease III, RNAse III; TM1102, structural genomics, JCSG, PSI, protein structure initiative, joint center for structural genomics; 2.00A {Thermotoga maritima} SCOP: a.149.1.1 d.50.1.1 Back     alignment and structure
>2yt4_A Protein DGCR8; DSRBD, RNA binding domain, RNA binding protein; 2.60A {Homo sapiens} Back     alignment and structure
>2l3j_A Double-stranded RNA-specific editase 1; editing, dsRNA recognition, DSRBM, hydrolase-RNA complex; NMR {Rattus norvegicus} Back     alignment and structure
>2a11_A Ribonuclease III, RNAse III; nuclease domain, structural genomic protein structure initiative; 2.10A {Mycobacterium tuberculosis} Back     alignment and structure
>2l3j_A Double-stranded RNA-specific editase 1; editing, dsRNA recognition, DSRBM, hydrolase-RNA complex; NMR {Rattus norvegicus} Back     alignment and structure
>3n3w_A Ribonuclease III; nuclease domain, ribonuclase III, IDP90862, csgid, structura genomics; 2.21A {Campylobacter jejuni subsp} Back     alignment and structure
>3e1s_A Exodeoxyribonuclease V, subunit RECD; alpha and beta protein, ATP-binding, nucleotide-binding, HYD; 2.20A {Deinococcus radiodurans} PDB: 3gp8_A 3gpl_A* Back     alignment and structure
>4b3f_X DNA-binding protein smubp-2; hydrolase, helicase; 2.50A {Homo sapiens} PDB: 4b3g_A Back     alignment and structure
>3upu_A ATP-dependent DNA helicase DDA; RECA-like domain, SH3 domain, PIN-tower interface, coupling hydrolysis to DNA unwinding, ssDNA; 3.30A {Enterobacteria phage T4} Back     alignment and structure
>2gk6_A Regulator of nonsense transcripts 1; UPF1, helicase, NMD, hydrolase; HET: ADP; 2.40A {Homo sapiens} PDB: 2gjk_A* 2gk7_A 2xzo_A* 2xzp_A Back     alignment and structure
>3rv0_A K. polysporus DCR1; RNAse III enzyme, RNA binding protein; 2.29A {Vanderwaltozyma polyspora} Back     alignment and structure
>2b8t_A Thymidine kinase; deoxyribonucleoside kinase, zinc-binding domain, TK1, UU-TK, transferase; HET: THM; 2.00A {Ureaplasma parvum} SCOP: c.37.1.24 g.39.1.14 PDB: 2uz3_A* Back     alignment and structure
>2o0j_A Terminase, DNA packaging protein GP17; nucleotide-binding fold, hydrolase; HET: DNA ADP; 1.80A {Enterobacteria phage T4} PDB: 2o0h_A* 2o0k_A* Back     alignment and structure
>3lfu_A DNA helicase II; SF1 helicase, ATP-binding, DNA damage, DNA REP replication, DNA-binding, hydrolase, nucleotide-B SOS response; HET: DNA; 1.80A {Escherichia coli} PDB: 2is6_A* 2is2_A* 2is1_A* 2is4_A* Back     alignment and structure
>3cpe_A Terminase, DNA packaging protein GP17; large terminase, alternative initiation, ATP-binding, DNA- binding, hydrolase, nuclease; HET: DNA; 2.80A {Bacteriophage T4} PDB: 3ezk_A* Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Back     alignment and structure
>2orw_A Thymidine kinase; TMTK, TP4A, transferase; HET: 4TA; 1.50A {Thermotoga maritima} PDB: 2qpo_A 2qq0_A* 2qqe_A* Back     alignment and structure
>3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A Back     alignment and structure
>1xx6_A Thymidine kinase; NESG, northeast structural genomics consortium, protein STRU initiative, PSI, structural genomics, DNA synthesis; HET: ADP; 2.00A {Clostridium acetobutylicum} SCOP: c.37.1.24 g.39.1.14 Back     alignment and structure
>1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* Back     alignment and structure
>3vkw_A Replicase large subunit; alpha/beta domain, helicase, transferase; 1.90A {Tomato mosaic virus} Back     alignment and structure
>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} Back     alignment and structure
>2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* Back     alignment and structure
>2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} Back     alignment and structure
>3c4b_A Endoribonuclease dicer; RNAse, dsRNA binding protein, ATP-binding, endonuclease, HEL hydrolase, nucleotide-binding, phosphoprotein, RN binding; HET: MSE; 1.68A {Mus musculus} PDB: 3c4t_A 2eb1_A Back     alignment and structure
>3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} Back     alignment and structure
>3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} Back     alignment and structure
>3e2i_A Thymidine kinase; Zn-binding, ATP-binding, DNA synthesis, nucleotide-B transferase; HET: MSE; 2.01A {Staphylococcus aureus} Back     alignment and structure
>2xzl_A ATP-dependent helicase NAM7; hydrolase-RNA complex, NMD, RNA degradation, allosteric REGU; HET: ADP 1PE; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A Back     alignment and structure
>1a5t_A Delta prime, HOLB; zinc finger, DNA replication; 2.20A {Escherichia coli K12} SCOP: a.80.1.1 c.37.1.20 PDB: 1jr3_E* 1xxh_E* 1xxi_E* 3glf_E* 3glg_E* 3glh_E* 3gli_E* Back     alignment and structure
>2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} Back     alignment and structure
>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>2orv_A Thymidine kinase; TP4A (P1-(5'-adenosyl)P4-(5'- (2'deoxythymidil))tetraphosphate, transferase; HET: 4TA; 2.30A {Homo sapiens} SCOP: c.37.1.24 g.39.1.14 Back     alignment and structure
>2zpa_A Uncharacterized protein YPFI; RNA modification enzyme, RNA helicase, acetyltransferase, GCN5 acetyltransferase; HET: ACO ADP; 2.35A {Escherichia coli K12} Back     alignment and structure
>2db2_A KIAA0890 protein; DSRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* Back     alignment and structure
>1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B* Back     alignment and structure
>2wjy_A Regulator of nonsense transcripts 1; nonsense mediated decay, zinc-finger, ATP-binding, metal-BIN UPF2, UPF1, helicase, hydrolase; 2.50A {Homo sapiens} PDB: 2wjv_A 2iyk_A Back     alignment and structure
>2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} Back     alignment and structure
>2j9r_A Thymidine kinase; TK1, DNK, lasso, transferase, ATP-binding, deoxyribonucleoside kinase, DNA synthesis, phosphate accept nucleotide-binding; HET: THM; 2.7A {Bacillus anthracis} PDB: 2ja1_A* Back     alignment and structure
>1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 Back     alignment and structure
>1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* Back     alignment and structure
>2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} Back     alignment and structure
>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A* Back     alignment and structure
>3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B* Back     alignment and structure
>1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* Back     alignment and structure
>1ojl_A Transcriptional regulatory protein ZRAR; response regulator, two component system, AAA domain, NTRC family, DNA-binding; HET: ATP; 3.0A {Salmonella typhimurium} Back     alignment and structure
>2qen_A Walker-type ATPase; unknown function; HET: ADP; 2.25A {Pyrococcus abyssi} Back     alignment and structure
>3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} Back     alignment and structure
>3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} Back     alignment and structure
>1ls1_A Signal recognition particle protein; FFH, SRP54, SRP, GTPase, ultrahigh resolution, protein transport; 1.10A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 1jpn_B* 1jpj_A* 1ry1_U* 2j45_A* 1o87_A* 2c04_A* 2j46_A* 1rj9_B* 2c03_A* 2j7p_A* 1okk_A* 2cnw_A* 1ng1_A* 2xkv_A 3ng1_A 1ffh_A 2ng1_A* Back     alignment and structure
>2gno_A DNA polymerase III, gamma subunit-related protein; structural genomics, joint center for structural genomics, J protein structure initiative; HET: DNA; 2.00A {Thermotoga maritima} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1uaa_A REP helicase, protein (ATP-dependent DNA helicase REP.); complex (helicase/DNA), DNA unwinding, hydrolase/DNA complex; HET: DNA; 3.00A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} Back     alignment and structure
>1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1w4r_A Thymidine kinase; type II, human, cytosolic, phosphorylation, transferase; HET: TTP; 1.83A {Homo sapiens} PDB: 1xbt_A* 2wvj_A* 2j87_A* Back     alignment and structure
>3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} Back     alignment and structure
>2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* Back     alignment and structure
>3u4q_A ATP-dependent helicase/nuclease subunit A; helicase, nuclease, double strand DNA repair, protein-DNA CO hydrolase-DNA complex; HET: DNA; 2.80A {Bacillus subtilis} PDB: 3u44_A* Back     alignment and structure
>1pjr_A PCRA; DNA repair, DNA replication, SOS response, helicase, ATP- binding, DNA-binding; 2.50A {Geobacillus stearothermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1qhg_A* 3pjr_A* 2pjr_A* 1qhh_B* 1qhh_D* 1qhh_A* 1qhh_C* 2pjr_B* Back     alignment and structure
>2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} Back     alignment and structure
>1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A* Back     alignment and structure
>1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* Back     alignment and structure
>2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* Back     alignment and structure
>3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C Back     alignment and structure
>1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2fna_A Conserved hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE ADP; 2.00A {Sulfolobus solfataricus} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} Back     alignment and structure
>2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} Back     alignment and structure
>2v3c_C SRP54, signal recognition 54 kDa protein; nucleotide-binding, signal recognition particle, GTP-binding, RNA-binding; 2.50A {Methanocaldococcus jannaschii} PDB: 3ndb_B Back     alignment and structure
>3hgt_A HDA1 complex subunit 3; RECA-like domain, SWI2/SNF2 helical domain, chromatin regulator, coiled coil, nucleus, repressor, transcription; 2.20A {Saccharomyces cerevisiae} PDB: 3hgq_A Back     alignment and structure
>1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} Back     alignment and structure
>3k1j_A LON protease, ATP-dependent protease LON; ATP-binding, nucleotide-binding, Pro hydrolase; HET: ADP PE8; 2.00A {Thermococcus onnurineus} Back     alignment and structure
>2chq_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATP ATP-binding, nucleotide-binding; HET: ANP; 3.5A {Archaeoglobus fulgidus} PDB: 2chv_A Back     alignment and structure
>2r6a_A DNAB helicase, replicative helicase; replication, DNAB; 2.90A {Geobacillus stearothermophilus} PDB: 2r6c_A 2r6d_A 2r6e_A 2vyf_A 2vye_A Back     alignment and structure
>2ffh_A Protein (FFH); SRP54, signal recognition particle, GTPase, M domain, RNA-binding, signal sequence-binding, helix-turn-helix, protein targeting; 3.20A {Thermus aquaticus} SCOP: a.24.13.1 a.36.1.1 c.37.1.10 PDB: 2iy3_A Back     alignment and structure
>3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A Back     alignment and structure
>3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} Back     alignment and structure
>2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A Back     alignment and structure
>2xxa_A Signal recognition particle protein; protein transport, RNA/RNA binding protein, hydrolase, gtpas; HET: GCP; 3.94A {Escherichia coli} PDB: 2j28_9 Back     alignment and structure
>3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae} Back     alignment and structure
>3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B* Back     alignment and structure
>2q6t_A DNAB replication FORK helicase; hydrolase; 2.90A {Thermus aquaticus} Back     alignment and structure
>1j8m_F SRP54, signal recognition 54 kDa protein; signaling protein; 2.00A {Acidianus ambivalens} SCOP: a.24.13.1 c.37.1.10 PDB: 1j8y_F Back     alignment and structure
>4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>3b85_A Phosphate starvation-inducible protein; PHOH2, ATPase, PFAM: PF02562, ST genomics, PSI-2, protein structure initiative; 2.35A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_H 26S protease regulatory subunit 7 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} Back     alignment and structure
>2gza_A Type IV secretion system protein VIRB11; ATPase, hydrolase; 2.60A {Brucella suis} Back     alignment and structure
>1g5t_A COB(I)alamin adenosyltransferase; P-loop protein, cobalamin biosynthesis, RECA fold; HET: ATP; 1.80A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1g5r_A* 1g64_A* Back     alignment and structure
>2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii} Back     alignment and structure
>2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus} Back     alignment and structure
>2oap_1 GSPE-2, type II secretion system protein; hexameric ATPase, hydrolase; HET: ANP; 2.95A {Archaeoglobus fulgidus} PDB: 2oaq_1 Back     alignment and structure
>2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus} Back     alignment and structure
>1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii} Back     alignment and structure
>3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2kou_A Dicer-like protein 4; ATP-binding, endonuclease, helicase, hydrolase, nuclease, nucleotide-binding, nucleus, RNA- binding; NMR {Arabidopsis thaliana} Back     alignment and structure
>2zts_A Putative uncharacterized protein PH0186; KAIC like protein, ATP-binding, nucleotide-binding, ATP- binding protein; HET: ADP; 2.07A {Pyrococcus horikoshii} Back     alignment and structure
>1zu4_A FTSY; GTPase, signal recognition particle, SRP, receptor, protein transport; 1.95A {Mycoplasma mycoides} PDB: 1zu5_A Back     alignment and structure
>3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1 Back     alignment and structure
>2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} Back     alignment and structure
>3lw7_A Adenylate kinase related protein (ADKA-like); AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 2.30A {Sulfolobus solfataricus} PDB: 3h0k_A Back     alignment and structure
>4b4t_L 26S protease subunit RPT4; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2pt7_A CAG-ALFA; ATPase, protein-protein complex, type IV secretion, hydrolas binding complex; 2.40A {Helicobacter pylori} SCOP: c.37.1.11 PDB: 1nly_A* 1nlz_A 1opx_A* 1g6o_A Back     alignment and structure
>1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 Back     alignment and structure
>1xp8_A RECA protein, recombinase A; recombination, radioresistance, DNA-repair, ATPase, DNA-BIND protein, DNA binding protein; HET: AGS; 2.50A {Deinococcus radiodurans} SCOP: c.37.1.11 d.48.1.1 Back     alignment and structure
>1z6g_A Guanylate kinase; structural genomics, SGC, structural genom consortium, transferase; HET: EPE; 2.18A {Plasmodium falciparum} Back     alignment and structure
>2yhs_A FTSY, cell division protein FTSY; cell cycle, protein targeting, simibi class GTPase, GTP-BIND membrane, nucleotide-binding; 1.60A {Escherichia coli} PDB: 2qy9_A 2xxa_B* 1fts_A Back     alignment and structure
>3ney_A 55 kDa erythrocyte membrane protein; structural genomics consortium, SGC, 55 kDa erythrocyte MEMB protein; 2.26A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>2j37_W Signal recognition particle 54 kDa protein (SRP54); ribosome, SRP, translation/RNA; 8.00A {Canis SP} PDB: 1wgw_A Back     alignment and structure
>4gp7_A Metallophosphoesterase; polynucleotide kinase phosphatase, RNA repair, transferase; HET: ATP CIT; 2.00A {Clostridium thermocellum} PDB: 4gp6_A* Back     alignment and structure
>1kht_A Adenylate kinase; phosphotransferase, signaling protein, transferase; HET: AMP; 2.50A {Methanococcus voltae} SCOP: c.37.1.1 PDB: 3h86_B* 1ki9_A Back     alignment and structure
>1znw_A Guanylate kinase, GMP kinase; ATP:GMP-phosphotransferase, TR; 2.10A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1znx_A* 1zny_A* 1znz_A* 1s4q_A 1z8f_A Back     alignment and structure
>4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3umf_A Adenylate kinase; rossmann fold, transferase; 2.05A {Schistosoma mansoni} Back     alignment and structure
>3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii} Back     alignment and structure
>4b4t_I 26S protease regulatory subunit 4 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3a8t_A Adenylate isopentenyltransferase; rossmann fold protein; HET: ATP; 2.37A {Humulus lupulus} Back     alignment and structure
>2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax} Back     alignment and structure
>1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 Back     alignment and structure
>3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A* Back     alignment and structure
>1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A* Back     alignment and structure
>3exa_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.30A {Bacillus halodurans} PDB: 2qgn_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 1197
d1yksa2299 c.37.1.14 (A:325-623) YFV helicase domain {Yellow 5e-31
d1a1va1136 c.37.1.14 (A:190-325) HCV helicase domain {Human h 2e-24
d2bmfa2305 c.37.1.14 (A:178-482) Dengue virus helicase {Dengu 2e-22
d2bmfa2305 c.37.1.14 (A:178-482) Dengue virus helicase {Dengu 7e-16
d1yksa1140 c.37.1.14 (A:185-324) YFV helicase domain {Yellow 1e-14
d1x47a185 d.50.1.1 (A:8-92) Dgcr8 protein {Human (Homo sapie 3e-09
d1o0wa269 d.50.1.1 (A:168-236) RNase III, C-terminal domain 3e-07
d2nuga268 d.50.1.1 (A:151-218) RNase III, C-terminal domain 9e-07
d1whna_128 d.50.1.1 (A:) tRNA-dihydrouridine synthase 2-like, 2e-06
d1wp9a2286 c.37.1.19 (A:201-486) putative ATP-dependent RNA h 3e-06
d2cpna176 d.50.1.1 (A:150-225) TAR RNA-binding protein 2 {Hu 4e-05
d1uhza_89 d.50.1.1 (A:) staufen homolog 2 {Mouse (Mus muscul 5e-05
d1di2a_69 d.50.1.1 (A:) Double-stranded RNA-binding protein 1e-04
d1uila_113 d.50.1.1 (A:) ATP-dependent RNA helicase A, Dhx9 { 6e-04
d1gkub1237 c.37.1.16 (B:1-250) Helicase-like "domain" of reve 9e-04
d1t4oa_81 d.50.1.1 (A:) RNase III, C-terminal domain {Baker' 0.001
d1qu6a190 d.50.1.1 (A:1-90) dsRNA-dependent protein kinase p 0.002
d1mv5a_242 c.37.1.12 (A:) Multidrug resistance ABC transporte 0.003
d2p6ra3202 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus 0.003
d1whqa_99 d.50.1.1 (A:) ATP-dependent RNA helicase A, Dhx9 { 0.004
>d1yksa2 c.37.1.14 (A:325-623) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Length = 299 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: RNA helicase
domain: YFV helicase domain
species: Yellow fever virus [TaxId: 11089]

 Score =  122 bits (306), Expect = 5e-31
 Identities = 47/308 (15%), Positives = 82/308 (26%), Gaps = 45/308 (14%)

Query: 575 ERPGAVLVFMTGWDDINSLKDQLQAHPLLGDPSRVLLLACHGSMASSEQRLIFDKPEDGV 634
                   F+      N +   L+          V++L  +      E   I  K     
Sbjct: 34  ADKRPTAWFLPSIRAANVMAASLRKAGK-----SVVVL--NRKTFEREYPTIKQKK---- 82

Query: 635 RKIVLATNMAETSITINDVVFVIDCGKA-KETSYDALNNTPCLLPSWISKAAARQRRGRA 693
              +LAT++AE    +  V  V+DC  A K    D         P  IS ++A QRRGR 
Sbjct: 83  PDFILATDIAEMGANL-CVERVLDCRTAFKPVLVDEGRKVAIKGPLRISASSAAQRRGRI 141

Query: 694 GRVQPGE-CYHLYPRYVYDAFADYQLPELLRTPLQSLCLQIKSLQLGSISEFLSRALQPP 752
           GR    +   + Y     +  A +         L ++ ++   +      E         
Sbjct: 142 GRNPNRDGDSYYYSEPTSENNAHHVCWLEASMLLDNMEVRGGMVAPLYGVEG--TKTPVS 199

Query: 753 EPLSVKNAIEYLQIIGALDENENLTVLGRNLSMLPVEPKLGKMLILGAIFNCLDPVMTVV 812
                    +       +   +    L   ++   ++    K                  
Sbjct: 200 PGEMRLRDDQRKVFRELVRNCDLPVWLSWQVAKAGLKTNDRKWC---------------- 243

Query: 813 AGLSVRDPFLMPFDKKDLAESAKAQFSARDYSDHLALVRAYDGWKDAERHQSGYEYCWKN 872
                   F  P + + L +S +             L      W D  R  S        
Sbjct: 244 --------FEGPEEHEILNDSGETVKCRAPGGAKKPL---RPRWCDE-RVSSDQS-ALSE 290

Query: 873 FLSAQTLK 880
           F+     +
Sbjct: 291 FIKFAEGR 298
>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Length = 136 Back     information, alignment and structure
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Length = 305 Back     information, alignment and structure
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Length = 305 Back     information, alignment and structure
>d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Length = 140 Back     information, alignment and structure
>d1x47a1 d.50.1.1 (A:8-92) Dgcr8 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1o0wa2 d.50.1.1 (A:168-236) RNase III, C-terminal domain {Thermotoga maritima [TaxId: 2336]} Length = 69 Back     information, alignment and structure
>d2nuga2 d.50.1.1 (A:151-218) RNase III, C-terminal domain {Aquifex aeolicus [TaxId: 63363]} Length = 68 Back     information, alignment and structure
>d1whna_ d.50.1.1 (A:) tRNA-dihydrouridine synthase 2-like, Dus2l (2310016k04Rik) {Mouse (Mus musculus) [TaxId: 10090]} Length = 128 Back     information, alignment and structure
>d1wp9a2 c.37.1.19 (A:201-486) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Length = 286 Back     information, alignment and structure
>d2cpna1 d.50.1.1 (A:150-225) TAR RNA-binding protein 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 76 Back     information, alignment and structure
>d1uhza_ d.50.1.1 (A:) staufen homolog 2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 89 Back     information, alignment and structure
>d1di2a_ d.50.1.1 (A:) Double-stranded RNA-binding protein A, second dsRBD {Xenopus laevis [TaxId: 8355]} Length = 69 Back     information, alignment and structure
>d1uila_ d.50.1.1 (A:) ATP-dependent RNA helicase A, Dhx9 {Mouse (Mus musculus) [TaxId: 10090]} Length = 113 Back     information, alignment and structure
>d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 237 Back     information, alignment and structure
>d1t4oa_ d.50.1.1 (A:) RNase III, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 81 Back     information, alignment and structure
>d1qu6a1 d.50.1.1 (A:1-90) dsRNA-dependent protein kinase pkr {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Length = 242 Back     information, alignment and structure
>d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Length = 202 Back     information, alignment and structure
>d1whqa_ d.50.1.1 (A:) ATP-dependent RNA helicase A, Dhx9 {Mouse (Mus musculus) [TaxId: 10090]} Length = 99 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query1197
d2bmfa2305 Dengue virus helicase {Dengue virus type 2 [TaxId: 99.98
d1yksa2299 YFV helicase domain {Yellow fever virus [TaxId: 11 99.92
d1veca_206 DEAD box RNA helicase rck/p54 {Human (Homo sapiens 99.78
d2j0sa1222 Probable ATP-dependent RNA helicase DDX48 {Human ( 99.77
d2p6ra3202 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 99.77
d1qdea_212 Initiation factor 4a {Baker's yeast (Saccharomyces 99.77
d2g9na1218 Initiation factor 4a {Human (Homo sapiens) [TaxId: 99.76
d1c4oa2174 Nucleotide excision repair enzyme UvrB {Thermus th 99.75
d1t6na_207 Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo 99.75
d1t5la2181 Nucleotide excision repair enzyme UvrB {Bacillus c 99.74
d1hv8a1208 Putative DEAD box RNA helicase {Archaeon Methanoco 99.74
d1s2ma2171 Putative ATP-dependent RNA helicase DHH1 {Baker's 99.74
d2j0sa2168 Probable ATP-dependent RNA helicase DDX48 {Human ( 99.74
d1fuka_162 Initiation factor 4a {Baker's yeast (Saccharomyces 99.74
d2rb4a1168 ATP-dependent RNA helicase DDX25 {Human (Homo sapi 99.74
d1oywa3200 RecQ helicase domain {Escherichia coli [TaxId: 562 99.73
d1hv8a2155 Putative DEAD box RNA helicase {Archaeon Methanoco 99.72
d1t5ia_168 Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo 99.71
d1a1va1136 HCV helicase domain {Human hepatitis C virus (HCV) 99.7
d1s2ma1206 Putative ATP-dependent RNA helicase DHH1 {Baker's 99.69
d1q0ua_209 Probable DEAD box RNA helicase YqfR {Bacillus stea 99.68
d1wrba1238 putative ATP-dependent RNA helicase VlgB {Flatworm 99.67
d1yksa1140 YFV helicase domain {Yellow fever virus [TaxId: 11 99.66
d1gkub1237 Helicase-like "domain" of reverse gyrase {Archaeon 99.64
d1wp9a1200 putative ATP-dependent RNA helicase PF2015 {Pyroco 99.63
d2p6ra4201 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 99.62
d1jr6a_138 HCV helicase domain {Human hepatitis C virus (HCV) 99.61
d1wp9a2286 putative ATP-dependent RNA helicase PF2015 {Pyroco 99.59
d1oywa2206 RecQ helicase domain {Escherichia coli [TaxId: 562 99.59
d1a1va2299 HCV helicase domain {Human hepatitis C virus (HCV) 99.4
d1gm5a4206 RecG helicase domain {Thermotoga maritima [TaxId: 99.38
d2fz4a1206 DNA repair protein RAD25 {Archaeoglobus fulgidus [ 99.37
d2eyqa5211 Transcription-repair coupling factor, TRCF {Escher 99.33
d2fwra1200 DNA repair protein RAD25 {Archaeoglobus fulgidus [ 99.29
d1rifa_282 DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665] 99.28
d1gm5a3264 RecG helicase domain {Thermotoga maritima [TaxId: 99.27
d2eyqa3233 Transcription-repair coupling factor, TRCF {Escher 99.19
d1gkub2248 Helicase-like "domain" of reverse gyrase {Archaeon 99.18
d1whna_128 tRNA-dihydrouridine synthase 2-like, Dus2l (231001 99.04
d1x47a185 Dgcr8 protein {Human (Homo sapiens) [TaxId: 9606]} 98.96
d1whqa_99 ATP-dependent RNA helicase A, Dhx9 {Mouse (Mus mus 98.95
d2dixa173 Interferon-inducible double stranded RNA-dependent 98.93
d1di2a_69 Double-stranded RNA-binding protein A, second dsRB 98.92
d1uhza_89 staufen homolog 2 {Mouse (Mus musculus) [TaxId: 10 98.91
d2nuga268 RNase III, C-terminal domain {Aquifex aeolicus [Ta 98.88
d1o0wa269 RNase III, C-terminal domain {Thermotoga maritima 98.83
d2cpna176 TAR RNA-binding protein 2 {Human (Homo sapiens) [T 98.83
d1ekza_76 Staufen, domain III {Fruit fly (Drosophila melanog 98.71
d1qu6a190 dsRNA-dependent protein kinase pkr {Human (Homo sa 98.61
d1x49a185 dsRNA-dependent protein kinase pkr {Mouse (Mus mus 98.57
d1qu6a289 dsRNA-dependent protein kinase pkr {Human (Homo sa 98.55
d1t4oa_81 RNase III, C-terminal domain {Baker's yeast (Sacch 98.5
d2b7va171 dsRNA-specific editase 1 {Rat (Rattus norvegicus) 98.44
d2b7ta173 dsRNA-specific editase 1 {Rat (Rattus norvegicus) 98.38
d1tf5a4175 Translocation ATPase SecA, nucleotide-binding doma 98.36
d1uila_113 ATP-dependent RNA helicase A, Dhx9 {Mouse (Mus mus 98.3
d1x48a176 dsRNA-dependent protein kinase pkr {Mouse (Mus mus 98.29
d1z3ix1346 Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxI 98.27
d2dmya184 Spermatid perinuclear RNA-binding protein {Human ( 98.26
d1z5za1244 Helicase of the SNF2/Rad54 hamily {Sulfolobus solf 98.25
d1z3ix2298 Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxI 98.12
d1z63a1230 Helicase of the SNF2/Rad54 hamily {Sulfolobus solf 97.95
d1w36d1359 Exodeoxyribonuclease V alpha chain (RecD) {Escheri 97.65
d1nkta4219 Translocation ATPase SecA, nucleotide-binding doma 97.12
d1okkd2207 GTPase domain of the signal recognition particle r 96.92
d1nkta3288 Translocation ATPase SecA, nucleotide-binding doma 96.9
d1tf5a3273 Translocation ATPase SecA, nucleotide-binding doma 96.86
d1vmaa2213 GTPase domain of the signal recognition particle r 96.83
d1ls1a2207 GTPase domain of the signal sequence recognition p 96.78
d2qy9a2211 GTPase domain of the signal recognition particle r 96.76
d1uaaa1306 DEXX box DNA helicase {Escherichia coli, RepD [Tax 96.39
d1pjra1318 DEXX box DNA helicase {Bacillus stearothermophilus 95.98
d1a5ta2207 delta prime subunit of DNA polymerase III, N-domai 95.75
d1njfa_239 delta prime subunit of DNA polymerase III, N-domai 95.61
d1j8yf2211 GTPase domain of the signal sequence recognition p 95.6
d1sxjc2227 Replication factor C3 {Baker's yeast (Saccharomyce 94.99
g1qhh.1623 DEXX box DNA helicase {Bacillus stearothermophilus 94.76
d2gnoa2198 gamma subunit of DNA polymerase III, N-domain {The 94.59
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 94.26
d1sxjb2224 Replication factor C4 {Baker's yeast (Saccharomyce 94.17
d1r6bx2268 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 93.44
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 93.38
d1sxjd2237 Replication factor C2 {Baker's yeast (Saccharomyce 93.29
d1l8qa2213 Chromosomal replication initiation factor DnaA {Aq 92.99
d1sxje2252 Replication factor C5 {Baker's yeast (Saccharomyce 92.57
d2b8ta1139 Thymidine kinase, TK1, N-terminal domain {Ureaplas 91.74
d2i3ba1189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 91.74
d1g6oa_323 Hexameric traffic ATPase, HP0525 {Helicobacter pyl 90.86
d1fnna2276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 90.58
d1khta_190 Adenylate kinase {Archaeon Methanococcus voltae [T 90.56
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 90.27
d1zp6a1176 Hypothetical protein Atu3015 {Agrobacterium tumefa 89.68
d1lw7a2192 Transcriptional regulator NadR, ribosylnicotinamid 89.33
d1kaga_169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 89.2
d1knqa_171 Gluconate kinase {Escherichia coli [TaxId: 562]} 88.97
d3adka_194 Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} 88.85
d1ixza_247 AAA domain of cell division protein FtsH {Thermus 88.72
d1p9ra_401 Extracellular secretion NTPase EpsE {Vibrio choler 88.54
d1qhxa_178 Chloramphenicol phosphotransferase {Streptomyces v 88.27
d1tf7a2242 Circadian clock protein KaiC {Synechococcus sp. st 88.27
d2bdta1176 Hypothetical protein BH3686 {Bacillus halodurans [ 88.12
d1rkba_173 Adenylate kinase {Human (Homo sapiens), isoenzyme 86.86
d1n0wa_242 DNA repair protein Rad51, catalytic domain {Human 86.84
d1y63a_174 Probable kinase LmjF30.1890 {Leishmania major [Tax 86.79
d1pzna2254 DNA repair protein Rad51, catalytic domain {Archae 86.66
d1t5la1413 Nucleotide excision repair enzyme UvrB {Bacillus c 86.36
d1zaka1189 Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} 86.27
d1e32a2258 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 86.17
d1gm5a3264 RecG helicase domain {Thermotoga maritima [TaxId: 85.56
d1ukza_196 Uridylate kinase {Baker's yeast (Saccharomyces cer 84.97
d1m8pa3183 ATP sulfurylase C-terminal domain {Fungus (Penicil 84.91
d1rz3a_198 Hypothetical protein rbstp0775 {Bacillus stearothe 84.73
d1qf9a_194 UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 84.61
d1teva_194 UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] 84.54
d2p6ra185 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 84.5
d1xx6a1141 Thymidine kinase, TK1, N-terminal domain {Clostrid 84.43
d1ny5a2247 Transcriptional activator sigm54 (NtrC1), C-termin 84.43
d1e4va1179 Adenylate kinase {Escherichia coli [TaxId: 562]} 84.08
d1znwa1182 Guanylate kinase {Mycobacterium tuberculosis [TaxI 83.99
d1zina1182 Adenylate kinase {Bacillus stearothermophilus [Tax 83.98
d1s3ga1182 Adenylate kinase {Bacillus globisporus [TaxId: 145 83.88
d1ofha_309 HslU {Haemophilus influenzae [TaxId: 727]} 83.33
d1szpa2251 DNA repair protein Rad51, catalytic domain {Baker' 83.21
d1ak2a1190 Adenylate kinase {Cow (Bos taurus), mitochondrial 83.11
d1tf7a1242 Circadian clock protein KaiC {Synechococcus sp. st 83.0
d1cr2a_277 Gene 4 protein (g4p, DNA primase), helicase domain 82.59
d2cdna1181 Adenylate kinase {Mycobacterium tuberculosis [TaxI 82.44
d1qvra3315 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 82.42
d1nksa_194 Adenylate kinase {Archaeon Sulfolobus acidocaldari 82.36
d1in4a2238 Holliday junction helicase RuvB {Thermotoga mariti 82.0
d2i1qa2258 DNA repair protein Rad51, catalytic domain {Archae 81.94
d1x6va3195 Adenosine-5'phosphosulfate kinase (APS kinase) {Hu 81.93
d1w36b1485 Exodeoxyribonuclease V beta chain (RecB), N-termin 81.75
d1v5wa_258 Meiotic recombination protein DMC1/LIM15 homolog { 81.61
d1g41a_443 HslU {Haemophilus influenzae [TaxId: 727]} 81.23
d1yj5a2172 5' polynucleotide kinase-3' phosphatase, C-termina 80.65
d1e6ca_170 Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax 80.42
d1ckea_225 CMP kinase {Escherichia coli [TaxId: 562]} 80.25
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: RNA helicase
domain: Dengue virus helicase
species: Dengue virus type 2 [TaxId: 11060]

Probab=99.98  E-value=2.3e-33  Score=314.95  Aligned_cols=294  Identities=17%  Similarity=0.142  Sum_probs=207.3

Q ss_pred             HHHcCCeEEEEecCCChHHHHHHHHHHHHHHHHccCCceEEEecchHHHHHHHHHHHHHHHhCCcccceeeeEeeecccc
Q 000991          309 AISENQVVVVSGETGCGKTTQLPQYILESETEAARGAACSIICTQPRRISAMAVSERVAAERGEKLGESVGYKVRLEGMK  388 (1197)
Q Consensus       309 ~I~~~~vvII~apTGSGKTtq~pq~ILe~~~~~~~g~~~~IivtqPrR~LA~qva~rVa~e~g~~lg~~VGy~ir~e~~~  388 (1197)
                      +++++++++|.||||||||++++.++++.....  +  .+++|++|+|+||.|++++++...   . ...++  ..+...
T Consensus         5 ~~~~~~~~lv~~~TGsGKT~~~l~~~~~~~~~~--~--~~~lvi~Ptr~La~q~~~~l~~~~---~-~~~~~--~~~~~~   74 (305)
T d2bmfa2           5 IFRKKRLTIMDLHPGAGKTKRYLPAIVREAIKR--G--LRTLILAPTRVVAAEMEEALRGLP---I-RYQTP--AIRAEH   74 (305)
T ss_dssp             SSSTTCEEEECCCTTSSTTTTHHHHHHHHHHHH--T--CCEEEEESSHHHHHHHHHHTTTSC---C-BCCC---------
T ss_pred             HhhcCCcEEEEECCCCCHHHHHHHHHHHHHHhc--C--CEEEEEccHHHHHHHHHHHHhcCC---c-ceeee--EEeecc
Confidence            356899999999999999998888888776643  2  346667799999999988774321   1 11111  123334


Q ss_pred             CCCceEEEEcchHHHHHHhcCCCCCCccEEEEecCCCCCCChhHHHHHHHHHcccCccceEEEecccCCHHHHHhhhCCC
Q 000991          389 GRDTRLMFCTTGILLRRLLVDRSLRGVTHVIVDEIHERGMNEDFLLIVLKELLPRRPELRLILMSATLNAELFSSYFGGA  468 (1197)
Q Consensus       389 ~~~t~Ilv~Tpg~LLr~L~~d~~L~~is~VIIDEaHeR~~~~D~Ll~lLr~ll~~r~~lklIlmSATl~~~~f~~yf~~~  468 (1197)
                      ...+.|+++|++.|...+..+..+.++++|||||+|+.+.....+..+++.+.. ++++++++||||++...        
T Consensus        75 ~~~~~i~~~t~~~l~~~~~~~~~~~~~~~vViDE~H~~~~~~~~~~~~l~~~~~-~~~~~~v~~SAT~~~~~--------  145 (305)
T d2bmfa2          75 TGREIVDLMCHATFTMRLLSPIRVPNYNLIIMDEAHFTDPASIAARGYISTRVE-MGEAAGIFMTATPPGSR--------  145 (305)
T ss_dssp             -CCCSEEEEEHHHHHHHHTSSSCCCCCSEEEEESTTCCSHHHHHHHHHHHHHHH-HTSCEEEEECSSCTTCC--------
T ss_pred             cCccccccCCcHHHHHHHhcCccccceeEEEeeeeeecchhhHHHHHHHHHhhc-cccceEEEeecCCCcce--------
Confidence            567889999999999988888889999999999999765445455555555433 46789999999985321        


Q ss_pred             CccccCCcccceeeeehHhHHHHhhhccCcccccccchhhhhHHHHHHHHHHHhhhhhhHHHHHHHHHhhhhcchhhhhh
Q 000991          469 PMLHIPGFTYPVRAYFLENILEMTRYRLNTYNQIDDYGQEKSWKMQKQALALRKRKSSIASAVEDALEAADFREYSVQTQ  548 (1197)
Q Consensus       469 pvi~i~gr~~PV~~~yledi~~l~~~~l~~~~~i~~~~~e~~~~~~~~~~~~~~~~~~~~~~ve~~l~~~~~~~~~~~~~  548 (1197)
                        .......+|+......               +...                                           
T Consensus       146 --~~~~~~~~~~~~~~~~---------------~~~~-------------------------------------------  165 (305)
T d2bmfa2         146 --DPFPQSNAPIMDEERE---------------IPER-------------------------------------------  165 (305)
T ss_dssp             --CSSCCCSSCEEEEECC---------------CCCS-------------------------------------------
T ss_pred             --eeecccCCcceEEEEe---------------ccHH-------------------------------------------
Confidence              1111122222211100               0000                                           


Q ss_pred             hccccCCCCCCchhhHHHHHHHHHhhcCCCcEEEEeCCHHHHHHHHHHHHcCCCCCCCCceEEEeccCCCCHHHHHHhcC
Q 000991          549 QSLSCWNPDSIGFNLIEHVLCHIVKKERPGAVLVFMTGWDDINSLKDQLQAHPLLGDPSRVLLLACHGSMASSEQRLIFD  628 (1197)
Q Consensus       549 ~~l~~~~~~~i~~~li~~ll~~i~~~~~~g~iLVFl~~~~ei~~l~~~L~~~~~~~~~~~~~I~~lHs~L~~~er~~v~~  628 (1197)
                             ....       .+..+  ....+++||||+++++++.+++.|.+.       ++.+..+||+++.+++    .
T Consensus       166 -------~~~~-------~~~~~--~~~~~~~lvf~~~~~~~~~l~~~L~~~-------~~~~~~l~~~~~~~~~----~  218 (305)
T d2bmfa2         166 -------SWNS-------GHEWV--TDFKGKTVWFVPSIKAGNDIAACLRKN-------GKKVIQLSRKTFDSEY----I  218 (305)
T ss_dssp             -------CCSS-------CCHHH--HSSCSCEEEECSCHHHHHHHHHHHHHH-------TCCCEECCTTCHHHHG----G
T ss_pred             -------HHHH-------HHHHH--HhhCCCEEEEeccHHHHHHHHHHHHhC-------CCCEEEeCCcChHHHH----h
Confidence                   0000       00111  124688999999999999999999876       4457889999876544    3


Q ss_pred             CCCCCceEEEEeecccccccccCCEEEEEeCCCCCcc--cccCCCCCCCccccccCHhhHHhhhcccCCCCCCeEE-Eec
Q 000991          629 KPEDGVRKIVLATNMAETSITINDVVFVIDCGKAKET--SYDALNNTPCLLPSWISKAAARQRRGRAGRVQPGECY-HLY  705 (1197)
Q Consensus       629 ~f~~G~~kVLVATniaEtGIdIPdV~~VId~G~~k~~--~yD~~~~~~~l~~~~iSkas~~QR~GRAGR~~~G~cy-~Ly  705 (1197)
                      .+++|.++++|||+++++|+|+ ++++|||+|.....  .||+++....+...++|.++|.||+|||||.+.|..+ .+|
T Consensus       219 ~~~~~~~~~lvaT~~~~~G~~~-~~~~Vi~~~~~~~~~~~~~~~~~~~~~~~~~~s~~~~~Qr~GR~GR~~~~~~~~~~~  297 (305)
T d2bmfa2         219 KTRTNDWDFVVTTDISEMGANF-KAERVIDPRRCMKPVILTDGEERVILAGPMPVTHSSAAQRRGRVGRNPKNENDQYIY  297 (305)
T ss_dssp             GGGTSCCSEEEECGGGGTTCCC-CCSEEEECCEEEEEEEECSSSCEEEEEEEEECCHHHHHHHHTTSSCSSSCCCEEEEE
T ss_pred             hhhccchhhhhhhHHHHhcCCC-CccEEEEcCCceeeeEecCCCCceEEeccccCCHHHHhhhhcCcCcCCCCceEEEEE
Confidence            5678999999999999999999 68899999876543  4888888888888999999999999999999876655 466


Q ss_pred             cccc
Q 000991          706 PRYV  709 (1197)
Q Consensus       706 s~~~  709 (1197)
                      ..+.
T Consensus       298 ~~~~  301 (305)
T d2bmfa2         298 MGEP  301 (305)
T ss_dssp             CSCC
T ss_pred             CCCC
Confidence            6544
>d1yksa2 c.37.1.14 (A:325-623) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d1veca_ c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2g9na1 c.37.1.19 (A:21-238) Initiation factor 4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1c4oa2 c.37.1.19 (A:410-583) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1t6na_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t5la2 c.37.1.19 (A:415-595) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} Back     information, alignment and structure
>d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1s2ma2 c.37.1.19 (A:252-422) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2j0sa2 c.37.1.19 (A:244-411) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fuka_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1oywa3 c.37.1.19 (A:207-406) RecQ helicase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hv8a2 c.37.1.19 (A:211-365) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1t5ia_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1s2ma1 c.37.1.19 (A:46-251) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1q0ua_ c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1wrba1 c.37.1.19 (A:164-401) putative ATP-dependent RNA helicase VlgB {Flatworm (Dugesia japonica) [TaxId: 6161]} Back     information, alignment and structure
>d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2p6ra4 c.37.1.19 (A:203-403) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1jr6a_ c.37.1.14 (A:) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1wp9a2 c.37.1.19 (A:201-486) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1oywa2 c.37.1.19 (A:1-206) RecQ helicase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1a1va2 c.37.1.14 (A:326-624) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1gm5a4 c.37.1.19 (A:550-755) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2eyqa5 c.37.1.19 (A:779-989) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fwra1 c.37.1.19 (A:257-456) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1rifa_ c.37.1.23 (A:) DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gkub2 c.37.1.16 (B:251-498) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1whna_ d.50.1.1 (A:) tRNA-dihydrouridine synthase 2-like, Dus2l (2310016k04Rik) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x47a1 d.50.1.1 (A:8-92) Dgcr8 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whqa_ d.50.1.1 (A:) ATP-dependent RNA helicase A, Dhx9 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dixa1 d.50.1.1 (A:7-79) Interferon-inducible double stranded RNA-dependent protein kinase activator A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1di2a_ d.50.1.1 (A:) Double-stranded RNA-binding protein A, second dsRBD {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1uhza_ d.50.1.1 (A:) staufen homolog 2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2nuga2 d.50.1.1 (A:151-218) RNase III, C-terminal domain {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1o0wa2 d.50.1.1 (A:168-236) RNase III, C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2cpna1 d.50.1.1 (A:150-225) TAR RNA-binding protein 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ekza_ d.50.1.1 (A:) Staufen, domain III {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1qu6a1 d.50.1.1 (A:1-90) dsRNA-dependent protein kinase pkr {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x49a1 d.50.1.1 (A:8-92) dsRNA-dependent protein kinase pkr {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1qu6a2 d.50.1.1 (A:91-179) dsRNA-dependent protein kinase pkr {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t4oa_ d.50.1.1 (A:) RNase III, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2b7va1 d.50.1.1 (A:1-71) dsRNA-specific editase 1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2b7ta1 d.50.1.1 (A:1-73) dsRNA-specific editase 1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1tf5a4 c.37.1.19 (A:396-570) Translocation ATPase SecA, nucleotide-binding domains {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1uila_ d.50.1.1 (A:) ATP-dependent RNA helicase A, Dhx9 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x48a1 d.50.1.1 (A:8-83) dsRNA-dependent protein kinase pkr {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1z3ix1 c.37.1.19 (X:390-735) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]} Back     information, alignment and structure
>d2dmya1 d.50.1.1 (A:8-91) Spermatid perinuclear RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z5za1 c.37.1.19 (A:663-906) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1z3ix2 c.37.1.19 (X:92-389) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]} Back     information, alignment and structure
>d1z63a1 c.37.1.19 (A:432-661) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nkta4 c.37.1.19 (A:397-615) Translocation ATPase SecA, nucleotide-binding domains {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1tf5a3 c.37.1.19 (A:1-226,A:349-395) Translocation ATPase SecA, nucleotide-binding domains {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} Back     information, alignment and structure
>d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2b8ta1 c.37.1.24 (A:11-149) Thymidine kinase, TK1, N-terminal domain {Ureaplasma urealyticum [TaxId: 2130]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1t5la1 c.37.1.19 (A:2-414) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} Back     information, alignment and structure
>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2p6ra1 a.4.5.43 (A:404-488) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1xx6a1 c.37.1.24 (A:2-142) Thymidine kinase, TK1, N-terminal domain {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d1ny5a2 c.37.1.20 (A:138-384) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} Back     information, alignment and structure
>d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} Back     information, alignment and structure
>d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w36b1 c.37.1.19 (B:1-485) Exodeoxyribonuclease V beta chain (RecB), N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure