Citrus Sinensis ID: 001074
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
|
|
Close Homologs for Annotation Transfer
Close Homologs in SWISS-PROT Database Detected by BLAST 
Original result of BLAST against SWISS-PROT Database
| ID | Alignment graph | Length |
Definition |
RBH(Q2H) |
RBH(H2Q) |
Q cover |
H cover |
Identity |
E-value |
| Query | 1163 | 2.2.26 [Sep-21-2011] | |||||||
| P93028 | 1080 | Ubiquitin-activating enzy | yes | no | 0.926 | 0.997 | 0.810 | 0.0 | |
| P92974 | 1077 | Ubiquitin-activating enzy | no | no | 0.914 | 0.987 | 0.801 | 0.0 | |
| P31251 | 1051 | Ubiquitin-activating enzy | N/A | no | 0.867 | 0.960 | 0.8 | 0.0 | |
| P20973 | 1051 | Ubiquitin-activating enzy | N/A | no | 0.867 | 0.960 | 0.8 | 0.0 | |
| P31252 | 1053 | Ubiquitin-activating enzy | N/A | no | 0.867 | 0.958 | 0.770 | 0.0 | |
| A3KMV5 | 1058 | Ubiquitin-like modifier-a | yes | no | 0.885 | 0.973 | 0.447 | 0.0 | |
| P22314 | 1058 | Ubiquitin-like modifier-a | yes | no | 0.885 | 0.973 | 0.449 | 0.0 | |
| Q29504 | 1058 | Ubiquitin-like modifier-a | yes | no | 0.885 | 0.973 | 0.447 | 0.0 | |
| Q5U300 | 1058 | Ubiquitin-like modifier-a | yes | no | 0.891 | 0.980 | 0.434 | 0.0 | |
| P31254 | 1058 | Ubiquitin-like modifier-a | yes | no | 0.893 | 0.982 | 0.433 | 0.0 |
| >sp|P93028|UBE11_ARATH Ubiquitin-activating enzyme E1 1 OS=Arabidopsis thaliana GN=UBA1 PE=1 SV=1 | Back alignment and function desciption |
|---|
Score = 1844 bits (4777), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 887/1095 (81%), Positives = 986/1095 (90%), Gaps = 18/1095 (1%)
Query: 69 KRASEGVVVVNEETQNAAQESQNDIEIANASSATKKHRISATADSNNNSSSSSSNNVVTG 128
KRASE A + ++ I + +++KK RI T S++ SSS ++ G
Sbjct: 4 KRASE------------ANDKNDNTIIGSDLASSKKRRIDFTESSSDKSSSILASGSSRG 51
Query: 129 KEGENHSISASIAEVPIMTLGNSNQTDIDEDLHSRQLAVYGRETMRRLFASNILVSGMQG 188
G+ S+ + M GNSN+ +IDEDLHSRQLAVYGRETMRRLFASN+L+SGM G
Sbjct: 52 FHGD------SVVQQIDMAFGNSNRQEIDEDLHSRQLAVYGRETMRRLFASNVLISGMHG 105
Query: 189 LGAEIAKNLILAGVKSVTLHDEGTVELWDLSSNFVFSDNDIGKNRALASVQKLQELNNAV 248
LGAEIAKNLILAGVKSVTLHDE VELWDLSSNFVFS++D+GKNRA ASVQKLQ+LNNAV
Sbjct: 106 LGAEIAKNLILAGVKSVTLHDERVVELWDLSSNFVFSEDDVGKNRADASVQKLQDLNNAV 165
Query: 249 VLSTLTSKLTKEQLSDFQAVVFTDISLDKAIEFDDFCHNHQPAISFIKAEVRGLFGSVFC 308
V+S+LT L KE LS FQ VVF+DIS+++AIEFDD+CH+HQP I+F+KA+VRGLFGSVFC
Sbjct: 166 VVSSLTKSLNKEDLSGFQVVVFSDISMERAIEFDDYCHSHQPPIAFVKADVRGLFGSVFC 225
Query: 309 DFGPEFTVVDVDGEDPHTGIIASISNDNPALVSCVDDERLEFQDGDLVVFSEVHGMTELN 368
DFGPEF V+DVDGE+PHTGIIASISN+N A +SCVDDERLEF+DGDLVVFSEV GMTELN
Sbjct: 226 DFGPEFAVLDVDGEEPHTGIIASISNENQAFISCVDDERLEFEDGDLVVFSEVEGMTELN 285
Query: 369 DGKPRKIKSARPYSFTLEEDTTNYGTYVKGGIVTQVKQPKVLNFKPLREALEDPGDFLLS 428
DGKPRKIKS RPYSFTL+EDTTNYGTYVKGGIVTQVKQPK+LNFKPLREAL+DPGDFL S
Sbjct: 286 DGKPRKIKSTRPYSFTLDEDTTNYGTYVKGGIVTQVKQPKLLNFKPLREALKDPGDFLFS 345
Query: 429 DFSKFDRPPPLHLAFQALDKFVSELGRFPVAGSEEDAQKLISVATNINESLGDGRVEDIN 488
DFSKFDRPP LHLAFQALD F +E GRFPVAGSEEDAQKLIS+AT IN GD +VE+++
Sbjct: 346 DFSKFDRPPLLHLAFQALDHFKAEAGRFPVAGSEEDAQKLISIATAINTGQGDLKVENVD 405
Query: 489 TKLLRHFAFGARAVLNPMAAMFGGIVGQEVVKACSGKFHPLYQFFYFDSVESLPTEPLDS 548
KLLRHF+FGA+AVLNPMAAMFGGIVGQEVVKACSGKFHPL+QFFYFDSVESLP+EP+DS
Sbjct: 406 QKLLRHFSFGAKAVLNPMAAMFGGIVGQEVVKACSGKFHPLFQFFYFDSVESLPSEPVDS 465
Query: 549 TEFKPINSRYDAQISVFGAKLQKKLEDAKVFIVGSGALGCEFLKNVALMGVSCGNQGKLT 608
++F P NSRYDAQISVFGAK QKKLEDAKVF VGSGALGCEFLKN+ALMGVSCG+QGKLT
Sbjct: 466 SDFAPRNSRYDAQISVFGAKFQKKLEDAKVFTVGSGALGCEFLKNLALMGVSCGSQGKLT 525
Query: 609 ITDDDVIEKSNLSRQFLFRDWNIGQAKSTVAASAATSINPRLNIEALQNRVGPETENVFD 668
+TDDD+IEKSNLSRQFLFRDWNIGQAKSTVAASAA INPR NIEALQNRVG ETENVFD
Sbjct: 526 VTDDDIIEKSNLSRQFLFRDWNIGQAKSTVAASAAAVINPRFNIEALQNRVGAETENVFD 585
Query: 669 DTFWENITCVINALDNVNARLYVDQRCLYFQKPLLESGTLGAKCNTQMVIPHLTENYGAS 728
D FWEN+T V+NALDNVNARLYVD RCLYFQKPLLESGTLG KCNTQ VIPHLTENYGAS
Sbjct: 586 DAFWENLTVVVNALDNVNARLYVDSRCLYFQKPLLESGTLGTKCNTQSVIPHLTENYGAS 645
Query: 729 RDPPEKQAPMCTVHSFPHNIDHCLTWARSEFEGLLEKTPAEVNAYLSNPVEYTTSMANAG 788
RDPPEKQAPMCTVHSFPHNIDHCLTWARSEFEGLLEKTPAEVNAYLS+PVEYT SM +AG
Sbjct: 646 RDPPEKQAPMCTVHSFPHNIDHCLTWARSEFEGLLEKTPAEVNAYLSSPVEYTNSMMSAG 705
Query: 789 DAQARDNLERVLECLDKEKCEIFQDCITWARLKFEDYFSNRVKQLIFTFPEDAATSTGAP 848
DAQARD LER++ECL+KEKCE FQDC+TWARL+FEDYF NRVKQLI+TFPEDAATSTGAP
Sbjct: 706 DAQARDTLERIVECLEKEKCETFQDCLTWARLRFEDYFVNRVKQLIYTFPEDAATSTGAP 765
Query: 849 FWSAPKRFPHPLQFSSADPSHLHFVMAASILRAETFGIPIPDWTNNPKMLAEAVDKVMVP 908
FWSAPKRFP PLQ+SS+DPS L+F+ A +ILRAETFGIPIP+WT NPK AEAVD+V+VP
Sbjct: 766 FWSAPKRFPRPLQYSSSDPSLLNFITATAILRAETFGIPIPEWTKNPKEAAEAVDRVIVP 825
Query: 909 DFLPKKDAKILTDEKATTLSTASVDDAAVINDLIIKLEQCRKNLPSGFRLKPIQFEKDDD 968
DF P++DAKI+TDEKATTL+TASVDDAAVI+DLI K++QCR NL FR+KPIQFEKDDD
Sbjct: 826 DFEPRQDAKIVTDEKATTLTTASVDDAAVIDDLIAKIDQCRHNLSPDFRMKPIQFEKDDD 885
Query: 969 TNYHMDMIAGLANMRARNYSIPEVDKLKAKFIAGRIIPAIATSTAMATGLVCLELYKVLD 1028
TNYHMD+IAGLANMRARNYSIPEVDKLKAKFIAGRIIPAIATSTAMATGLVCLELYKVLD
Sbjct: 886 TNYHMDVIAGLANMRARNYSIPEVDKLKAKFIAGRIIPAIATSTAMATGLVCLELYKVLD 945
Query: 1029 GGHKLEDYRNTFANLALPLFSMAEPVPPKVIKHRDMSWTVWDRWILKDNPTLRELIQWLK 1088
GGHK+E YRNTFANLALPLFSMAEP+PPKV+KHRDM+WTVWDRW+LK NPTLRE++QWL+
Sbjct: 946 GGHKVEAYRNTFANLALPLFSMAEPLPPKVVKHRDMAWTVWDRWVLKGNPTLREVLQWLE 1005
Query: 1089 DKGLNAYSISCGSCLLFNSMFPRHKERMDKKVVDLAREVAKVELPPYRRHLDVVVACEDD 1148
DKGL+AYSISCGSCLLFNSMF RHKERMDKKVVDLAR+VAKVELPPYR HLDVVVACED+
Sbjct: 1006 DKGLSAYSISCGSCLLFNSMFTRHKERMDKKVVDLARDVAKVELPPYRNHLDVVVACEDE 1065
Query: 1149 EDNDIDIPLISIYFR 1163
+DND+DIPL+SIYFR
Sbjct: 1066 DDNDVDIPLVSIYFR 1080
|
Activates ubiquitin by first adenylating its C-terminal glycine residue with ATP, and thereafter linking this residue to the side chain of a cysteine residue in E1, yielding an ubiquitin-E1 thioester and free AMP. Arabidopsis thaliana (taxid: 3702) |
| >sp|P92974|UBE12_ARATH Ubiquitin-activating enzyme E1 2 OS=Arabidopsis thaliana GN=UBA2 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|P31251|UBE12_WHEAT Ubiquitin-activating enzyme E1 2 OS=Triticum aestivum GN=UBA2 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|P20973|UBE11_WHEAT Ubiquitin-activating enzyme E1 1 OS=Triticum aestivum GN=UBA1 PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|P31252|UBE13_WHEAT Ubiquitin-activating enzyme E1 3 OS=Triticum aestivum GN=UBA3 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|A3KMV5|UBA1_BOVIN Ubiquitin-like modifier-activating enzyme 1 OS=Bos taurus GN=UBA1 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|P22314|UBA1_HUMAN Ubiquitin-like modifier-activating enzyme 1 OS=Homo sapiens GN=UBA1 PE=1 SV=3 | Back alignment and function description |
|---|
| >sp|Q29504|UBA1_RABIT Ubiquitin-like modifier-activating enzyme 1 OS=Oryctolagus cuniculus GN=UBA1 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q5U300|UBA1_RAT Ubiquitin-like modifier-activating enzyme 1 OS=Rattus norvegicus GN=Uba1 PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|P31254|UBA1Y_MOUSE Ubiquitin-like modifier-activating enzyme 1 Y OS=Mus musculus GN=Ube1ay PE=2 SV=2 | Back alignment and function description |
|---|
Close Homologs in the Non-Redundant Database Detected by BLAST
Original result of BLAST against Nonredundant Database
| GI | Alignment Graph | Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 1163 | ||||||
| 359478703 | 1100 | PREDICTED: ubiquitin-activating enzyme E | 0.938 | 0.992 | 0.857 | 0.0 | |
| 255571336 | 1107 | ubiquitin-activating enzyme E1, putative | 0.950 | 0.999 | 0.839 | 0.0 | |
| 356498972 | 1106 | PREDICTED: ubiquitin-activating enzyme E | 0.948 | 0.997 | 0.851 | 0.0 | |
| 356553102 | 1108 | PREDICTED: ubiquitin-activating enzyme E | 0.949 | 0.996 | 0.846 | 0.0 | |
| 357491029 | 1180 | Ubiquitin-activating enzyme E1 [Medicago | 0.940 | 0.927 | 0.827 | 0.0 | |
| 357491027 | 1179 | Ubiquitin-activating enzyme E1 [Medicago | 0.934 | 0.921 | 0.831 | 0.0 | |
| 449450834 | 1152 | PREDICTED: ubiquitin-activating enzyme E | 0.941 | 0.950 | 0.823 | 0.0 | |
| 356537581 | 1154 | PREDICTED: ubiquitin-activating enzyme E | 0.989 | 0.997 | 0.798 | 0.0 | |
| 359481277 | 1111 | PREDICTED: ubiquitin-activating enzyme E | 0.943 | 0.987 | 0.824 | 0.0 | |
| 341657646 | 1094 | ubiquitin activating enzyme E1 [Camellia | 0.883 | 0.938 | 0.853 | 0.0 |
| >gi|359478703|ref|XP_002275617.2| PREDICTED: ubiquitin-activating enzyme E1 1 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 1967 bits (5095), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 957/1116 (85%), Positives = 1027/1116 (92%), Gaps = 24/1116 (2%)
Query: 53 GFCVVFGSLLHYMLPRKRASEGVVVVNEETQNAAQESQNDIEIANASSATKKHRISATAD 112
GFC VF SLLHYMLPRKRA G VV ++++ N +S+ KKHRIS++A
Sbjct: 2 GFCGVFSSLLHYMLPRKRAVAGEVV-DDDSDNTG------------TSSIKKHRISSSAA 48
Query: 113 ------SNNNSSSSSSNNVVTGKEGENHSISASIAEVPIMTLGNSNQTDIDEDLHSRQLA 166
+NNNS SS NN NHS S E+ IM LG+ + DIDEDLHSRQLA
Sbjct: 49 GTETTVNNNNSGSSLGNN----SGNSNHS-GGSEVELQIMALGDGHPPDIDEDLHSRQLA 103
Query: 167 VYGRETMRRLFASNILVSGMQGLGAEIAKNLILAGVKSVTLHDEGTVELWDLSSNFVFSD 226
VYGRETMRRLFASN+LVSG+QGLGAEIAKNLILAGVKSVTLHDEGTVELWD+SSNF+FS+
Sbjct: 104 VYGRETMRRLFASNVLVSGLQGLGAEIAKNLILAGVKSVTLHDEGTVELWDMSSNFIFSE 163
Query: 227 NDIGKNRALASVQKLQELNNAVVLSTLTSKLTKEQLSDFQAVVFTDISLDKAIEFDDFCH 286
ND+GKNRALASVQKLQELNNAVV+STLT+KLTKE LSDFQAVVFTDI +KAIEF+D+CH
Sbjct: 164 NDVGKNRALASVQKLQELNNAVVISTLTTKLTKEDLSDFQAVVFTDIYFEKAIEFNDYCH 223
Query: 287 NHQPAISFIKAEVRGLFGSVFCDFGPEFTVVDVDGEDPHTGIIASISNDNPALVSCVDDE 346
+HQP I+FIKAEVRGLFGSVFCDFGPEFTV DVDGE+PHTGIIASISNDNPALVSCVDDE
Sbjct: 224 SHQPPIAFIKAEVRGLFGSVFCDFGPEFTVFDVDGEEPHTGIIASISNDNPALVSCVDDE 283
Query: 347 RLEFQDGDLVVFSEVHGMTELNDGKPRKIKSARPYSFTLEEDTTNYGTYVKGGIVTQVKQ 406
RLEFQDGDLVVFSEVHGMTELNDGKPRKIK+ARPYSFTLEEDTTN+GTY KGGIVTQVKQ
Sbjct: 284 RLEFQDGDLVVFSEVHGMTELNDGKPRKIKNARPYSFTLEEDTTNFGTYEKGGIVTQVKQ 343
Query: 407 PKVLNFKPLREALEDPGDFLLSDFSKFDRPPPLHLAFQALDKFVSELGRFPVAGSEEDAQ 466
PKVLNFKPLREAL DPGDFLLSDFSKFDRPP LHLAFQALD+F+SELGRFPVAGSEEDAQ
Sbjct: 344 PKVLNFKPLREALSDPGDFLLSDFSKFDRPPLLHLAFQALDRFISELGRFPVAGSEEDAQ 403
Query: 467 KLISVATNINESLGDGRVEDINTKLLRHFAFGARAVLNPMAAMFGGIVGQEVVKACSGKF 526
KLI +++NINE LGDG++EDIN KLLRHFAFGARAVLNPMAAMFGGIVGQEVVKACSGKF
Sbjct: 404 KLIFISSNINEGLGDGKLEDINPKLLRHFAFGARAVLNPMAAMFGGIVGQEVVKACSGKF 463
Query: 527 HPLYQFFYFDSVESLPTEPLDSTEFKPINSRYDAQISVFGAKLQKKLEDAKVFIVGSGAL 586
HPL+QFFYFDSVESLPTE DS++FKP+NSRYDAQISVFG+KLQKKLEDA VF+VGSGAL
Sbjct: 464 HPLFQFFYFDSVESLPTEAPDSSDFKPLNSRYDAQISVFGSKLQKKLEDAVVFMVGSGAL 523
Query: 587 GCEFLKNVALMGVSCGNQGKLTITDDDVIEKSNLSRQFLFRDWNIGQAKSTVAASAATSI 646
GCEFLKNVALMGVSCGNQGKLTITDDDVIEKSNLSRQFLFRDWNIGQAKSTVAASAA +I
Sbjct: 524 GCEFLKNVALMGVSCGNQGKLTITDDDVIEKSNLSRQFLFRDWNIGQAKSTVAASAAQTI 583
Query: 647 NPRLNIEALQNRVGPETENVFDDTFWENITCVINALDNVNARLYVDQRCLYFQKPLLESG 706
NP L+IEALQNRVGPETENVF+D FWEN++ VINALDNVNARLYVDQRCLYFQKPLLESG
Sbjct: 584 NPCLHIEALQNRVGPETENVFNDAFWENLSVVINALDNVNARLYVDQRCLYFQKPLLESG 643
Query: 707 TLGAKCNTQMVIPHLTENYGASRDPPEKQAPMCTVHSFPHNIDHCLTWARSEFEGLLEKT 766
TLGAKCNTQMVIPHLTENYGASRDPPEKQAPMCTVHSFPHNIDHCLTWARSEFEGLLEKT
Sbjct: 644 TLGAKCNTQMVIPHLTENYGASRDPPEKQAPMCTVHSFPHNIDHCLTWARSEFEGLLEKT 703
Query: 767 PAEVNAYLSNPVEYTTSMANAGDAQARDNLERVLECLDKEKCEIFQDCITWARLKFEDYF 826
PAEVNA+LSNP EY ++M NAGDAQARDNLERVLECL++E+CE FQDCITWARL+FEDYF
Sbjct: 704 PAEVNAFLSNPTEYASAMRNAGDAQARDNLERVLECLERERCETFQDCITWARLRFEDYF 763
Query: 827 SNRVKQLIFTFPEDAATSTGAPFWSAPKRFPHPLQFSSADPSHLHFVMAASILRAETFGI 886
NRVKQLIFTFPEDAATSTGAPFWSAPKRFPHPLQFS+AD HL+FVMAASILRAETFGI
Sbjct: 764 VNRVKQLIFTFPEDAATSTGAPFWSAPKRFPHPLQFSAADAGHLYFVMAASILRAETFGI 823
Query: 887 PIPDWTNNPKMLAEAVDKVMVPDFLPKKDAKILTDEKATTLSTASVDDAAVINDLIIKLE 946
PIPDW +PK LAEAVDKV+VP+F PK D KI+TDEKAT+LSTASVDDAAVIN+L+ K+E
Sbjct: 824 PIPDWAKHPKKLAEAVDKVIVPEFQPKTDVKIVTDEKATSLSTASVDDAAVINELLAKIE 883
Query: 947 QCRKNLPSGFRLKPIQFEKDDDTNYHMDMIAGLANMRARNYSIPEVDKLKAKFIAGRIIP 1006
Q K+LP GFR+ PIQFEKDDDTNYHMD+IAGLANMRARNYSIPEVDKLKAKFIAGRIIP
Sbjct: 884 QSWKSLPPGFRMNPIQFEKDDDTNYHMDLIAGLANMRARNYSIPEVDKLKAKFIAGRIIP 943
Query: 1007 AIATSTAMATGLVCLELYKVLDGGHKLEDYRNTFANLALPLFSMAEPVPPKVIKHRDMSW 1066
AIATSTAMATGLVCLELYKVLDGGHKLEDYRNTFANLALPLFSMAEPVPPKVIKHRDMSW
Sbjct: 944 AIATSTAMATGLVCLELYKVLDGGHKLEDYRNTFANLALPLFSMAEPVPPKVIKHRDMSW 1003
Query: 1067 TVWDRWILKDNPTLRELIQWLKDKGLNAYSISCGSCLLFNSMFPRHKERMDKKVVDLARE 1126
TVWDRWILKDNPTLREL+QWLKDKGLNAYSISCGSCLL+NSMFPRH+ERMDKKVVDLARE
Sbjct: 1004 TVWDRWILKDNPTLRELLQWLKDKGLNAYSISCGSCLLYNSMFPRHRERMDKKVVDLARE 1063
Query: 1127 VAKVELPPYRRHLDVVVACEDDEDNDIDIPLISIYF 1162
VAKVELP YR HLDVVVACEDDEDNDIDIP +SIYF
Sbjct: 1064 VAKVELPAYRSHLDVVVACEDDEDNDIDIPQVSIYF 1099
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|255571336|ref|XP_002526617.1| ubiquitin-activating enzyme E1, putative [Ricinus communis] gi|223534057|gb|EEF35776.1| ubiquitin-activating enzyme E1, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|356498972|ref|XP_003518319.1| PREDICTED: ubiquitin-activating enzyme E1 2-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356553102|ref|XP_003544897.1| PREDICTED: ubiquitin-activating enzyme E1 2-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|357491029|ref|XP_003615802.1| Ubiquitin-activating enzyme E1 [Medicago truncatula] gi|355517137|gb|AES98760.1| Ubiquitin-activating enzyme E1 [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|357491027|ref|XP_003615801.1| Ubiquitin-activating enzyme E1 [Medicago truncatula] gi|355517136|gb|AES98759.1| Ubiquitin-activating enzyme E1 [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|449450834|ref|XP_004143167.1| PREDICTED: ubiquitin-activating enzyme E1 2-like [Cucumis sativus] gi|449519322|ref|XP_004166684.1| PREDICTED: ubiquitin-activating enzyme E1 2-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|356537581|ref|XP_003537305.1| PREDICTED: ubiquitin-activating enzyme E1 1-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|359481277|ref|XP_002267395.2| PREDICTED: ubiquitin-activating enzyme E1 1-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|341657646|gb|AEK86562.1| ubiquitin activating enzyme E1 [Camellia sinensis] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST
Original result of BLAST against Gene Ontology (AMIGO)
| ID |
Alignment graph |
Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 1163 | ||||||
| TAIR|locus:2060854 | 1080 | UBA1 "ubiquitin-activating enz | 0.928 | 1.0 | 0.800 | 0.0 | |
| TAIR|locus:2164270 | 1077 | UBA 2 "ubiquitin activating en | 0.914 | 0.987 | 0.791 | 0.0 | |
| UNIPROTKB|A3KMV5 | 1058 | UBA1 "Ubiquitin-like modifier- | 0.879 | 0.966 | 0.449 | 6.1e-245 | |
| UNIPROTKB|P22314 | 1058 | UBA1 "Ubiquitin-like modifier- | 0.879 | 0.966 | 0.451 | 8.9e-244 | |
| UNIPROTKB|F1RWX8 | 1058 | UBA1 "Uncharacterized protein" | 0.880 | 0.967 | 0.444 | 1.9e-241 | |
| ZFIN|ZDB-GENE-040426-2009 | 1058 | uba1 "ubiquitin-like modifier | 0.877 | 0.964 | 0.442 | 6.7e-239 | |
| RGD|1359327 | 1058 | Uba1 "ubiquitin-like modifier | 0.879 | 0.966 | 0.439 | 7.6e-238 | |
| MGI|MGI:98891 | 1058 | Uba1y "ubiquitin-activating en | 0.876 | 0.963 | 0.436 | 8.8e-237 | |
| UNIPROTKB|E2RGH5 | 1057 | UBA1 "Uncharacterized protein" | 0.878 | 0.966 | 0.438 | 2.3e-236 | |
| MGI|MGI:98890 | 1058 | Uba1 "ubiquitin-like modifier | 0.879 | 0.966 | 0.439 | 6.2e-236 |
| TAIR|locus:2060854 UBA1 "ubiquitin-activating enzyme 1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 4634 (1636.3 bits), Expect = 0., P = 0.
Identities = 870/1087 (80%), Positives = 968/1087 (89%)
Query: 77 VVNEETQNAAQESQNDIEIANASSATKKHRISATADXXXXXXXXXXXXVVTGKEGENHSI 136
++++ A ++ N I I + +++KK RI T G G+
Sbjct: 1 MLHKRASEANDKNDNTI-IGSDLASSKKRRIDFTESSSDKSSSILASGSSRGFHGD---- 55
Query: 137 SASIAEVPIMTLGNSNQTDIDEDLHSRQLAVYGRETMRRLFASNILVSGMQGLGAEIAKN 196
S+ + M GNSN+ +IDEDLHSRQLAVYGRETMRRLFASN+L+SGM GLGAEIAKN
Sbjct: 56 --SVVQQIDMAFGNSNRQEIDEDLHSRQLAVYGRETMRRLFASNVLISGMHGLGAEIAKN 113
Query: 197 LILAGVKSVTLHDEGTVELWDLSSNFVFSDNDIGKNRALASVQKLQELNNAVVLSTLTSK 256
LILAGVKSVTLHDE VELWDLSSNFVFS++D+GKNRA ASVQKLQ+LNNAVV+S+LT
Sbjct: 114 LILAGVKSVTLHDERVVELWDLSSNFVFSEDDVGKNRADASVQKLQDLNNAVVVSSLTKS 173
Query: 257 LTKEQLSDFQAVVFTDISLDKAIEFDDFCHNHQPAISFIKAEVRGLFGSVFCDFGPEFTV 316
L KE LS FQ VVF+DIS+++AIEFDD+CH+HQP I+F+KA+VRGLFGSVFCDFGPEF V
Sbjct: 174 LNKEDLSGFQVVVFSDISMERAIEFDDYCHSHQPPIAFVKADVRGLFGSVFCDFGPEFAV 233
Query: 317 VDVDGEDPHTGIIASISNDNPALVSCVDDERLEFQDGDLVVFSEVHGMTELNDGKPRKIK 376
+DVDGE+PHTGIIASISN+N A +SCVDDERLEF+DGDLVVFSEV GMTELNDGKPRKIK
Sbjct: 234 LDVDGEEPHTGIIASISNENQAFISCVDDERLEFEDGDLVVFSEVEGMTELNDGKPRKIK 293
Query: 377 SARPYSFTLEEDTTNYGTYVKGGIVTQVKQPKVLNFKPLREALEDPGDFLLSDFSKFDRP 436
S RPYSFTL+EDTTNYGTYVKGGIVTQVKQPK+LNFKPLREAL+DPGDFL SDFSKFDRP
Sbjct: 294 STRPYSFTLDEDTTNYGTYVKGGIVTQVKQPKLLNFKPLREALKDPGDFLFSDFSKFDRP 353
Query: 437 PPLHLAFQALDKFVSELGRFPVAGSEEDAQKLISVATNINESLGDGRVEDINTKLLRHFA 496
P LHLAFQALD F +E GRFPVAGSEEDAQKLIS+AT IN GD +VE+++ KLLRHF+
Sbjct: 354 PLLHLAFQALDHFKAEAGRFPVAGSEEDAQKLISIATAINTGQGDLKVENVDQKLLRHFS 413
Query: 497 FGARAVLNPMAAMFGGIVGQEVVKACSGKFHPLYQFFYFDSVESLPTEPLDSTEFKPINS 556
FGA+AVLNPMAAMFGGIVGQEVVKACSGKFHPL+QFFYFDSVESLP+EP+DS++F P NS
Sbjct: 414 FGAKAVLNPMAAMFGGIVGQEVVKACSGKFHPLFQFFYFDSVESLPSEPVDSSDFAPRNS 473
Query: 557 RYDAQISVFGAKLQKKLEDAKVFIVGSGALGCEFLKNVALMGVSCGNQGKLTITDDDVIE 616
RYDAQISVFGAK QKKLEDAKVF VGSGALGCEFLKN+ALMGVSCG+QGKLT+TDDD+IE
Sbjct: 474 RYDAQISVFGAKFQKKLEDAKVFTVGSGALGCEFLKNLALMGVSCGSQGKLTVTDDDIIE 533
Query: 617 KSNLSRQFLFRDWNIGQXXXXXXXXXXXXINPRLNIEALQNRVGPETENVFDDTFWENIT 676
KSNLSRQFLFRDWNIGQ INPR NIEALQNRVG ETENVFDD FWEN+T
Sbjct: 534 KSNLSRQFLFRDWNIGQAKSTVAASAAAVINPRFNIEALQNRVGAETENVFDDAFWENLT 593
Query: 677 CVINALDNVNARLYVDQRCLYFQKPLLESGTLGAKCNTQMVIPHLTENYGASRDPPEKQA 736
V+NALDNVNARLYVD RCLYFQKPLLESGTLG KCNTQ VIPHLTENYGASRDPPEKQA
Sbjct: 594 VVVNALDNVNARLYVDSRCLYFQKPLLESGTLGTKCNTQSVIPHLTENYGASRDPPEKQA 653
Query: 737 PMCTVHSFPHNIDHCLTWARSEFEGLLEKTPAEVNAYLSNPVEYTTSMANAGDAQARDNL 796
PMCTVHSFPHNIDHCLTWARSEFEGLLEKTPAEVNAYLS+PVEYT SM +AGDAQARD L
Sbjct: 654 PMCTVHSFPHNIDHCLTWARSEFEGLLEKTPAEVNAYLSSPVEYTNSMMSAGDAQARDTL 713
Query: 797 ERVLECLDKEKCEIFQDCITWARLKFEDYFSNRVKQLIFTFPEDAATSTGAPFWSAPKRF 856
ER++ECL+KEKCE FQDC+TWARL+FEDYF NRVKQLI+TFPEDAATSTGAPFWSAPKRF
Sbjct: 714 ERIVECLEKEKCETFQDCLTWARLRFEDYFVNRVKQLIYTFPEDAATSTGAPFWSAPKRF 773
Query: 857 PHPLQFSSADPSHLHFVMAASILRAETFGIPIPDWTNNPKMLAEAVDKVMVPDFLPKKDA 916
P PLQ+SS+DPS L+F+ A +ILRAETFGIPIP+WT NPK AEAVD+V+VPDF P++DA
Sbjct: 774 PRPLQYSSSDPSLLNFITATAILRAETFGIPIPEWTKNPKEAAEAVDRVIVPDFEPRQDA 833
Query: 917 KILTDEKATTLSTASVDDAAVINDLIIKLEQCRKNLPSGFRLKPIQFEKDDDTNYHMDMI 976
KI+TDEKATTL+TASVDDAAVI+DLI K++QCR NL FR+KPIQFEKDDDTNYHMD+I
Sbjct: 834 KIVTDEKATTLTTASVDDAAVIDDLIAKIDQCRHNLSPDFRMKPIQFEKDDDTNYHMDVI 893
Query: 977 AGLANMRARNYSIPEVDKLKAKFIAGRIIPAIATSTAMATGLVCLELYKVLDGGHKLEDY 1036
AGLANMRARNYSIPEVDKLKAKFIAGRIIPAIATSTAMATGLVCLELYKVLDGGHK+E Y
Sbjct: 894 AGLANMRARNYSIPEVDKLKAKFIAGRIIPAIATSTAMATGLVCLELYKVLDGGHKVEAY 953
Query: 1037 RNTFANLALPLFSMAEPVPPKVIKHRDMSWTVWDRWILKDNPTLRELIQWLKDKGLNAYS 1096
RNTFANLALPLFSMAEP+PPKV+KHRDM+WTVWDRW+LK NPTLRE++QWL+DKGL+AYS
Sbjct: 954 RNTFANLALPLFSMAEPLPPKVVKHRDMAWTVWDRWVLKGNPTLREVLQWLEDKGLSAYS 1013
Query: 1097 ISCGSCLLFNSMFPRHKERMDKKVVDLAREVAKVELPPYRRHLDVVVACEDDEDNDIDIP 1156
ISCGSCLLFNSMF RHKERMDKKVVDLAR+VAKVELPPYR HLDVVVACED++DND+DIP
Sbjct: 1014 ISCGSCLLFNSMFTRHKERMDKKVVDLARDVAKVELPPYRNHLDVVVACEDEDDNDVDIP 1073
Query: 1157 LISIYFR 1163
L+SIYFR
Sbjct: 1074 LVSIYFR 1080
|
|
| TAIR|locus:2164270 UBA 2 "ubiquitin activating enzyme 2" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|A3KMV5 UBA1 "Ubiquitin-like modifier-activating enzyme 1" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P22314 UBA1 "Ubiquitin-like modifier-activating enzyme 1" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1RWX8 UBA1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-040426-2009 uba1 "ubiquitin-like modifier activating enzyme 1" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| RGD|1359327 Uba1 "ubiquitin-like modifier activating enzyme 1" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:98891 Uba1y "ubiquitin-activating enzyme, Chr Y" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2RGH5 UBA1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:98890 Uba1 "ubiquitin-like modifier activating enzyme 1" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Annotation Transfer from SWISS-PROT Entries
Original result of BLAST against SWISS-PROT
| ID | Name | Annotated EC number | Identity | Query coverage | Hit coverage | RBH(Q2H) | RBH(H2Q) |
| P93028 | UBE11_ARATH | No assigned EC number | 0.8100 | 0.9260 | 0.9972 | yes | no |
| P31254 | UBA1Y_MOUSE | No assigned EC number | 0.4335 | 0.8933 | 0.9820 | yes | no |
| P31252 | UBE13_WHEAT | No assigned EC number | 0.7700 | 0.8675 | 0.9582 | N/A | no |
| P31251 | UBE12_WHEAT | No assigned EC number | 0.8 | 0.8675 | 0.9600 | N/A | no |
| P20973 | UBE11_WHEAT | No assigned EC number | 0.8 | 0.8675 | 0.9600 | N/A | no |
| Q55C16 | UBA1_DICDI | No assigned EC number | 0.4460 | 0.8452 | 0.9665 | yes | no |
| O94609 | UBA1_SCHPO | No assigned EC number | 0.4480 | 0.8529 | 0.9802 | yes | no |
| P22314 | UBA1_HUMAN | No assigned EC number | 0.4493 | 0.8856 | 0.9735 | yes | no |
| A3KMV5 | UBA1_BOVIN | No assigned EC number | 0.4474 | 0.8856 | 0.9735 | yes | no |
| Q29504 | UBA1_RABIT | No assigned EC number | 0.4474 | 0.8856 | 0.9735 | yes | no |
| P92974 | UBE12_ARATH | No assigned EC number | 0.8018 | 0.9148 | 0.9879 | no | no |
| P22515 | UBA1_YEAST | No assigned EC number | 0.4519 | 0.8607 | 0.9775 | yes | no |
| Q5U300 | UBA1_RAT | No assigned EC number | 0.4342 | 0.8916 | 0.9801 | yes | no |
EC Number Prediction by Ezypred Server
Original result from Ezypred Server
Fail to connect to Ezypred Server
EC Number Prediction by EFICAz Software
No EC number assignment, probably not an enzyme!
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST
Original result of RPS-BLAST against CDD database part I
| ID | Alignment Graph | Length |
Definition |
E-value |
| Query | 1163 | |||
| TIGR01408 | 1008 | TIGR01408, Ube1, ubiquitin-activating enzyme E1 | 0.0 | |
| cd01490 | 435 | cd01490, Ube1_repeat2, Ubiquitin activating enzyme | 1e-173 | |
| cd01491 | 286 | cd01491, Ube1_repeat1, Ubiquitin activating enzyme | 1e-131 | |
| cd01490 | 435 | cd01490, Ube1_repeat2, Ubiquitin activating enzyme | 5e-76 | |
| cd01484 | 234 | cd01484, E1-2_like, Ubiquitin activating enzyme (E | 2e-63 | |
| pfam09358 | 124 | pfam09358, UBA_e1_C, Ubiquitin-activating enzyme e | 9e-52 | |
| smart00985 | 128 | smart00985, UBA_e1_C, Ubiquitin-activating enzyme | 1e-44 | |
| cd01489 | 312 | cd01489, Uba2_SUMO, Ubiquitin activating enzyme (E | 5e-44 | |
| pfam00899 | 134 | pfam00899, ThiF, ThiF family | 9e-39 | |
| cd01492 | 197 | cd01492, Aos1_SUMO, Ubiquitin activating enzyme (E | 2e-35 | |
| cd01485 | 198 | cd01485, E1-1_like, Ubiquitin activating enzyme (E | 4e-35 | |
| COG0476 | 254 | COG0476, ThiF, Dinucleotide-utilizing enzymes invo | 1e-34 | |
| cd00757 | 228 | cd00757, ThiF_MoeB_HesA_family, ThiF_MoeB_HesA | 7e-33 | |
| cd01488 | 291 | cd01488, Uba3_RUB, Ubiquitin activating enzyme (E1 | 2e-31 | |
| cd01483 | 143 | cd01483, E1_enzyme_family, Superfamily of activati | 3e-31 | |
| COG0476 | 254 | COG0476, ThiF, Dinucleotide-utilizing enzymes invo | 1e-28 | |
| TIGR02356 | 202 | TIGR02356, adenyl_thiF, thiazole biosynthesis aden | 6e-25 | |
| pfam02134 | 66 | pfam02134, UBACT, Repeat in ubiquitin-activating ( | 7e-24 | |
| cd01493 | 425 | cd01493, APPBP1_RUB, Ubiquitin activating enzyme ( | 3e-22 | |
| TIGR02355 | 240 | TIGR02355, moeB, molybdopterin synthase sulfurylas | 7e-22 | |
| cd01491 | 286 | cd01491, Ube1_repeat1, Ubiquitin activating enzyme | 1e-21 | |
| PRK05690 | 245 | PRK05690, PRK05690, molybdopterin biosynthesis pro | 2e-21 | |
| PRK08762 | 376 | PRK08762, PRK08762, molybdopterin biosynthesis pro | 2e-19 | |
| pfam10585 | 44 | pfam10585, UBA_e1_thiolCys, Ubiquitin-activating e | 4e-18 | |
| cd01492 | 197 | cd01492, Aos1_SUMO, Ubiquitin activating enzyme (E | 2e-17 | |
| PRK08644 | 212 | PRK08644, PRK08644, thiamine biosynthesis protein | 6e-17 | |
| TIGR02356 | 202 | TIGR02356, adenyl_thiF, thiazole biosynthesis aden | 1e-16 | |
| pfam00899 | 134 | pfam00899, ThiF, ThiF family | 3e-15 | |
| PRK05597 | 355 | PRK05597, PRK05597, molybdopterin biosynthesis pro | 1e-14 | |
| PRK05600 | 370 | PRK05600, PRK05600, thiamine biosynthesis protein | 1e-14 | |
| PRK07688 | 339 | PRK07688, PRK07688, thiamine/molybdopterin biosynt | 1e-14 | |
| PRK12475 | 338 | PRK12475, PRK12475, thiamine/molybdopterin biosynt | 3e-14 | |
| cd00757 | 228 | cd00757, ThiF_MoeB_HesA_family, ThiF_MoeB_HesA | 4e-14 | |
| cd00755 | 231 | cd00755, YgdL_like, Family of activating enzymes ( | 4e-14 | |
| PRK08328 | 231 | PRK08328, PRK08328, hypothetical protein; Provisio | 2e-13 | |
| cd01485 | 198 | cd01485, E1-1_like, Ubiquitin activating enzyme (E | 3e-13 | |
| cd01483 | 143 | cd01483, E1_enzyme_family, Superfamily of activati | 3e-13 | |
| cd01484 | 234 | cd01484, E1-2_like, Ubiquitin activating enzyme (E | 4e-13 | |
| cd01489 | 312 | cd01489, Uba2_SUMO, Ubiquitin activating enzyme (E | 4e-13 | |
| PRK08328 | 231 | PRK08328, PRK08328, hypothetical protein; Provisio | 1e-12 | |
| COG1179 | 263 | COG1179, COG1179, Dinucleotide-utilizing enzymes i | 1e-12 | |
| PRK07878 | 392 | PRK07878, PRK07878, molybdopterin biosynthesis-lik | 4e-12 | |
| cd01491 | 286 | cd01491, Ube1_repeat1, Ubiquitin activating enzyme | 2e-11 | |
| TIGR02354 | 200 | TIGR02354, thiF_fam2, thiamine biosynthesis protei | 2e-11 | |
| PTZ00245 | 287 | PTZ00245, PTZ00245, ubiquitin activating enzyme; P | 5e-11 | |
| PRK05600 | 370 | PRK05600, PRK05600, thiamine biosynthesis protein | 2e-10 | |
| PRK07411 | 390 | PRK07411, PRK07411, hypothetical protein; Validate | 5e-10 | |
| cd01493 | 425 | cd01493, APPBP1_RUB, Ubiquitin activating enzyme ( | 6e-10 | |
| PRK08223 | 287 | PRK08223, PRK08223, hypothetical protein; Validate | 1e-09 | |
| cd01487 | 174 | cd01487, E1_ThiF_like, E1_ThiF_like | 2e-09 | |
| TIGR02355 | 240 | TIGR02355, moeB, molybdopterin synthase sulfurylas | 2e-08 | |
| PRK14852 | 989 | PRK14852, PRK14852, hypothetical protein; Provisio | 4e-08 | |
| PRK05690 | 245 | PRK05690, PRK05690, molybdopterin biosynthesis pro | 1e-07 | |
| PRK05597 | 355 | PRK05597, PRK05597, molybdopterin biosynthesis pro | 1e-07 | |
| cd01488 | 291 | cd01488, Uba3_RUB, Ubiquitin activating enzyme (E1 | 2e-07 | |
| PRK14851 | 679 | PRK14851, PRK14851, hypothetical protein; Provisio | 2e-07 | |
| cd01485 | 198 | cd01485, E1-1_like, Ubiquitin activating enzyme (E | 5e-07 | |
| cd01489 | 312 | cd01489, Uba2_SUMO, Ubiquitin activating enzyme (E | 3e-06 | |
| PRK07688 | 339 | PRK07688, PRK07688, thiamine/molybdopterin biosynt | 6e-06 | |
| cd01487 | 174 | cd01487, E1_ThiF_like, E1_ThiF_like | 6e-06 | |
| PRK15116 | 268 | PRK15116, PRK15116, sulfur acceptor protein CsdL; | 7e-06 | |
| cd01484 | 234 | cd01484, E1-2_like, Ubiquitin activating enzyme (E | 2e-05 | |
| TIGR02354 | 200 | TIGR02354, thiF_fam2, thiamine biosynthesis protei | 2e-05 | |
| PRK08644 | 212 | PRK08644, PRK08644, thiamine biosynthesis protein | 6e-05 | |
| cd01492 | 197 | cd01492, Aos1_SUMO, Ubiquitin activating enzyme (E | 1e-04 | |
| pfam02134 | 66 | pfam02134, UBACT, Repeat in ubiquitin-activating ( | 1e-04 | |
| cd00755 | 231 | cd00755, YgdL_like, Family of activating enzymes ( | 1e-04 | |
| COG1179 | 263 | COG1179, COG1179, Dinucleotide-utilizing enzymes i | 1e-04 | |
| PRK08762 | 376 | PRK08762, PRK08762, molybdopterin biosynthesis pro | 3e-04 | |
| cd01486 | 307 | cd01486, Apg7, Apg7 is an E1-like protein, that ac | 5e-04 | |
| PRK12475 | 338 | PRK12475, PRK12475, thiamine/molybdopterin biosynt | 6e-04 | |
| cd01488 | 291 | cd01488, Uba3_RUB, Ubiquitin activating enzyme (E1 | 0.001 | |
| cd01486 | 307 | cd01486, Apg7, Apg7 is an E1-like protein, that ac | 0.002 |
| >gnl|CDD|130475 TIGR01408, Ube1, ubiquitin-activating enzyme E1 | Back alignment and domain information |
|---|
Score = 1635 bits (4235), Expect = 0.0
Identities = 526/1012 (51%), Positives = 683/1012 (67%), Gaps = 7/1012 (0%)
Query: 155 DIDEDLHSRQLAVYGRETMRRLFASNILVSGMQGLGAEIAKNLILAGVKSVTLHDEGTVE 214
+IDE L+SRQL V G E M+++ SN+L+SGM GLG EIAKNL+LAGVKSVTLHD +
Sbjct: 1 EIDEALYSRQLYVLGDEAMQKMAKSNVLISGMGGLGLEIAKNLVLAGVKSVTLHDTEKCQ 60
Query: 215 LWDLSSNFVFSDNDIGKNRALASVQKLQELNNAVVLSTLTSKLTKEQLSDFQAVVFTDIS 274
WDLSSNF S++D+G+NRA A V+KL ELN V +S+ + +E L FQ VV T++S
Sbjct: 61 AWDLSSNFFLSEDDVGRNRAEAVVKKLAELNPYVHVSSSSVPFNEEFLDKFQCVVLTEMS 120
Query: 275 LDKAIEFDDFCHNHQPAISFIKAEVRGLFGSVFCDFGPEFTVVDVDGEDPHTGIIASISN 334
L E +DFCH+ P I+FI A+VRGLFGS+FCDFG EF V+D DGE+P TG IASI+
Sbjct: 121 LPLQKEINDFCHSQCPPIAFISADVRGLFGSLFCDFGDEFEVLDTDGEEPKTGFIASITQ 180
Query: 335 DNPALVSCVDDERLEFQDGDLVVFSEVHGMTELNDGKPRKIKSARPYSFTLEEDTTNYGT 394
NP +V+C+++ R + + GD V F EV+GMT LNDG PRKI PYSF++ + T G
Sbjct: 181 ANPGIVTCLENHRHKLETGDFVTFREVNGMTGLNDGSPRKITVISPYSFSIGDTTE-LGP 239
Query: 395 YVKGGIVTQVKQPKVLNFKPLREALEDPGDFLLSDFSKFDRPPPLHLAFQALDKFVSELG 454
Y+ GGI TQVK PK + FK LRE L+DP L+ DFSK +RPP +H AFQALD+F +
Sbjct: 240 YLHGGIATQVKTPKTVFFKSLREQLKDP-KCLIVDFSKPERPPEIHTAFQALDQFQEKYS 298
Query: 455 RFPVAGSEEDAQKLISVATNINESLGDGRVEDINTKLLRHFAFGARAVLNPMAAMFGGIV 514
R P G ++DA++L+ +AT+I+E+ + +V D++ KL+ ++ A+ L+PMAA GG+V
Sbjct: 299 RKPNVGCQQDAEELLKLATSISET-LEEKVPDVDAKLVHWLSWTAQGFLSPMAAAVGGVV 357
Query: 515 GQEVVKACSGKFHPLYQFFYFDSVESLPTE-PLDSTEFKPINSRYDAQISVFGAKLQKKL 573
QEV+KA +GKF PL Q+FYFDS ESLP+ + EF P RYDAQI+VFG Q+KL
Sbjct: 358 SQEVLKAVTGKFSPLCQWFYFDSAESLPSLGKPECEEFLPRGDRYDAQIAVFGDTFQQKL 417
Query: 574 EDAKVFIVGSGALGCEFLKNVALMGVSCGNQGKLTITDDDVIEKSNLSRQFLFRDWNIGQ 633
++ +F+VG GA+GCE LKN ALMGV G +G +T+TD D+IEKSNL+RQFLFR +IG+
Sbjct: 418 QNLNIFLVGCGAIGCEMLKNFALMGVGTGKKGMITVTDPDLIEKSNLNRQFLFRPHHIGK 477
Query: 634 AKSTVAASAATSINPRLNIEALQNRVGPETENVFDDTFWENITCVINALDNVNARLYVDQ 693
KS AA A INP++ I+A QNRVGPETE +F+D F+E + VINALDNV AR YVD
Sbjct: 478 PKSYTAADATLKINPQIKIDAHQNRVGPETETIFNDEFYEKLDVVINALDNVEARRYVDS 537
Query: 694 RCLYFQKPLLESGTLGAKCNTQMVIPHLTENYGASRDPPEKQAPMCTVHSFPHNIDHCLT 753
RCL F KPLLESGTLG K NTQ+V+PHLTE+YG+SRDPPEK+ P CT+ SFP I+H +
Sbjct: 538 RCLAFLKPLLESGTLGTKGNTQVVVPHLTESYGSSRDPPEKEIPFCTLKSFPAAIEHTIQ 597
Query: 754 WARSEFEGLLEKTPAEVNAYLSNPVEYTTSMANAGDAQARDNLERVLECLDKEKCEIFQD 813
WAR +FEGL P+ VN YLS+P + +R+ LE++++ L KEK F
Sbjct: 598 WARDKFEGLFSHKPSLVNKYLSSPSSAEEVLQKIQSGHSREGLEQIIKLLSKEKPRNFSQ 657
Query: 814 CITWARLKFEDYFSNRVKQLIFTFPEDAATSTGAPFWSAPKRFPHPLQFSSADPSHLHFV 873
C+ WARLKFE YF+N+ QL+ FP D TSTG+PFWS+PKR P PL+F +P HL F+
Sbjct: 658 CVEWARLKFEKYFNNKALQLLHCFPLDIRTSTGSPFWSSPKRPPSPLKFDLNEPLHLSFI 717
Query: 874 MAASILRAETFGIPIPDWTNNPKMLAEAVDKVMVPDFLPKKDAKILTDEKATTLSTASVD 933
AA+ L A +GIP + + L + +V +P+F P+ + KI TDE A TA D
Sbjct: 718 QAAAKLYATVYGIPFAEEDLSADALLNILSEVKIPEFKPRSNKKIQTDETARKPDTAPED 777
Query: 934 DAAVINDLIIKLEQCRKNLPSGFRLKPIQFEKDDDTNYHMDMIAGLANMRARNYSIPEVD 993
D I L + S FR+ P+ FEKDDD N H+D I +N+RA+NYSI D
Sbjct: 778 DRNAIFQLEKAILSNEATK-SDFRMAPLSFEKDDDHNGHIDFITAASNLRAKNYSIEPAD 836
Query: 994 KLKAKFIAGRIIPAIATSTAMATGLVCLELYKVLDGGHKLEDYRNTFANLALPLFSMAEP 1053
+ K KFIAG+IIPAIATSTA +GLVCLEL KV DGG+K E Y+N F NLA+PLF EP
Sbjct: 837 RFKTKFIAGKIIPAIATSTATVSGLVCLELIKVTDGGYKFEVYKNCFLNLAIPLFVFTEP 896
Query: 1054 VPPKVIKHRDMSW-TVWDRWILKDNPTLRELIQWLK-DKGLNAYSISCGSCLLFNSMFPR 1111
+ K R+ T+WDRW L + TL E I +K GL +S G LL+ + P
Sbjct: 897 TEVRKTKIRNGISFTIWDRWTLHGDFTLLEFINAVKEKYGLEPTMVSQGVKLLYVPVMPG 956
Query: 1112 HKERMDKKVVDLAREVAKVELPPYRRHLDVVVACEDDEDNDIDIPLISIYFR 1163
H ER+ K+ L + K +LPPYR HL V AC+DD D D+ P + IYF
Sbjct: 957 HAERLKLKMHKLVKPTTKKKLPPYRVHLTVSFACDDDGDEDVPGPPVRIYFS 1008
|
This model represents the full length, over a thousand amino acids, of a multicopy family of eukaryotic proteins, many of which are designated ubiquitin-activating enzyme E1. Members have two copies of the ThiF family domain (pfam00899), a repeat found in ubiquitin-activating proteins (pfam02134), and other regions. Length = 1008 |
| >gnl|CDD|238767 cd01490, Ube1_repeat2, Ubiquitin activating enzyme (E1), repeat 2 | Back alignment and domain information |
|---|
| >gnl|CDD|238768 cd01491, Ube1_repeat1, Ubiquitin activating enzyme (E1), repeat 1 | Back alignment and domain information |
|---|
| >gnl|CDD|238767 cd01490, Ube1_repeat2, Ubiquitin activating enzyme (E1), repeat 2 | Back alignment and domain information |
|---|
| >gnl|CDD|238761 cd01484, E1-2_like, Ubiquitin activating enzyme (E1), repeat 2-like | Back alignment and domain information |
|---|
| >gnl|CDD|220201 pfam09358, UBA_e1_C, Ubiquitin-activating enzyme e1 C-terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|214955 smart00985, UBA_e1_C, Ubiquitin-activating enzyme e1 C-terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|238766 cd01489, Uba2_SUMO, Ubiquitin activating enzyme (E1) subunit UBA2 | Back alignment and domain information |
|---|
| >gnl|CDD|216180 pfam00899, ThiF, ThiF family | Back alignment and domain information |
|---|
| >gnl|CDD|238769 cd01492, Aos1_SUMO, Ubiquitin activating enzyme (E1) subunit Aos1 | Back alignment and domain information |
|---|
| >gnl|CDD|238762 cd01485, E1-1_like, Ubiquitin activating enzyme (E1), repeat 1-like | Back alignment and domain information |
|---|
| >gnl|CDD|223552 COG0476, ThiF, Dinucleotide-utilizing enzymes involved in molybdopterin and thiamine biosynthesis family 2 [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|238386 cd00757, ThiF_MoeB_HesA_family, ThiF_MoeB_HesA | Back alignment and domain information |
|---|
| >gnl|CDD|238765 cd01488, Uba3_RUB, Ubiquitin activating enzyme (E1) subunit UBA3 | Back alignment and domain information |
|---|
| >gnl|CDD|238760 cd01483, E1_enzyme_family, Superfamily of activating enzymes (E1) of the ubiquitin-like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|223552 COG0476, ThiF, Dinucleotide-utilizing enzymes involved in molybdopterin and thiamine biosynthesis family 2 [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|162820 TIGR02356, adenyl_thiF, thiazole biosynthesis adenylyltransferase ThiF, E | Back alignment and domain information |
|---|
| >gnl|CDD|202124 pfam02134, UBACT, Repeat in ubiquitin-activating (UBA) protein | Back alignment and domain information |
|---|
| >gnl|CDD|238770 cd01493, APPBP1_RUB, Ubiquitin activating enzyme (E1) subunit APPBP1 | Back alignment and domain information |
|---|
| >gnl|CDD|131408 TIGR02355, moeB, molybdopterin synthase sulfurylase MoeB | Back alignment and domain information |
|---|
| >gnl|CDD|238768 cd01491, Ube1_repeat1, Ubiquitin activating enzyme (E1), repeat 1 | Back alignment and domain information |
|---|
| >gnl|CDD|180204 PRK05690, PRK05690, molybdopterin biosynthesis protein MoeB; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236337 PRK08762, PRK08762, molybdopterin biosynthesis protein MoeB; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|192635 pfam10585, UBA_e1_thiolCys, Ubiquitin-activating enzyme active site | Back alignment and domain information |
|---|
| >gnl|CDD|238769 cd01492, Aos1_SUMO, Ubiquitin activating enzyme (E1) subunit Aos1 | Back alignment and domain information |
|---|
| >gnl|CDD|236320 PRK08644, PRK08644, thiamine biosynthesis protein ThiF; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|162820 TIGR02356, adenyl_thiF, thiazole biosynthesis adenylyltransferase ThiF, E | Back alignment and domain information |
|---|
| >gnl|CDD|216180 pfam00899, ThiF, ThiF family | Back alignment and domain information |
|---|
| >gnl|CDD|235526 PRK05597, PRK05597, molybdopterin biosynthesis protein MoeB; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|235528 PRK05600, PRK05600, thiamine biosynthesis protein ThiF; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|181084 PRK07688, PRK07688, thiamine/molybdopterin biosynthesis ThiF/MoeB-like protein; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|183547 PRK12475, PRK12475, thiamine/molybdopterin biosynthesis MoeB-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|238386 cd00757, ThiF_MoeB_HesA_family, ThiF_MoeB_HesA | Back alignment and domain information |
|---|
| >gnl|CDD|238384 cd00755, YgdL_like, Family of activating enzymes (E1) of ubiquitin-like proteins related to the E | Back alignment and domain information |
|---|
| >gnl|CDD|169382 PRK08328, PRK08328, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|238762 cd01485, E1-1_like, Ubiquitin activating enzyme (E1), repeat 1-like | Back alignment and domain information |
|---|
| >gnl|CDD|238760 cd01483, E1_enzyme_family, Superfamily of activating enzymes (E1) of the ubiquitin-like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|238761 cd01484, E1-2_like, Ubiquitin activating enzyme (E1), repeat 2-like | Back alignment and domain information |
|---|
| >gnl|CDD|238766 cd01489, Uba2_SUMO, Ubiquitin activating enzyme (E1) subunit UBA2 | Back alignment and domain information |
|---|
| >gnl|CDD|169382 PRK08328, PRK08328, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|224100 COG1179, COG1179, Dinucleotide-utilizing enzymes involved in molybdopterin and thiamine biosynthesis family 1 [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|181156 PRK07878, PRK07878, molybdopterin biosynthesis-like protein MoeZ; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|238768 cd01491, Ube1_repeat1, Ubiquitin activating enzyme (E1), repeat 1 | Back alignment and domain information |
|---|
| >gnl|CDD|162819 TIGR02354, thiF_fam2, thiamine biosynthesis protein ThiF, family 2 | Back alignment and domain information |
|---|
| >gnl|CDD|140272 PTZ00245, PTZ00245, ubiquitin activating enzyme; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235528 PRK05600, PRK05600, thiamine biosynthesis protein ThiF; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|180967 PRK07411, PRK07411, hypothetical protein; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|238770 cd01493, APPBP1_RUB, Ubiquitin activating enzyme (E1) subunit APPBP1 | Back alignment and domain information |
|---|
| >gnl|CDD|181302 PRK08223, PRK08223, hypothetical protein; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|238764 cd01487, E1_ThiF_like, E1_ThiF_like | Back alignment and domain information |
|---|
| >gnl|CDD|131408 TIGR02355, moeB, molybdopterin synthase sulfurylase MoeB | Back alignment and domain information |
|---|
| >gnl|CDD|184854 PRK14852, PRK14852, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|180204 PRK05690, PRK05690, molybdopterin biosynthesis protein MoeB; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235526 PRK05597, PRK05597, molybdopterin biosynthesis protein MoeB; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|238765 cd01488, Uba3_RUB, Ubiquitin activating enzyme (E1) subunit UBA3 | Back alignment and domain information |
|---|
| >gnl|CDD|184853 PRK14851, PRK14851, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|238762 cd01485, E1-1_like, Ubiquitin activating enzyme (E1), repeat 1-like | Back alignment and domain information |
|---|
| >gnl|CDD|238766 cd01489, Uba2_SUMO, Ubiquitin activating enzyme (E1) subunit UBA2 | Back alignment and domain information |
|---|
| >gnl|CDD|181084 PRK07688, PRK07688, thiamine/molybdopterin biosynthesis ThiF/MoeB-like protein; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|238764 cd01487, E1_ThiF_like, E1_ThiF_like | Back alignment and domain information |
|---|
| >gnl|CDD|185071 PRK15116, PRK15116, sulfur acceptor protein CsdL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|238761 cd01484, E1-2_like, Ubiquitin activating enzyme (E1), repeat 2-like | Back alignment and domain information |
|---|
| >gnl|CDD|162819 TIGR02354, thiF_fam2, thiamine biosynthesis protein ThiF, family 2 | Back alignment and domain information |
|---|
| >gnl|CDD|236320 PRK08644, PRK08644, thiamine biosynthesis protein ThiF; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|238769 cd01492, Aos1_SUMO, Ubiquitin activating enzyme (E1) subunit Aos1 | Back alignment and domain information |
|---|
| >gnl|CDD|202124 pfam02134, UBACT, Repeat in ubiquitin-activating (UBA) protein | Back alignment and domain information |
|---|
| >gnl|CDD|238384 cd00755, YgdL_like, Family of activating enzymes (E1) of ubiquitin-like proteins related to the E | Back alignment and domain information |
|---|
| >gnl|CDD|224100 COG1179, COG1179, Dinucleotide-utilizing enzymes involved in molybdopterin and thiamine biosynthesis family 1 [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|236337 PRK08762, PRK08762, molybdopterin biosynthesis protein MoeB; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|238763 cd01486, Apg7, Apg7 is an E1-like protein, that activates two different ubiquitin-like proteins, Apg12 and Apg8, and assigns them to specific E2 enzymes, Apg10 and Apg3, respectively | Back alignment and domain information |
|---|
| >gnl|CDD|183547 PRK12475, PRK12475, thiamine/molybdopterin biosynthesis MoeB-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|238765 cd01488, Uba3_RUB, Ubiquitin activating enzyme (E1) subunit UBA3 | Back alignment and domain information |
|---|
| >gnl|CDD|238763 cd01486, Apg7, Apg7 is an E1-like protein, that activates two different ubiquitin-like proteins, Apg12 and Apg8, and assigns them to specific E2 enzymes, Apg10 and Apg3, respectively | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch
Original result of HHsearch against CDD database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 1163 | |||
| KOG2012 | 1013 | consensus Ubiquitin activating enzyme UBA1 [Posttr | 100.0 | |
| TIGR01408 | 1008 | Ube1 ubiquitin-activating enzyme E1. This model re | 100.0 | |
| cd01490 | 435 | Ube1_repeat2 Ubiquitin activating enzyme (E1), rep | 100.0 | |
| KOG2013 | 603 | consensus SMT3/SUMO-activating complex, catalytic | 100.0 | |
| cd01489 | 312 | Uba2_SUMO Ubiquitin activating enzyme (E1) subunit | 100.0 | |
| cd01491 | 286 | Ube1_repeat1 Ubiquitin activating enzyme (E1), rep | 100.0 | |
| cd01484 | 234 | E1-2_like Ubiquitin activating enzyme (E1), repeat | 100.0 | |
| KOG2015 | 422 | consensus NEDD8-activating complex, catalytic comp | 100.0 | |
| cd01488 | 291 | Uba3_RUB Ubiquitin activating enzyme (E1) subunit | 100.0 | |
| cd01493 | 425 | APPBP1_RUB Ubiquitin activating enzyme (E1) subuni | 100.0 | |
| KOG2014 | 331 | consensus SMT3/SUMO-activating complex, AOS1/RAD31 | 100.0 | |
| KOG2016 | 523 | consensus NEDD8-activating complex, APP-BP1/UBA5 c | 100.0 | |
| cd01492 | 197 | Aos1_SUMO Ubiquitin activating enzyme (E1) subunit | 100.0 | |
| cd01485 | 198 | E1-1_like Ubiquitin activating enzyme (E1), repeat | 100.0 | |
| PRK08223 | 287 | hypothetical protein; Validated | 100.0 | |
| TIGR02356 | 202 | adenyl_thiF thiazole biosynthesis adenylyltransfer | 100.0 | |
| cd00757 | 228 | ThiF_MoeB_HesA_family ThiF_MoeB_HesA. Family of E1 | 100.0 | |
| PRK05690 | 245 | molybdopterin biosynthesis protein MoeB; Provision | 100.0 | |
| PRK07411 | 390 | hypothetical protein; Validated | 100.0 | |
| PRK08328 | 231 | hypothetical protein; Provisional | 100.0 | |
| PRK05597 | 355 | molybdopterin biosynthesis protein MoeB; Validated | 100.0 | |
| TIGR02355 | 240 | moeB molybdopterin synthase sulfurylase MoeB. This | 100.0 | |
| cd01492 | 197 | Aos1_SUMO Ubiquitin activating enzyme (E1) subunit | 100.0 | |
| cd01493 | 425 | APPBP1_RUB Ubiquitin activating enzyme (E1) subuni | 100.0 | |
| PRK07878 | 392 | molybdopterin biosynthesis-like protein MoeZ; Vali | 100.0 | |
| PRK07878 | 392 | molybdopterin biosynthesis-like protein MoeZ; Vali | 100.0 | |
| cd01491 | 286 | Ube1_repeat1 Ubiquitin activating enzyme (E1), rep | 100.0 | |
| PRK05600 | 370 | thiamine biosynthesis protein ThiF; Validated | 100.0 | |
| cd01485 | 198 | E1-1_like Ubiquitin activating enzyme (E1), repeat | 99.98 | |
| cd01489 | 312 | Uba2_SUMO Ubiquitin activating enzyme (E1) subunit | 99.98 | |
| PRK12475 | 338 | thiamine/molybdopterin biosynthesis MoeB-like prot | 99.98 | |
| PRK05597 | 355 | molybdopterin biosynthesis protein MoeB; Validated | 99.98 | |
| PRK07688 | 339 | thiamine/molybdopterin biosynthesis ThiF/MoeB-like | 99.97 | |
| PRK05600 | 370 | thiamine biosynthesis protein ThiF; Validated | 99.97 | |
| PRK08223 | 287 | hypothetical protein; Validated | 99.97 | |
| PRK05690 | 245 | molybdopterin biosynthesis protein MoeB; Provision | 99.97 | |
| TIGR03736 | 244 | PRTRC_ThiF PRTRC system ThiF family protein. A nov | 99.97 | |
| TIGR02356 | 202 | adenyl_thiF thiazole biosynthesis adenylyltransfer | 99.97 | |
| COG0476 | 254 | ThiF Dinucleotide-utilizing enzymes involved in mo | 99.97 | |
| PRK08762 | 376 | molybdopterin biosynthesis protein MoeB; Validated | 99.97 | |
| cd00757 | 228 | ThiF_MoeB_HesA_family ThiF_MoeB_HesA. Family of E1 | 99.97 | |
| PRK07411 | 390 | hypothetical protein; Validated | 99.97 | |
| KOG2017 | 427 | consensus Molybdopterin synthase sulfurylase [Coen | 99.97 | |
| cd01488 | 291 | Uba3_RUB Ubiquitin activating enzyme (E1) subunit | 99.96 | |
| PF09358 | 125 | UBA_e1_C: Ubiquitin-activating enzyme e1 C-termina | 99.96 | |
| PRK08328 | 231 | hypothetical protein; Provisional | 99.96 | |
| PRK14851 | 679 | hypothetical protein; Provisional | 99.96 | |
| TIGR02355 | 240 | moeB molybdopterin synthase sulfurylase MoeB. This | 99.96 | |
| PRK14852 | 989 | hypothetical protein; Provisional | 99.96 | |
| PRK15116 | 268 | sulfur acceptor protein CsdL; Provisional | 99.96 | |
| cd01484 | 234 | E1-2_like Ubiquitin activating enzyme (E1), repeat | 99.95 | |
| cd00755 | 231 | YgdL_like Family of activating enzymes (E1) of ubi | 99.95 | |
| PRK07688 | 339 | thiamine/molybdopterin biosynthesis ThiF/MoeB-like | 99.95 | |
| PRK12475 | 338 | thiamine/molybdopterin biosynthesis MoeB-like prot | 99.95 | |
| PRK08644 | 212 | thiamine biosynthesis protein ThiF; Provisional | 99.95 | |
| PF00899 | 135 | ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-a | 99.95 | |
| PRK07877 | 722 | hypothetical protein; Provisional | 99.95 | |
| TIGR01408 | 1008 | Ube1 ubiquitin-activating enzyme E1. This model re | 99.95 | |
| TIGR01381 | 664 | E1_like_apg7 E1-like protein-activating enzyme Gsa | 99.94 | |
| PRK15116 | 268 | sulfur acceptor protein CsdL; Provisional | 99.94 | |
| COG0476 | 254 | ThiF Dinucleotide-utilizing enzymes involved in mo | 99.94 | |
| COG1179 | 263 | Dinucleotide-utilizing enzymes involved in molybdo | 99.94 | |
| PTZ00245 | 287 | ubiquitin activating enzyme; Provisional | 99.94 | |
| KOG2013 | 603 | consensus SMT3/SUMO-activating complex, catalytic | 99.94 | |
| PRK14852 | 989 | hypothetical protein; Provisional | 99.94 | |
| PRK08762 | 376 | molybdopterin biosynthesis protein MoeB; Validated | 99.94 | |
| cd01490 | 435 | Ube1_repeat2 Ubiquitin activating enzyme (E1), rep | 99.94 | |
| PRK14851 | 679 | hypothetical protein; Provisional | 99.93 | |
| KOG2015 | 422 | consensus NEDD8-activating complex, catalytic comp | 99.93 | |
| cd01483 | 143 | E1_enzyme_family Superfamily of activating enzymes | 99.93 | |
| cd01486 | 307 | Apg7 Apg7 is an E1-like protein, that activates tw | 99.93 | |
| PF00899 | 135 | ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-a | 99.92 | |
| TIGR03603 | 318 | cyclo_dehy_ocin bacteriocin biosynthesis cyclodehy | 99.92 | |
| cd01487 | 174 | E1_ThiF_like E1_ThiF_like. Member of superfamily o | 99.92 | |
| PRK08644 | 212 | thiamine biosynthesis protein ThiF; Provisional | 99.92 | |
| cd00755 | 231 | YgdL_like Family of activating enzymes (E1) of ubi | 99.92 | |
| cd01483 | 143 | E1_enzyme_family Superfamily of activating enzymes | 99.92 | |
| KOG2017 | 427 | consensus Molybdopterin synthase sulfurylase [Coen | 99.91 | |
| TIGR02354 | 200 | thiF_fam2 thiamine biosynthesis protein ThiF, fami | 99.91 | |
| PTZ00245 | 287 | ubiquitin activating enzyme; Provisional | 99.89 | |
| COG1179 | 263 | Dinucleotide-utilizing enzymes involved in molybdo | 99.89 | |
| PRK07877 | 722 | hypothetical protein; Provisional | 99.89 | |
| PRK06153 | 393 | hypothetical protein; Provisional | 99.88 | |
| cd01486 | 307 | Apg7 Apg7 is an E1-like protein, that activates tw | 99.86 | |
| TIGR02354 | 200 | thiF_fam2 thiamine biosynthesis protein ThiF, fami | 99.85 | |
| cd01487 | 174 | E1_ThiF_like E1_ThiF_like. Member of superfamily o | 99.85 | |
| KOG2336 | 422 | consensus Molybdopterin biosynthesis-related prote | 99.85 | |
| TIGR01381 | 664 | E1_like_apg7 E1-like protein-activating enzyme Gsa | 99.85 | |
| TIGR03603 | 318 | cyclo_dehy_ocin bacteriocin biosynthesis cyclodehy | 99.85 | |
| KOG2014 | 331 | consensus SMT3/SUMO-activating complex, AOS1/RAD31 | 99.84 | |
| KOG2016 | 523 | consensus NEDD8-activating complex, APP-BP1/UBA5 c | 99.84 | |
| PF02134 | 67 | UBACT: Repeat in ubiquitin-activating (UBA) protei | 99.82 | |
| KOG2018 | 430 | consensus Predicted dinucleotide-utilizing enzyme | 99.82 | |
| KOG2012 | 1013 | consensus Ubiquitin activating enzyme UBA1 [Posttr | 99.79 | |
| PRK06153 | 393 | hypothetical protein; Provisional | 99.78 | |
| TIGR03736 | 244 | PRTRC_ThiF PRTRC system ThiF family protein. A nov | 99.74 | |
| KOG2018 | 430 | consensus Predicted dinucleotide-utilizing enzyme | 99.73 | |
| KOG2336 | 422 | consensus Molybdopterin biosynthesis-related prote | 99.52 | |
| PF10585 | 45 | UBA_e1_thiolCys: Ubiquitin-activating enzyme activ | 99.52 | |
| KOG2337 | 669 | consensus Ubiquitin activating E1 enzyme-like prot | 99.39 | |
| TIGR03693 | 637 | ocin_ThiF_like putative thiazole-containing bacter | 99.39 | |
| KOG2337 | 669 | consensus Ubiquitin activating E1 enzyme-like prot | 99.11 | |
| TIGR03693 | 637 | ocin_ThiF_like putative thiazole-containing bacter | 99.02 | |
| PF02134 | 67 | UBACT: Repeat in ubiquitin-activating (UBA) protei | 98.11 | |
| COG4015 | 217 | Predicted dinucleotide-utilizing enzyme of the Thi | 97.83 | |
| PRK06718 | 202 | precorrin-2 dehydrogenase; Reviewed | 97.49 | |
| TIGR01470 | 205 | cysG_Nterm siroheme synthase, N-terminal domain. T | 97.39 | |
| PF08825 | 84 | E2_bind: E2 binding domain; InterPro: IPR014929 E1 | 97.32 | |
| PF01488 | 135 | Shikimate_DH: Shikimate / quinate 5-dehydrogenase; | 97.08 | |
| COG1748 | 389 | LYS9 Saccharopine dehydrogenase and related protei | 97.05 | |
| PRK06719 | 157 | precorrin-2 dehydrogenase; Validated | 97.02 | |
| PRK12549 | 284 | shikimate 5-dehydrogenase; Reviewed | 96.98 | |
| PF13241 | 103 | NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_ | 96.94 | |
| PRK12549 | 284 | shikimate 5-dehydrogenase; Reviewed | 96.91 | |
| PF01488 | 135 | Shikimate_DH: Shikimate / quinate 5-dehydrogenase; | 96.9 | |
| PRK05562 | 223 | precorrin-2 dehydrogenase; Provisional | 96.89 | |
| PRK06718 | 202 | precorrin-2 dehydrogenase; Reviewed | 96.84 | |
| COG1748 | 389 | LYS9 Saccharopine dehydrogenase and related protei | 96.76 | |
| COG4015 | 217 | Predicted dinucleotide-utilizing enzyme of the Thi | 96.7 | |
| TIGR03882 | 193 | cyclo_dehyd_2 bacteriocin biosynthesis cyclodehydr | 96.5 | |
| PRK06719 | 157 | precorrin-2 dehydrogenase; Validated | 96.43 | |
| PF13241 | 103 | NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_ | 96.38 | |
| TIGR01470 | 205 | cysG_Nterm siroheme synthase, N-terminal domain. T | 96.37 | |
| PF03435 | 386 | Saccharop_dh: Saccharopine dehydrogenase ; InterPr | 95.99 | |
| PRK10637 | 457 | cysG siroheme synthase; Provisional | 95.9 | |
| PRK05562 | 223 | precorrin-2 dehydrogenase; Provisional | 95.8 | |
| COG1648 | 210 | CysG Siroheme synthase (precorrin-2 oxidase/ferroc | 95.78 | |
| PRK14027 | 283 | quinate/shikimate dehydrogenase; Provisional | 95.47 | |
| PRK14027 | 283 | quinate/shikimate dehydrogenase; Provisional | 95.19 | |
| PRK12548 | 289 | shikimate 5-dehydrogenase; Provisional | 95.1 | |
| PF00056 | 141 | Ldh_1_N: lactate/malate dehydrogenase, NAD binding | 94.85 | |
| PRK07819 | 286 | 3-hydroxybutyryl-CoA dehydrogenase; Validated | 94.81 | |
| COG0373 | 414 | HemA Glutamyl-tRNA reductase [Coenzyme metabolism] | 94.76 | |
| TIGR01809 | 282 | Shik-DH-AROM shikimate-5-dehydrogenase, fungal ARO | 94.74 | |
| PRK14106 | 450 | murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn | 94.53 | |
| TIGR01809 | 282 | Shik-DH-AROM shikimate-5-dehydrogenase, fungal ARO | 94.51 | |
| PRK00258 | 278 | aroE shikimate 5-dehydrogenase; Reviewed | 94.41 | |
| KOG4169 | 261 | consensus 15-hydroxyprostaglandin dehydrogenase an | 94.3 | |
| PRK14106 | 450 | murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn | 94.29 | |
| PRK00258 | 278 | aroE shikimate 5-dehydrogenase; Reviewed | 94.28 | |
| PRK07066 | 321 | 3-hydroxybutyryl-CoA dehydrogenase; Validated | 94.26 | |
| cd01065 | 155 | NAD_bind_Shikimate_DH NAD(P) binding domain of Shi | 94.24 | |
| COG0169 | 283 | AroE Shikimate 5-dehydrogenase [Amino acid transpo | 94.22 | |
| PRK12548 | 289 | shikimate 5-dehydrogenase; Provisional | 94.17 | |
| PF03446 | 163 | NAD_binding_2: NAD binding domain of 6-phosphogluc | 94.15 | |
| cd05291 | 306 | HicDH_like L-2-hydroxyisocapronate dehydrogenases | 94.09 | |
| PF05237 | 84 | MoeZ_MoeB: MoeZ/MoeB domain; InterPro: IPR007901 T | 94.06 | |
| PRK13940 | 414 | glutamyl-tRNA reductase; Provisional | 93.91 | |
| PF01113 | 124 | DapB_N: Dihydrodipicolinate reductase, N-terminus; | 93.86 | |
| PF02826 | 178 | 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehy | 93.82 | |
| PF03435 | 386 | Saccharop_dh: Saccharopine dehydrogenase ; InterPr | 93.81 | |
| COG1648 | 210 | CysG Siroheme synthase (precorrin-2 oxidase/ferroc | 93.8 | |
| TIGR03882 | 193 | cyclo_dehyd_2 bacteriocin biosynthesis cyclodehydr | 93.76 | |
| PRK05808 | 282 | 3-hydroxybutyryl-CoA dehydrogenase; Validated | 93.72 | |
| COG0373 | 414 | HemA Glutamyl-tRNA reductase [Coenzyme metabolism] | 93.7 | |
| PF00070 | 80 | Pyr_redox: Pyridine nucleotide-disulphide oxidored | 93.58 | |
| PRK13940 | 414 | glutamyl-tRNA reductase; Provisional | 93.53 | |
| PRK12749 | 288 | quinate/shikimate dehydrogenase; Reviewed | 93.47 | |
| PF02737 | 180 | 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD bind | 93.34 | |
| PRK09260 | 288 | 3-hydroxybutyryl-CoA dehydrogenase; Validated | 93.12 | |
| COG0169 | 283 | AroE Shikimate 5-dehydrogenase [Amino acid transpo | 93.07 | |
| PRK10637 | 457 | cysG siroheme synthase; Provisional | 93.05 | |
| PRK04148 | 134 | hypothetical protein; Provisional | 93.02 | |
| PRK12749 | 288 | quinate/shikimate dehydrogenase; Reviewed | 93.0 | |
| PRK06130 | 311 | 3-hydroxybutyryl-CoA dehydrogenase; Validated | 92.98 | |
| PLN00203 | 519 | glutamyl-tRNA reductase | 92.89 | |
| COG0569 | 225 | TrkA K+ transport systems, NAD-binding component [ | 92.88 | |
| PF14732 | 87 | UAE_UbL: Ubiquitin/SUMO-activating enzyme ubiquiti | 92.78 | |
| cd00300 | 300 | LDH_like L-lactate dehydrogenase-like enzymes. Mem | 92.71 | |
| PRK08293 | 287 | 3-hydroxybutyryl-CoA dehydrogenase; Validated | 92.65 | |
| PRK00066 | 315 | ldh L-lactate dehydrogenase; Reviewed | 92.56 | |
| cd01065 | 155 | NAD_bind_Shikimate_DH NAD(P) binding domain of Shi | 92.48 | |
| PRK05476 | 425 | S-adenosyl-L-homocysteine hydrolase; Provisional | 92.47 | |
| PRK05708 | 305 | 2-dehydropantoate 2-reductase; Provisional | 92.34 | |
| cd01080 | 168 | NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of | 92.32 | |
| cd05213 | 311 | NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain | 92.24 | |
| PF02254 | 116 | TrkA_N: TrkA-N domain; InterPro: IPR003148 The reg | 92.18 | |
| TIGR01035 | 417 | hemA glutamyl-tRNA reductase. This enzyme, togethe | 92.13 | |
| cd05311 | 226 | NAD_bind_2_malic_enz NAD(P) binding domain of mali | 91.85 | |
| KOG4169 | 261 | consensus 15-hydroxyprostaglandin dehydrogenase an | 91.83 | |
| PLN00203 | 519 | glutamyl-tRNA reductase | 91.72 | |
| cd05291 | 306 | HicDH_like L-2-hydroxyisocapronate dehydrogenases | 91.7 | |
| PLN02602 | 350 | lactate dehydrogenase | 91.68 | |
| COG0569 | 225 | TrkA K+ transport systems, NAD-binding component [ | 91.67 | |
| cd05290 | 307 | LDH_3 A subgroup of L-lactate dehydrogenases. L-la | 91.62 | |
| PF03446 | 163 | NAD_binding_2: NAD binding domain of 6-phosphogluc | 91.61 | |
| cd05293 | 312 | LDH_1 A subgroup of L-lactate dehydrogenases. L-la | 91.35 | |
| PRK04148 | 134 | hypothetical protein; Provisional | 91.23 | |
| COG0111 | 324 | SerA Phosphoglycerate dehydrogenase and related de | 91.17 | |
| cd05311 | 226 | NAD_bind_2_malic_enz NAD(P) binding domain of mali | 90.98 | |
| PRK08618 | 325 | ornithine cyclodeaminase; Validated | 90.93 | |
| PF10585 | 45 | UBA_e1_thiolCys: Ubiquitin-activating enzyme activ | 90.8 | |
| cd00401 | 413 | AdoHcyase S-adenosyl-L-homocysteine hydrolase (Ado | 90.78 | |
| PLN02819 | 1042 | lysine-ketoglutarate reductase/saccharopine dehydr | 90.72 | |
| PF00670 | 162 | AdoHcyase_NAD: S-adenosyl-L-homocysteine hydrolase | 90.5 | |
| PTZ00117 | 319 | malate dehydrogenase; Provisional | 90.49 | |
| cd05213 | 311 | NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain | 90.46 | |
| cd01078 | 194 | NAD_bind_H4MPT_DH NADP binding domain of methylene | 90.4 | |
| PRK07063 | 260 | short chain dehydrogenase; Provisional | 90.4 | |
| PRK07819 | 286 | 3-hydroxybutyryl-CoA dehydrogenase; Validated | 90.32 | |
| PRK08410 | 311 | 2-hydroxyacid dehydrogenase; Provisional | 90.3 | |
| PRK14192 | 283 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 90.26 | |
| PRK06197 | 306 | short chain dehydrogenase; Provisional | 90.21 | |
| PRK15469 | 312 | ghrA bifunctional glyoxylate/hydroxypyruvate reduc | 90.17 | |
| PRK09599 | 301 | 6-phosphogluconate dehydrogenase-like protein; Rev | 90.0 | |
| cd01078 | 194 | NAD_bind_H4MPT_DH NADP binding domain of methylene | 89.99 | |
| TIGR00936 | 406 | ahcY adenosylhomocysteinase. This enzyme hydrolyze | 89.96 | |
| PRK00066 | 315 | ldh L-lactate dehydrogenase; Reviewed | 89.87 | |
| PRK06487 | 317 | glycerate dehydrogenase; Provisional | 89.83 | |
| PRK01710 | 458 | murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn | 89.81 | |
| PRK00141 | 473 | murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn | 89.79 | |
| PRK13243 | 333 | glyoxylate reductase; Reviewed | 89.76 | |
| cd01075 | 200 | NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of l | 89.74 | |
| PRK01438 | 480 | murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn | 89.6 | |
| PRK07574 | 385 | formate dehydrogenase; Provisional | 89.56 | |
| PF03807 | 96 | F420_oxidored: NADP oxidoreductase coenzyme F420-d | 89.52 | |
| cd05290 | 307 | LDH_3 A subgroup of L-lactate dehydrogenases. L-la | 89.47 | |
| PTZ00082 | 321 | L-lactate dehydrogenase; Provisional | 89.46 | |
| TIGR00507 | 270 | aroE shikimate 5-dehydrogenase. This model finds p | 89.46 | |
| PRK05808 | 282 | 3-hydroxybutyryl-CoA dehydrogenase; Validated | 89.44 | |
| PRK06932 | 314 | glycerate dehydrogenase; Provisional | 89.41 | |
| PLN02545 | 295 | 3-hydroxybutyryl-CoA dehydrogenase | 89.4 | |
| PRK07530 | 292 | 3-hydroxybutyryl-CoA dehydrogenase; Validated | 89.26 | |
| PRK00045 | 423 | hemA glutamyl-tRNA reductase; Reviewed | 89.26 | |
| PRK05854 | 313 | short chain dehydrogenase; Provisional | 89.23 | |
| PRK06129 | 308 | 3-hydroxyacyl-CoA dehydrogenase; Validated | 88.96 | |
| TIGR02992 | 326 | ectoine_eutC ectoine utilization protein EutC. Mem | 88.96 | |
| PRK15438 | 378 | erythronate-4-phosphate dehydrogenase PdxB; Provis | 88.94 | |
| cd01080 | 168 | NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of | 88.87 | |
| PF00056 | 141 | Ldh_1_N: lactate/malate dehydrogenase, NAD binding | 88.75 | |
| PRK07531 | 495 | bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioe | 88.72 | |
| PLN03139 | 386 | formate dehydrogenase; Provisional | 88.62 | |
| PRK06130 | 311 | 3-hydroxybutyryl-CoA dehydrogenase; Validated | 88.58 | |
| PF02737 | 180 | 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD bind | 88.58 | |
| PF00070 | 80 | Pyr_redox: Pyridine nucleotide-disulphide oxidored | 88.56 | |
| PRK06436 | 303 | glycerate dehydrogenase; Provisional | 88.33 | |
| PRK06197 | 306 | short chain dehydrogenase; Provisional | 88.3 | |
| TIGR00507 | 270 | aroE shikimate 5-dehydrogenase. This model finds p | 88.24 | |
| PRK07066 | 321 | 3-hydroxybutyryl-CoA dehydrogenase; Validated | 88.13 | |
| TIGR01759 | 323 | MalateDH-SF1 malate dehydrogenase. This model repr | 87.95 | |
| PRK14619 | 308 | NAD(P)H-dependent glycerol-3-phosphate dehydrogena | 87.9 | |
| COG1086 | 588 | Predicted nucleoside-diphosphate sugar epimerases | 87.85 | |
| PRK09242 | 257 | tropinone reductase; Provisional | 87.82 | |
| PRK00048 | 257 | dihydrodipicolinate reductase; Provisional | 87.75 | |
| PRK00257 | 381 | erythronate-4-phosphate dehydrogenase; Validated | 87.64 | |
| PRK11880 | 267 | pyrroline-5-carboxylate reductase; Reviewed | 87.63 | |
| PF01210 | 157 | NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate | 87.6 | |
| PRK09496 | 453 | trkA potassium transporter peripheral membrane com | 87.51 | |
| PF01118 | 121 | Semialdhyde_dh: Semialdehyde dehydrogenase, NAD bi | 87.47 | |
| PRK07831 | 262 | short chain dehydrogenase; Provisional | 87.44 | |
| COG0300 | 265 | DltE Short-chain dehydrogenases of various substra | 87.4 | |
| PTZ00325 | 321 | malate dehydrogenase; Provisional | 87.37 | |
| PRK07530 | 292 | 3-hydroxybutyryl-CoA dehydrogenase; Validated | 87.36 | |
| PRK07634 | 245 | pyrroline-5-carboxylate reductase; Reviewed | 87.21 | |
| PLN03209 | 576 | translocon at the inner envelope of chloroplast su | 87.21 | |
| PF02558 | 151 | ApbA: Ketopantoate reductase PanE/ApbA; InterPro: | 87.15 | |
| PRK06141 | 314 | ornithine cyclodeaminase; Validated | 87.07 | |
| PRK12480 | 330 | D-lactate dehydrogenase; Provisional | 86.93 | |
| PRK03659 | 601 | glutathione-regulated potassium-efflux system prot | 86.89 | |
| PRK07062 | 265 | short chain dehydrogenase; Provisional | 86.88 | |
| PRK03562 | 621 | glutathione-regulated potassium-efflux system prot | 86.83 | |
| PF02254 | 116 | TrkA_N: TrkA-N domain; InterPro: IPR003148 The reg | 86.82 | |
| cd05191 | 86 | NAD_bind_amino_acid_DH NAD(P) binding domain of am | 86.79 | |
| PRK14175 | 286 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 86.72 | |
| PRK07417 | 279 | arogenate dehydrogenase; Reviewed | 86.67 | |
| PLN02494 | 477 | adenosylhomocysteinase | 86.58 | |
| PRK07502 | 307 | cyclohexadienyl dehydrogenase; Validated | 86.57 | |
| PRK06522 | 304 | 2-dehydropantoate 2-reductase; Reviewed | 86.55 | |
| TIGR00872 | 298 | gnd_rel 6-phosphogluconate dehydrogenase (decarbox | 86.51 | |
| PRK02705 | 459 | murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn | 86.49 | |
| PRK07340 | 304 | ornithine cyclodeaminase; Validated | 86.46 | |
| COG0771 | 448 | MurD UDP-N-acetylmuramoylalanine-D-glutamate ligas | 86.46 | |
| PLN02545 | 295 | 3-hydroxybutyryl-CoA dehydrogenase | 86.45 | |
| cd05293 | 312 | LDH_1 A subgroup of L-lactate dehydrogenases. L-la | 86.42 | |
| PRK12490 | 299 | 6-phosphogluconate dehydrogenase-like protein; Rev | 86.42 | |
| TIGR00872 | 298 | gnd_rel 6-phosphogluconate dehydrogenase (decarbox | 86.3 | |
| COG0039 | 313 | Mdh Malate/lactate dehydrogenases [Energy producti | 86.28 | |
| cd05191 | 86 | NAD_bind_amino_acid_DH NAD(P) binding domain of am | 86.24 | |
| PF03807 | 96 | F420_oxidored: NADP oxidoreductase coenzyme F420-d | 86.24 | |
| PLN02206 | 442 | UDP-glucuronate decarboxylase | 86.18 | |
| PRK07576 | 264 | short chain dehydrogenase; Provisional | 86.12 | |
| PRK08251 | 248 | short chain dehydrogenase; Provisional | 86.02 | |
| PLN02928 | 347 | oxidoreductase family protein | 86.0 | |
| PRK06141 | 314 | ornithine cyclodeaminase; Validated | 85.77 | |
| PRK05479 | 330 | ketol-acid reductoisomerase; Provisional | 85.7 | |
| PRK11154 | 708 | fadJ multifunctional fatty acid oxidation complex | 85.61 | |
| PRK12826 | 251 | 3-ketoacyl-(acyl-carrier-protein) reductase; Revie | 85.53 | |
| PRK08339 | 263 | short chain dehydrogenase; Provisional | 85.44 | |
| PLN02350 | 493 | phosphogluconate dehydrogenase (decarboxylating) | 85.43 | |
| PRK05867 | 253 | short chain dehydrogenase; Provisional | 85.43 | |
| PRK07340 | 304 | ornithine cyclodeaminase; Validated | 85.36 | |
| PRK00094 | 325 | gpsA NAD(P)H-dependent glycerol-3-phosphate dehydr | 85.36 | |
| PRK06035 | 291 | 3-hydroxyacyl-CoA dehydrogenase; Validated | 85.3 | |
| PRK07231 | 251 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; | 85.23 | |
| PRK10537 | 393 | voltage-gated potassium channel; Provisional | 85.21 | |
| PRK08618 | 325 | ornithine cyclodeaminase; Validated | 85.11 | |
| PLN02819 | 1042 | lysine-ketoglutarate reductase/saccharopine dehydr | 85.07 | |
| PF01113 | 124 | DapB_N: Dihydrodipicolinate reductase, N-terminus; | 85.05 | |
| PRK07523 | 255 | gluconate 5-dehydrogenase; Provisional | 85.05 | |
| PRK04308 | 445 | murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn | 84.9 | |
| PF13460 | 183 | NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X | 84.89 | |
| PRK09186 | 256 | flagellin modification protein A; Provisional | 84.79 | |
| PLN02602 | 350 | lactate dehydrogenase | 84.78 | |
| PRK11790 | 409 | D-3-phosphoglycerate dehydrogenase; Provisional | 84.72 | |
| PLN02206 | 442 | UDP-glucuronate decarboxylase | 84.71 | |
| PRK06223 | 307 | malate dehydrogenase; Reviewed | 84.7 | |
| PLN02306 | 386 | hydroxypyruvate reductase | 84.7 | |
| COG1893 | 307 | ApbA Ketopantoate reductase [Coenzyme metabolism] | 84.7 | |
| PRK06249 | 313 | 2-dehydropantoate 2-reductase; Provisional | 84.7 | |
| PRK11908 | 347 | NAD-dependent epimerase/dehydratase family protein | 84.68 | |
| PF02826 | 178 | 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehy | 84.64 | |
| PRK07680 | 273 | late competence protein ComER; Validated | 84.63 | |
| cd01338 | 322 | MDH_choloroplast_like Chloroplast-like malate dehy | 84.59 | |
| PRK02006 | 498 | murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn | 84.56 | |
| PRK08293 | 287 | 3-hydroxybutyryl-CoA dehydrogenase; Validated | 84.54 | |
| PRK08217 | 253 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; | 84.45 | |
| cd01075 | 200 | NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of l | 84.43 | |
| PRK09242 | 257 | tropinone reductase; Provisional | 84.36 | |
| PRK05854 | 313 | short chain dehydrogenase; Provisional | 84.33 | |
| PRK07478 | 254 | short chain dehydrogenase; Provisional | 84.24 | |
| PRK07502 | 307 | cyclohexadienyl dehydrogenase; Validated | 84.23 | |
| PRK04690 | 468 | murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn | 84.23 | |
| cd01339 | 300 | LDH-like_MDH L-lactate dehydrogenase-like malate d | 84.17 | |
| PRK07417 | 279 | arogenate dehydrogenase; Reviewed | 84.13 | |
| cd05292 | 308 | LDH_2 A subgroup of L-lactate dehydrogenases. L-la | 84.03 | |
| PRK09599 | 301 | 6-phosphogluconate dehydrogenase-like protein; Rev | 83.93 | |
| PRK07679 | 279 | pyrroline-5-carboxylate reductase; Reviewed | 83.88 | |
| PRK15409 | 323 | bifunctional glyoxylate/hydroxypyruvate reductase | 83.87 | |
| TIGR00465 | 314 | ilvC ketol-acid reductoisomerase. This is the seco | 83.85 | |
| PRK11730 | 715 | fadB multifunctional fatty acid oxidation complex | 83.84 | |
| PRK06545 | 359 | prephenate dehydrogenase; Validated | 83.79 | |
| cd00300 | 300 | LDH_like L-lactate dehydrogenase-like enzymes. Mem | 83.75 | |
| PRK12921 | 305 | 2-dehydropantoate 2-reductase; Provisional | 83.72 | |
| PRK14618 | 328 | NAD(P)H-dependent glycerol-3-phosphate dehydrogena | 83.57 | |
| TIGR01915 | 219 | npdG NADPH-dependent F420 reductase. This model re | 83.53 | |
| PRK03562 | 621 | glutathione-regulated potassium-efflux system prot | 83.43 | |
| TIGR02992 | 326 | ectoine_eutC ectoine utilization protein EutC. Mem | 83.42 | |
| PRK05479 | 330 | ketol-acid reductoisomerase; Provisional | 83.4 | |
| PRK07531 | 495 | bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioe | 83.39 | |
| PRK04663 | 438 | murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn | 83.36 | |
| PLN02780 | 320 | ketoreductase/ oxidoreductase | 83.36 | |
| cd00401 | 413 | AdoHcyase S-adenosyl-L-homocysteine hydrolase (Ado | 83.35 | |
| PRK06523 | 260 | short chain dehydrogenase; Provisional | 83.32 | |
| PRK05866 | 293 | short chain dehydrogenase; Provisional | 83.31 | |
| PTZ00142 | 470 | 6-phosphogluconate dehydrogenase; Provisional | 83.25 | |
| PRK05335 | 436 | tRNA (uracil-5-)-methyltransferase Gid; Reviewed | 83.21 | |
| TIGR01757 | 387 | Malate-DH_plant malate dehydrogenase, NADP-depende | 83.21 | |
| PF01210 | 157 | NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate | 83.19 | |
| COG1250 | 307 | FadB 3-hydroxyacyl-CoA dehydrogenase [Lipid metabo | 83.18 | |
| PF00106 | 167 | adh_short: short chain dehydrogenase alcohol dehyd | 83.11 | |
| PRK14619 | 308 | NAD(P)H-dependent glycerol-3-phosphate dehydrogena | 83.01 | |
| PRK11559 | 296 | garR tartronate semialdehyde reductase; Provisiona | 83.01 | |
| PRK07063 | 260 | short chain dehydrogenase; Provisional | 82.91 | |
| PF01118 | 121 | Semialdhyde_dh: Semialdehyde dehydrogenase, NAD bi | 82.91 | |
| TIGR02440 | 699 | FadJ fatty oxidation complex, alpha subunit FadJ. | 82.85 | |
| PRK05708 | 305 | 2-dehydropantoate 2-reductase; Provisional | 82.83 | |
| PLN03129 | 581 | NADP-dependent malic enzyme; Provisional | 82.8 | |
| PRK09260 | 288 | 3-hydroxybutyryl-CoA dehydrogenase; Validated | 82.79 | |
| PRK02472 | 447 | murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn | 82.72 | |
| PRK05875 | 276 | short chain dehydrogenase; Provisional | 82.71 | |
| PRK08655 | 437 | prephenate dehydrogenase; Provisional | 82.69 | |
| PRK11880 | 267 | pyrroline-5-carboxylate reductase; Reviewed | 82.62 | |
| KOG0069 | 336 | consensus Glyoxylate/hydroxypyruvate reductase (D- | 82.41 | |
| PRK05565 | 247 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; | 82.38 | |
| PLN02253 | 280 | xanthoxin dehydrogenase | 82.36 | |
| PRK08291 | 330 | ectoine utilization protein EutC; Validated | 82.36 | |
| TIGR00873 | 467 | gnd 6-phosphogluconate dehydrogenase, decarboxylat | 82.35 | |
| PRK06928 | 277 | pyrroline-5-carboxylate reductase; Reviewed | 82.34 | |
| cd05296 | 419 | GH4_P_beta_glucosidase Glycoside Hydrolases Family | 82.32 | |
| PTZ00431 | 260 | pyrroline carboxylate reductase; Provisional | 82.3 | |
| PRK06476 | 258 | pyrroline-5-carboxylate reductase; Reviewed | 82.26 | |
| COG1063 | 350 | Tdh Threonine dehydrogenase and related Zn-depende | 82.23 | |
| PRK13304 | 265 | L-aspartate dehydrogenase; Reviewed | 82.2 | |
| PRK07067 | 257 | sorbitol dehydrogenase; Provisional | 82.16 | |
| PRK07062 | 265 | short chain dehydrogenase; Provisional | 82.14 | |
| PRK14620 | 326 | NAD(P)H-dependent glycerol-3-phosphate dehydrogena | 82.11 | |
| PLN03209 | 576 | translocon at the inner envelope of chloroplast su | 82.1 | |
| TIGR01035 | 417 | hemA glutamyl-tRNA reductase. This enzyme, togethe | 82.07 | |
| PRK05442 | 326 | malate dehydrogenase; Provisional | 81.99 | |
| PRK03803 | 448 | murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn | 81.82 | |
| PRK13302 | 271 | putative L-aspartate dehydrogenase; Provisional | 81.79 | |
| PRK08229 | 341 | 2-dehydropantoate 2-reductase; Provisional | 81.71 | |
| PF00106 | 167 | adh_short: short chain dehydrogenase alcohol dehyd | 81.71 | |
| TIGR01763 | 305 | MalateDH_bact malate dehydrogenase, NAD-dependent. | 81.68 | |
| PTZ00431 | 260 | pyrroline carboxylate reductase; Provisional | 81.68 | |
| TIGR02437 | 714 | FadB fatty oxidation complex, alpha subunit FadB. | 81.68 | |
| TIGR02279 | 503 | PaaC-3OHAcCoADH 3-hydroxyacyl-CoA dehydrogenase Pa | 81.62 | |
| cd00650 | 263 | LDH_MDH_like NAD-dependent, lactate dehydrogenase- | 81.56 | |
| PRK09496 | 453 | trkA potassium transporter peripheral membrane com | 81.55 | |
| PLN03096 | 395 | glyceraldehyde-3-phosphate dehydrogenase A; Provis | 81.55 | |
| PRK12939 | 250 | short chain dehydrogenase; Provisional | 81.51 | |
| PRK06139 | 330 | short chain dehydrogenase; Provisional | 81.47 | |
| PRK08605 | 332 | D-lactate dehydrogenase; Validated | 81.45 | |
| PRK06057 | 255 | short chain dehydrogenase; Provisional | 81.4 | |
| TIGR01771 | 299 | L-LDH-NAD L-lactate dehydrogenase. This model repr | 81.35 | |
| TIGR00518 | 370 | alaDH alanine dehydrogenase. The family of known L | 81.33 | |
| PTZ00082 | 321 | L-lactate dehydrogenase; Provisional | 81.33 | |
| TIGR01327 | 525 | PGDH D-3-phosphoglycerate dehydrogenase. This mode | 81.31 | |
| PRK06940 | 275 | short chain dehydrogenase; Provisional | 81.21 | |
| PRK10669 | 558 | putative cation:proton antiport protein; Provision | 81.13 | |
| PF02558 | 151 | ApbA: Ketopantoate reductase PanE/ApbA; InterPro: | 81.08 | |
| PF02056 | 183 | Glyco_hydro_4: Family 4 glycosyl hydrolase; InterP | 80.99 | |
| PRK07576 | 264 | short chain dehydrogenase; Provisional | 80.97 | |
| PLN02240 | 352 | UDP-glucose 4-epimerase | 80.92 | |
| cd01337 | 310 | MDH_glyoxysomal_mitochondrial Glyoxysomal and mito | 80.89 | |
| PTZ00117 | 319 | malate dehydrogenase; Provisional | 80.82 | |
| PRK08291 | 330 | ectoine utilization protein EutC; Validated | 80.58 | |
| PRK13529 | 563 | malate dehydrogenase; Provisional | 80.57 | |
| PRK06720 | 169 | hypothetical protein; Provisional | 80.49 | |
| TIGR00036 | 266 | dapB dihydrodipicolinate reductase. | 80.47 | |
| PRK07792 | 306 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; | 80.45 | |
| PRK15059 | 292 | tartronate semialdehyde reductase; Provisional | 80.37 | |
| PRK06181 | 263 | short chain dehydrogenase; Provisional | 80.27 | |
| TIGR02632 | 676 | RhaD_aldol-ADH rhamnulose-1-phosphate aldolase/alc | 80.26 | |
| TIGR02622 | 349 | CDP_4_6_dhtase CDP-glucose 4,6-dehydratase. Member | 80.2 | |
| PRK08251 | 248 | short chain dehydrogenase; Provisional | 80.2 | |
| PRK12384 | 259 | sorbitol-6-phosphate dehydrogenase; Provisional | 80.06 | |
| PLN02240 | 352 | UDP-glucose 4-epimerase | 80.02 | |
| TIGR03589 | 324 | PseB UDP-N-acetylglucosamine 4,6-dehydratase. This | 80.02 | |
| TIGR03466 | 328 | HpnA hopanoid-associated sugar epimerase. The sequ | 80.02 |
| >KOG2012 consensus Ubiquitin activating enzyme UBA1 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
Probab=100.00 E-value=5.5e-265 Score=2279.89 Aligned_cols=1003 Identities=60% Similarity=1.018 Sum_probs=975.2
Q ss_pred CCCCCCCchhHhhhhhhhhccCHHHHHHhhcCeEEEEcCChHHHHHHHHHHHhCCCeEEEEeCCccCcccCCcccccCCC
Q 001074 148 LGNSNQTDIDEDLHSRQLAVYGRETMRRLFASNILVSGMQGLGAEIAKNLILAGVKSVTLHDEGTVELWDLSSNFVFSDN 227 (1163)
Q Consensus 148 ~~~~~~~~~d~~rYdRQi~l~G~e~q~kL~~s~VlIiG~gglGsEiaKNLvlaGVg~itLvD~d~V~~sDL~rqff~~~~ 227 (1163)
.++....+||+++||||+|++|+++|+||..|+|||+|++|||.||||||+|+||+++||+|+..+.++||++|||++++
T Consensus 7 ~~~~a~~~IDE~LYSRQLYVlG~eAM~~m~~S~VLisGl~GLGvEIAKNliLaGVksvTlhD~~~~~~~DLssqf~L~E~ 86 (1013)
T KOG2012|consen 7 DGNSASQEIDESLYSRQLYVLGHEAMRRMQGSNVLISGLQGLGVEIAKNLILAGVKSVTLHDPRPVQLSDLSSQFYLSEE 86 (1013)
T ss_pred ccCcchhhhhhhhhhhhhhhccHHHHHHHhhCcEEEecCCcccHHHHhhHhhhccceEEeeCCCcccHHhhccceeeeHH
Confidence 33444579999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred ccCchHHHHHHHHHHHhcCCCEEEEeecCCChhhcCCCcEEEEecCChhHHHHHHHHHHhcCCCceeEEeeecceeEEEE
Q 001074 228 DIGKNRALASVQKLQELNNAVVLSTLTSKLTKEQLSDFQAVVFTDISLDKAIEFDDFCHNHQPAISFIKAEVRGLFGSVF 307 (1163)
Q Consensus 228 DiGk~Kaea~~~~L~eLNp~V~V~~~~~~l~~e~l~~fdvVI~~~~~~~~~~~ln~~cr~~~~~IpfI~~~~~G~~G~vf 307 (1163)
|||++||+++.++|++||++|.|.++++.++++++++|+|||+|+.+.+.+.+||++||+++ |.||.++++|++|++|
T Consensus 87 DigknRA~as~~~LaeLN~yV~V~v~t~~~~~e~L~~FqvVVlt~~~le~q~~i~~fch~~~--i~fi~ad~RGLfg~lF 164 (1013)
T KOG2012|consen 87 DIGKNRAEASVEKLAELNNYVPVVVLTGPLTEEFLSDFQVVVLTDASLEEQLKINDFCHSHG--IAFIAADTRGLFGQLF 164 (1013)
T ss_pred hcCCchHHHHHHHHHHhhcceeeEEecCcccHHHHhCCcEEEEecCchHHHHHHHHHHHhcC--eEEEEeccchhhhhhh
Confidence 99999999999999999999999999999999999999999999999999999999999999 9999999999999999
Q ss_pred EEcCCceEEEcCCCCCCcceeecccccCCCceeecccccccccccCCeeEEEeeccccccCCCCCccccccCcceeeecc
Q 001074 308 CDFGPEFTVVDVDGEDPHTGIIASISNDNPALVSCVDDERLEFQDGDLVVFSEVHGMTELNDGKPRKIKSARPYSFTLEE 387 (1163)
Q Consensus 308 ~d~g~~f~v~d~~ge~p~~~~I~~I~~~~~~lv~~~d~~rh~~~dgd~V~f~ev~gm~eln~~~~~~i~~~~~~~f~i~~ 387 (1163)
||||++|+|.|.+||+|.+++|++|++++|++|||+++.||+|+|||+|+|+||+||+++|+++|++|++++||+|+| +
T Consensus 165 CDFG~eF~v~D~tGeeP~t~mI~~Is~d~pGvvT~ld~~rH~lEdGd~V~FsEveGm~eLN~~~P~kI~v~~p~sf~I-g 243 (1013)
T KOG2012|consen 165 CDFGEEFTVLDPTGEEPLTGMIASISQDNPGVVTCLDGARHGFEDGDLVTFSEVEGMTELNDCKPRKITVLGPYSFSI-G 243 (1013)
T ss_pred ccCCCceEEeCCCCCcchhhHHhhccCCCCceEEEecCccccCccCCEEEEEeeccccccCCCCceEEEEecCceEEe-c
Confidence 999999999999999999999999999999999999999999999999999999999999999999999999999999 5
Q ss_pred ccccccceeecceEEEeecCeeecccchHhhhcCCCCcccccCccCCCCChHHHHHHHHHHHHHHhCCCCCCCCHHHHHH
Q 001074 388 DTTNYGTYVKGGIVTQVKQPKVLNFKPLREALEDPGDFLLSDFSKFDRPPPLHLAFQALDKFVSELGRFPVAGSEEDAQK 467 (1163)
Q Consensus 388 Dt~~f~~y~~gg~~~qvk~p~~i~fksL~e~L~~p~~~l~~d~~k~~~~~~l~~~~~aL~~F~~~~gr~P~~~~~~Da~~ 467 (1163)
||+.|+.|.+||+++|||+|++++|+||+++|.+| +++.+|++|++||+++|++|+||++|.++|||+|.+++++|+++
T Consensus 244 dt~~f~~y~~GGi~tQVK~Pk~isfKsL~~~L~~P-~fl~~df~k~~rp~~lH~af~AL~~F~~~~Gr~P~p~~e~DA~~ 322 (1013)
T KOG2012|consen 244 DTTEFGEYKKGGIFTQVKVPKTISFKSLREALKEP-EFLISDFAKFDRPPQLHLAFQALHQFQEAHGRLPRPGNEEDAEE 322 (1013)
T ss_pred cccchhhhhcCceeEEeecCceEecccHHHhhcCC-CeeeeccccccccHHHHHHHHHHHHHHHHhCCCCCCCChhhHHH
Confidence 79999999999999999999999999999999999 79999999999999999999999999999999999999999999
Q ss_pred HHHHHHHHHHhcCCCCCCCCCHHHHHHHHhhcccccCchhhHhhhhhhHHHHHhhcCCcccceeeeeeeccCCCCCC--C
Q 001074 468 LISVATNINESLGDGRVEDINTKLLRHFAFGARAVLNPMAAMFGGIVGQEVVKACSGKFHPLYQFFYFDSVESLPTE--P 545 (1163)
Q Consensus 468 l~~ia~~i~~~~~~~~~~~i~~~li~~~~~~~~~el~PvaA~iGGiaAQEVIKaiTgkf~PI~q~~~fD~ie~Lp~~--~ 545 (1163)
|++++..+.+..+ ...++++++|++|++.+++.|.||+|++||+|||||+|+|||||+||.||||||++|+||.+ +
T Consensus 323 l~~l~~~i~~~~~--~~~~vde~Lir~~s~~a~g~L~pm~A~~GG~vaQEvlKa~sgKF~PL~Q~lYfDale~LP~d~~~ 400 (1013)
T KOG2012|consen 323 LVELARDISEGLG--LEEDVDEKLIRHFSFSARGDLNPMVAFFGGIVAQEVLKACSGKFTPLKQWLYFDALESLPSDNLP 400 (1013)
T ss_pred HHHHHHHhhhhcc--ccccchHHHHHHHHHhhccCcchHHHHHhhhhHHHHHHhhccCccchhHheehhhHhhCCCcCCC
Confidence 9999999988765 35689999999999999999999999999999999999999999999999999999999975 7
Q ss_pred CCCCCCCCccCchhhhhhhcCHHHHHHHhcCcEEEEecCcchHHHHHHHHHcccccCCCccEEEecCCcccccCcCcccC
Q 001074 546 LDSTEFKPINSRYDAQISVFGAKLQKKLEDAKVFIVGSGALGCEFLKNVALMGVSCGNQGKLTITDDDVIEKSNLSRQFL 625 (1163)
Q Consensus 546 ~~~~~~~~~~~Rydrq~~l~G~~~q~kL~~~kVlvVGaGglGce~lknLa~~Gv~~~~~g~i~ivD~D~Ie~SNLnRQfL 625 (1163)
+++++++|.++|||.|+++||...|+||.++++|+|||||||||+|||||+|||+||..|+|+|+|||.||.||||||||
T Consensus 401 ~~e~d~~prgsRYD~qiavfG~~fqeKL~~~~~FlVGaGAIGCE~LKN~am~Gvg~g~~g~ItVTDmD~IEkSNLnRQFL 480 (1013)
T KOG2012|consen 401 PSEEDCQPRGSRYDGQIAVFGAKFQEKLADQKVFLVGAGAIGCELLKNFALMGVGCGNSGKITVTDMDHIEKSNLNRQFL 480 (1013)
T ss_pred CCHHHcccccCccccchhhhchHHHHHHhhCcEEEEccchhhHHHHHhhhheeeccCCCCceEEeccchhhhccccceee
Confidence 88899999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred cccCcccchHHHHHHHHHHhhCCCCeEEEEeccCCcccccccchhhhccCCEEEEccCchHHHHHHHhhcccccccEEec
Q 001074 626 FRDWNIGQAKSTVAASAATSINPRLNIEALQNRVGPETENVFDDTFWENITCVINALDNVNARLYVDQRCLYFQKPLLES 705 (1163)
Q Consensus 626 f~~~dIG~~Ka~vaa~~l~~~np~~~I~~~~~~v~~~~e~~~~~~f~~~~DvVi~alDn~~aR~~v~~~c~~~~~PlI~s 705 (1163)
||.+|||++||++||++++.|||+++|+++.++++++||++|+|+||++.|+|+|||||++||+|++++|+.+.|||++|
T Consensus 481 FR~~dVgk~KSe~AA~A~~~mNp~l~I~a~~~rvgpeTE~If~D~Ff~~ld~VanALDNVdAR~YvD~RCv~~~kPLLES 560 (1013)
T KOG2012|consen 481 FRPWDVGKPKSEVAAAAARGMNPDLNIIALQNRVGPETEHIFNDEFFENLDGVANALDNVDARRYVDRRCVYYRKPLLES 560 (1013)
T ss_pred ccccccCchHHHHHHHHHHhcCCCceeeehhhccCcccccccchhHHhhhHHHHHhhcchhhhhhhhhhhhhhccchhhc
Confidence 99999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred CCCCcccceEEEeCCcccccCCCCCCCCCCCCCccccCCCCChhhHHHHHHHHhhhhccCChhhhhhccCCchhhhhhhh
Q 001074 706 GTLGAKCNTQMVIPHLTENYGASRDPPEKQAPMCTVHSFPHNIDHCLTWARSEFEGLLEKTPAEVNAYLSNPVEYTTSMA 785 (1163)
Q Consensus 706 gt~G~~G~v~viip~~t~~y~~~~dp~~~~~p~Ct~~~fP~~~~Hci~wAr~~F~~lF~~~~~~~n~~l~~~~~~~~~~~ 785 (1163)
||+|++|++||++|++||+|++++|||||++|+||+++||+.|||||+|||+.||++|.++++++|+||++|..+...++
T Consensus 561 GTlGTKGntQVvvPhlTEsY~SS~DPPEksiP~CTlknFPn~IeHTiqWAR~eFEg~F~~~~e~vN~yls~p~f~e~sl~ 640 (1013)
T KOG2012|consen 561 GTLGTKGNTQVVVPHLTESYGSSRDPPEKSIPVCTLKSFPNAIEHTIQWARDEFEGLFKQSAENVNKYLSDPVFYETSLK 640 (1013)
T ss_pred cCcCCccceeEEeccccccccccCCCcccCCceeeeccCchHHHHHHHHHHHHHHHHhhCCHHHHHHHhcCchHHHHHHh
Confidence 99999999999999999999999999999999999999999999999999999999999999999999999998888888
Q ss_pred hcCchhHHHHHHHHHHHhhhhcccchHHHHHHHHHHHHHHHHHHHHHHhhcCCccccccCCCCCccCCCCCCCccccCCC
Q 001074 786 NAGDAQARDNLERVLECLDKEKCEIFQDCITWARLKFEDYFSNRVKQLIFTFPEDAATSTGAPFWSAPKRFPHPLQFSSA 865 (1163)
Q Consensus 786 ~~~~~~~~~~l~~~~~~l~~~~~~~~~dci~~a~~~f~~~F~~~I~~Ll~~~p~d~~t~~g~~fWs~~kr~P~pl~fd~~ 865 (1163)
..++++.++.|+++.+.|. .+|.+|+||++|||..|+++|+++|+|||++||+|++|++|+||||||||+|+||+||.+
T Consensus 641 ~~~~~~~~~~l~~v~~~l~-~rp~~~~dCv~warl~f~~~f~~~ikqLl~~FP~d~~t~~G~pFWs~pKr~P~pl~Fd~n 719 (1013)
T KOG2012|consen 641 LIGEPQSLETLERVVDCLS-ERPQNWQDCVEWARLHFEKYFHNRIKQLLHNFPPDAKTSDGAPFWSGPKRCPRPLEFDVN 719 (1013)
T ss_pred hccCcchhHHHHHHHHHhh-cCCccHHHHHHHHHHHHHHHhhHHHHHhhcCCCcccccCCCCcCCCCCCCCCCceeecCC
Confidence 8999999999999999998 999999999999999999999999999999999999999999999999999999999999
Q ss_pred CCcchhHHHHHHHHHHHHcCCCCCCCCCChHHHHHHhhhcCCCCcCCCCCcceecccccccccccCcCcHHHHHHHHHHH
Q 001074 866 DPSHLHFVMAASILRAETFGIPIPDWTNNPKMLAEAVDKVMVPDFLPKKDAKILTDEKATTLSTASVDDAAVINDLIIKL 945 (1163)
Q Consensus 866 ~~~h~~fi~~~a~l~a~~~~i~~~~~~~~~~~~~~~~~~~~~~~f~~~~~~~i~~~e~~~~~~~~~~~~~~~~~~l~~~l 945 (1163)
|++|+.||++||+|||++|||+.. .+.+.++.++..+++|+|+|+++++|.+++.+....+++.|+.+.|++|...+
T Consensus 720 ~~~hl~fv~Aaa~l~a~~~gi~~~---~d~~~~~~~~~~v~~p~f~P~~~~~i~~~~~~~~~~~~s~d~~~~i~~l~~~l 796 (1013)
T KOG2012|consen 720 DPLHLNFVQAAANLRAEVYGIPGS---QDREALAELLERVIVPEFEPKQKVKIVVEEAELAASSASVDDSAAIDQLNKAL 796 (1013)
T ss_pred CchhHHHHHHHHHHHHHhcCCCcc---cCHHHhhhhHhhcCCCccccccCCeecccccccccccccCCchHHHHHHhhcc
Confidence 999999999999999999999984 56678999999999999999999999999988887778889999999999999
Q ss_pred HHhhhcCCCCCCcCCceeeccCCCCchhHHHHHHhhhhhhccCCCCccHHHHHHHhCcccchhhhhHHHHHHHHHHHHHH
Q 001074 946 EQCRKNLPSGFRLKPIQFEKDDDTNYHMDMIAGLANMRARNYSIPEVDKLKAKFIAGRIIPAIATSTAMATGLVCLELYK 1025 (1163)
Q Consensus 946 ~~~~~~~~~~~~~~p~~FeKDDd~n~hidFi~aasNlRa~ny~I~~~~~~~~k~iAG~IIPAIaTTtA~vaGl~~lEl~K 1025 (1163)
..+.. ..+++|.|+.||||||+|+|||||+|||||||+||+||++||+++|+|||+||||||||||+|+||+||||||
T Consensus 797 ~~~~~--~~~~~~~p~~FEKDDDsN~H~dfi~aasnlRA~nY~I~~adr~k~K~IaGkIIPAIATtTa~v~Glv~LElyK 874 (1013)
T KOG2012|consen 797 PSPSV--LPSFKMKPLDFEKDDDSNFHMDFITAASNLRAQNYSIPPADRLKTKRIAGKIIPAIATTTAAVSGLVCLELYK 874 (1013)
T ss_pred ccccc--CCCCceeeeeeccccccccchHHHHHHhhhhhhccCCCccchhhhheeeeeEEEEEeehhHHHHHHHHhhhhh
Confidence 88766 4458999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred HhcCCCCcccccccccccccCcccccCCCCCcccc-cCCcceeEEeEEEcCCCCcHHHHHHHHHHc-CCceeeeecCCce
Q 001074 1026 VLDGGHKLEDYRNTFANLALPLFSMAEPVPPKVIK-HRDMSWTVWDRWILKDNPTLRELIQWLKDK-GLNAYSISCGSCL 1103 (1163)
Q Consensus 1026 ~l~~~~~~~~~rn~f~nla~p~~~~~eP~~~~~~~-~~~~~~t~Wd~~~v~~~~TL~eli~~~~~k-~l~~~~I~~g~~l 1103 (1163)
++.|+.+++.|||+|+|||+|+|.++||.++++.. +.+.+||+||||++.+++||++|+++++++ |++++||++|+++
T Consensus 875 v~~G~~~~e~~Kn~flnLAlp~f~~~ep~~~pk~~~~~~~~~tlWdR~~v~g~~tL~~~L~~~~~~~gl~i~mls~G~~l 954 (1013)
T KOG2012|consen 875 VVDGKRPVEAYKNTFLNLALPFFSFAEPLAAPKVQYHNDLSWTLWDRWEVKGEPTLREFLDHLEEQHGLEITMLSQGVSL 954 (1013)
T ss_pred hccCCCchHHhhhhhhcccccceeecccCCCcceeeecccceeeeEEEEecCCCCHHHHHHHHhhhcCceEEEEecccee
Confidence 99998999999999999999999999999977766 456699999999999999999999999988 9999999999999
Q ss_pred eecCCCcchhhcccCcHHHHHHHhhccCCCCceeEEEEEEEeecCCCCccccCeEEEEe
Q 001074 1104 LFNSMFPRHKERMDKKVVDLAREVAKVELPPYRRHLDVVVACEDDEDNDIDIPLISIYF 1162 (1163)
Q Consensus 1104 lY~~~~~~~~~~l~~~l~~l~~~~~~~~~~~~~~~~~l~~~~~d~~~~~~~~P~v~~~~ 1162 (1163)
||++|+|++++||+++++||++.++|+++|+++++|+|+++|+|+||+|+++|+|||+|
T Consensus 955 ly~~~~~k~~erl~~~v~elv~~~~k~~~~~~~~~lvle~~~~d~~~eDve~P~v~y~f 1013 (1013)
T KOG2012|consen 955 LYASFMPKHAERLPLRVTELVRDVTKKKLPPHVRHLVLEVACEDDDDEDVEVPPVRYYF 1013 (1013)
T ss_pred ehhhhhhHHHHhcCCcHHHHHHHHhcccCCCcceEEEEEEecCCCCCCcCCCCceEEeC
Confidence 99999999999999999999999999999999999999999999999999999999986
|
|
| >TIGR01408 Ube1 ubiquitin-activating enzyme E1 | Back alignment and domain information |
|---|
| >cd01490 Ube1_repeat2 Ubiquitin activating enzyme (E1), repeat 2 | Back alignment and domain information |
|---|
| >KOG2013 consensus SMT3/SUMO-activating complex, catalytic component UBA2 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd01489 Uba2_SUMO Ubiquitin activating enzyme (E1) subunit UBA2 | Back alignment and domain information |
|---|
| >cd01491 Ube1_repeat1 Ubiquitin activating enzyme (E1), repeat 1 | Back alignment and domain information |
|---|
| >cd01484 E1-2_like Ubiquitin activating enzyme (E1), repeat 2-like | Back alignment and domain information |
|---|
| >KOG2015 consensus NEDD8-activating complex, catalytic component UBA3 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd01488 Uba3_RUB Ubiquitin activating enzyme (E1) subunit UBA3 | Back alignment and domain information |
|---|
| >cd01493 APPBP1_RUB Ubiquitin activating enzyme (E1) subunit APPBP1 | Back alignment and domain information |
|---|
| >KOG2014 consensus SMT3/SUMO-activating complex, AOS1/RAD31 component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG2016 consensus NEDD8-activating complex, APP-BP1/UBA5 component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd01492 Aos1_SUMO Ubiquitin activating enzyme (E1) subunit Aos1 | Back alignment and domain information |
|---|
| >cd01485 E1-1_like Ubiquitin activating enzyme (E1), repeat 1-like | Back alignment and domain information |
|---|
| >PRK08223 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >TIGR02356 adenyl_thiF thiazole biosynthesis adenylyltransferase ThiF, E | Back alignment and domain information |
|---|
| >cd00757 ThiF_MoeB_HesA_family ThiF_MoeB_HesA | Back alignment and domain information |
|---|
| >PRK05690 molybdopterin biosynthesis protein MoeB; Provisional | Back alignment and domain information |
|---|
| >PRK07411 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK08328 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK05597 molybdopterin biosynthesis protein MoeB; Validated | Back alignment and domain information |
|---|
| >TIGR02355 moeB molybdopterin synthase sulfurylase MoeB | Back alignment and domain information |
|---|
| >cd01492 Aos1_SUMO Ubiquitin activating enzyme (E1) subunit Aos1 | Back alignment and domain information |
|---|
| >cd01493 APPBP1_RUB Ubiquitin activating enzyme (E1) subunit APPBP1 | Back alignment and domain information |
|---|
| >PRK07878 molybdopterin biosynthesis-like protein MoeZ; Validated | Back alignment and domain information |
|---|
| >PRK07878 molybdopterin biosynthesis-like protein MoeZ; Validated | Back alignment and domain information |
|---|
| >cd01491 Ube1_repeat1 Ubiquitin activating enzyme (E1), repeat 1 | Back alignment and domain information |
|---|
| >PRK05600 thiamine biosynthesis protein ThiF; Validated | Back alignment and domain information |
|---|
| >cd01485 E1-1_like Ubiquitin activating enzyme (E1), repeat 1-like | Back alignment and domain information |
|---|
| >cd01489 Uba2_SUMO Ubiquitin activating enzyme (E1) subunit UBA2 | Back alignment and domain information |
|---|
| >PRK12475 thiamine/molybdopterin biosynthesis MoeB-like protein; Provisional | Back alignment and domain information |
|---|
| >PRK05597 molybdopterin biosynthesis protein MoeB; Validated | Back alignment and domain information |
|---|
| >PRK07688 thiamine/molybdopterin biosynthesis ThiF/MoeB-like protein; Validated | Back alignment and domain information |
|---|
| >PRK05600 thiamine biosynthesis protein ThiF; Validated | Back alignment and domain information |
|---|
| >PRK08223 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK05690 molybdopterin biosynthesis protein MoeB; Provisional | Back alignment and domain information |
|---|
| >TIGR03736 PRTRC_ThiF PRTRC system ThiF family protein | Back alignment and domain information |
|---|
| >TIGR02356 adenyl_thiF thiazole biosynthesis adenylyltransferase ThiF, E | Back alignment and domain information |
|---|
| >COG0476 ThiF Dinucleotide-utilizing enzymes involved in molybdopterin and thiamine biosynthesis family 2 [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PRK08762 molybdopterin biosynthesis protein MoeB; Validated | Back alignment and domain information |
|---|
| >cd00757 ThiF_MoeB_HesA_family ThiF_MoeB_HesA | Back alignment and domain information |
|---|
| >PRK07411 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >KOG2017 consensus Molybdopterin synthase sulfurylase [Coenzyme transport and metabolism] | Back alignment and domain information |
|---|
| >cd01488 Uba3_RUB Ubiquitin activating enzyme (E1) subunit UBA3 | Back alignment and domain information |
|---|
| >PF09358 UBA_e1_C: Ubiquitin-activating enzyme e1 C-terminal domain; InterPro: IPR018965 This presumed domain found at the C terminus of Ubiquitin-activating enzyme e1 proteins is functionally uncharacterised | Back alignment and domain information |
|---|
| >PRK08328 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK14851 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR02355 moeB molybdopterin synthase sulfurylase MoeB | Back alignment and domain information |
|---|
| >PRK14852 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK15116 sulfur acceptor protein CsdL; Provisional | Back alignment and domain information |
|---|
| >cd01484 E1-2_like Ubiquitin activating enzyme (E1), repeat 2-like | Back alignment and domain information |
|---|
| >cd00755 YgdL_like Family of activating enzymes (E1) of ubiquitin-like proteins related to the E | Back alignment and domain information |
|---|
| >PRK07688 thiamine/molybdopterin biosynthesis ThiF/MoeB-like protein; Validated | Back alignment and domain information |
|---|
| >PRK12475 thiamine/molybdopterin biosynthesis MoeB-like protein; Provisional | Back alignment and domain information |
|---|
| >PRK08644 thiamine biosynthesis protein ThiF; Provisional | Back alignment and domain information |
|---|
| >PF00899 ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-activating enzyme (E1 enzyme) [, ] activates ubiquitin by first adenylating with ATP its C-terminal glycine residue and thereafter linking this residue to the side chain of a cysteine residue in E1, yielding an ubiquitin-E1 thiolester and free AMP | Back alignment and domain information |
|---|
| >PRK07877 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR01408 Ube1 ubiquitin-activating enzyme E1 | Back alignment and domain information |
|---|
| >TIGR01381 E1_like_apg7 E1-like protein-activating enzyme Gsa7p/Apg7p | Back alignment and domain information |
|---|
| >PRK15116 sulfur acceptor protein CsdL; Provisional | Back alignment and domain information |
|---|
| >COG0476 ThiF Dinucleotide-utilizing enzymes involved in molybdopterin and thiamine biosynthesis family 2 [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >COG1179 Dinucleotide-utilizing enzymes involved in molybdopterin and thiamine biosynthesis family 1 [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PTZ00245 ubiquitin activating enzyme; Provisional | Back alignment and domain information |
|---|
| >KOG2013 consensus SMT3/SUMO-activating complex, catalytic component UBA2 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK14852 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK08762 molybdopterin biosynthesis protein MoeB; Validated | Back alignment and domain information |
|---|
| >cd01490 Ube1_repeat2 Ubiquitin activating enzyme (E1), repeat 2 | Back alignment and domain information |
|---|
| >PRK14851 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG2015 consensus NEDD8-activating complex, catalytic component UBA3 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd01483 E1_enzyme_family Superfamily of activating enzymes (E1) of the ubiquitin-like proteins | Back alignment and domain information |
|---|
| >cd01486 Apg7 Apg7 is an E1-like protein, that activates two different ubiquitin-like proteins, Apg12 and Apg8, and assigns them to specific E2 enzymes, Apg10 and Apg3, respectively | Back alignment and domain information |
|---|
| >PF00899 ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-activating enzyme (E1 enzyme) [, ] activates ubiquitin by first adenylating with ATP its C-terminal glycine residue and thereafter linking this residue to the side chain of a cysteine residue in E1, yielding an ubiquitin-E1 thiolester and free AMP | Back alignment and domain information |
|---|
| >TIGR03603 cyclo_dehy_ocin bacteriocin biosynthesis cyclodehydratase, SagC family | Back alignment and domain information |
|---|
| >cd01487 E1_ThiF_like E1_ThiF_like | Back alignment and domain information |
|---|
| >PRK08644 thiamine biosynthesis protein ThiF; Provisional | Back alignment and domain information |
|---|
| >cd00755 YgdL_like Family of activating enzymes (E1) of ubiquitin-like proteins related to the E | Back alignment and domain information |
|---|
| >cd01483 E1_enzyme_family Superfamily of activating enzymes (E1) of the ubiquitin-like proteins | Back alignment and domain information |
|---|
| >KOG2017 consensus Molybdopterin synthase sulfurylase [Coenzyme transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR02354 thiF_fam2 thiamine biosynthesis protein ThiF, family 2 | Back alignment and domain information |
|---|
| >PTZ00245 ubiquitin activating enzyme; Provisional | Back alignment and domain information |
|---|
| >COG1179 Dinucleotide-utilizing enzymes involved in molybdopterin and thiamine biosynthesis family 1 [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PRK07877 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK06153 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >cd01486 Apg7 Apg7 is an E1-like protein, that activates two different ubiquitin-like proteins, Apg12 and Apg8, and assigns them to specific E2 enzymes, Apg10 and Apg3, respectively | Back alignment and domain information |
|---|
| >TIGR02354 thiF_fam2 thiamine biosynthesis protein ThiF, family 2 | Back alignment and domain information |
|---|
| >cd01487 E1_ThiF_like E1_ThiF_like | Back alignment and domain information |
|---|
| >KOG2336 consensus Molybdopterin biosynthesis-related protein [Coenzyme transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR01381 E1_like_apg7 E1-like protein-activating enzyme Gsa7p/Apg7p | Back alignment and domain information |
|---|
| >TIGR03603 cyclo_dehy_ocin bacteriocin biosynthesis cyclodehydratase, SagC family | Back alignment and domain information |
|---|
| >KOG2014 consensus SMT3/SUMO-activating complex, AOS1/RAD31 component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG2016 consensus NEDD8-activating complex, APP-BP1/UBA5 component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF02134 UBACT: Repeat in ubiquitin-activating (UBA) protein; InterPro: IPR000127 The post-translational attachment of ubiquitin (IPR000626 from INTERPRO) to proteins (ubiquitinylation) alters the function, location or trafficking of a protein, or targets it to the 26S proteasome for degradation [, , ] | Back alignment and domain information |
|---|
| >KOG2018 consensus Predicted dinucleotide-utilizing enzyme involved in molybdopterin and thiamine biosynthesis [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG2012 consensus Ubiquitin activating enzyme UBA1 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK06153 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR03736 PRTRC_ThiF PRTRC system ThiF family protein | Back alignment and domain information |
|---|
| >KOG2018 consensus Predicted dinucleotide-utilizing enzyme involved in molybdopterin and thiamine biosynthesis [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG2336 consensus Molybdopterin biosynthesis-related protein [Coenzyme transport and metabolism] | Back alignment and domain information |
|---|
| >PF10585 UBA_e1_thiolCys: Ubiquitin-activating enzyme active site ; InterPro: IPR019572 Ubiquitin-activating enzyme (E1 enzyme) activates ubiquitin by first adenylating with ATP its C-terminal glycine residue and thereafter linking this residue to the side chain of a cysteine residue in E1, yielding an ubiquitin-E1 thiolester and free AMP | Back alignment and domain information |
|---|
| >KOG2337 consensus Ubiquitin activating E1 enzyme-like protein [Coenzyme transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR03693 ocin_ThiF_like putative thiazole-containing bacteriocin maturation protein | Back alignment and domain information |
|---|
| >KOG2337 consensus Ubiquitin activating E1 enzyme-like protein [Coenzyme transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR03693 ocin_ThiF_like putative thiazole-containing bacteriocin maturation protein | Back alignment and domain information |
|---|
| >PF02134 UBACT: Repeat in ubiquitin-activating (UBA) protein; InterPro: IPR000127 The post-translational attachment of ubiquitin (IPR000626 from INTERPRO) to proteins (ubiquitinylation) alters the function, location or trafficking of a protein, or targets it to the 26S proteasome for degradation [, , ] | Back alignment and domain information |
|---|
| >COG4015 Predicted dinucleotide-utilizing enzyme of the ThiF/HesA family [General function prediction only] | Back alignment and domain information |
|---|
| >PRK06718 precorrin-2 dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >TIGR01470 cysG_Nterm siroheme synthase, N-terminal domain | Back alignment and domain information |
|---|
| >PF08825 E2_bind: E2 binding domain; InterPro: IPR014929 E1 and E2 enzymes play a central role in ubiquitin and ubiquitin-like protein transfer cascades | Back alignment and domain information |
|---|
| >PF01488 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; InterPro: IPR006151 This entry represents a domain found in shikimate and quinate dehydrogenases, as well as glutamyl-tRNA reductases | Back alignment and domain information |
|---|
| >COG1748 LYS9 Saccharopine dehydrogenase and related proteins [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK06719 precorrin-2 dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK12549 shikimate 5-dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PF13241 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_B 1PJT_A 1PJS_A 1PJQ_A 1KYQ_B | Back alignment and domain information |
|---|
| >PRK12549 shikimate 5-dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PF01488 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; InterPro: IPR006151 This entry represents a domain found in shikimate and quinate dehydrogenases, as well as glutamyl-tRNA reductases | Back alignment and domain information |
|---|
| >PRK05562 precorrin-2 dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06718 precorrin-2 dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >COG1748 LYS9 Saccharopine dehydrogenase and related proteins [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >COG4015 Predicted dinucleotide-utilizing enzyme of the ThiF/HesA family [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR03882 cyclo_dehyd_2 bacteriocin biosynthesis cyclodehydratase domain | Back alignment and domain information |
|---|
| >PRK06719 precorrin-2 dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PF13241 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_B 1PJT_A 1PJS_A 1PJQ_A 1KYQ_B | Back alignment and domain information |
|---|
| >TIGR01470 cysG_Nterm siroheme synthase, N-terminal domain | Back alignment and domain information |
|---|
| >PF03435 Saccharop_dh: Saccharopine dehydrogenase ; InterPro: IPR005097 This entry represents saccharopine dehydrogenase and homospermidine synthase | Back alignment and domain information |
|---|
| >PRK10637 cysG siroheme synthase; Provisional | Back alignment and domain information |
|---|
| >PRK05562 precorrin-2 dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >COG1648 CysG Siroheme synthase (precorrin-2 oxidase/ferrochelatase domain) [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PRK14027 quinate/shikimate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK14027 quinate/shikimate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK12548 shikimate 5-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PF00056 Ldh_1_N: lactate/malate dehydrogenase, NAD binding domain Prosite entry for lactate dehydrogenase Prosite entry for malate dehydrogenase; InterPro: IPR001236 L-lactate dehydrogenases are metabolic enzymes which catalyse the conversion of L-lactate to pyruvate, the last step in anaerobic glycolysis [] | Back alignment and domain information |
|---|
| >PRK07819 3-hydroxybutyryl-CoA dehydrogenase; Validated | Back alignment and domain information |
|---|
| >COG0373 HemA Glutamyl-tRNA reductase [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >TIGR01809 Shik-DH-AROM shikimate-5-dehydrogenase, fungal AROM-type | Back alignment and domain information |
|---|
| >PRK14106 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional | Back alignment and domain information |
|---|
| >TIGR01809 Shik-DH-AROM shikimate-5-dehydrogenase, fungal AROM-type | Back alignment and domain information |
|---|
| >PRK00258 aroE shikimate 5-dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >KOG4169 consensus 15-hydroxyprostaglandin dehydrogenase and related dehydrogenases [Lipid transport and metabolism; General function prediction only] | Back alignment and domain information |
|---|
| >PRK14106 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional | Back alignment and domain information |
|---|
| >PRK00258 aroE shikimate 5-dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PRK07066 3-hydroxybutyryl-CoA dehydrogenase; Validated | Back alignment and domain information |
|---|
| >cd01065 NAD_bind_Shikimate_DH NAD(P) binding domain of Shikimate dehydrogenase | Back alignment and domain information |
|---|
| >COG0169 AroE Shikimate 5-dehydrogenase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK12548 shikimate 5-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PF03446 NAD_binding_2: NAD binding domain of 6-phosphogluconate dehydrogenase; InterPro: IPR006115 6-Phosphogluconate dehydrogenase (1 | Back alignment and domain information |
|---|
| >cd05291 HicDH_like L-2-hydroxyisocapronate dehydrogenases and some bacterial L-lactate dehydrogenases | Back alignment and domain information |
|---|
| >PF05237 MoeZ_MoeB: MoeZ/MoeB domain; InterPro: IPR007901 This putative domain is found in the MoeZ protein and the MoeB protein | Back alignment and domain information |
|---|
| >PRK13940 glutamyl-tRNA reductase; Provisional | Back alignment and domain information |
|---|
| >PF01113 DapB_N: Dihydrodipicolinate reductase, N-terminus; InterPro: IPR000846 Dihydrodipicolinate reductase catalyzes the second step in the biosynthesis of diaminopimelic acid and lysine, the NAD or NADP-dependent reduction of 2,3-dihydrodipicolinate into 2,3,4,5-tetrahydrodipicolinate [, , ] | Back alignment and domain information |
|---|
| >PF02826 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain; InterPro: IPR006140 A number of NAD-dependent 2-hydroxyacid dehydrogenases which seem to be specific for the D-isomer of their substrate have been shown to be functionally and structurally related | Back alignment and domain information |
|---|
| >PF03435 Saccharop_dh: Saccharopine dehydrogenase ; InterPro: IPR005097 This entry represents saccharopine dehydrogenase and homospermidine synthase | Back alignment and domain information |
|---|
| >COG1648 CysG Siroheme synthase (precorrin-2 oxidase/ferrochelatase domain) [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >TIGR03882 cyclo_dehyd_2 bacteriocin biosynthesis cyclodehydratase domain | Back alignment and domain information |
|---|
| >PRK05808 3-hydroxybutyryl-CoA dehydrogenase; Validated | Back alignment and domain information |
|---|
| >COG0373 HemA Glutamyl-tRNA reductase [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PF00070 Pyr_redox: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR001327 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] | Back alignment and domain information |
|---|
| >PRK13940 glutamyl-tRNA reductase; Provisional | Back alignment and domain information |
|---|
| >PRK12749 quinate/shikimate dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PF02737 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain; InterPro: IPR006176 3-hydroxyacyl-CoA dehydrogenase (1 | Back alignment and domain information |
|---|
| >PRK09260 3-hydroxybutyryl-CoA dehydrogenase; Validated | Back alignment and domain information |
|---|
| >COG0169 AroE Shikimate 5-dehydrogenase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK10637 cysG siroheme synthase; Provisional | Back alignment and domain information |
|---|
| >PRK04148 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK12749 quinate/shikimate dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PRK06130 3-hydroxybutyryl-CoA dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PLN00203 glutamyl-tRNA reductase | Back alignment and domain information |
|---|
| >COG0569 TrkA K+ transport systems, NAD-binding component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PF14732 UAE_UbL: Ubiquitin/SUMO-activating enzyme ubiquitin-like domain; PDB: 1Y8Q_B 1Y8R_E 3KYD_B 3KYC_B | Back alignment and domain information |
|---|
| >cd00300 LDH_like L-lactate dehydrogenase-like enzymes | Back alignment and domain information |
|---|
| >PRK08293 3-hydroxybutyryl-CoA dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK00066 ldh L-lactate dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >cd01065 NAD_bind_Shikimate_DH NAD(P) binding domain of Shikimate dehydrogenase | Back alignment and domain information |
|---|
| >PRK05476 S-adenosyl-L-homocysteine hydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK05708 2-dehydropantoate 2-reductase; Provisional | Back alignment and domain information |
|---|
| >cd01080 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of methylene-tetrahydrofolate dehydrogenase/cyclohydrolase | Back alignment and domain information |
|---|
| >cd05213 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain of glutamyl-tRNA reductase | Back alignment and domain information |
|---|
| >PF02254 TrkA_N: TrkA-N domain; InterPro: IPR003148 The regulator of K+ conductance (RCK) domain is found in many ligand-gated K+ channels, most often attached to the intracellular carboxy terminus | Back alignment and domain information |
|---|
| >TIGR01035 hemA glutamyl-tRNA reductase | Back alignment and domain information |
|---|
| >cd05311 NAD_bind_2_malic_enz NAD(P) binding domain of malic enzyme (ME), subgroup 2 | Back alignment and domain information |
|---|
| >KOG4169 consensus 15-hydroxyprostaglandin dehydrogenase and related dehydrogenases [Lipid transport and metabolism; General function prediction only] | Back alignment and domain information |
|---|
| >PLN00203 glutamyl-tRNA reductase | Back alignment and domain information |
|---|
| >cd05291 HicDH_like L-2-hydroxyisocapronate dehydrogenases and some bacterial L-lactate dehydrogenases | Back alignment and domain information |
|---|
| >PLN02602 lactate dehydrogenase | Back alignment and domain information |
|---|
| >COG0569 TrkA K+ transport systems, NAD-binding component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >cd05290 LDH_3 A subgroup of L-lactate dehydrogenases | Back alignment and domain information |
|---|
| >PF03446 NAD_binding_2: NAD binding domain of 6-phosphogluconate dehydrogenase; InterPro: IPR006115 6-Phosphogluconate dehydrogenase (1 | Back alignment and domain information |
|---|
| >cd05293 LDH_1 A subgroup of L-lactate dehydrogenases | Back alignment and domain information |
|---|
| >PRK04148 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >COG0111 SerA Phosphoglycerate dehydrogenase and related dehydrogenases [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >cd05311 NAD_bind_2_malic_enz NAD(P) binding domain of malic enzyme (ME), subgroup 2 | Back alignment and domain information |
|---|
| >PRK08618 ornithine cyclodeaminase; Validated | Back alignment and domain information |
|---|
| >PF10585 UBA_e1_thiolCys: Ubiquitin-activating enzyme active site ; InterPro: IPR019572 Ubiquitin-activating enzyme (E1 enzyme) activates ubiquitin by first adenylating with ATP its C-terminal glycine residue and thereafter linking this residue to the side chain of a cysteine residue in E1, yielding an ubiquitin-E1 thiolester and free AMP | Back alignment and domain information |
|---|
| >cd00401 AdoHcyase S-adenosyl-L-homocysteine hydrolase (AdoHycase) catalyzes the hydrolysis of S-adenosyl-L-homocysteine (AdoHyc) to form adenosine (Ado) and homocysteine (Hcy) | Back alignment and domain information |
|---|
| >PLN02819 lysine-ketoglutarate reductase/saccharopine dehydrogenase | Back alignment and domain information |
|---|
| >PF00670 AdoHcyase_NAD: S-adenosyl-L-homocysteine hydrolase, NAD binding domain; InterPro: IPR015878 S-adenosyl-L-homocysteine hydrolase (3 | Back alignment and domain information |
|---|
| >PTZ00117 malate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >cd05213 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain of glutamyl-tRNA reductase | Back alignment and domain information |
|---|
| >cd01078 NAD_bind_H4MPT_DH NADP binding domain of methylene tetrahydromethanopterin dehydrogenase | Back alignment and domain information |
|---|
| >PRK07063 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07819 3-hydroxybutyryl-CoA dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK08410 2-hydroxyacid dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK14192 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK06197 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK15469 ghrA bifunctional glyoxylate/hydroxypyruvate reductase A; Provisional | Back alignment and domain information |
|---|
| >PRK09599 6-phosphogluconate dehydrogenase-like protein; Reviewed | Back alignment and domain information |
|---|
| >cd01078 NAD_bind_H4MPT_DH NADP binding domain of methylene tetrahydromethanopterin dehydrogenase | Back alignment and domain information |
|---|
| >TIGR00936 ahcY adenosylhomocysteinase | Back alignment and domain information |
|---|
| >PRK00066 ldh L-lactate dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PRK06487 glycerate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK01710 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional | Back alignment and domain information |
|---|
| >PRK00141 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional | Back alignment and domain information |
|---|
| >PRK13243 glyoxylate reductase; Reviewed | Back alignment and domain information |
|---|
| >cd01075 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase | Back alignment and domain information |
|---|
| >PRK01438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional | Back alignment and domain information |
|---|
| >PRK07574 formate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PF03807 F420_oxidored: NADP oxidoreductase coenzyme F420-dependent; InterPro: IPR004455 The function of F420-dependent NADP reductase is the transfer of electrons from reduced coenzyme F420 into an electron transport chain | Back alignment and domain information |
|---|
| >cd05290 LDH_3 A subgroup of L-lactate dehydrogenases | Back alignment and domain information |
|---|
| >PTZ00082 L-lactate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR00507 aroE shikimate 5-dehydrogenase | Back alignment and domain information |
|---|
| >PRK05808 3-hydroxybutyryl-CoA dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK06932 glycerate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PLN02545 3-hydroxybutyryl-CoA dehydrogenase | Back alignment and domain information |
|---|
| >PRK07530 3-hydroxybutyryl-CoA dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK00045 hemA glutamyl-tRNA reductase; Reviewed | Back alignment and domain information |
|---|
| >PRK05854 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06129 3-hydroxyacyl-CoA dehydrogenase; Validated | Back alignment and domain information |
|---|
| >TIGR02992 ectoine_eutC ectoine utilization protein EutC | Back alignment and domain information |
|---|
| >PRK15438 erythronate-4-phosphate dehydrogenase PdxB; Provisional | Back alignment and domain information |
|---|
| >cd01080 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of methylene-tetrahydrofolate dehydrogenase/cyclohydrolase | Back alignment and domain information |
|---|
| >PF00056 Ldh_1_N: lactate/malate dehydrogenase, NAD binding domain Prosite entry for lactate dehydrogenase Prosite entry for malate dehydrogenase; InterPro: IPR001236 L-lactate dehydrogenases are metabolic enzymes which catalyse the conversion of L-lactate to pyruvate, the last step in anaerobic glycolysis [] | Back alignment and domain information |
|---|
| >PRK07531 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioesterase; Validated | Back alignment and domain information |
|---|
| >PLN03139 formate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06130 3-hydroxybutyryl-CoA dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PF02737 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain; InterPro: IPR006176 3-hydroxyacyl-CoA dehydrogenase (1 | Back alignment and domain information |
|---|
| >PF00070 Pyr_redox: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR001327 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] | Back alignment and domain information |
|---|
| >PRK06436 glycerate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06197 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR00507 aroE shikimate 5-dehydrogenase | Back alignment and domain information |
|---|
| >PRK07066 3-hydroxybutyryl-CoA dehydrogenase; Validated | Back alignment and domain information |
|---|
| >TIGR01759 MalateDH-SF1 malate dehydrogenase | Back alignment and domain information |
|---|
| >PRK14619 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >COG1086 Predicted nucleoside-diphosphate sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PRK09242 tropinone reductase; Provisional | Back alignment and domain information |
|---|
| >PRK00048 dihydrodipicolinate reductase; Provisional | Back alignment and domain information |
|---|
| >PRK00257 erythronate-4-phosphate dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK11880 pyrroline-5-carboxylate reductase; Reviewed | Back alignment and domain information |
|---|
| >PF01210 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus; InterPro: IPR011128 NAD-dependent glycerol-3-phosphate dehydrogenase (GPDH) catalyses the interconversion of dihydroxyacetone phosphate and L-glycerol-3-phosphate | Back alignment and domain information |
|---|
| >PRK09496 trkA potassium transporter peripheral membrane component; Reviewed | Back alignment and domain information |
|---|
| >PF01118 Semialdhyde_dh: Semialdehyde dehydrogenase, NAD binding domain; InterPro: IPR000534 The semialdehyde dehydrogenase family is found in N-acetyl-glutamine semialdehyde dehydrogenase (AgrC), which is involved in arginine biosynthesis, and aspartate-semialdehyde dehydrogenase [], an enzyme involved in the biosynthesis of various amino acids from aspartate | Back alignment and domain information |
|---|
| >PRK07831 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >COG0300 DltE Short-chain dehydrogenases of various substrate specificities [General function prediction only] | Back alignment and domain information |
|---|
| >PTZ00325 malate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07530 3-hydroxybutyryl-CoA dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK07634 pyrroline-5-carboxylate reductase; Reviewed | Back alignment and domain information |
|---|
| >PLN03209 translocon at the inner envelope of chloroplast subunit 62; Provisional | Back alignment and domain information |
|---|
| >PF02558 ApbA: Ketopantoate reductase PanE/ApbA; InterPro: IPR013332 ApbA, the ketopantoate reductase enzyme 1 | Back alignment and domain information |
|---|
| >PRK06141 ornithine cyclodeaminase; Validated | Back alignment and domain information |
|---|
| >PRK12480 D-lactate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK03659 glutathione-regulated potassium-efflux system protein KefB; Provisional | Back alignment and domain information |
|---|
| >PRK07062 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK03562 glutathione-regulated potassium-efflux system protein KefC; Provisional | Back alignment and domain information |
|---|
| >PF02254 TrkA_N: TrkA-N domain; InterPro: IPR003148 The regulator of K+ conductance (RCK) domain is found in many ligand-gated K+ channels, most often attached to the intracellular carboxy terminus | Back alignment and domain information |
|---|
| >cd05191 NAD_bind_amino_acid_DH NAD(P) binding domain of amino acid dehydrogenase-like proteins | Back alignment and domain information |
|---|
| >PRK14175 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK07417 arogenate dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PLN02494 adenosylhomocysteinase | Back alignment and domain information |
|---|
| >PRK07502 cyclohexadienyl dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK06522 2-dehydropantoate 2-reductase; Reviewed | Back alignment and domain information |
|---|
| >TIGR00872 gnd_rel 6-phosphogluconate dehydrogenase (decarboxylating) | Back alignment and domain information |
|---|
| >PRK02705 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional | Back alignment and domain information |
|---|
| >PRK07340 ornithine cyclodeaminase; Validated | Back alignment and domain information |
|---|
| >COG0771 MurD UDP-N-acetylmuramoylalanine-D-glutamate ligase [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >PLN02545 3-hydroxybutyryl-CoA dehydrogenase | Back alignment and domain information |
|---|
| >cd05293 LDH_1 A subgroup of L-lactate dehydrogenases | Back alignment and domain information |
|---|
| >PRK12490 6-phosphogluconate dehydrogenase-like protein; Reviewed | Back alignment and domain information |
|---|
| >TIGR00872 gnd_rel 6-phosphogluconate dehydrogenase (decarboxylating) | Back alignment and domain information |
|---|
| >COG0039 Mdh Malate/lactate dehydrogenases [Energy production and conversion] | Back alignment and domain information |
|---|
| >cd05191 NAD_bind_amino_acid_DH NAD(P) binding domain of amino acid dehydrogenase-like proteins | Back alignment and domain information |
|---|
| >PF03807 F420_oxidored: NADP oxidoreductase coenzyme F420-dependent; InterPro: IPR004455 The function of F420-dependent NADP reductase is the transfer of electrons from reduced coenzyme F420 into an electron transport chain | Back alignment and domain information |
|---|
| >PLN02206 UDP-glucuronate decarboxylase | Back alignment and domain information |
|---|
| >PRK07576 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08251 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PLN02928 oxidoreductase family protein | Back alignment and domain information |
|---|
| >PRK06141 ornithine cyclodeaminase; Validated | Back alignment and domain information |
|---|
| >PRK05479 ketol-acid reductoisomerase; Provisional | Back alignment and domain information |
|---|
| >PRK11154 fadJ multifunctional fatty acid oxidation complex subunit alpha; Reviewed | Back alignment and domain information |
|---|
| >PRK12826 3-ketoacyl-(acyl-carrier-protein) reductase; Reviewed | Back alignment and domain information |
|---|
| >PRK08339 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PLN02350 phosphogluconate dehydrogenase (decarboxylating) | Back alignment and domain information |
|---|
| >PRK05867 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07340 ornithine cyclodeaminase; Validated | Back alignment and domain information |
|---|
| >PRK00094 gpsA NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK06035 3-hydroxyacyl-CoA dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK07231 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK10537 voltage-gated potassium channel; Provisional | Back alignment and domain information |
|---|
| >PRK08618 ornithine cyclodeaminase; Validated | Back alignment and domain information |
|---|
| >PLN02819 lysine-ketoglutarate reductase/saccharopine dehydrogenase | Back alignment and domain information |
|---|
| >PF01113 DapB_N: Dihydrodipicolinate reductase, N-terminus; InterPro: IPR000846 Dihydrodipicolinate reductase catalyzes the second step in the biosynthesis of diaminopimelic acid and lysine, the NAD or NADP-dependent reduction of 2,3-dihydrodipicolinate into 2,3,4,5-tetrahydrodipicolinate [, , ] | Back alignment and domain information |
|---|
| >PRK07523 gluconate 5-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK04308 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional | Back alignment and domain information |
|---|
| >PF13460 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X_A 3GPI_A 3QVO_A 2Q46_B 1YBM_B 1XQ6_B 2Q4B_B 3EW7_A 3IUS_B | Back alignment and domain information |
|---|
| >PRK09186 flagellin modification protein A; Provisional | Back alignment and domain information |
|---|
| >PLN02602 lactate dehydrogenase | Back alignment and domain information |
|---|
| >PRK11790 D-3-phosphoglycerate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PLN02206 UDP-glucuronate decarboxylase | Back alignment and domain information |
|---|
| >PRK06223 malate dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PLN02306 hydroxypyruvate reductase | Back alignment and domain information |
|---|
| >COG1893 ApbA Ketopantoate reductase [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PRK06249 2-dehydropantoate 2-reductase; Provisional | Back alignment and domain information |
|---|
| >PRK11908 NAD-dependent epimerase/dehydratase family protein; Provisional | Back alignment and domain information |
|---|
| >PF02826 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain; InterPro: IPR006140 A number of NAD-dependent 2-hydroxyacid dehydrogenases which seem to be specific for the D-isomer of their substrate have been shown to be functionally and structurally related | Back alignment and domain information |
|---|
| >PRK07680 late competence protein ComER; Validated | Back alignment and domain information |
|---|
| >cd01338 MDH_choloroplast_like Chloroplast-like malate dehydrogenases | Back alignment and domain information |
|---|
| >PRK02006 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional | Back alignment and domain information |
|---|
| >PRK08293 3-hydroxybutyryl-CoA dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK08217 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >cd01075 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase | Back alignment and domain information |
|---|
| >PRK09242 tropinone reductase; Provisional | Back alignment and domain information |
|---|
| >PRK05854 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07478 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07502 cyclohexadienyl dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK04690 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional | Back alignment and domain information |
|---|
| >cd01339 LDH-like_MDH L-lactate dehydrogenase-like malate dehydrogenase proteins | Back alignment and domain information |
|---|
| >PRK07417 arogenate dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >cd05292 LDH_2 A subgroup of L-lactate dehydrogenases | Back alignment and domain information |
|---|
| >PRK09599 6-phosphogluconate dehydrogenase-like protein; Reviewed | Back alignment and domain information |
|---|
| >PRK07679 pyrroline-5-carboxylate reductase; Reviewed | Back alignment and domain information |
|---|
| >PRK15409 bifunctional glyoxylate/hydroxypyruvate reductase B; Provisional | Back alignment and domain information |
|---|
| >TIGR00465 ilvC ketol-acid reductoisomerase | Back alignment and domain information |
|---|
| >PRK11730 fadB multifunctional fatty acid oxidation complex subunit alpha; Reviewed | Back alignment and domain information |
|---|
| >PRK06545 prephenate dehydrogenase; Validated | Back alignment and domain information |
|---|
| >cd00300 LDH_like L-lactate dehydrogenase-like enzymes | Back alignment and domain information |
|---|
| >PRK12921 2-dehydropantoate 2-reductase; Provisional | Back alignment and domain information |
|---|
| >PRK14618 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR01915 npdG NADPH-dependent F420 reductase | Back alignment and domain information |
|---|
| >PRK03562 glutathione-regulated potassium-efflux system protein KefC; Provisional | Back alignment and domain information |
|---|
| >TIGR02992 ectoine_eutC ectoine utilization protein EutC | Back alignment and domain information |
|---|
| >PRK05479 ketol-acid reductoisomerase; Provisional | Back alignment and domain information |
|---|
| >PRK07531 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioesterase; Validated | Back alignment and domain information |
|---|
| >PRK04663 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional | Back alignment and domain information |
|---|
| >PLN02780 ketoreductase/ oxidoreductase | Back alignment and domain information |
|---|
| >cd00401 AdoHcyase S-adenosyl-L-homocysteine hydrolase (AdoHycase) catalyzes the hydrolysis of S-adenosyl-L-homocysteine (AdoHyc) to form adenosine (Ado) and homocysteine (Hcy) | Back alignment and domain information |
|---|
| >PRK06523 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK05866 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PTZ00142 6-phosphogluconate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK05335 tRNA (uracil-5-)-methyltransferase Gid; Reviewed | Back alignment and domain information |
|---|
| >TIGR01757 Malate-DH_plant malate dehydrogenase, NADP-dependent | Back alignment and domain information |
|---|
| >PF01210 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus; InterPro: IPR011128 NAD-dependent glycerol-3-phosphate dehydrogenase (GPDH) catalyses the interconversion of dihydroxyacetone phosphate and L-glycerol-3-phosphate | Back alignment and domain information |
|---|
| >COG1250 FadB 3-hydroxyacyl-CoA dehydrogenase [Lipid metabolism] | Back alignment and domain information |
|---|
| >PF00106 adh_short: short chain dehydrogenase alcohol dehydrogenase superfamily signature glucose/ribitol dehydrogenase family signature; InterPro: IPR002198 The short-chain dehydrogenases/reductases family (SDR) [] is a very large family of enzymes, most of which are known to be NAD- or NADP-dependent oxidoreductases | Back alignment and domain information |
|---|
| >PRK14619 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK11559 garR tartronate semialdehyde reductase; Provisional | Back alignment and domain information |
|---|
| >PRK07063 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PF01118 Semialdhyde_dh: Semialdehyde dehydrogenase, NAD binding domain; InterPro: IPR000534 The semialdehyde dehydrogenase family is found in N-acetyl-glutamine semialdehyde dehydrogenase (AgrC), which is involved in arginine biosynthesis, and aspartate-semialdehyde dehydrogenase [], an enzyme involved in the biosynthesis of various amino acids from aspartate | Back alignment and domain information |
|---|
| >TIGR02440 FadJ fatty oxidation complex, alpha subunit FadJ | Back alignment and domain information |
|---|
| >PRK05708 2-dehydropantoate 2-reductase; Provisional | Back alignment and domain information |
|---|
| >PLN03129 NADP-dependent malic enzyme; Provisional | Back alignment and domain information |
|---|
| >PRK09260 3-hydroxybutyryl-CoA dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK02472 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional | Back alignment and domain information |
|---|
| >PRK05875 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08655 prephenate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK11880 pyrroline-5-carboxylate reductase; Reviewed | Back alignment and domain information |
|---|
| >KOG0069 consensus Glyoxylate/hydroxypyruvate reductase (D-isomer-specific 2-hydroxy acid dehydrogenase superfamily) [Energy production and conversion] | Back alignment and domain information |
|---|
| >PRK05565 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PLN02253 xanthoxin dehydrogenase | Back alignment and domain information |
|---|
| >PRK08291 ectoine utilization protein EutC; Validated | Back alignment and domain information |
|---|
| >TIGR00873 gnd 6-phosphogluconate dehydrogenase, decarboxylating | Back alignment and domain information |
|---|
| >PRK06928 pyrroline-5-carboxylate reductase; Reviewed | Back alignment and domain information |
|---|
| >cd05296 GH4_P_beta_glucosidase Glycoside Hydrolases Family 4; Phospho-beta-glucosidase | Back alignment and domain information |
|---|
| >PTZ00431 pyrroline carboxylate reductase; Provisional | Back alignment and domain information |
|---|
| >PRK06476 pyrroline-5-carboxylate reductase; Reviewed | Back alignment and domain information |
|---|
| >COG1063 Tdh Threonine dehydrogenase and related Zn-dependent dehydrogenases [Amino acid transport and metabolism / General function prediction only] | Back alignment and domain information |
|---|
| >PRK13304 L-aspartate dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PRK07067 sorbitol dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07062 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK14620 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PLN03209 translocon at the inner envelope of chloroplast subunit 62; Provisional | Back alignment and domain information |
|---|
| >TIGR01035 hemA glutamyl-tRNA reductase | Back alignment and domain information |
|---|
| >PRK05442 malate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK03803 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional | Back alignment and domain information |
|---|
| >PRK13302 putative L-aspartate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08229 2-dehydropantoate 2-reductase; Provisional | Back alignment and domain information |
|---|
| >PF00106 adh_short: short chain dehydrogenase alcohol dehydrogenase superfamily signature glucose/ribitol dehydrogenase family signature; InterPro: IPR002198 The short-chain dehydrogenases/reductases family (SDR) [] is a very large family of enzymes, most of which are known to be NAD- or NADP-dependent oxidoreductases | Back alignment and domain information |
|---|
| >TIGR01763 MalateDH_bact malate dehydrogenase, NAD-dependent | Back alignment and domain information |
|---|
| >PTZ00431 pyrroline carboxylate reductase; Provisional | Back alignment and domain information |
|---|
| >TIGR02437 FadB fatty oxidation complex, alpha subunit FadB | Back alignment and domain information |
|---|
| >TIGR02279 PaaC-3OHAcCoADH 3-hydroxyacyl-CoA dehydrogenase PaaC | Back alignment and domain information |
|---|
| >cd00650 LDH_MDH_like NAD-dependent, lactate dehydrogenase-like, 2-hydroxycarboxylate dehydrogenase family | Back alignment and domain information |
|---|
| >PRK09496 trkA potassium transporter peripheral membrane component; Reviewed | Back alignment and domain information |
|---|
| >PLN03096 glyceraldehyde-3-phosphate dehydrogenase A; Provisional | Back alignment and domain information |
|---|
| >PRK12939 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06139 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08605 D-lactate dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK06057 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR01771 L-LDH-NAD L-lactate dehydrogenase | Back alignment and domain information |
|---|
| >TIGR00518 alaDH alanine dehydrogenase | Back alignment and domain information |
|---|
| >PTZ00082 L-lactate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR01327 PGDH D-3-phosphoglycerate dehydrogenase | Back alignment and domain information |
|---|
| >PRK06940 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK10669 putative cation:proton antiport protein; Provisional | Back alignment and domain information |
|---|
| >PF02558 ApbA: Ketopantoate reductase PanE/ApbA; InterPro: IPR013332 ApbA, the ketopantoate reductase enzyme 1 | Back alignment and domain information |
|---|
| >PF02056 Glyco_hydro_4: Family 4 glycosyl hydrolase; InterPro: IPR001088 O-Glycosyl hydrolases 3 | Back alignment and domain information |
|---|
| >PRK07576 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PLN02240 UDP-glucose 4-epimerase | Back alignment and domain information |
|---|
| >cd01337 MDH_glyoxysomal_mitochondrial Glyoxysomal and mitochondrial malate dehydrogenases | Back alignment and domain information |
|---|
| >PTZ00117 malate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08291 ectoine utilization protein EutC; Validated | Back alignment and domain information |
|---|
| >PRK13529 malate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06720 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR00036 dapB dihydrodipicolinate reductase | Back alignment and domain information |
|---|
| >PRK07792 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK15059 tartronate semialdehyde reductase; Provisional | Back alignment and domain information |
|---|
| >PRK06181 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR02632 RhaD_aldol-ADH rhamnulose-1-phosphate aldolase/alcohol dehydrogenase | Back alignment and domain information |
|---|
| >TIGR02622 CDP_4_6_dhtase CDP-glucose 4,6-dehydratase | Back alignment and domain information |
|---|
| >PRK08251 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK12384 sorbitol-6-phosphate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PLN02240 UDP-glucose 4-epimerase | Back alignment and domain information |
|---|
| >TIGR03589 PseB UDP-N-acetylglucosamine 4,6-dehydratase | Back alignment and domain information |
|---|
| >TIGR03466 HpnA hopanoid-associated sugar epimerase | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST
Original result of BLAST against Protein Data Bank
| ID | Alignment Graph | Length |
Definition |
E-value | |
| Query | 1163 | ||||
| 3cmm_A | 1015 | Crystal Structure Of The Uba1-Ubiquitin Complex Len | 0.0 | ||
| 4ii2_A | 1001 | Crystal Structure Of Ubiquitin Activating Enzyme 1 | 0.0 | ||
| 1z7l_A | 276 | Crystal Structure Of Fragment Of Mouse Ubiquitin-Ac | 8e-56 | ||
| 1y8q_A | 346 | Sumo E1 Activating Enzyme Sae1-Sae2-Mg-Atp Complex | 9e-30 | ||
| 1y8q_A | 346 | Sumo E1 Activating Enzyme Sae1-Sae2-Mg-Atp Complex | 1e-07 | ||
| 3kyd_B | 551 | Human Sumo E1~sumo1-amp Tetrahedral Intermediate Mi | 3e-25 | ||
| 3kyd_B | 551 | Human Sumo E1~sumo1-amp Tetrahedral Intermediate Mi | 6e-07 | ||
| 3kyc_B | 660 | Human Sumo E1 Complex With A Sumo1-Amp Mimic Length | 3e-25 | ||
| 3kyc_B | 660 | Human Sumo E1 Complex With A Sumo1-Amp Mimic Length | 7e-07 | ||
| 1y8q_B | 640 | Sumo E1 Activating Enzyme Sae1-Sae2-Mg-Atp Complex | 4e-24 | ||
| 1y8q_B | 640 | Sumo E1 Activating Enzyme Sae1-Sae2-Mg-Atp Complex | 7e-07 | ||
| 2v31_A | 112 | Structure Of First Catalytic Cysteine Half-Domain O | 8e-24 | ||
| 2nvu_B | 805 | Structure Of Appbp1-Uba3~nedd8-Nedd8-Mgatp-Ubc12(C1 | 5e-22 | ||
| 3gzn_B | 463 | Structure Of Nedd8-Activating Enzyme In Complex Wit | 5e-22 | ||
| 1tt5_B | 434 | Structure Of Appbp1-Uba3-Ubc12n26: A Unique E1-E2 I | 5e-22 | ||
| 1yov_B | 444 | Insights Into The Ubiquitin Transfer Cascade From T | 5e-22 | ||
| 3dbr_B | 434 | Structural Dissection Of A Gating Mechanism Prevent | 2e-21 | ||
| 3dbl_B | 434 | Structural Dissection Of A Gating Mechanism Prevent | 7e-21 | ||
| 1r4m_B | 431 | Appbp1-Uba3-Nedd8, An E1-Ubiquitin-Like Protein Com | 8e-21 | ||
| 3dbh_B | 434 | Structural Dissection Of A Gating Mechanism Prevent | 1e-20 | ||
| 1zfn_A | 253 | Structural Analysis Of Escherichia Coli Thif Length | 4e-10 | ||
| 1zud_1 | 251 | Structure Of This-Thif Protein Complex Length = 251 | 4e-10 | ||
| 1tt5_A | 531 | Structure Of Appbp1-Uba3-Ubc12n26: A Unique E1-E2 I | 7e-10 | ||
| 1tt5_A | 531 | Structure Of Appbp1-Uba3-Ubc12n26: A Unique E1-E2 I | 3e-04 | ||
| 1r4m_A | 529 | Appbp1-Uba3-Nedd8, An E1-Ubiquitin-Like Protein Com | 7e-10 | ||
| 1r4m_A | 529 | Appbp1-Uba3-Nedd8, An E1-Ubiquitin-Like Protein Com | 3e-04 | ||
| 1yov_A | 537 | Insights Into The Ubiquitin Transfer Cascade From T | 7e-10 | ||
| 1yov_A | 537 | Insights Into The Ubiquitin Transfer Cascade From T | 3e-04 | ||
| 2nvu_A | 536 | Structure Of Appbp1-Uba3~nedd8-Nedd8-Mgatp-Ubc12(C1 | 7e-10 | ||
| 2nvu_A | 536 | Structure Of Appbp1-Uba3~nedd8-Nedd8-Mgatp-Ubc12(C1 | 3e-04 | ||
| 3gzn_A | 534 | Structure Of Nedd8-Activating Enzyme In Complex Wit | 8e-10 | ||
| 3gzn_A | 534 | Structure Of Nedd8-Activating Enzyme In Complex Wit | 3e-04 | ||
| 1jwb_B | 249 | Structure Of The Covalent Acyl-Adenylate Form Of Th | 2e-09 | ||
| 3h5n_A | 353 | Crystal Structure Of E. Coli Mccb + Atp Length = 35 | 1e-06 | ||
| 3h5a_A | 358 | Crystal Structure Of E. Coli Mccb Length = 358 | 2e-06 |
| >pdb|3CMM|A Chain A, Crystal Structure Of The Uba1-Ubiquitin Complex Length = 1015 | Back alignment and structure |
|
| >pdb|4II2|A Chain A, Crystal Structure Of Ubiquitin Activating Enzyme 1 (uba1) In Complex With The Ub E2 Ubc4, Ubiquitin, And Atp/mg Length = 1001 | Back alignment and structure |
| >pdb|1Z7L|A Chain A, Crystal Structure Of Fragment Of Mouse Ubiquitin-Activating Enzyme Length = 276 | Back alignment and structure |
| >pdb|1Y8Q|A Chain A, Sumo E1 Activating Enzyme Sae1-Sae2-Mg-Atp Complex Length = 346 | Back alignment and structure |
| >pdb|1Y8Q|A Chain A, Sumo E1 Activating Enzyme Sae1-Sae2-Mg-Atp Complex Length = 346 | Back alignment and structure |
| >pdb|3KYD|B Chain B, Human Sumo E1~sumo1-amp Tetrahedral Intermediate Mimic Length = 551 | Back alignment and structure |
| >pdb|3KYD|B Chain B, Human Sumo E1~sumo1-amp Tetrahedral Intermediate Mimic Length = 551 | Back alignment and structure |
| >pdb|3KYC|B Chain B, Human Sumo E1 Complex With A Sumo1-Amp Mimic Length = 660 | Back alignment and structure |
| >pdb|3KYC|B Chain B, Human Sumo E1 Complex With A Sumo1-Amp Mimic Length = 660 | Back alignment and structure |
| >pdb|1Y8Q|B Chain B, Sumo E1 Activating Enzyme Sae1-Sae2-Mg-Atp Complex Length = 640 | Back alignment and structure |
| >pdb|1Y8Q|B Chain B, Sumo E1 Activating Enzyme Sae1-Sae2-Mg-Atp Complex Length = 640 | Back alignment and structure |
| >pdb|2V31|A Chain A, Structure Of First Catalytic Cysteine Half-Domain Of Mouse Ubiquitin-Activating Enzyme Length = 112 | Back alignment and structure |
| >pdb|2NVU|B Chain B, Structure Of Appbp1-Uba3~nedd8-Nedd8-Mgatp-Ubc12(C111a), A Trapped Ubiquitin-Like Protein Activation Complex Length = 805 | Back alignment and structure |
| >pdb|3GZN|B Chain B, Structure Of Nedd8-Activating Enzyme In Complex With Nedd8 And Mln4924 Length = 463 | Back alignment and structure |
| >pdb|1TT5|B Chain B, Structure Of Appbp1-Uba3-Ubc12n26: A Unique E1-E2 Interaction Required For Optimal Conjugation Of The Ubiquitin-Like Protein Nedd8 Length = 434 | Back alignment and structure |
| >pdb|1YOV|B Chain B, Insights Into The Ubiquitin Transfer Cascade From The Refined Structure Of The Activating Enzyme For Nedd8 Length = 444 | Back alignment and structure |
| >pdb|3DBR|B Chain B, Structural Dissection Of A Gating Mechanism Preventing Misactivation Of Ubiquitin By Nedd8's E1 (Appbp1- Uba3arg190gln-Nedd8ala72arg) Length = 434 | Back alignment and structure |
| >pdb|3DBL|B Chain B, Structural Dissection Of A Gating Mechanism Preventing Misactivation Of Ubiquitin By Nedd8's E1 (Appbp1- Uba3arg190wt-Nedd8ala72gln) Length = 434 | Back alignment and structure |
| >pdb|1R4M|B Chain B, Appbp1-Uba3-Nedd8, An E1-Ubiquitin-Like Protein Complex Length = 431 | Back alignment and structure |
| >pdb|3DBH|B Chain B, Structural Dissection Of A Gating Mechanism Preventing Misactivation Of Ubiquitin By Nedd8's E1 (Appbp1- Uba3arg190ala-Nedd8ala72arg) Length = 434 | Back alignment and structure |
| >pdb|1ZFN|A Chain A, Structural Analysis Of Escherichia Coli Thif Length = 253 | Back alignment and structure |
| >pdb|1ZUD|1 Chain 1, Structure Of This-Thif Protein Complex Length = 251 | Back alignment and structure |
| >pdb|1TT5|A Chain A, Structure Of Appbp1-Uba3-Ubc12n26: A Unique E1-E2 Interaction Required For Optimal Conjugation Of The Ubiquitin-Like Protein Nedd8 Length = 531 | Back alignment and structure |
| >pdb|1TT5|A Chain A, Structure Of Appbp1-Uba3-Ubc12n26: A Unique E1-E2 Interaction Required For Optimal Conjugation Of The Ubiquitin-Like Protein Nedd8 Length = 531 | Back alignment and structure |
| >pdb|1R4M|A Chain A, Appbp1-Uba3-Nedd8, An E1-Ubiquitin-Like Protein Complex Length = 529 | Back alignment and structure |
| >pdb|1R4M|A Chain A, Appbp1-Uba3-Nedd8, An E1-Ubiquitin-Like Protein Complex Length = 529 | Back alignment and structure |
| >pdb|1YOV|A Chain A, Insights Into The Ubiquitin Transfer Cascade From The Refined Structure Of The Activating Enzyme For Nedd8 Length = 537 | Back alignment and structure |
| >pdb|1YOV|A Chain A, Insights Into The Ubiquitin Transfer Cascade From The Refined Structure Of The Activating Enzyme For Nedd8 Length = 537 | Back alignment and structure |
| >pdb|2NVU|A Chain A, Structure Of Appbp1-Uba3~nedd8-Nedd8-Mgatp-Ubc12(C111a), A Trapped Ubiquitin-Like Protein Activation Complex Length = 536 | Back alignment and structure |
| >pdb|2NVU|A Chain A, Structure Of Appbp1-Uba3~nedd8-Nedd8-Mgatp-Ubc12(C111a), A Trapped Ubiquitin-Like Protein Activation Complex Length = 536 | Back alignment and structure |
| >pdb|3GZN|A Chain A, Structure Of Nedd8-Activating Enzyme In Complex With Nedd8 And Mln4924 Length = 534 | Back alignment and structure |
| >pdb|3GZN|A Chain A, Structure Of Nedd8-Activating Enzyme In Complex With Nedd8 And Mln4924 Length = 534 | Back alignment and structure |
| >pdb|1JWB|B Chain B, Structure Of The Covalent Acyl-Adenylate Form Of The Moeb-Moad Protein Complex Length = 249 | Back alignment and structure |
| >pdb|3H5N|A Chain A, Crystal Structure Of E. Coli Mccb + Atp Length = 353 | Back alignment and structure |
| >pdb|3H5A|A Chain A, Crystal Structure Of E. Coli Mccb Length = 358 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST
Original result of RPS-BLAST against PDB70 database
| >3cmm_A Ubiquitin-activating enzyme E1 1; UBA1, protein turnover, ligase, conformationa thioester, adenylation, transthioesterification, ATP-bindin nucleotide-binding; 2.70A {Saccharomyces cerevisiae} Length = 1015 | Back alignment and structure |
|---|
Score = 1020 bits (2638), Expect = 0.0
Identities = 457/1024 (44%), Positives = 661/1024 (64%), Gaps = 26/1024 (2%)
Query: 154 TDIDEDLHSRQLAVYGRETMRRLFASNILVSGMQGLGAEIAKNLILAGVKSVTLHDEGTV 213
+IDE L+SRQL V G+E M ++ SN+L+ G++GLG EIAKN++LAGVKS+T+ D V
Sbjct: 3 GEIDESLYSRQLYVLGKEAMLKMQTSNVLILGLKGLGVEIAKNVVLAGVKSMTVFDPEPV 62
Query: 214 ELWDLSSNFVFSDNDIGKNRALASVQKLQELNNAVVLSTLTSKLTKEQLSDFQAVVFTD- 272
+L DLS+ F ++ DIG+ R + KL ELN V ++ L S QLS FQ VV TD
Sbjct: 63 QLADLSTQFFLTEKDIGQKRGDVTRAKLAELNAYVPVNVLDSLDDVTQLSQFQVVVATDT 122
Query: 273 ISLDKAIEFDDFCHNHQPAISFIKAEVRGLFGSVFCDFGPEFTVVDVDGEDPHTGIIASI 332
+SL+ ++ ++FCH+ I FI +E RGLFG+ F D G EFTV+D GE+P TG+++ I
Sbjct: 123 VSLEDKVKINEFCHSSG--IRFISSETRGLFGNTFVDLGDEFTVLDPTGEEPRTGMVSDI 180
Query: 333 SNDNPALVSCVDDERLEFQDGDLVVFSEVHGMTELNDGKPRKIKSARPYSFTLEEDTTNY 392
D V+ +DD R +DG+ V FSEV G+ +LNDG K++ P++F + Y
Sbjct: 181 EPDGT--VTMLDDNRHGLEDGNFVRFSEVEGLDKLNDGTLFKVEVLGPFAFRI-GSVKEY 237
Query: 393 GTYVKGGIVTQVKQPKVLNFKPLREALEDPGDFLLSDFSKFDRPPPLHLAFQALDKFVSE 452
G Y KGGI T+VK P+ ++FK L++ L +P +F+ SDF+KFDR LHL FQAL +F
Sbjct: 238 GEYKKGGIFTEVKVPRKISFKSLKQQLSNP-EFVFSDFAKFDRAAQLHLGFQALHQFAVR 296
Query: 453 -LGRFPVAGSEEDAQKLISVATNINESLGD--GRVEDINTKLLRHFAFGARAVLNPMAAM 509
G P ++EDA +LI + T+++ + G D+N L++ ++ AR + + A
Sbjct: 297 HNGELPRTMNDEDANELIKLVTDLSVQQPEVLGEGVDVNEDLIKELSYQARGDIPGVVAF 356
Query: 510 FGGIVGQEVVKACSGKFHPLYQFFYFDSVESLPTE---PLDSTEFKPINSRYDAQISVFG 566
FGG+V QEV+KACSGKF PL QF YFDS+ESLP P + +P+NSRYD QI+VFG
Sbjct: 357 FGGLVAQEVLKACSGKFTPLKQFMYFDSLESLPDPKNFPRNEKTTQPVNSRYDNQIAVFG 416
Query: 567 AKLQKKLEDAKVFIVGSGALGCEFLKNVALMGVSCGNQGKLTITDDDVIEKSNLSRQFLF 626
QKK+ ++KVF+VGSGA+GCE LKN AL+G+ G+ G + +TD+D IEKSNL+RQFLF
Sbjct: 417 LDFQKKIANSKVFLVGSGAIGCEMLKNWALLGLGSGSDGYIVVTDNDSIEKSNLNRQFLF 476
Query: 627 RDWNIGQAKSTVAASAATSINPRLNIE--ALQNRVGPETENVFDDTFWENITCVINALDN 684
R ++G+ KS VAA A ++NP L + A ++VGPETE +F+D+FWE++ V NALDN
Sbjct: 477 RPKDVGKNKSEVAAEAVCAMNPDLKGKINAKIDKVGPETEEIFNDSFWESLDFVTNALDN 536
Query: 685 VNARLYVDQRCLYFQKPLLESGTLGAKCNTQMVIPHLTENYGASRDPPEKQAPMCTVHSF 744
V+AR YVD+RC++++KPLLESGTLG K NTQ++IP LTE+Y +SRDPPEK P+CT+ SF
Sbjct: 537 VDARTYVDRRCVFYRKPLLESGTLGTKGNTQVIIPRLTESYSSSRDPPEKSIPLCTLRSF 596
Query: 745 PHNIDHCLTWARSEFEGLLEKTPAEVNAYLSNPVEYTTSMANAGDAQARDNLERVLECLD 804
P+ IDH + WA+S F+G + VN YL+ P ++ +GD + LE + + L
Sbjct: 597 PNKIDHTIAWAKSLFQGYFTDSAENVNMYLTQPNFVEQTLKQSGD--VKGVLESISDSLS 654
Query: 805 KEKCEIFQDCITWARLKFEDYFSNRVKQLIFTFPEDAATSTGAPFWSAPKRFPHPLQFSS 864
K F+DCI WARL+FE F++ +KQL+F FP+DA TS G PFWS KR P PL+F
Sbjct: 655 -SKPHNFEDCIKWARLEFEKKFNHDIKQLLFNFPKDAKTSNGEPFWSGAKRAPTPLEFDI 713
Query: 865 ADPSHLHFVMAASILRAETFGIPIPDWTNNPKM--LAEAVDKVMVPDFLPKKDAKILTDE 922
+ H HFV+A + LRA +GI D + P + +D +++P+F P + KI ++
Sbjct: 714 YNNDHFHFVVAGASLRAYNYGIKSDDSNSKPNVDEYKSVIDHMIIPEFTPNANLKIQVND 773
Query: 923 KATTLSTASVDDAAVINDLIIKLEQCRKNLPSGFRLKPIQFEKDDDTNYHMDMIAGLANM 982
+ + + + I+ L+ L +GF+L+P+ FEKDDDTN+H++ I +N
Sbjct: 774 DDPDPNANAANGSDEIDQLVSSLPDPSTL--AGFKLEPVDFEKDDDTNHHIEFITACSNC 831
Query: 983 RARNYSIPEVDKLKAKFIAGRIIPAIATSTAMATGLVCLELYKVLDGGHKLEDYRNTFAN 1042
RA+NY I D+ K KFIAGRIIPAIAT+T++ TGLV LELYK++D +E Y+N F N
Sbjct: 832 RAQNYFIETADRQKTKFIAGRIIPAIATTTSLVTGLVNLELYKLIDNKTDIEQYKNGFVN 891
Query: 1043 LALPLFSMAEPVPPKVIKHRDMSW-TVWDRWILKDNPTLRELIQWLKDK-GLNAYSISCG 1100
LALP F +EP+ ++ + + +WDR+ +K + L +LI+ + GL +S G
Sbjct: 892 LALPFFGFSEPIASPKGEYNNKKYDKIWDRFDIKGDIKLSDLIEHFEKDEGLEITMLSYG 951
Query: 1101 SCLLFNSMFPRHK--ERMDKKVVDLAREVAKVELPPYRRHLDVVVACEDDEDNDIDIPLI 1158
LL+ S FP K ER++ + L + V K ++P + + + + +D E D+++P I
Sbjct: 952 VSLLYASFFPPKKLKERLNLPITQLVKLVTKKDIPAHVSTMILEICADDKEGEDVEVPFI 1011
Query: 1159 SIYF 1162
+I+
Sbjct: 1012 TIHL 1015
|
| >3cmm_A Ubiquitin-activating enzyme E1 1; UBA1, protein turnover, ligase, conformationa thioester, adenylation, transthioesterification, ATP-bindin nucleotide-binding; 2.70A {Saccharomyces cerevisiae} Length = 1015 | Back alignment and structure |
|---|
| >1y8q_B Anthracycline-, ubiquitin-like 2 activating enzyme E1B; SUMO, heterodimer, UBL, ligase; HET: ATP; 2.25A {Homo sapiens} PDB: 1y8r_B* 3kyc_B* 3kyd_B* 2px9_A Length = 640 | Back alignment and structure |
|---|
| >1y8q_B Anthracycline-, ubiquitin-like 2 activating enzyme E1B; SUMO, heterodimer, UBL, ligase; HET: ATP; 2.25A {Homo sapiens} PDB: 1y8r_B* 3kyc_B* 3kyd_B* 2px9_A Length = 640 | Back alignment and structure |
|---|
| >1y8q_A Ubiquitin-like 1 activating enzyme E1A; SUMO, heterodimer, UBL, ligase; HET: ATP; 2.25A {Homo sapiens} PDB: 1y8r_A* 3kyc_A* 3kyd_A* Length = 346 | Back alignment and structure |
|---|
| >1y8q_A Ubiquitin-like 1 activating enzyme E1A; SUMO, heterodimer, UBL, ligase; HET: ATP; 2.25A {Homo sapiens} PDB: 1y8r_A* 3kyc_A* 3kyd_A* Length = 346 | Back alignment and structure |
|---|
| >1z7l_A Ubiquitin-activating enzyme E1 1; SCCH, second catalytic cysteine half-domain, ligase; HET: TBR; 2.80A {Mus musculus} Length = 276 | Back alignment and structure |
|---|
| >2nvu_B Maltose binding protein/NEDD8-activating enzyme E1 catalytic subunit chimera; multifunction macromolecular complex, ubiquitin, ATP, conformational change, thioester, switch, adenylation, protein turnover, ligase; HET: ATP; 2.80A {Homo sapiens} SCOP: c.111.1.2 c.94.1.1 Length = 805 | Back alignment and structure |
|---|
| >2nvu_B Maltose binding protein/NEDD8-activating enzyme E1 catalytic subunit chimera; multifunction macromolecular complex, ubiquitin, ATP, conformational change, thioester, switch, adenylation, protein turnover, ligase; HET: ATP; 2.80A {Homo sapiens} SCOP: c.111.1.2 c.94.1.1 Length = 805 | Back alignment and structure |
|---|
| >2nvu_B Maltose binding protein/NEDD8-activating enzyme E1 catalytic subunit chimera; multifunction macromolecular complex, ubiquitin, ATP, conformational change, thioester, switch, adenylation, protein turnover, ligase; HET: ATP; 2.80A {Homo sapiens} SCOP: c.111.1.2 c.94.1.1 Length = 805 | Back alignment and structure |
|---|
| >1tt5_B Ubiquitin-activating enzyme E1C isoform 1; cell cycle, ligase; 2.60A {Homo sapiens} SCOP: c.111.1.2 PDB: 3dbl_B 3dbr_B 3dbh_B 3gzn_B* 1yov_B 1r4m_B 1r4n_B* Length = 434 | Back alignment and structure |
|---|
| >1tt5_B Ubiquitin-activating enzyme E1C isoform 1; cell cycle, ligase; 2.60A {Homo sapiens} SCOP: c.111.1.2 PDB: 3dbl_B 3dbr_B 3dbh_B 3gzn_B* 1yov_B 1r4m_B 1r4n_B* Length = 434 | Back alignment and structure |
|---|
| >1tt5_B Ubiquitin-activating enzyme E1C isoform 1; cell cycle, ligase; 2.60A {Homo sapiens} SCOP: c.111.1.2 PDB: 3dbl_B 3dbr_B 3dbh_B 3gzn_B* 1yov_B 1r4m_B 1r4n_B* Length = 434 | Back alignment and structure |
|---|
| >1tt5_A APPBP1, amyloid protein-binding protein 1; cell cycle, ligase; 2.60A {Homo sapiens} SCOP: c.111.1.2 PDB: 3dbh_A 3dbl_A 3dbr_A 1r4m_A 1r4n_A* 2nvu_A* 1yov_A 3gzn_A* Length = 531 | Back alignment and structure |
|---|
| >1tt5_A APPBP1, amyloid protein-binding protein 1; cell cycle, ligase; 2.60A {Homo sapiens} SCOP: c.111.1.2 PDB: 3dbh_A 3dbl_A 3dbr_A 1r4m_A 1r4n_A* 2nvu_A* 1yov_A 3gzn_A* Length = 531 | Back alignment and structure |
|---|
| >1tt5_A APPBP1, amyloid protein-binding protein 1; cell cycle, ligase; 2.60A {Homo sapiens} SCOP: c.111.1.2 PDB: 3dbh_A 3dbl_A 3dbr_A 1r4m_A 1r4n_A* 2nvu_A* 1yov_A 3gzn_A* Length = 531 | Back alignment and structure |
|---|
| >2v31_A Ubiquitin-activating enzyme E1 X; ligase, phosphorylation, catalytic domain, heteronuclear first catalytic cysteine half-domain, E1 protein; NMR {Mus musculus} Length = 112 | Back alignment and structure |
|---|
| >3h5n_A MCCB protein; ubiquitin-activating enzyme, microcin, protein structure, MCCC7, peptide antibiotics, N-P bond formation, transferase; HET: ATP; 1.90A {Escherichia coli} PDB: 3h5r_A 3h9g_A 3h9j_A* 3h9q_A 3h5a_A Length = 353 | Back alignment and structure |
|---|
| >3h5n_A MCCB protein; ubiquitin-activating enzyme, microcin, protein structure, MCCC7, peptide antibiotics, N-P bond formation, transferase; HET: ATP; 1.90A {Escherichia coli} PDB: 3h5r_A 3h9g_A 3h9j_A* 3h9q_A 3h5a_A Length = 353 | Back alignment and structure |
|---|
| >1jw9_B Molybdopterin biosynthesis MOEB protein; MOEB: modified rossmann fold, (2) Cys-X-X-Cys zinc-binding M MOAD: ubiquitin-like fold; 1.70A {Escherichia coli} SCOP: c.111.1.1 PDB: 1jwa_B* 1jwb_B* Length = 249 | Back alignment and structure |
|---|
| >1jw9_B Molybdopterin biosynthesis MOEB protein; MOEB: modified rossmann fold, (2) Cys-X-X-Cys zinc-binding M MOAD: ubiquitin-like fold; 1.70A {Escherichia coli} SCOP: c.111.1.1 PDB: 1jwa_B* 1jwb_B* Length = 249 | Back alignment and structure |
|---|
| >3h8v_A Ubiquitin-like modifier-activating enzyme 5; rossman fold, ATP-binding, UBL conjugation pathway, transfer structural genomics consortium, SGC; HET: ATP; 2.00A {Homo sapiens} PDB: 3guc_A* Length = 292 | Back alignment and structure |
|---|
| >3h8v_A Ubiquitin-like modifier-activating enzyme 5; rossman fold, ATP-binding, UBL conjugation pathway, transfer structural genomics consortium, SGC; HET: ATP; 2.00A {Homo sapiens} PDB: 3guc_A* Length = 292 | Back alignment and structure |
|---|
| >1zud_1 Adenylyltransferase THIF; thiamin, thiazole, protein-protein complex, THIF, TRAN biosynthetic protein complex; 1.98A {Escherichia coli} PDB: 1zfn_A* 1zkm_A Length = 251 | Back alignment and structure |
|---|
| >1zud_1 Adenylyltransferase THIF; thiamin, thiazole, protein-protein complex, THIF, TRAN biosynthetic protein complex; 1.98A {Escherichia coli} PDB: 1zfn_A* 1zkm_A Length = 251 | Back alignment and structure |
|---|
| >3rui_A Ubiquitin-like modifier-activating enzyme ATG7; autophagosome formation, non-canonical E1, ATP BI UBL, ATG8, ATG12, ATG10, ATG3, UBL activation, thiolation; 1.91A {Saccharomyces cerevisiae} PDB: 3t7e_A 3vh3_A 3vh4_A* Length = 340 | Back alignment and structure |
|---|
| >3rui_A Ubiquitin-like modifier-activating enzyme ATG7; autophagosome formation, non-canonical E1, ATP BI UBL, ATG8, ATG12, ATG10, ATG3, UBL activation, thiolation; 1.91A {Saccharomyces cerevisiae} PDB: 3t7e_A 3vh3_A 3vh4_A* Length = 340 | Back alignment and structure |
|---|
| >3vh1_A Ubiquitin-like modifier-activating enzyme ATG7; autophagy, zinc binding, metal binding protein; 3.00A {Saccharomyces cerevisiae} PDB: 3vh2_A Length = 598 | Back alignment and structure |
|---|
| >3vh1_A Ubiquitin-like modifier-activating enzyme ATG7; autophagy, zinc binding, metal binding protein; 3.00A {Saccharomyces cerevisiae} PDB: 3vh2_A Length = 598 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch
Original result of HHsearch against PDB70 database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 1163 | |||
| 3cmm_A | 1015 | Ubiquitin-activating enzyme E1 1; UBA1, protein tu | 100.0 | |
| 1y8q_B | 640 | Anthracycline-, ubiquitin-like 2 activating enzyme | 100.0 | |
| 1z7l_A | 276 | Ubiquitin-activating enzyme E1 1; SCCH, second cat | 100.0 | |
| 1tt5_A | 531 | APPBP1, amyloid protein-binding protein 1; cell cy | 100.0 | |
| 1y8q_A | 346 | Ubiquitin-like 1 activating enzyme E1A; SUMO, hete | 100.0 | |
| 1tt5_B | 434 | Ubiquitin-activating enzyme E1C isoform 1; cell cy | 100.0 | |
| 2nvu_B | 805 | Maltose binding protein/NEDD8-activating enzyme E1 | 100.0 | |
| 1y8q_A | 346 | Ubiquitin-like 1 activating enzyme E1A; SUMO, hete | 100.0 | |
| 1tt5_A | 531 | APPBP1, amyloid protein-binding protein 1; cell cy | 100.0 | |
| 1tt5_B | 434 | Ubiquitin-activating enzyme E1C isoform 1; cell cy | 100.0 | |
| 3h8v_A | 292 | Ubiquitin-like modifier-activating enzyme 5; rossm | 100.0 | |
| 1zud_1 | 251 | Adenylyltransferase THIF; thiamin, thiazole, prote | 99.97 | |
| 1zud_1 | 251 | Adenylyltransferase THIF; thiamin, thiazole, prote | 99.97 | |
| 2nvu_B | 805 | Maltose binding protein/NEDD8-activating enzyme E1 | 99.97 | |
| 1jw9_B | 249 | Molybdopterin biosynthesis MOEB protein; MOEB: mod | 99.97 | |
| 3h5n_A | 353 | MCCB protein; ubiquitin-activating enzyme, microci | 99.97 | |
| 3rui_A | 340 | Ubiquitin-like modifier-activating enzyme ATG7; au | 99.96 | |
| 1y8q_B | 640 | Anthracycline-, ubiquitin-like 2 activating enzyme | 99.96 | |
| 3cmm_A | 1015 | Ubiquitin-activating enzyme E1 1; UBA1, protein tu | 99.96 | |
| 1jw9_B | 249 | Molybdopterin biosynthesis MOEB protein; MOEB: mod | 99.95 | |
| 3vh1_A | 598 | Ubiquitin-like modifier-activating enzyme ATG7; au | 99.95 | |
| 4gsl_A | 615 | Ubiquitin-like modifier-activating enzyme ATG7; ub | 99.95 | |
| 3h8v_A | 292 | Ubiquitin-like modifier-activating enzyme 5; rossm | 99.95 | |
| 3h5n_A | 353 | MCCB protein; ubiquitin-activating enzyme, microci | 99.94 | |
| 3rui_A | 340 | Ubiquitin-like modifier-activating enzyme ATG7; au | 99.91 | |
| 3vh1_A | 598 | Ubiquitin-like modifier-activating enzyme ATG7; au | 99.91 | |
| 2v31_A | 112 | Ubiquitin-activating enzyme E1 X; ligase, phosphor | 99.91 | |
| 4gsl_A | 615 | Ubiquitin-like modifier-activating enzyme ATG7; ub | 99.9 | |
| 1z7l_A | 276 | Ubiquitin-activating enzyme E1 1; SCCH, second cat | 98.39 | |
| 3dfz_A | 223 | SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase | 97.25 | |
| 3jyo_A | 283 | Quinate/shikimate dehydrogenase; enzyme-cofactor c | 96.93 | |
| 3jyo_A | 283 | Quinate/shikimate dehydrogenase; enzyme-cofactor c | 96.79 | |
| 3dfz_A | 223 | SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase | 96.78 | |
| 3ic5_A | 118 | Putative saccharopine dehydrogenase; structural ge | 96.74 | |
| 1kyq_A | 274 | Met8P, siroheme biosynthesis protein Met8; homodim | 96.65 | |
| 1y8x_B | 98 | Ubiquitin-activating enzyme E1C; ubiquitin-conjuga | 96.62 | |
| 1pjq_A | 457 | CYSG, siroheme synthase; rossman fold, nucleotide | 96.49 | |
| 3llv_A | 141 | Exopolyphosphatase-related protein; NAD(P)-binding | 96.13 | |
| 3ic5_A | 118 | Putative saccharopine dehydrogenase; structural ge | 96.11 | |
| 3tnl_A | 315 | Shikimate dehydrogenase; structural genomics, cent | 95.82 | |
| 2hmt_A | 144 | YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane | 95.81 | |
| 3llv_A | 141 | Exopolyphosphatase-related protein; NAD(P)-binding | 95.75 | |
| 2g1u_A | 155 | Hypothetical protein TM1088A; structural genomics, | 95.69 | |
| 2g1u_A | 155 | Hypothetical protein TM1088A; structural genomics, | 95.68 | |
| 3tum_A | 269 | Shikimate dehydrogenase family protein; rossmann-f | 95.67 | |
| 3t4e_A | 312 | Quinate/shikimate dehydrogenase; structural genomi | 95.54 | |
| 3tnl_A | 315 | Shikimate dehydrogenase; structural genomics, cent | 95.51 | |
| 3t4e_A | 312 | Quinate/shikimate dehydrogenase; structural genomi | 95.49 | |
| 2hmt_A | 144 | YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane | 95.48 | |
| 4ina_A | 405 | Saccharopine dehydrogenase; structural genomics, P | 95.44 | |
| 3tum_A | 269 | Shikimate dehydrogenase family protein; rossmann-f | 95.39 | |
| 1kyq_A | 274 | Met8P, siroheme biosynthesis protein Met8; homodim | 95.34 | |
| 3e8x_A | 236 | Putative NAD-dependent epimerase/dehydratase; stru | 95.13 | |
| 1id1_A | 153 | Putative potassium channel protein; RCK domain, E. | 95.08 | |
| 1pjq_A | 457 | CYSG, siroheme synthase; rossman fold, nucleotide | 95.06 | |
| 1lss_A | 140 | TRK system potassium uptake protein TRKA homolog; | 94.89 | |
| 3abi_A | 365 | Putative uncharacterized protein PH1688; L-lysine | 94.75 | |
| 1lss_A | 140 | TRK system potassium uptake protein TRKA homolog; | 94.73 | |
| 3pwz_A | 272 | Shikimate dehydrogenase 3; alpha-beta, oxidoreduct | 94.71 | |
| 2ph5_A | 480 | Homospermidine synthase; alpha-beta protein, struc | 94.61 | |
| 3o8q_A | 281 | Shikimate 5-dehydrogenase I alpha; structural geno | 94.55 | |
| 3pwz_A | 272 | Shikimate dehydrogenase 3; alpha-beta, oxidoreduct | 94.54 | |
| 3o8q_A | 281 | Shikimate 5-dehydrogenase I alpha; structural geno | 94.45 | |
| 3oj0_A | 144 | Glutr, glutamyl-tRNA reductase; structural genomic | 94.44 | |
| 1id1_A | 153 | Putative potassium channel protein; RCK domain, E. | 94.41 | |
| 3fwz_A | 140 | Inner membrane protein YBAL; TRKA-N domain, E.coli | 94.38 | |
| 3qsg_A | 312 | NAD-binding phosphogluconate dehydrogenase-like P; | 94.32 | |
| 3c85_A | 183 | Putative glutathione-regulated potassium-efflux S | 94.27 | |
| 2z2v_A | 365 | Hypothetical protein PH1688; L-lysine dehydrogenas | 94.11 | |
| 2egg_A | 297 | AROE, shikimate 5-dehydrogenase; dimer, X-RAY diff | 93.99 | |
| 3gvi_A | 324 | Malate dehydrogenase; NAD, oxidoreductase, tricarb | 93.95 | |
| 3abi_A | 365 | Putative uncharacterized protein PH1688; L-lysine | 93.79 | |
| 3oj0_A | 144 | Glutr, glutamyl-tRNA reductase; structural genomic | 93.79 | |
| 3l4b_C | 218 | TRKA K+ channel protien TM1088B; potassium channel | 93.77 | |
| 4ina_A | 405 | Saccharopine dehydrogenase; structural genomics, P | 93.6 | |
| 1hyh_A | 309 | L-hicdh, L-2-hydroxyisocaproate dehydrogenase; L-2 | 93.57 | |
| 3don_A | 277 | Shikimate dehydrogenase; alpha-beta structure, ros | 93.55 | |
| 3rku_A | 287 | Oxidoreductase YMR226C; substrate fingerprint, sho | 93.46 | |
| 3p7m_A | 321 | Malate dehydrogenase; putative dehydrogenase, enzy | 93.45 | |
| 3e8x_A | 236 | Putative NAD-dependent epimerase/dehydratase; stru | 93.25 | |
| 2raf_A | 209 | Putative dinucleotide-binding oxidoreductase; NP_7 | 93.18 | |
| 2d4a_B | 308 | Malate dehydrogenase; archaea, hyperthermophIle, o | 93.16 | |
| 2egg_A | 297 | AROE, shikimate 5-dehydrogenase; dimer, X-RAY diff | 93.13 | |
| 3l4b_C | 218 | TRKA K+ channel protien TM1088B; potassium channel | 93.1 | |
| 3h2s_A | 224 | Putative NADH-flavin reductase; Q03B84, NESG, LCR1 | 93.0 | |
| 3fwz_A | 140 | Inner membrane protein YBAL; TRKA-N domain, E.coli | 93.0 | |
| 3slg_A | 372 | PBGP3 protein; structural genomics, seattle struct | 92.92 | |
| 3dqp_A | 219 | Oxidoreductase YLBE; alpha-beta protein., structur | 92.85 | |
| 2axq_A | 467 | Saccharopine dehydrogenase; rossmann fold variant, | 92.84 | |
| 3t4x_A | 267 | Oxidoreductase, short chain dehydrogenase/reducta; | 92.83 | |
| 3dhn_A | 227 | NAD-dependent epimerase/dehydratase; reductase, PF | 92.81 | |
| 3gpi_A | 286 | NAD-dependent epimerase/dehydratase; structural ge | 92.81 | |
| 1p9l_A | 245 | Dihydrodipicolinate reductase; oxidoreductase, lys | 92.72 | |
| 3o38_A | 266 | Short chain dehydrogenase; tuberculosis, ortholog | 92.72 | |
| 3ruf_A | 351 | WBGU; rossmann fold, UDP-hexose 4-epimerase, isome | 92.65 | |
| 3d0o_A | 317 | L-LDH 1, L-lactate dehydrogenase 1; cytoplasm, gly | 92.65 | |
| 1ldn_A | 316 | L-lactate dehydrogenase; oxidoreductase(CHOH(D)-NA | 92.61 | |
| 2h78_A | 302 | Hibadh, 3-hydroxyisobutyrate dehydrogenase; APC601 | 92.57 | |
| 1hdo_A | 206 | Biliverdin IX beta reductase; foetal metabolism, H | 92.53 | |
| 3doj_A | 310 | AT3G25530, dehydrogenase-like protein; gamma-hydro | 92.51 | |
| 2aef_A | 234 | Calcium-gated potassium channel MTHK; rossmann fol | 92.44 | |
| 1npy_A | 271 | Hypothetical shikimate 5-dehydrogenase-like protei | 92.43 | |
| 4ezb_A | 317 | Uncharacterized conserved protein; structural geno | 92.35 | |
| 4e12_A | 283 | Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1 | 92.34 | |
| 1hdo_A | 206 | Biliverdin IX beta reductase; foetal metabolism, H | 92.29 | |
| 2z2v_A | 365 | Hypothetical protein PH1688; L-lysine dehydrogenas | 92.21 | |
| 2ewd_A | 317 | Lactate dehydrogenase,; protein-substrate_cofactor | 92.19 | |
| 3onh_A | 127 | Ubiquitin-activating enzyme E1-like; ligase, SUMO | 92.14 | |
| 3don_A | 277 | Shikimate dehydrogenase; alpha-beta structure, ros | 92.07 | |
| 3vku_A | 326 | L-LDH, L-lactate dehydrogenase; rossmann fold, NAD | 92.05 | |
| 1y1p_A | 342 | ARII, aldehyde reductase II; rossmann fold, short | 92.03 | |
| 4aj2_A | 331 | L-lactate dehydrogenase A chain; oxidoreductase-in | 91.96 | |
| 1oju_A | 294 | MDH, malate dehydrogenase; hyperthermophilic, oxid | 91.82 | |
| 1xg5_A | 279 | ARPG836; short chain dehydrogenase, human, SGC, st | 91.78 | |
| 3lf2_A | 265 | Short chain oxidoreductase Q9HYA2; SDR, SCOR, ross | 91.76 | |
| 3dhn_A | 227 | NAD-dependent epimerase/dehydratase; reductase, PF | 91.71 | |
| 3l9w_A | 413 | Glutathione-regulated potassium-efflux system Pro | 91.67 | |
| 4e21_A | 358 | 6-phosphogluconate dehydrogenase (decarboxylating; | 91.66 | |
| 2raf_A | 209 | Putative dinucleotide-binding oxidoreductase; NP_7 | 91.64 | |
| 3fbt_A | 282 | Chorismate mutase and shikimate 5-dehydrogenase fu | 91.62 | |
| 2hk9_A | 275 | Shikimate dehydrogenase; shikimate pathway, drug d | 91.53 | |
| 4id9_A | 347 | Short-chain dehydrogenase/reductase; putative dehy | 91.49 | |
| 2b69_A | 343 | UDP-glucuronate decarboxylase 1; UDP-glucoronic ac | 91.47 | |
| 2hjr_A | 328 | Malate dehydrogenase; malaria, structural genomics | 91.43 | |
| 3rku_A | 287 | Oxidoreductase YMR226C; substrate fingerprint, sho | 91.4 | |
| 3pqe_A | 326 | L-LDH, L-lactate dehydrogenase; FBP, oxidoreductas | 91.35 | |
| 3tl2_A | 315 | Malate dehydrogenase; center for structural genomi | 91.32 | |
| 3nyw_A | 250 | Putative oxidoreductase; fatty acid synthesis,3-ox | 91.16 | |
| 3gpi_A | 286 | NAD-dependent epimerase/dehydratase; structural ge | 91.15 | |
| 3ruf_A | 351 | WBGU; rossmann fold, UDP-hexose 4-epimerase, isome | 91.08 | |
| 3qsg_A | 312 | NAD-binding phosphogluconate dehydrogenase-like P; | 91.06 | |
| 3d1l_A | 266 | Putative NADP oxidoreductase BF3122; structural ge | 91.05 | |
| 1ff9_A | 450 | Saccharopine reductase; lysine biosynthesis, alpha | 91.04 | |
| 2x0j_A | 294 | Malate dehydrogenase; oxidoreductase, hyperthermop | 91.03 | |
| 3hg7_A | 324 | D-isomer specific 2-hydroxyacid dehydrogenase FAM | 91.0 | |
| 4id9_A | 347 | Short-chain dehydrogenase/reductase; putative dehy | 90.97 | |
| 3ldh_A | 330 | Lactate dehydrogenase; oxidoreductase, CHOH donor, | 90.95 | |
| 1iy8_A | 267 | Levodione reductase; oxidoreductase; HET: NAD; 1.6 | 90.95 | |
| 4egb_A | 346 | DTDP-glucose 4,6-dehydratase; rhamnose pathway, ce | 90.94 | |
| 4g65_A | 461 | TRK system potassium uptake protein TRKA; structur | 90.92 | |
| 2dpo_A | 319 | L-gulonate 3-dehydrogenase; structural genomics, N | 90.86 | |
| 3evt_A | 324 | Phosphoglycerate dehydrogenase; structural genomic | 90.86 | |
| 4gbj_A | 297 | 6-phosphogluconate dehydrogenase NAD-binding; stru | 90.82 | |
| 2pzm_A | 330 | Putative nucleotide sugar epimerase/ dehydratase; | 90.81 | |
| 3obb_A | 300 | Probable 3-hydroxyisobutyrate dehydrogenase; struc | 90.79 | |
| 3pp8_A | 315 | Glyoxylate/hydroxypyruvate reductase A; structural | 90.78 | |
| 1lu9_A | 287 | Methylene tetrahydromethanopterin dehydrogenase; a | 90.76 | |
| 3qiv_A | 253 | Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR | 90.73 | |
| 4ezb_A | 317 | Uncharacterized conserved protein; structural geno | 90.69 | |
| 1lld_A | 319 | L-lactate dehydrogenase; oxidoreductase(CHOH (D)-N | 90.68 | |
| 2bka_A | 242 | CC3, TAT-interacting protein TIP30; NADPH, PEG600, | 90.65 | |
| 4e12_A | 283 | Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1 | 90.54 | |
| 1ur5_A | 309 | Malate dehydrogenase; oxidoreductase, tricarboxyli | 90.53 | |
| 3slg_A | 372 | PBGP3 protein; structural genomics, seattle struct | 90.52 | |
| 3o26_A | 311 | Salutaridine reductase; short chain dehydrogenase/ | 90.5 | |
| 2cvz_A | 289 | Dehydrogenase, 3-hydroxyisobutyrate dehydrogenase; | 90.44 | |
| 2v6b_A | 304 | L-LDH, L-lactate dehydrogenase; oxidoreductase, ra | 90.39 | |
| 3d1l_A | 266 | Putative NADP oxidoreductase BF3122; structural ge | 90.33 | |
| 3ew7_A | 221 | LMO0794 protein; Q8Y8U8_lismo, putative NAD-depend | 90.22 | |
| 3gvi_A | 324 | Malate dehydrogenase; NAD, oxidoreductase, tricarb | 90.22 | |
| 3tri_A | 280 | Pyrroline-5-carboxylate reductase; amino acid bios | 90.16 | |
| 4egb_A | 346 | DTDP-glucose 4,6-dehydratase; rhamnose pathway, ce | 90.14 | |
| 3r6d_A | 221 | NAD-dependent epimerase/dehydratase; structural ge | 90.12 | |
| 3pef_A | 287 | 6-phosphogluconate dehydrogenase, NAD-binding; gam | 90.04 | |
| 3dqp_A | 219 | Oxidoreductase YLBE; alpha-beta protein., structur | 89.94 | |
| 3m2p_A | 311 | UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J | 89.85 | |
| 2gf2_A | 296 | Hibadh, 3-hydroxyisobutyrate dehydrogenase; struct | 89.84 | |
| 3l9w_A | 413 | Glutathione-regulated potassium-efflux system Pro | 89.82 | |
| 3g0o_A | 303 | 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine | 89.81 | |
| 3tri_A | 280 | Pyrroline-5-carboxylate reductase; amino acid bios | 89.78 | |
| 1a5z_A | 319 | L-lactate dehydrogenase; oxidoreductase, glycolysi | 89.75 | |
| 1p77_A | 272 | Shikimate 5-dehydrogenase; NADPH, oxidoreductase; | 89.75 | |
| 3ius_A | 286 | Uncharacterized conserved protein; APC63810, silic | 89.7 | |
| 3dtt_A | 245 | NADP oxidoreductase; structural genomics, joint ce | 89.66 | |
| 3pdu_A | 287 | 3-hydroxyisobutyrate dehydrogenase family protein; | 89.62 | |
| 3p7m_A | 321 | Malate dehydrogenase; putative dehydrogenase, enzy | 89.45 | |
| 3qvo_A | 236 | NMRA family protein; structural genomics, PSI-biol | 89.4 | |
| 1xu9_A | 286 | Corticosteroid 11-beta-dehydrogenase, isozyme 1; h | 89.37 | |
| 2b69_A | 343 | UDP-glucuronate decarboxylase 1; UDP-glucoronic ac | 89.21 | |
| 2gn4_A | 344 | FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann | 89.21 | |
| 3phh_A | 269 | Shikimate dehydrogenase; shikimate pathway, helico | 89.12 | |
| 3gt0_A | 247 | Pyrroline-5-carboxylate reductase; structural geno | 89.12 | |
| 1ez4_A | 318 | Lactate dehydrogenase; rossmann fold, oxidoreducta | 89.06 | |
| 1sb8_A | 352 | WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCN | 89.05 | |
| 1y1p_A | 342 | ARII, aldehyde reductase II; rossmann fold, short | 89.04 | |
| 3ioy_A | 319 | Short-chain dehydrogenase/reductase SDR; structura | 89.0 | |
| 3ius_A | 286 | Uncharacterized conserved protein; APC63810, silic | 88.99 | |
| 3rkr_A | 262 | Short chain oxidoreductase; rossmann fold; HET: NA | 88.95 | |
| 3qvo_A | 236 | NMRA family protein; structural genomics, PSI-biol | 88.95 | |
| 1nvt_A | 287 | Shikimate 5'-dehydrogenase; structural genomics, P | 88.94 | |
| 3vps_A | 321 | TUNA, NAD-dependent epimerase/dehydratase; tunicam | 88.93 | |
| 3svt_A | 281 | Short-chain type dehydrogenase/reductase; ssgcid, | 88.9 | |
| 3vku_A | 326 | L-LDH, L-lactate dehydrogenase; rossmann fold, NAD | 88.9 | |
| 3i1j_A | 247 | Oxidoreductase, short chain dehydrogenase/reducta; | 88.87 | |
| 3m2p_A | 311 | UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J | 88.84 | |
| 3gaf_A | 256 | 7-alpha-hydroxysteroid dehydrogenase; seattle stru | 88.82 | |
| 3u62_A | 253 | Shikimate dehydrogenase; shikimate pathway, oxidor | 88.79 | |
| 1ks9_A | 291 | KPA reductase;, 2-dehydropantoate 2-reductase; PAN | 88.78 | |
| 3c85_A | 183 | Putative glutathione-regulated potassium-efflux S | 88.74 | |
| 3fi9_A | 343 | Malate dehydrogenase; structural genomics, oxidore | 88.73 | |
| 2pzm_A | 330 | Putative nucleotide sugar epimerase/ dehydratase; | 88.73 | |
| 1t2d_A | 322 | LDH-P, L-lactate dehydrogenase; ternary complex, o | 88.72 | |
| 2z1n_A | 260 | Dehydrogenase; reductase, SDR, oxidoreductase; 1.8 | 88.6 | |
| 3ucx_A | 264 | Short chain dehydrogenase; ssgcid, seattle structu | 88.58 | |
| 3uve_A | 286 | Carveol dehydrogenase ((+)-trans-carveol dehydrog; | 88.58 | |
| 3kkj_A | 336 | Amine oxidase, flavin-containing; oxidoreductase, | 88.56 | |
| 2hjr_A | 328 | Malate dehydrogenase; malaria, structural genomics | 88.53 | |
| 3ko8_A | 312 | NAD-dependent epimerase/dehydratase; isomerase, UD | 88.51 | |
| 4dll_A | 320 | 2-hydroxy-3-oxopropionate reductase; structural ge | 88.5 | |
| 3ggo_A | 314 | Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-b | 88.46 | |
| 3sju_A | 279 | Keto reductase; short-chain dehydrogenase, oxidore | 88.44 | |
| 2ph5_A | 480 | Homospermidine synthase; alpha-beta protein, struc | 88.4 | |
| 2gn4_A | 344 | FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann | 88.37 | |
| 1x7d_A | 350 | Ornithine cyclodeaminase; binds NAD+, binds L-orni | 88.34 | |
| 4e21_A | 358 | 6-phosphogluconate dehydrogenase (decarboxylating; | 88.33 | |
| 3pk0_A | 262 | Short-chain dehydrogenase/reductase SDR; ssgcid, s | 88.32 | |
| 2bll_A | 345 | Protein YFBG; decarboxylase, short chain dehydroge | 88.27 | |
| 2d5c_A | 263 | AROE, shikimate 5-dehydrogenase; substrate, dimer, | 88.22 | |
| 3i6i_A | 346 | Putative leucoanthocyanidin reductase 1; rossmann | 88.22 | |
| 3rft_A | 267 | Uronate dehydrogenase; apoenzyme, rossmann fold, N | 88.21 | |
| 2pv7_A | 298 | T-protein [includes: chorismate mutase (EC 5.4.99 | 88.21 | |
| 3tjr_A | 301 | Short chain dehydrogenase; structural genomics, se | 88.2 | |
| 3pqe_A | 326 | L-LDH, L-lactate dehydrogenase; FBP, oxidoreductas | 88.19 | |
| 1sby_A | 254 | Alcohol dehydrogenase; ternary complex, NAD, trifl | 88.14 | |
| 1yb4_A | 295 | Tartronic semialdehyde reductase; structural genom | 88.12 | |
| 2d5c_A | 263 | AROE, shikimate 5-dehydrogenase; substrate, dimer, | 87.97 | |
| 3tox_A | 280 | Short chain dehydrogenase; structural genomics, PS | 87.97 | |
| 2f1k_A | 279 | Prephenate dehydrogenase; tyrosine synthesis, X-RA | 87.88 | |
| 2uyy_A | 316 | N-PAC protein; long-chain dehydrogenase, cytokine; | 87.84 | |
| 3rwb_A | 247 | TPLDH, pyridoxal 4-dehydrogenase; short chain dehy | 87.84 | |
| 4da9_A | 280 | Short-chain dehydrogenase/reductase; structural ge | 87.83 | |
| 4g65_A | 461 | TRK system potassium uptake protein TRKA; structur | 87.82 | |
| 3l6d_A | 306 | Putative oxidoreductase; structural genomics, prot | 87.81 | |
| 3gvx_A | 290 | Glycerate dehydrogenase related protein; NYSGXRC, | 87.81 | |
| 3vps_A | 321 | TUNA, NAD-dependent epimerase/dehydratase; tunicam | 87.8 | |
| 2dc1_A | 236 | L-aspartate dehydrogenase; NAD, oxidoreductase; HE | 87.79 | |
| 1bg6_A | 359 | N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L | 87.78 | |
| 2x4g_A | 342 | Nucleoside-diphosphate-sugar epimerase; isomerase; | 87.78 | |
| 3tfo_A | 264 | Putative 3-oxoacyl-(acyl-carrier-protein) reducta; | 87.78 | |
| 2ew2_A | 316 | 2-dehydropantoate 2-reductase, putative; alpha-str | 87.75 | |
| 3pgx_A | 280 | Carveol dehydrogenase; structural genomics, seattl | 87.74 | |
| 3nep_X | 314 | Malate dehydrogenase; halophIle, molecular adpatat | 87.73 | |
| 3phh_A | 269 | Shikimate dehydrogenase; shikimate pathway, helico | 87.72 | |
| 4egf_A | 266 | L-xylulose reductase; structural genomics, ssgcid, | 87.66 | |
| 3qlj_A | 322 | Short chain dehydrogenase; structural genomics, se | 87.58 | |
| 2xxj_A | 310 | L-LDH, L-lactate dehydrogenase; oxidoreductase, hy | 87.57 | |
| 4e6p_A | 259 | Probable sorbitol dehydrogenase (L-iditol 2-dehyd; | 87.57 | |
| 3sxp_A | 362 | ADP-L-glycero-D-mannoheptose-6-epimerase; rossman | 87.52 | |
| 1lnq_A | 336 | MTHK channels, potassium channel related protein; | 87.44 | |
| 2zqz_A | 326 | L-LDH, L-lactate dehydrogenase; oxidoreductase, ro | 87.39 | |
| 3lk7_A | 451 | UDP-N-acetylmuramoylalanine--D-glutamate ligase; a | 87.34 | |
| 2rcy_A | 262 | Pyrroline carboxylate reductase; malaria, structur | 87.32 | |
| 3nzo_A | 399 | UDP-N-acetylglucosamine 4,6-dehydratase; structura | 87.31 | |
| 2zat_A | 260 | Dehydrogenase/reductase SDR family member 4; alpha | 87.25 | |
| 2g5c_A | 281 | Prephenate dehydrogenase; TYRA, oxidoreductase; HE | 87.23 | |
| 4huj_A | 220 | Uncharacterized protein; PSI-biology, nysgrc, stru | 87.18 | |
| 3r1i_A | 276 | Short-chain type dehydrogenase/reductase; structur | 87.17 | |
| 4ibo_A | 271 | Gluconate dehydrogenase; enzyme function initiativ | 87.16 | |
| 3jtm_A | 351 | Formate dehydrogenase, mitochondrial; mitochondrio | 87.16 | |
| 1gee_A | 261 | Glucose 1-dehydrogenase; short-chain dehydrogenase | 87.14 | |
| 2pv7_A | 298 | T-protein [includes: chorismate mutase (EC 5.4.99 | 87.11 | |
| 3grp_A | 266 | 3-oxoacyl-(acyl carrierprotein) reductase; structu | 87.08 | |
| 2cvz_A | 289 | Dehydrogenase, 3-hydroxyisobutyrate dehydrogenase; | 87.07 | |
| 1x7d_A | 350 | Ornithine cyclodeaminase; binds NAD+, binds L-orni | 87.06 | |
| 1sb8_A | 352 | WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCN | 86.95 | |
| 3sxp_A | 362 | ADP-L-glycero-D-mannoheptose-6-epimerase; rossman | 86.91 | |
| 4dqv_A | 478 | Probable peptide synthetase NRP (peptide synthase; | 86.91 | |
| 2q1s_A | 377 | Putative nucleotide sugar epimerase/ dehydratase; | 86.85 | |
| 3tsc_A | 277 | Putative oxidoreductase; structural genomics, seat | 86.85 | |
| 1lu9_A | 287 | Methylene tetrahydromethanopterin dehydrogenase; a | 86.84 | |
| 3v2h_A | 281 | D-beta-hydroxybutyrate dehydrogenase; structural g | 86.84 | |
| 2x0j_A | 294 | Malate dehydrogenase; oxidoreductase, hyperthermop | 86.82 | |
| 3c24_A | 286 | Putative oxidoreductase; YP_511008.1, structural g | 86.81 | |
| 2jah_A | 247 | Clavulanic acid dehydrogenase; short-chain dehydro | 86.81 | |
| 2ae2_A | 260 | Protein (tropinone reductase-II); oxidoreductase, | 86.8 | |
| 3enk_A | 341 | UDP-glucose 4-epimerase; seattle structural genomi | 86.78 | |
| 3r6d_A | 221 | NAD-dependent epimerase/dehydratase; structural ge | 86.78 | |
| 3sx2_A | 278 | Putative 3-ketoacyl-(acyl-carrier-protein) reduct; | 86.77 | |
| 2zyd_A | 480 | 6-phosphogluconate dehydrogenase, decarboxylating; | 86.73 | |
| 2bka_A | 242 | CC3, TAT-interacting protein TIP30; NADPH, PEG600, | 86.72 | |
| 1p9l_A | 245 | Dihydrodipicolinate reductase; oxidoreductase, lys | 86.7 | |
| 1yb1_A | 272 | 17-beta-hydroxysteroid dehydrogenase type XI; shor | 86.68 | |
| 3h7a_A | 252 | Short chain dehydrogenase; oxidoreductase, PSI-2, | 86.66 | |
| 2q1s_A | 377 | Putative nucleotide sugar epimerase/ dehydratase; | 86.66 | |
| 3t4x_A | 267 | Oxidoreductase, short chain dehydrogenase/reducta; | 86.64 | |
| 1vl6_A | 388 | Malate oxidoreductase; TM0542, NAD-dependent malic | 86.61 | |
| 3awd_A | 260 | GOX2181, putative polyol dehydrogenase; oxidoreduc | 86.59 | |
| 3ngx_A | 276 | Bifunctional protein fold; methylenetetrahydrofola | 86.57 | |
| 4iin_A | 271 | 3-ketoacyl-acyl carrier protein reductase (FABG); | 86.55 | |
| 2yq5_A | 343 | D-isomer specific 2-hydroxyacid dehydrogenase; oxi | 86.49 | |
| 1guz_A | 310 | Malate dehydrogenase; oxidoreductase, tricarboxyli | 86.46 | |
| 3obb_A | 300 | Probable 3-hydroxyisobutyrate dehydrogenase; struc | 86.46 | |
| 4imr_A | 275 | 3-oxoacyl-(acyl-carrier-protein) reductase; oxidor | 86.44 | |
| 3lyl_A | 247 | 3-oxoacyl-(acyl-carrier-protein) reductase; alpha | 86.41 | |
| 1oaa_A | 259 | Sepiapterin reductase; tetrahydrobiopterin, oxidor | 86.39 | |
| 4fc7_A | 277 | Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossman | 86.38 | |
| 1fmc_A | 255 | 7 alpha-hydroxysteroid dehydrogenase; short-chain | 86.37 | |
| 3v2g_A | 271 | 3-oxoacyl-[acyl-carrier-protein] reductase; struct | 86.37 | |
| 4fn4_A | 254 | Short chain dehydrogenase; NADH-binding, rossmann | 86.3 | |
| 2d4a_B | 308 | Malate dehydrogenase; archaea, hyperthermophIle, o | 86.27 | |
| 3fbt_A | 282 | Chorismate mutase and shikimate 5-dehydrogenase fu | 86.27 | |
| 2x6t_A | 357 | ADP-L-glycero-D-manno-heptose-6-epimerase; isomera | 86.25 | |
| 2h78_A | 302 | Hibadh, 3-hydroxyisobutyrate dehydrogenase; APC601 | 86.24 | |
| 1o0s_A | 605 | NAD-ME, NAD-dependent malic enzyme; oxidoreductase | 86.19 | |
| 3imf_A | 257 | Short chain dehydrogenase; structural genomics, in | 86.17 | |
| 1ldn_A | 316 | L-lactate dehydrogenase; oxidoreductase(CHOH(D)-NA | 86.16 | |
| 3nzo_A | 399 | UDP-N-acetylglucosamine 4,6-dehydratase; structura | 86.15 | |
| 3ggo_A | 314 | Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-b | 86.04 | |
| 2z1m_A | 345 | GDP-D-mannose dehydratase; short-chain dehydrogena | 85.98 | |
| 4a26_A | 300 | Putative C-1-tetrahydrofolate synthase, cytoplasm; | 85.98 | |
| 1o6z_A | 303 | MDH, malate dehydrogenase; halophilic, ION-binding | 85.94 | |
| 3nyw_A | 250 | Putative oxidoreductase; fatty acid synthesis,3-ox | 85.9 | |
| 1a4i_A | 301 | Methylenetetrahydrofolate dehydrogenase / methenyl | 85.88 | |
| 3hn2_A | 312 | 2-dehydropantoate 2-reductase; PSI-2, NYSGXRC, str | 85.88 | |
| 3v8b_A | 283 | Putative dehydrogenase, possibly 3-oxoacyl-[acyl- | 85.87 | |
| 3ew7_A | 221 | LMO0794 protein; Q8Y8U8_lismo, putative NAD-depend | 85.84 | |
| 2ywl_A | 180 | Thioredoxin reductase related protein; uncharacter | 85.82 | |
| 3l77_A | 235 | Short-chain alcohol dehydrogenase; oxidoreductase; | 85.79 | |
| 3u62_A | 253 | Shikimate dehydrogenase; shikimate pathway, oxidor | 85.79 | |
| 3ksu_A | 262 | 3-oxoacyl-acyl carrier protein reductase; structur | 85.78 | |
| 1dih_A | 273 | Dihydrodipicolinate reductase; oxidoreductase; HET | 85.69 | |
| 3ego_A | 307 | Probable 2-dehydropantoate 2-reductase; structural | 85.68 | |
| 3i83_A | 320 | 2-dehydropantoate 2-reductase; structural genomics | 85.64 | |
| 3ftp_A | 270 | 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid | 85.62 | |
| 1mxh_A | 276 | Pteridine reductase 2; SDR topology, protein-subst | 85.59 | |
| 1oju_A | 294 | MDH, malate dehydrogenase; hyperthermophilic, oxid | 85.59 | |
| 3g0o_A | 303 | 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine | 85.56 | |
| 1xg5_A | 279 | ARPG836; short chain dehydrogenase, human, SGC, st | 85.55 | |
| 1yxm_A | 303 | Pecra, peroxisomal trans 2-enoyl COA reductase; pe | 85.54 | |
| 1t2d_A | 322 | LDH-P, L-lactate dehydrogenase; ternary complex, o | 85.52 | |
| 3i6i_A | 346 | Putative leucoanthocyanidin reductase 1; rossmann | 85.52 | |
| 1i36_A | 264 | Conserved hypothetical protein MTH1747; NADP bindi | 85.5 | |
| 1zcj_A | 463 | Peroxisomal bifunctional enzyme; peroxisomal multi | 85.46 | |
| 1zem_A | 262 | Xylitol dehydrogenase; rossmann fold, dinucleotide | 85.45 | |
| 1pzg_A | 331 | LDH, lactate dehydrogenase; apicomplexa, APAD, tet | 85.42 | |
| 3afn_B | 258 | Carbonyl reductase; alpha/beta/alpha, rossmann-fol | 85.37 | |
| 1rkx_A | 357 | CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; | 85.34 | |
| 3u9l_A | 324 | 3-oxoacyl-[acyl-carrier-protein] reductase; struct | 85.28 | |
| 1vl6_A | 388 | Malate oxidoreductase; TM0542, NAD-dependent malic | 85.27 | |
| 3r3s_A | 294 | Oxidoreductase; structural genomics, csgid, center | 85.25 | |
| 1gq2_A | 555 | Malic enzyme; oxidoreductase, pigeon liver, NADP-d | 85.24 | |
| 2v6b_A | 304 | L-LDH, L-lactate dehydrogenase; oxidoreductase, ra | 85.2 | |
| 2z1m_A | 345 | GDP-D-mannose dehydratase; short-chain dehydrogena | 85.2 | |
| 3doj_A | 310 | AT3G25530, dehydrogenase-like protein; gamma-hydro | 85.2 | |
| 2x4g_A | 342 | Nucleoside-diphosphate-sugar epimerase; isomerase; | 85.19 | |
| 3gvc_A | 277 | Oxidoreductase, probable short-chain type dehydrog | 85.11 | |
| 2bgk_A | 278 | Rhizome secoisolariciresinol dehydrogenase; oxidor | 85.11 | |
| 2j6i_A | 364 | Formate dehydrogenase; oxidoreductase, D-specific- | 85.09 | |
| 1ez4_A | 318 | Lactate dehydrogenase; rossmann fold, oxidoreducta | 85.07 | |
| 2a9f_A | 398 | Putative malic enzyme ((S)-malate:NAD+ oxidoreduct | 85.06 | |
| 4fs3_A | 256 | Enoyl-[acyl-carrier-protein] reductase [NADPH] FA; | 85.05 | |
| 3p2o_A | 285 | Bifunctional protein fold; structural genomics, ce | 85.04 | |
| 3hwr_A | 318 | 2-dehydropantoate 2-reductase; YP_299159.1, PANE/A | 85.01 | |
| 2i99_A | 312 | MU-crystallin homolog; thyroid hormine binding pro | 84.94 | |
| 1y6j_A | 318 | L-lactate dehydrogenase; southeast collaboratory f | 84.94 | |
| 3ai3_A | 263 | NADPH-sorbose reductase; rossmann-fold, NADPH-depe | 84.94 | |
| 2c5a_A | 379 | GDP-mannose-3', 5'-epimerase; short chain dehydrat | 84.93 | |
| 3n74_A | 261 | 3-ketoacyl-(acyl-carrier-protein) reductase; seatt | 84.93 | |
| 3rih_A | 293 | Short chain dehydrogenase or reductase; structural | 84.92 | |
| 2qyt_A | 317 | 2-dehydropantoate 2-reductase; APC81190, porphyrom | 84.9 | |
| 2rhc_B | 277 | Actinorhodin polyketide ketoreductase; oxidoreduct | 84.84 | |
| 3o38_A | 266 | Short chain dehydrogenase; tuberculosis, ortholog | 84.82 | |
| 1b0a_A | 288 | Protein (fold bifunctional protein); folate, dehyd | 84.79 | |
| 2gdz_A | 267 | NAD+-dependent 15-hydroxyprostaglandin dehydrogen; | 84.7 | |
| 4hb9_A | 412 | Similarities with probable monooxygenase; flavin, | 84.65 | |
| 1omo_A | 322 | Alanine dehydrogenase; two-domain, beta-sandwich-d | 84.65 | |
| 1rkx_A | 357 | CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; | 84.65 | |
| 3d0o_A | 317 | L-LDH 1, L-lactate dehydrogenase 1; cytoplasm, gly | 84.59 | |
| 2nac_A | 393 | NAD-dependent formate dehydrogenase; oxidoreductas | 84.57 | |
| 3e48_A | 289 | Putative nucleoside-diphosphate-sugar epimerase; a | 84.55 | |
| 4f6c_A | 427 | AUSA reductase domain protein; thioester reductase | 84.51 | |
| 4gwg_A | 484 | 6-phosphogluconate dehydrogenase, decarboxylating; | 84.5 | |
| 3kkj_A | 336 | Amine oxidase, flavin-containing; oxidoreductase, | 84.48 | |
| 2izz_A | 322 | Pyrroline-5-carboxylate reductase 1; amino-acid bi | 84.42 | |
| 1wma_A | 276 | Carbonyl reductase [NADPH] 1; oxidoreductase; HET: | 84.4 | |
| 2qq5_A | 260 | DHRS1, dehydrogenase/reductase SDR family member 1 | 84.4 | |
| 4e5n_A | 330 | Thermostable phosphite dehydrogenase; D-2-hydroxya | 84.37 | |
| 3ehe_A | 313 | UDP-glucose 4-epimerase (GALE-1); PSI-II, NYSGXRC, | 84.33 | |
| 1spx_A | 278 | Short-chain reductase family member (5L265); paral | 84.33 | |
| 3ko8_A | 312 | NAD-dependent epimerase/dehydratase; isomerase, UD | 84.3 | |
| 2i99_A | 312 | MU-crystallin homolog; thyroid hormine binding pro | 84.28 | |
| 2axq_A | 467 | Saccharopine dehydrogenase; rossmann fold variant, | 84.21 | |
| 4gx0_A | 565 | TRKA domain protein; membrane protein, ION channel | 84.14 | |
| 3oet_A | 381 | Erythronate-4-phosphate dehydrogenase; structural | 84.1 | |
| 3lf2_A | 265 | Short chain oxidoreductase Q9HYA2; SDR, SCOR, ross | 84.09 | |
| 3l07_A | 285 | Bifunctional protein fold; structural genomics, ID | 84.07 | |
| 2c5a_A | 379 | GDP-mannose-3', 5'-epimerase; short chain dehydrat | 84.02 | |
| 2cuk_A | 311 | Glycerate dehydrogenase/glyoxylate reductase; stru | 84.0 | |
| 4fgs_A | 273 | Probable dehydrogenase protein; PSI-biology, nysgr | 83.97 | |
| 3osu_A | 246 | 3-oxoacyl-[acyl-carrier-protein] reductase; struct | 83.95 | |
| 3qy9_A | 243 | DHPR, dihydrodipicolinate reductase; rossmann fold | 83.95 | |
| 3enk_A | 341 | UDP-glucose 4-epimerase; seattle structural genomi | 83.95 | |
| 1pjc_A | 361 | Protein (L-alanine dehydrogenase); oxidoreductase, | 83.92 | |
| 2q1w_A | 333 | Putative nucleotide sugar epimerase/ dehydratase; | 83.87 | |
| 1jay_A | 212 | Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossma | 83.85 | |
| 2ahr_A | 259 | Putative pyrroline carboxylate reductase; pyrrolin | 83.84 | |
| 4dyv_A | 272 | Short-chain dehydrogenase/reductase SDR; structura | 83.8 | |
| 2jl1_A | 287 | Triphenylmethane reductase; oxidoreductase, biorem | 83.79 | |
| 2o23_A | 265 | HADH2 protein; HSD17B10, schad, ERAB, type II HADH | 83.76 | |
| 3dtt_A | 245 | NADP oxidoreductase; structural genomics, joint ce | 83.72 | |
| 4dry_A | 281 | 3-oxoacyl-[acyl-carrier-protein] reductase; struct | 83.66 | |
| 2iz1_A | 474 | 6-phosphogluconate dehydrogenase, decarboxylating; | 83.63 | |
| 2a9f_A | 398 | Putative malic enzyme ((S)-malate:NAD+ oxidoreduct | 83.61 | |
| 3hg7_A | 324 | D-isomer specific 2-hydroxyacid dehydrogenase FAM | 83.61 | |
| 4dll_A | 320 | 2-hydroxy-3-oxopropionate reductase; structural ge | 83.61 | |
| 3eag_A | 326 | UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-ME | 83.58 | |
| 4dqx_A | 277 | Probable oxidoreductase protein; structural genomi | 83.5 | |
| 2nwq_A | 272 | Probable short-chain dehydrogenase; oxidoreductase | 83.48 | |
| 3b1f_A | 290 | Putative prephenate dehydrogenase; enzyme, 4-hydro | 83.45 | |
| 2pd6_A | 264 | Estradiol 17-beta-dehydrogenase 8; short-chain deh | 83.43 | |
| 1omo_A | 322 | Alanine dehydrogenase; two-domain, beta-sandwich-d | 83.41 | |
| 4eso_A | 255 | Putative oxidoreductase; NADP, structural genomics | 83.37 | |
| 3pef_A | 287 | 6-phosphogluconate dehydrogenase, NAD-binding; gam | 83.36 | |
| 1sby_A | 254 | Alcohol dehydrogenase; ternary complex, NAD, trifl | 83.36 | |
| 4dmm_A | 269 | 3-oxoacyl-[acyl-carrier-protein] reductase; rossma | 83.36 | |
| 1npy_A | 271 | Hypothetical shikimate 5-dehydrogenase-like protei | 83.34 | |
| 3l6e_A | 235 | Oxidoreductase, short-chain dehydrogenase/reducta; | 83.33 | |
| 1ur5_A | 309 | Malate dehydrogenase; oxidoreductase, tricarboxyli | 83.33 | |
| 1xq1_A | 266 | Putative tropinone reducatse; structural genomics, | 83.32 | |
| 3e48_A | 289 | Putative nucleoside-diphosphate-sugar epimerase; a | 83.3 | |
| 3cxt_A | 291 | Dehydrogenase with different specificities; rossma | 83.26 | |
| 3rd5_A | 291 | Mypaa.01249.C; ssgcid, structural genomics, seattl | 83.25 | |
| 4gx0_A | 565 | TRKA domain protein; membrane protein, ION channel | 83.24 | |
| 2pnf_A | 248 | 3-oxoacyl-[acyl-carrier-protein] reductase; short | 83.23 | |
| 1ja9_A | 274 | 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; p | 83.22 | |
| 2zqz_A | 326 | L-LDH, L-lactate dehydrogenase; oxidoreductase, ro | 83.22 | |
| 2gas_A | 307 | Isoflavone reductase; NADPH-dependent reductase, o | 83.19 | |
| 3grk_A | 293 | Enoyl-(acyl-carrier-protein) reductase (NADH); ssg | 83.19 | |
| 1iy8_A | 267 | Levodione reductase; oxidoreductase; HET: NAD; 1.6 | 83.18 | |
| 3hn2_A | 312 | 2-dehydropantoate 2-reductase; PSI-2, NYSGXRC, str | 83.16 | |
| 2hk9_A | 275 | Shikimate dehydrogenase; shikimate pathway, drug d | 83.15 | |
| 2rcy_A | 262 | Pyrroline carboxylate reductase; malaria, structur | 83.14 | |
| 3svt_A | 281 | Short-chain type dehydrogenase/reductase; ssgcid, | 83.13 | |
| 3gt0_A | 247 | Pyrroline-5-carboxylate reductase; structural geno | 83.05 | |
| 3is3_A | 270 | 17BETA-hydroxysteroid dehydrogenase; short chain d | 83.03 | |
| 3nv9_A | 487 | Malic enzyme; rossmann fold, oxidoreductase; 2.25A | 82.96 | |
| 2uvd_A | 246 | 3-oxoacyl-(acyl-carrier-protein) reductase; beta-k | 82.95 | |
| 2hrz_A | 342 | AGR_C_4963P, nucleoside-diphosphate-sugar epimeras | 82.93 | |
| 1ae1_A | 273 | Tropinone reductase-I; oxidoreductase, tropane alk | 82.92 | |
| 1xkq_A | 280 | Short-chain reductase family member (5D234); parra | 82.83 | |
| 4iiu_A | 267 | 3-oxoacyl-[acyl-carrier protein] reductase; struct | 82.82 | |
| 2b4q_A | 276 | Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier | 82.8 | |
| 1vl8_A | 267 | Gluconate 5-dehydrogenase; TM0441, structural geno | 82.79 | |
| 2ydy_A | 315 | Methionine adenosyltransferase 2 subunit beta; oxi | 82.74 | |
| 2xxj_A | 310 | L-LDH, L-lactate dehydrogenase; oxidoreductase, hy | 82.72 | |
| 3k96_A | 356 | Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA | 82.72 | |
| 3st7_A | 369 | Capsular polysaccharide synthesis enzyme CAP5F; ro | 82.72 | |
| 1txg_A | 335 | Glycerol-3-phosphate dehydrogenase [NAD(P)+]; oxid | 82.72 | |
| 4f3y_A | 272 | DHPR, dihydrodipicolinate reductase; structural ge | 82.71 | |
| 2x9g_A | 288 | PTR1, pteridine reductase; short chain dehydrogena | 82.71 | |
| 3rkr_A | 262 | Short chain oxidoreductase; rossmann fold; HET: NA | 82.69 | |
| 1nyt_A | 271 | Shikimate 5-dehydrogenase; alpha/beta domains, WID | 82.69 | |
| 1gpj_A | 404 | Glutamyl-tRNA reductase; tRNA-dependent tetrapyrro | 82.67 | |
| 3k6j_A | 460 | Protein F01G10.3, confirmed by transcript evidenc; | 82.59 | |
| 3gvx_A | 290 | Glycerate dehydrogenase related protein; NYSGXRC, | 82.59 | |
| 4aj2_A | 331 | L-lactate dehydrogenase A chain; oxidoreductase-in | 82.55 | |
| 2eez_A | 369 | Alanine dehydrogenase; TTHA0216, structural genomi | 82.47 | |
| 3op4_A | 248 | 3-oxoacyl-[acyl-carrier protein] reductase; 3-keto | 82.46 | |
| 2aef_A | 234 | Calcium-gated potassium channel MTHK; rossmann fol | 82.45 | |
| 1orr_A | 347 | CDP-tyvelose-2-epimerase; rossmann fold, short-cha | 82.42 | |
| 1z82_A | 335 | Glycerol-3-phosphate dehydrogenase; TM0378, struct | 82.42 | |
| 3k5p_A | 416 | D-3-phosphoglycerate dehydrogenase; niaid, ssgcid, | 82.42 | |
| 3hhp_A | 312 | Malate dehydrogenase; MDH, citric acid cycle, TCA | 82.39 | |
| 1nff_A | 260 | Putative oxidoreductase RV2002; directed evolution | 82.34 | |
| 3l6d_A | 306 | Putative oxidoreductase; structural genomics, prot | 82.33 | |
| 3ak4_A | 263 | NADH-dependent quinuclidinone reductase; SDR, (R)- | 82.3 | |
| 2iz1_A | 474 | 6-phosphogluconate dehydrogenase, decarboxylating; | 82.26 | |
| 3pp8_A | 315 | Glyoxylate/hydroxypyruvate reductase A; structural | 82.22 | |
| 3a28_C | 258 | L-2.3-butanediol dehydrogenase; chiral substrate r | 82.21 | |
| 2i6t_A | 303 | Ubiquitin-conjugating enzyme E2-like isoform A; L- | 82.21 | |
| 3qiv_A | 253 | Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR | 82.19 | |
| 3un1_A | 260 | Probable oxidoreductase; structural genomics, PSI- | 82.16 | |
| 3kb6_A | 334 | D-lactate dehydrogenase; oxidoreductase, D-LDH, NA | 82.1 | |
| 1zk4_A | 251 | R-specific alcohol dehydrogenase; short chain redu | 82.07 | |
| 3sc6_A | 287 | DTDP-4-dehydrorhamnose reductase; RFBD, structural | 82.05 | |
| 3gg2_A | 450 | Sugar dehydrogenase, UDP-glucose/GDP-mannose dehyd | 82.02 | |
| 1nyt_A | 271 | Shikimate 5-dehydrogenase; alpha/beta domains, WID | 81.98 | |
| 3i83_A | 320 | 2-dehydropantoate 2-reductase; structural genomics | 81.85 | |
| 1pj3_A | 564 | NAD-dependent malic enzyme, mitochondrial; oxidati | 81.76 | |
| 2c07_A | 285 | 3-oxoacyl-(acyl-carrier protein) reductase; oxidor | 81.74 | |
| 2hq1_A | 247 | Glucose/ribitol dehydrogenase; CTH-1438, structura | 81.73 | |
| 2dvm_A | 439 | Malic enzyme, 439AA long hypothetical malate oxido | 81.72 | |
| 3rft_A | 267 | Uronate dehydrogenase; apoenzyme, rossmann fold, N | 81.69 | |
| 3i1j_A | 247 | Oxidoreductase, short chain dehydrogenase/reducta; | 81.69 | |
| 3qlj_A | 322 | Short chain dehydrogenase; structural genomics, se | 81.66 | |
| 3cky_A | 301 | 2-hydroxymethyl glutarate dehydrogenase; rossmann | 81.65 | |
| 3qha_A | 296 | Putative oxidoreductase; seattle structural genomi | 81.63 | |
| 3ehe_A | 313 | UDP-glucose 4-epimerase (GALE-1); PSI-II, NYSGXRC, | 81.51 | |
| 3ghy_A | 335 | Ketopantoate reductase protein; oxidoreductase, NA | 81.45 | |
| 3ado_A | 319 | Lambda-crystallin; L-gulonate 3-dehydrogenase, str | 81.43 | |
| 1f0y_A | 302 | HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive | 81.39 | |
| 3s55_A | 281 | Putative short-chain dehydrogenase/reductase; stru | 81.39 | |
| 1vkn_A | 351 | N-acetyl-gamma-glutamyl-phosphate reductase; TM178 | 81.36 | |
| 2ejw_A | 332 | HDH, homoserine dehydrogenase; NAD-dependent, oxid | 81.34 | |
| 1geg_A | 256 | Acetoin reductase; SDR family, oxidoreductase; HET | 81.32 | |
| 3d4o_A | 293 | Dipicolinate synthase subunit A; NP_243269.1, stru | 81.28 | |
| 3ond_A | 488 | Adenosylhomocysteinase; plant protein, enzyme-subs | 81.25 | |
| 3ldh_A | 330 | Lactate dehydrogenase; oxidoreductase, CHOH donor, | 81.19 | |
| 3nep_X | 314 | Malate dehydrogenase; halophIle, molecular adpatat | 81.19 | |
| 2hun_A | 336 | 336AA long hypothetical DTDP-glucose 4,6-dehydrat; | 81.14 |
| >3cmm_A Ubiquitin-activating enzyme E1 1; UBA1, protein turnover, ligase, conformationa thioester, adenylation, transthioesterification, ATP-bindin nucleotide-binding; 2.70A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
Probab=100.00 E-value=9.6e-215 Score=2018.83 Aligned_cols=998 Identities=45% Similarity=0.815 Sum_probs=938.9
Q ss_pred CchhHhhhhhhhhccCHHHHHHhhcCeEEEEcCChHHHHHHHHHHHhCCCeEEEEeCCccCcccCCcccccCCCccCchH
Q 001074 154 TDIDEDLHSRQLAVYGRETMRRLFASNILVSGMQGLGAEIAKNLILAGVKSVTLHDEGTVELWDLSSNFVFSDNDIGKNR 233 (1163)
Q Consensus 154 ~~~d~~rYdRQi~l~G~e~q~kL~~s~VlIiG~gglGsEiaKNLvlaGVg~itLvD~d~V~~sDL~rqff~~~~DiGk~K 233 (1163)
++++++|||||+++||.++|++|++++|+|+|+||+|+|+||||+++|||+|||+|+|.|+++||+||||++++|||++|
T Consensus 3 ~~id~~rY~Rqi~l~G~~~q~rL~~s~VlIvG~GGlGseiak~La~aGVg~itlvD~D~V~~sNL~RQ~l~~~~dvG~~K 82 (1015)
T 3cmm_A 3 GEIDESLYSRQLYVLGKEAMLKMQTSNVLILGLKGLGVEIAKNVVLAGVKSMTVFDPEPVQLADLSTQFFLTEKDIGQKR 82 (1015)
T ss_dssp CCCCHHHHHHHHHHSCHHHHHHHTTCEEEEECCSHHHHHHHHHHHHHCCSEEEEECCSBCCGGGGGTCTTCCGGGTTSBH
T ss_pred hhhhhHhccchHhhcCHHHHHHHhcCEEEEECCChHHHHHHHHHHHcCCCeEEEecCCEechhhhccccccChhhcChHH
Confidence 47899999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred HHHHHHHHHHhcCCCEEEEeecCCChhhcCCCcEEEEecC-ChhHHHHHHHHHHhcCCCceeEEeeecceeEEEEEEcCC
Q 001074 234 ALASVQKLQELNNAVVLSTLTSKLTKEQLSDFQAVVFTDI-SLDKAIEFDDFCHNHQPAISFIKAEVRGLFGSVFCDFGP 312 (1163)
Q Consensus 234 aea~~~~L~eLNp~V~V~~~~~~l~~e~l~~fdvVI~~~~-~~~~~~~ln~~cr~~~~~IpfI~~~~~G~~G~vf~d~g~ 312 (1163)
|++++++|+++||+|+|+++...++++++.+||+||+|.+ +.+.+..||++|++++ +|||++++.|++|++|+|+|+
T Consensus 83 a~a~~~~L~~lNP~v~v~~~~~~l~~~~l~~~DvVv~~~d~~~~~r~~ln~~c~~~~--iplI~~~~~G~~G~v~~d~~~ 160 (1015)
T 3cmm_A 83 GDVTRAKLAELNAYVPVNVLDSLDDVTQLSQFQVVVATDTVSLEDKVKINEFCHSSG--IRFISSETRGLFGNTFVDLGD 160 (1015)
T ss_dssp HHHHHHHHTTSCTTSCEEECCCCCCSTTGGGCSEEEECTTSCHHHHHHHHHHHHHHT--CEEEEEEEETTEEEEEEECCS
T ss_pred HHHHHHHHHHHCCCCeEEEecCCCCHHHHhcCCEEEEcCCCCHHHHHHHHHHHHHcC--CCEEEEEecccEEEEEecCCC
Confidence 9999999999999999999999999999999999999999 9999999999999999 999999999999999999999
Q ss_pred ceEEEcCCCCCCcceeecccccCCCceeecccccccccccCCeeEEEeeccccccCCCCCccccccCcceeeeccccccc
Q 001074 313 EFTVVDVDGEDPHTGIIASISNDNPALVSCVDDERLEFQDGDLVVFSEVHGMTELNDGKPRKIKSARPYSFTLEEDTTNY 392 (1163)
Q Consensus 313 ~f~v~d~~ge~p~~~~I~~I~~~~~~lv~~~d~~rh~~~dgd~V~f~ev~gm~eln~~~~~~i~~~~~~~f~i~~Dt~~f 392 (1163)
+|.|.+.+|+.|.+.+|.+| +.|++++++++.+|++++||+|.|++++||+++|+++++++++.+||+|.| +|++.|
T Consensus 161 ~~~c~~~~~~~p~~~~i~~i--~~p~~v~~l~~~~h~~~~gd~v~F~ev~gm~elN~~e~~~i~~~~p~~f~I-~Dts~~ 237 (1015)
T 3cmm_A 161 EFTVLDPTGEEPRTGMVSDI--EPDGTVTMLDDNRHGLEDGNFVRFSEVEGLDKLNDGTLFKVEVLGPFAFRI-GSVKEY 237 (1015)
T ss_dssp CEEESBSSCCCCCEEEEEEE--CTTCEEEESTTCCCCCCTTCEEEEECCBTSGGGGSSCCEECEEEETTEEEC-SCCTTT
T ss_pred ceEEeeCCCCCCccccccCC--CCCceeEeeecccccCCCCCeEEEEeeccchhhcCccceeeEEcCCceeEe-cccchh
Confidence 99999999999999999999 567899999999999999999999999999999999999999999999999 699999
Q ss_pred cceeecceEEEeecCeeecccchHhhhcCCCCcccccCccCCCCChHHHHHHHHHHHHHHh-CCCCCCCCHHHHHHHHHH
Q 001074 393 GTYVKGGIVTQVKQPKVLNFKPLREALEDPGDFLLSDFSKFDRPPPLHLAFQALDKFVSEL-GRFPVAGSEEDAQKLISV 471 (1163)
Q Consensus 393 ~~y~~gg~~~qvk~p~~i~fksL~e~L~~p~~~l~~d~~k~~~~~~l~~~~~aL~~F~~~~-gr~P~~~~~~Da~~l~~i 471 (1163)
+.|++||+++|+|+|++++|++|++.+++| .++.+|+.|++++..+|++||||++|.++| ||+|++++++|+++|.++
T Consensus 238 ~~yv~~g~~~qvk~p~~i~f~~l~~~l~~p-~~l~~d~~k~~~~~~l~~~~~Al~~F~~~~~gr~P~~~~~~D~~~l~~~ 316 (1015)
T 3cmm_A 238 GEYKKGGIFTEVKVPRKISFKSLKQQLSNP-EFVFSDFAKFDRAAQLHLGFQALHQFAVRHNGELPRTMNDEDANELIKL 316 (1015)
T ss_dssp CCCCBCCEEEECCCCEEECCCCHHHHHHSC-CBCCSCGGGTHHHHHHHHHHHHHHHHHHHTTTCCCCTTCHHHHHHHHHH
T ss_pred hhhhcCceeEEecCCcccCHHHHHHHHcCh-HHHHHHHhccCcchHHHHHHHHHHHHHHhcCCCCCCCCCHHHHHHHHHH
Confidence 999999999999999999999999999999 477889998889999999999999999999 999999999999999999
Q ss_pred HHHHHHhcCCC--CCCCCCHHHHHHHHhhcccccCchhhHhhhhhhHHHHHhhcCCcccceeeeeeeccCCCCC---CCC
Q 001074 472 ATNINESLGDG--RVEDINTKLLRHFAFGARAVLNPMAAMFGGIVGQEVVKACSGKFHPLYQFFYFDSVESLPT---EPL 546 (1163)
Q Consensus 472 a~~i~~~~~~~--~~~~i~~~li~~~~~~~~~el~PvaA~iGGiaAQEVIKaiTgkf~PI~q~~~fD~ie~Lp~---~~~ 546 (1163)
+++++.+.+.. ...+++++++++|+++++++|||||||+||+|||||||+|||||+||+||||||+++++|. .++
T Consensus 317 a~~~~~~~~~~~~~~~~~~~~~~~e~~~~~~~el~pvaA~iGGivAQEVIKaiT~kf~Pi~~~~~~d~~~~~~~~~~~~~ 396 (1015)
T 3cmm_A 317 VTDLSVQQPEVLGEGVDVNEDLIKELSYQARGDIPGVVAFFGGLVAQEVLKACSGKFTPLKQFMYFDSLESLPDPKNFPR 396 (1015)
T ss_dssp HHHHHHHCHHHHCTTCCCCHHHHHHHHHTTTCCCHHHHHHHHHHHHHHHHHHHHCBSCCCCSEEEEECGGGSCCTTTSCC
T ss_pred HHHHHHhcCCCccccccCcHHHHHHHHHhcCcccCcHHHHhcchHHHHHHHHhccCCCcccceEEecchhhccccccCCC
Confidence 99998764311 0036889999999999999999999999999999999999999999999999999999994 567
Q ss_pred CCCCCCCccCchhhhhhhcCHHHHHHHhcCcEEEEecCcchHHHHHHHHHcccccCCCccEEEecCCcccccCcCcccCc
Q 001074 547 DSTEFKPINSRYDAQISVFGAKLQKKLEDAKVFIVGSGALGCEFLKNVALMGVSCGNQGKLTITDDDVIEKSNLSRQFLF 626 (1163)
Q Consensus 547 ~~~~~~~~~~Rydrq~~l~G~~~q~kL~~~kVlvVGaGglGce~lknLa~~Gv~~~~~g~i~ivD~D~Ie~SNLnRQfLf 626 (1163)
++++++|.++||+||+++||.++|++|++++|+||||||+||++|++||++||+||++|+|+|+|+|+|+.|||||||||
T Consensus 397 ~~~~~~~~~~Ry~rq~~l~G~~~q~kL~~~~VlvVGaGGlGsevlk~La~~Gv~~g~~G~i~lvD~D~Ve~SNLnRQ~lf 476 (1015)
T 3cmm_A 397 NEKTTQPVNSRYDNQIAVFGLDFQKKIANSKVFLVGSGAIGCEMLKNWALLGLGSGSDGYIVVTDNDSIEKSNLNRQFLF 476 (1015)
T ss_dssp STTTTSCCSSTTHHHHHHHCHHHHHHHHTCEEEEECCSHHHHHHHHHHHHHTTTCSTTCEEEEECCCBCCGGGTTTCTTC
T ss_pred ChhhccchhhhhhhHHHhcCHHHHHHHhcCeEEEEecCHHHHHHHHHHHHcCcCcCCCCeEEEEeCCEeccccccccccC
Confidence 78888898999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred ccCcccchHHHHHHHHHHhhCCCC--eEEEEeccCCcccccccchhhhccCCEEEEccCchHHHHHHHhhcccccccEEe
Q 001074 627 RDWNIGQAKSTVAASAATSINPRL--NIEALQNRVGPETENVFDDTFWENITCVINALDNVNARLYVDQRCLYFQKPLLE 704 (1163)
Q Consensus 627 ~~~dIG~~Ka~vaa~~l~~~np~~--~I~~~~~~v~~~~e~~~~~~f~~~~DvVi~alDn~~aR~~v~~~c~~~~~PlI~ 704 (1163)
+.+|||++||++|+++++++||++ +|+++..+++++++.+|+++||+++|+||+|+||+++|++++++|+.+++|+|+
T Consensus 477 ~~~dvG~~Ka~~aa~~l~~iNP~v~~~v~~~~~~i~~~~~~~~~~~~~~~~D~Vi~a~Dn~~aR~~ln~~c~~~~~Pli~ 556 (1015)
T 3cmm_A 477 RPKDVGKNKSEVAAEAVCAMNPDLKGKINAKIDKVGPETEEIFNDSFWESLDFVTNALDNVDARTYVDRRCVFYRKPLLE 556 (1015)
T ss_dssp CGGGTTSBHHHHHHHHHHHHCGGGTTTEEEECCCCSGGGTTTSCHHHHHHCSEEEECCSSHHHHHHHHHHHHHHTCCEEE
T ss_pred ChhhCCCHHHHHHHHHHHHHCCCCcceEEEEecccCchhhhhccHhhhccCCEEEECCCCHHHHHHHHHHHHHcCCcEEE
Confidence 999999999999999999999999 999999999998888888999999999999999999999999999999999999
Q ss_pred cCCCCcccceEEEeCCcccccCCCCCCCCCCCCCccccCCCCChhhHHHHHHHHhhhhccCChhhhhhccCCchhhhhhh
Q 001074 705 SGTLGAKCNTQMVIPHLTENYGASRDPPEKQAPMCTVHSFPHNIDHCLTWARSEFEGLLEKTPAEVNAYLSNPVEYTTSM 784 (1163)
Q Consensus 705 sgt~G~~G~v~viip~~t~~y~~~~dp~~~~~p~Ct~~~fP~~~~Hci~wAr~~F~~lF~~~~~~~n~~l~~~~~~~~~~ 784 (1163)
+|+.|++|++++++|+.|+||.|..+|+++.+|+||+++||+.++|||+|||++|+++|++.++++|+|++|| .|++.+
T Consensus 557 ~g~~G~~G~v~v~~p~~t~cy~c~~dp~~~~~P~Ctl~~~P~~~~h~i~wa~~~f~~lf~~~~~~~~~~l~~~-~~~~~~ 635 (1015)
T 3cmm_A 557 SGTLGTKGNTQVIIPRLTESYSSSRDPPEKSIPLCTLRSFPNKIDHTIAWAKSLFQGYFTDSAENVNMYLTQP-NFVEQT 635 (1015)
T ss_dssp EEEETTEEEEEEECTTTBCCGGGSCCCCCCCCCHHHHHTCCCSHHHHHHHHHHHHHHHHTHHHHHHHHHHHCT-THHHHH
T ss_pred eCCCccccceEEEeCCCCCccCCCCCCCCCCCCcccccCCCCCcHHHHHHHHHHHHHHHhhhhhhhhhhccCc-hhHHHH
Confidence 9999999999999999999999999999999999999999999999999999999999999999999999999 677777
Q ss_pred hhcCchhHHHHHHHHHHHhhhhcccchHHHHHHHHHHHHHHHHHHHHHHhhcCCccccccCCCCCccCCCCCCCccccCC
Q 001074 785 ANAGDAQARDNLERVLECLDKEKCEIFQDCITWARLKFEDYFSNRVKQLIFTFPEDAATSTGAPFWSAPKRFPHPLQFSS 864 (1163)
Q Consensus 785 ~~~~~~~~~~~l~~~~~~l~~~~~~~~~dci~~a~~~f~~~F~~~I~~Ll~~~p~d~~t~~g~~fWs~~kr~P~pl~fd~ 864 (1163)
.+.+..+. +.|+.+++.| ..+|.+|+||++||+.+|+++|+++|+|||++||+|++|++|+|||+||||+|+||+||+
T Consensus 636 ~~~~~~~~-~~l~~~~~~l-~~~~~~~~~c~~~a~~~f~~~F~~~I~~Ll~~~p~d~~~~~g~~fW~~~kr~P~pl~fd~ 713 (1015)
T 3cmm_A 636 LKQSGDVK-GVLESISDSL-SSKPHNFEDCIKWARLEFEKKFNHDIKQLLFNFPKDAKTSNGEPFWSGAKRAPTPLEFDI 713 (1015)
T ss_dssp HC---CCH-HHHHHHHHHH-HSCCSSHHHHHHHHHHHHHHHHTHHHHHHHHHSCTTCBCSTTCBSSCTTCCCCCCCCCCT
T ss_pred HhccchhH-HHHHHHHHHh-hcCCCcHHHHHHHHHHHHHHHHHHHHHHHHHhCCcccccccCcccccCCCCCCCCcccCC
Confidence 66544343 7789998888 788999999999999999999999999999999999999999999999999999999999
Q ss_pred CCCcchhHHHHHHHHHHHHcCCCCC--CCCCChHHHHHHhhhcCCCCcCCCCCcceecccccccccccCcCcHHHHHHHH
Q 001074 865 ADPSHLHFVMAASILRAETFGIPIP--DWTNNPKMLAEAVDKVMVPDFLPKKDAKILTDEKATTLSTASVDDAAVINDLI 942 (1163)
Q Consensus 865 ~~~~h~~fi~~~a~l~a~~~~i~~~--~~~~~~~~~~~~~~~~~~~~f~~~~~~~i~~~e~~~~~~~~~~~~~~~~~~l~ 942 (1163)
+|++|++||+++|+|+|++|||+.+ .|..+.+.+.++++++.+|+|.|+++++|.+++++...++...++.+.++.|.
T Consensus 714 ~~~~h~~fi~~~a~l~a~~~~i~~~~~~~~~~~~~~~~~~~~~~v~~f~~~~~~ki~~~~~~~~~~~~~~~~~~~~~~l~ 793 (1015)
T 3cmm_A 714 YNNDHFHFVVAGASLRAYNYGIKSDDSNSKPNVDEYKSVIDHMIIPEFTPNANLKIQVNDDDPDPNANAANGSDEIDQLV 793 (1015)
T ss_dssp TSHHHHHHHHHHHHHHHHHHTCCCSSTTSSCCHHHHHHHHTTCCCCCCCCCSSCCCCSSTTSSCC---------CCHHHH
T ss_pred CCHHHHHHHHHHHHhHHHhcCCCCccccccCCHHHHHHHHhhCcCCCcCCccCceeccchhhhcccccccccHHHHHHHH
Confidence 9999999999999999999999985 47788999999999999999999999999988876544332332445566777
Q ss_pred HHHHHhhhcCCCCCCcCCceeeccCCCCchhHHHHHHhhhhhhccCCCCccHHHHHHHhCcccchhhhhHHHHHHHHHHH
Q 001074 943 IKLEQCRKNLPSGFRLKPIQFEKDDDTNYHMDMIAGLANMRARNYSIPEVDKLKAKFIAGRIIPAIATSTAMATGLVCLE 1022 (1163)
Q Consensus 943 ~~l~~~~~~~~~~~~~~p~~FeKDDd~n~hidFi~aasNlRa~ny~I~~~~~~~~k~iAG~IIPAIaTTtA~vaGl~~lE 1022 (1163)
++|++... ..++++.|++||||||+|+|||||+|||||||+||+||++|||++|+|||||||||||||||||||+|+|
T Consensus 794 ~~l~~~~~--~~~~~~~~~~FeKDDd~n~h~dFi~aasNlRa~ny~I~~~~~~~~k~iaG~IIPAIaTT~AivaGl~~lE 871 (1015)
T 3cmm_A 794 SSLPDPST--LAGFKLEPVDFEKDDDTNHHIEFITACSNCRAQNYFIETADRQKTKFIAGRIIPAIATTTSLVTGLVNLE 871 (1015)
T ss_dssp TTSCCGGG--GTTCCCCCCCCCTTCTTSSHHHHHHHHHHHHHHHTTCCCCCHHHHHHHHTTCCCCCHHHHHHHHHHHHHH
T ss_pred HHhccchh--cccCCCCceeeecCCCchhHHHHHHHHHHHHHHHcCCCccCHHHHHHHhCCcCccchhHHHHHHHHHHHH
Confidence 66655433 2467899999999999999999999999999999999999999999999999999999999999999999
Q ss_pred HHHHhcCCCCcccccccccccccCcccccCCCCCcccccCCcce-eEEeEEEcCCCCcHHHHHHHHHHc-CCceeeeecC
Q 001074 1023 LYKVLDGGHKLEDYRNTFANLALPLFSMAEPVPPKVIKHRDMSW-TVWDRWILKDNPTLRELIQWLKDK-GLNAYSISCG 1100 (1163)
Q Consensus 1023 l~K~l~~~~~~~~~rn~f~nla~p~~~~~eP~~~~~~~~~~~~~-t~Wd~~~v~~~~TL~eli~~~~~k-~l~~~~I~~g 1100 (1163)
+||++++.+++++|||+|+|||+|+|.|+||.+|++.++...+| |+||||++.+++||+||+++|+++ |++++||++|
T Consensus 872 ~~K~~~~~~~~~~~kn~f~nla~~~~~~~~p~~~~~~~~~~~~~~t~wd~~~v~~~~Tl~~li~~~~~~~~~~~~~i~~~ 951 (1015)
T 3cmm_A 872 LYKLIDNKTDIEQYKNGFVNLALPFFGFSEPIASPKGEYNNKKYDKIWDRFDIKGDIKLSDLIEHFEKDEGLEITMLSYG 951 (1015)
T ss_dssp HHHHHTTCCCGGGCCEEEEETTTTEEEEECCCBCCEEEETTEEEETTTCEEEEESCCBHHHHHHHHHHTTCCEEEEEEET
T ss_pred HHHHHhcccchhhhhhHHHhccCCceeecCCCCCCCCCCCCCCCCeEEEEEEECCCCcHHHHHHHHHHHhCCcceeeccC
Confidence 99999987889999999999999999999999999988888899 999999998899999999999999 9999999999
Q ss_pred CceeecCCCc--chhhcccCcHHHHHHHhhccCCCCceeEEEEEEEeecCCCCccccCeEEEEe
Q 001074 1101 SCLLFNSMFP--RHKERMDKKVVDLAREVAKVELPPYRRHLDVVVACEDDEDNDIDIPLISIYF 1162 (1163)
Q Consensus 1101 ~~llY~~~~~--~~~~~l~~~l~~l~~~~~~~~~~~~~~~~~l~~~~~d~~~~~~~~P~v~~~~ 1162 (1163)
+++||++++| ++++||+++|+||++.++++++|++++||+|+|+|+|++++||++|+|||+|
T Consensus 952 ~~~ly~~~~~~~~~~~~l~~~l~~l~~~~~~~~~~~~~~~~~~~~~~~d~~~~d~~~p~v~~~~ 1015 (1015)
T 3cmm_A 952 VSLLYASFFPPKKLKERLNLPITQLVKLVTKKDIPAHVSTMILEICADDKEGEDVEVPFITIHL 1015 (1015)
T ss_dssp TEEEEETTCCHHHHHHHTTSBHHHHHHHHSSSCCCSSCCEEEEEEEEECTTSCEECCCEEEEEC
T ss_pred CcEEEecCCCchhhHHhccCCHHHHHHhhccCcCCCCceEEEEEEEecCCCCCcCCCCcEEEeC
Confidence 9999999987 6789999999999999999999999999999999999999999999999986
|
| >1y8q_B Anthracycline-, ubiquitin-like 2 activating enzyme E1B; SUMO, heterodimer, UBL, ligase; HET: ATP; 2.25A {Homo sapiens} PDB: 1y8r_B* 3kyc_B* 3kyd_B* 2px9_A | Back alignment and structure |
|---|
| >1z7l_A Ubiquitin-activating enzyme E1 1; SCCH, second catalytic cysteine half-domain, ligase; HET: TBR; 2.80A {Mus musculus} | Back alignment and structure |
|---|
| >1tt5_A APPBP1, amyloid protein-binding protein 1; cell cycle, ligase; 2.60A {Homo sapiens} SCOP: c.111.1.2 PDB: 3dbh_A 3dbl_A 3dbr_A 1r4m_A 1r4n_A* 2nvu_A* 1yov_A 3gzn_A* | Back alignment and structure |
|---|
| >1y8q_A Ubiquitin-like 1 activating enzyme E1A; SUMO, heterodimer, UBL, ligase; HET: ATP; 2.25A {Homo sapiens} PDB: 1y8r_A* 3kyc_A* 3kyd_A* | Back alignment and structure |
|---|
| >1tt5_B Ubiquitin-activating enzyme E1C isoform 1; cell cycle, ligase; 2.60A {Homo sapiens} SCOP: c.111.1.2 PDB: 3dbl_B 3dbr_B 3dbh_B 3gzn_B* 1yov_B 1r4m_B 1r4n_B* | Back alignment and structure |
|---|
| >2nvu_B Maltose binding protein/NEDD8-activating enzyme E1 catalytic subunit chimera; multifunction macromolecular complex, ubiquitin, ATP, conformational change, thioester, switch, adenylation, protein turnover, ligase; HET: ATP; 2.80A {Homo sapiens} SCOP: c.111.1.2 c.94.1.1 | Back alignment and structure |
|---|
| >1y8q_A Ubiquitin-like 1 activating enzyme E1A; SUMO, heterodimer, UBL, ligase; HET: ATP; 2.25A {Homo sapiens} PDB: 1y8r_A* 3kyc_A* 3kyd_A* | Back alignment and structure |
|---|
| >1tt5_A APPBP1, amyloid protein-binding protein 1; cell cycle, ligase; 2.60A {Homo sapiens} SCOP: c.111.1.2 PDB: 3dbh_A 3dbl_A 3dbr_A 1r4m_A 1r4n_A* 2nvu_A* 1yov_A 3gzn_A* | Back alignment and structure |
|---|
| >1tt5_B Ubiquitin-activating enzyme E1C isoform 1; cell cycle, ligase; 2.60A {Homo sapiens} SCOP: c.111.1.2 PDB: 3dbl_B 3dbr_B 3dbh_B 3gzn_B* 1yov_B 1r4m_B 1r4n_B* | Back alignment and structure |
|---|
| >3h8v_A Ubiquitin-like modifier-activating enzyme 5; rossman fold, ATP-binding, UBL conjugation pathway, transfer structural genomics consortium, SGC; HET: ATP; 2.00A {Homo sapiens} PDB: 3guc_A* | Back alignment and structure |
|---|
| >1zud_1 Adenylyltransferase THIF; thiamin, thiazole, protein-protein complex, THIF, TRAN biosynthetic protein complex; 1.98A {Escherichia coli} PDB: 1zfn_A* 1zkm_A | Back alignment and structure |
|---|
| >1zud_1 Adenylyltransferase THIF; thiamin, thiazole, protein-protein complex, THIF, TRAN biosynthetic protein complex; 1.98A {Escherichia coli} PDB: 1zfn_A* 1zkm_A | Back alignment and structure |
|---|
| >2nvu_B Maltose binding protein/NEDD8-activating enzyme E1 catalytic subunit chimera; multifunction macromolecular complex, ubiquitin, ATP, conformational change, thioester, switch, adenylation, protein turnover, ligase; HET: ATP; 2.80A {Homo sapiens} SCOP: c.111.1.2 c.94.1.1 | Back alignment and structure |
|---|
| >1jw9_B Molybdopterin biosynthesis MOEB protein; MOEB: modified rossmann fold, (2) Cys-X-X-Cys zinc-binding M MOAD: ubiquitin-like fold; 1.70A {Escherichia coli} SCOP: c.111.1.1 PDB: 1jwa_B* 1jwb_B* | Back alignment and structure |
|---|
| >3h5n_A MCCB protein; ubiquitin-activating enzyme, microcin, protein structure, MCCC7, peptide antibiotics, N-P bond formation, transferase; HET: ATP; 1.90A {Escherichia coli} PDB: 3h5r_A 3h9g_A 3h9j_A* 3h9q_A 3h5a_A | Back alignment and structure |
|---|
| >3rui_A Ubiquitin-like modifier-activating enzyme ATG7; autophagosome formation, non-canonical E1, ATP BI UBL, ATG8, ATG12, ATG10, ATG3, UBL activation, thiolation; 1.91A {Saccharomyces cerevisiae} PDB: 3t7e_A 3vh3_A 3vh4_A* | Back alignment and structure |
|---|
| >1y8q_B Anthracycline-, ubiquitin-like 2 activating enzyme E1B; SUMO, heterodimer, UBL, ligase; HET: ATP; 2.25A {Homo sapiens} PDB: 1y8r_B* 3kyc_B* 3kyd_B* 2px9_A | Back alignment and structure |
|---|
| >3cmm_A Ubiquitin-activating enzyme E1 1; UBA1, protein turnover, ligase, conformationa thioester, adenylation, transthioesterification, ATP-bindin nucleotide-binding; 2.70A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1jw9_B Molybdopterin biosynthesis MOEB protein; MOEB: modified rossmann fold, (2) Cys-X-X-Cys zinc-binding M MOAD: ubiquitin-like fold; 1.70A {Escherichia coli} SCOP: c.111.1.1 PDB: 1jwa_B* 1jwb_B* | Back alignment and structure |
|---|
| >3vh1_A Ubiquitin-like modifier-activating enzyme ATG7; autophagy, zinc binding, metal binding protein; 3.00A {Saccharomyces cerevisiae} PDB: 3vh2_A | Back alignment and structure |
|---|
| >4gsl_A Ubiquitin-like modifier-activating enzyme ATG7; ubiquitin-like protein activation enzyme, ubiquitin-like Pro transfer enzyme, protein transport; 2.70A {Saccharomyces cerevisiae} PDB: 3vh2_A 4gsk_A 3vh1_A | Back alignment and structure |
|---|
| >3h8v_A Ubiquitin-like modifier-activating enzyme 5; rossman fold, ATP-binding, UBL conjugation pathway, transfer structural genomics consortium, SGC; HET: ATP; 2.00A {Homo sapiens} PDB: 3guc_A* | Back alignment and structure |
|---|
| >3h5n_A MCCB protein; ubiquitin-activating enzyme, microcin, protein structure, MCCC7, peptide antibiotics, N-P bond formation, transferase; HET: ATP; 1.90A {Escherichia coli} PDB: 3h5r_A 3h9g_A 3h9j_A* 3h9q_A 3h5a_A | Back alignment and structure |
|---|
| >3rui_A Ubiquitin-like modifier-activating enzyme ATG7; autophagosome formation, non-canonical E1, ATP BI UBL, ATG8, ATG12, ATG10, ATG3, UBL activation, thiolation; 1.91A {Saccharomyces cerevisiae} PDB: 3t7e_A 3vh3_A 3vh4_A* | Back alignment and structure |
|---|
| >3vh1_A Ubiquitin-like modifier-activating enzyme ATG7; autophagy, zinc binding, metal binding protein; 3.00A {Saccharomyces cerevisiae} PDB: 3vh2_A | Back alignment and structure |
|---|
| >2v31_A Ubiquitin-activating enzyme E1 X; ligase, phosphorylation, catalytic domain, heteronuclear first catalytic cysteine half-domain, E1 protein; NMR {Mus musculus} | Back alignment and structure |
|---|
| >4gsl_A Ubiquitin-like modifier-activating enzyme ATG7; ubiquitin-like protein activation enzyme, ubiquitin-like Pro transfer enzyme, protein transport; 2.70A {Saccharomyces cerevisiae} PDB: 3vh2_A 4gsk_A 3vh1_A | Back alignment and structure |
|---|
| >1z7l_A Ubiquitin-activating enzyme E1 1; SCCH, second catalytic cysteine half-domain, ligase; HET: TBR; 2.80A {Mus musculus} | Back alignment and structure |
|---|
| >3dfz_A SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase, cobalamin biosynthesis, NAD, oxidoreducta porphyrin biosynthesis; 2.30A {Bacillus megaterium} | Back alignment and structure |
|---|
| >3jyo_A Quinate/shikimate dehydrogenase; enzyme-cofactor complex, amino-acid biosynthesis, aromatic A biosynthesis, NAD, oxidoreductase; HET: NAD; 1.00A {Corynebacterium glutamicum} PDB: 3jyp_A* 3jyq_A* 2nlo_A | Back alignment and structure |
|---|
| >3jyo_A Quinate/shikimate dehydrogenase; enzyme-cofactor complex, amino-acid biosynthesis, aromatic A biosynthesis, NAD, oxidoreductase; HET: NAD; 1.00A {Corynebacterium glutamicum} PDB: 3jyp_A* 3jyq_A* 2nlo_A | Back alignment and structure |
|---|
| >3dfz_A SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase, cobalamin biosynthesis, NAD, oxidoreducta porphyrin biosynthesis; 2.30A {Bacillus megaterium} | Back alignment and structure |
|---|
| >3ic5_A Putative saccharopine dehydrogenase; structural genomics, APC63807.2, N-terminal domain, saccharo dehydrogenase, PSI-2; HET: MSE; 2.08A {Ruegeria pomeroyi} | Back alignment and structure |
|---|
| >1kyq_A Met8P, siroheme biosynthesis protein Met8; homodimer, oxidoreductase, lyase; HET: NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.2.1.11 e.37.1.1 | Back alignment and structure |
|---|
| >1y8x_B Ubiquitin-activating enzyme E1C; ubiquitin-conjugating enzyme E2 M, ligase; 2.40A {Homo sapiens} SCOP: c.111.1.2 PDB: 3fn1_A | Back alignment and structure |
|---|
| >1pjq_A CYSG, siroheme synthase; rossman fold, nucleotide binding motif, SAM, NAD, phosphoserine, transferase/oxidoreductase/lyase complex; HET: SEP PGE SAH; 2.21A {Salmonella typhimurium} SCOP: c.2.1.11 c.90.1.1 e.37.1.1 PDB: 1pjs_A* 1pjt_A* | Back alignment and structure |
|---|
| >3llv_A Exopolyphosphatase-related protein; NAD(P)-binding, rossmann, PSI, M structural genomics; 1.70A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >3ic5_A Putative saccharopine dehydrogenase; structural genomics, APC63807.2, N-terminal domain, saccharo dehydrogenase, PSI-2; HET: MSE; 2.08A {Ruegeria pomeroyi} | Back alignment and structure |
|---|
| >3tnl_A Shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD SKM; 1.45A {Listeria monocytogenes} PDB: 3toz_A* | Back alignment and structure |
|---|
| >2hmt_A YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane protein, ION transporter, symporter, transport protein; HET: NAI; 2.20A {Bacillus subtilis} SCOP: c.2.1.9 PDB: 2hms_A* 2hmu_A* 2hmv_A* 2hmw_A* 1lsu_A* | Back alignment and structure |
|---|
| >3llv_A Exopolyphosphatase-related protein; NAD(P)-binding, rossmann, PSI, M structural genomics; 1.70A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >2g1u_A Hypothetical protein TM1088A; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.50A {Thermotoga maritima} PDB: 3l4b_A* | Back alignment and structure |
|---|
| >2g1u_A Hypothetical protein TM1088A; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.50A {Thermotoga maritima} PDB: 3l4b_A* | Back alignment and structure |
|---|
| >3t4e_A Quinate/shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 1.95A {Salmonella enterica subsp} PDB: 1npd_A* 1o9b_A* 1vi2_A* | Back alignment and structure |
|---|
| >3tnl_A Shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD SKM; 1.45A {Listeria monocytogenes} PDB: 3toz_A* | Back alignment and structure |
|---|
| >3t4e_A Quinate/shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 1.95A {Salmonella enterica subsp} PDB: 1npd_A* 1o9b_A* 1vi2_A* | Back alignment and structure |
|---|
| >2hmt_A YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane protein, ION transporter, symporter, transport protein; HET: NAI; 2.20A {Bacillus subtilis} SCOP: c.2.1.9 PDB: 2hms_A* 2hmu_A* 2hmv_A* 2hmw_A* 1lsu_A* | Back alignment and structure |
|---|
| >4ina_A Saccharopine dehydrogenase; structural genomics, PSI-biology, northeast structural genom consortium, NESG, oxidoreductas; 2.49A {Wolinella succinogenes} | Back alignment and structure |
|---|
| >1kyq_A Met8P, siroheme biosynthesis protein Met8; homodimer, oxidoreductase, lyase; HET: NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.2.1.11 e.37.1.1 | Back alignment and structure |
|---|
| >3e8x_A Putative NAD-dependent epimerase/dehydratase; structural genomics, APC7755, NADP, P protein structure initiative; HET: MSE NAP; 2.10A {Bacillus halodurans} | Back alignment and structure |
|---|
| >1id1_A Putative potassium channel protein; RCK domain, E.coli potassium channel, BK channel, rossmann fold, membrane protein; 2.40A {Escherichia coli} SCOP: c.2.1.9 | Back alignment and structure |
|---|
| >1pjq_A CYSG, siroheme synthase; rossman fold, nucleotide binding motif, SAM, NAD, phosphoserine, transferase/oxidoreductase/lyase complex; HET: SEP PGE SAH; 2.21A {Salmonella typhimurium} SCOP: c.2.1.11 c.90.1.1 e.37.1.1 PDB: 1pjs_A* 1pjt_A* | Back alignment and structure |
|---|
| >1lss_A TRK system potassium uptake protein TRKA homolog; KTN domain, NAD, RCK domain, potassium transport, potassium channel, KTRA; HET: NAD; 2.30A {Methanocaldococcus jannaschii} SCOP: c.2.1.9 | Back alignment and structure |
|---|
| >3abi_A Putative uncharacterized protein PH1688; L-lysine dehydrogenase, oxidoreductase; HET: NAD; 2.44A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >1lss_A TRK system potassium uptake protein TRKA homolog; KTN domain, NAD, RCK domain, potassium transport, potassium channel, KTRA; HET: NAD; 2.30A {Methanocaldococcus jannaschii} SCOP: c.2.1.9 | Back alignment and structure |
|---|
| >3pwz_A Shikimate dehydrogenase 3; alpha-beta, oxidoreductase; 1.71A {Pseudomonas putida} | Back alignment and structure |
|---|
| >2ph5_A Homospermidine synthase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: NAD; 2.50A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >3o8q_A Shikimate 5-dehydrogenase I alpha; structural genomics, center for structural genomics of infec diseases, csgid; HET: EPE; 1.45A {Vibrio cholerae biovar el tor} PDB: 3sef_A* 3pgj_A* 3o8q_B* | Back alignment and structure |
|---|
| >3pwz_A Shikimate dehydrogenase 3; alpha-beta, oxidoreductase; 1.71A {Pseudomonas putida} | Back alignment and structure |
|---|
| >3o8q_A Shikimate 5-dehydrogenase I alpha; structural genomics, center for structural genomics of infec diseases, csgid; HET: EPE; 1.45A {Vibrio cholerae biovar el tor} PDB: 3sef_A* 3pgj_A* 3o8q_B* | Back alignment and structure |
|---|
| >3oj0_A Glutr, glutamyl-tRNA reductase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE SO4; 1.65A {Thermoplasma volcanium} | Back alignment and structure |
|---|
| >1id1_A Putative potassium channel protein; RCK domain, E.coli potassium channel, BK channel, rossmann fold, membrane protein; 2.40A {Escherichia coli} SCOP: c.2.1.9 | Back alignment and structure |
|---|
| >3fwz_A Inner membrane protein YBAL; TRKA-N domain, E.coli, structural genomics, PSI-2, Pro structure initiative; HET: MSE AMP; 1.79A {Escherichia coli k-12} | Back alignment and structure |
|---|
| >3qsg_A NAD-binding phosphogluconate dehydrogenase-like P; structural genomics, PSI-biology, midwest center for structu genomics; 1.90A {Alicyclobacillus acidocaldarius subsp} | Back alignment and structure |
|---|
| >3c85_A Putative glutathione-regulated potassium-efflux S protein KEFB; TRKA domain; HET: AMP; 1.90A {Vibrio parahaemolyticus rimd 2210633} | Back alignment and structure |
|---|
| >2egg_A AROE, shikimate 5-dehydrogenase; dimer, X-RAY diffraction, structural genomics, NPPSFA; 2.25A {Geobacillus kaustophilus} | Back alignment and structure |
|---|
| >3gvi_A Malate dehydrogenase; NAD, oxidoreductase, tricarboxylic acid cycle, structural genomics; HET: ADP; 2.25A {Brucella melitensis biovar ABORTUS2308} PDB: 3gvh_A* | Back alignment and structure |
|---|
| >3abi_A Putative uncharacterized protein PH1688; L-lysine dehydrogenase, oxidoreductase; HET: NAD; 2.44A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >3oj0_A Glutr, glutamyl-tRNA reductase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE SO4; 1.65A {Thermoplasma volcanium} | Back alignment and structure |
|---|
| >3l4b_C TRKA K+ channel protien TM1088B; potassium channel, ring-gating complex, structural GEN PSI-2-2, protein structure initiative; HET: AMP; 3.45A {Thermotoga maritima} | Back alignment and structure |
|---|
| >4ina_A Saccharopine dehydrogenase; structural genomics, PSI-biology, northeast structural genom consortium, NESG, oxidoreductas; 2.49A {Wolinella succinogenes} | Back alignment and structure |
|---|
| >1hyh_A L-hicdh, L-2-hydroxyisocaproate dehydrogenase; L-2-hydroxycarboxylate dehydrogenase, L-lactate dehydrogenas oxidoreductase (CHOH(D)-NAD+(A)); HET: NAD; 2.20A {Weissella confusa} SCOP: c.2.1.5 d.162.1.1 | Back alignment and structure |
|---|
| >3don_A Shikimate dehydrogenase; alpha-beta structure, rossman fold, amino-acid biosynthesis, amino acid biosynthesis, NADP, oxidoreductase; 2.10A {Staphylococcus epidermidis} PDB: 3doo_A* | Back alignment and structure |
|---|
| >3rku_A Oxidoreductase YMR226C; substrate fingerprint, short chain oxidoreductase, rossmann oxidoreductase; HET: NAP; 2.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3p7m_A Malate dehydrogenase; putative dehydrogenase, enzyme, structural genomics, center structural genomics of infectious diseases, csgid; 2.20A {Francisella tularensis} | Back alignment and structure |
|---|
| >3e8x_A Putative NAD-dependent epimerase/dehydratase; structural genomics, APC7755, NADP, P protein structure initiative; HET: MSE NAP; 2.10A {Bacillus halodurans} | Back alignment and structure |
|---|
| >2raf_A Putative dinucleotide-binding oxidoreductase; NP_786167.1, NADP oxidoreductase coenzyme F420-dependent, structural genomics; HET: MSE NAP; 1.60A {Lactobacillus plantarum WCFS1} | Back alignment and structure |
|---|
| >2d4a_B Malate dehydrogenase; archaea, hyperthermophIle, oxidoreductase; 2.87A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >2egg_A AROE, shikimate 5-dehydrogenase; dimer, X-RAY diffraction, structural genomics, NPPSFA; 2.25A {Geobacillus kaustophilus} | Back alignment and structure |
|---|
| >3l4b_C TRKA K+ channel protien TM1088B; potassium channel, ring-gating complex, structural GEN PSI-2-2, protein structure initiative; HET: AMP; 3.45A {Thermotoga maritima} | Back alignment and structure |
|---|
| >3h2s_A Putative NADH-flavin reductase; Q03B84, NESG, LCR19, structural genomics, PSI-2, protein structure initiative; HET: NDP; 1.78A {Lactobacillus casei atcc 334} | Back alignment and structure |
|---|
| >3fwz_A Inner membrane protein YBAL; TRKA-N domain, E.coli, structural genomics, PSI-2, Pro structure initiative; HET: MSE AMP; 1.79A {Escherichia coli k-12} | Back alignment and structure |
|---|
| >3slg_A PBGP3 protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid, melioidosis, glanders; 2.10A {Burkholderia pseudomallei} | Back alignment and structure |
|---|
| >3dqp_A Oxidoreductase YLBE; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 1.40A {Lactococcus lactis subsp} | Back alignment and structure |
|---|
| >2axq_A Saccharopine dehydrogenase; rossmann fold variant, saccharopine reductase fold (domain II), alpha/beta protein; 1.70A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3t4x_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, center for structural genomics of infec diseases, csgid; 2.80A {Bacillus anthracis} | Back alignment and structure |
|---|
| >3dhn_A NAD-dependent epimerase/dehydratase; reductase, PF01370, Q89Z24_bactn, NESG, BTR310, structural genomics, PSI-2; 2.00A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >3gpi_A NAD-dependent epimerase/dehydratase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.44A {Methylobacillus flagellatus KT} | Back alignment and structure |
|---|
| >1p9l_A Dihydrodipicolinate reductase; oxidoreductase, lysine biosynthesis, NADH binding specificity, TB structural genomics consortium; HET: NAD PDC PG4; 2.30A {Mycobacterium tuberculosis} SCOP: c.2.1.3 d.81.1.3 PDB: 1c3v_A* 1yl5_A 1yl7_A* 1yl6_A* | Back alignment and structure |
|---|
| >3o38_A Short chain dehydrogenase; tuberculosis, ortholog from A non-pathogenic dehydrogenase, structural genomics; 1.95A {Mycobacterium smegmatis} | Back alignment and structure |
|---|
| >3ruf_A WBGU; rossmann fold, UDP-hexose 4-epimerase, isomerase; HET: NAD UDP; 2.00A {Plesiomonas shigelloides} SCOP: c.2.1.2 PDB: 3ru9_A* 3rud_A* 3rue_A* 3rua_A* 3ruh_A* 3ruc_A* 3ru7_A* 3lu1_A* | Back alignment and structure |
|---|
| >3d0o_A L-LDH 1, L-lactate dehydrogenase 1; cytoplasm, glycolysis, NAD, oxidoreductase, phosphoprotein; 1.80A {Staphylococcus aureus} PDB: 3d4p_A* 3h3j_A* | Back alignment and structure |
|---|
| >1ldn_A L-lactate dehydrogenase; oxidoreductase(CHOH(D)-NAD(A)); HET: FBP NAD; 2.50A {Geobacillus stearothermophilus} SCOP: c.2.1.5 d.162.1.1 PDB: 1ldb_A 2ldb_A* | Back alignment and structure |
|---|
| >1hdo_A Biliverdin IX beta reductase; foetal metabolism, HAEM degradation, flavin reductase, diaphorase, green HAEM binding protein; HET: NAP; 1.15A {Homo sapiens} SCOP: c.2.1.2 PDB: 1he2_A* 1he3_A* 1he4_A* 1he5_A* | Back alignment and structure |
|---|
| >3doj_A AT3G25530, dehydrogenase-like protein; gamma-hydroxybutyrate dehydrogenase, 4-hydroxybutyrate dehydrogenase; 2.10A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2aef_A Calcium-gated potassium channel MTHK; rossmann fold, helix-turn-helix, Ca2+ binding, flexible interface; 1.70A {Methanothermobacterthermautotrophicus} PDB: 2aej_A 2aem_A 3rbx_A 2ogu_A 2fy8_A 3kxd_A | Back alignment and structure |
|---|
| >1npy_A Hypothetical shikimate 5-dehydrogenase-like protein HI0607; structural genomics, PSI, protein structure initiative; 1.75A {Haemophilus influenzae} SCOP: c.2.1.7 c.58.1.5 | Back alignment and structure |
|---|
| >4ezb_A Uncharacterized conserved protein; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 2.10A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >4e12_A Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1.93A {Acinetobacter baylyi} PDB: 4dyd_A* 4e13_A* | Back alignment and structure |
|---|
| >1hdo_A Biliverdin IX beta reductase; foetal metabolism, HAEM degradation, flavin reductase, diaphorase, green HAEM binding protein; HET: NAP; 1.15A {Homo sapiens} SCOP: c.2.1.2 PDB: 1he2_A* 1he3_A* 1he4_A* 1he5_A* | Back alignment and structure |
|---|
| >2ewd_A Lactate dehydrogenase,; protein-substrate_cofactor analog complex, oxidoreductase; HET: A3D; 2.00A {Cryptosporidium parvum} PDB: 2frm_A 2fn7_A* 2fnz_A* 2fm3_A | Back alignment and structure |
|---|
| >3onh_A Ubiquitin-activating enzyme E1-like; ligase, SUMO conjugation, UBC9; 1.60A {Saccharomyces cerevisiae} PDB: 3ong_A | Back alignment and structure |
|---|
| >3don_A Shikimate dehydrogenase; alpha-beta structure, rossman fold, amino-acid biosynthesis, amino acid biosynthesis, NADP, oxidoreductase; 2.10A {Staphylococcus epidermidis} PDB: 3doo_A* | Back alignment and structure |
|---|
| >3vku_A L-LDH, L-lactate dehydrogenase; rossmann fold, NADH binding, oxidoreductase; 1.96A {Lactobacillus casei} PDB: 2zqz_A 2zqy_A 3vkv_A* 1llc_A* | Back alignment and structure |
|---|
| >1y1p_A ARII, aldehyde reductase II; rossmann fold, short chain dehydrogenase reductase, oxidoreductase; HET: NMN AMP; 1.60A {Sporidiobolus salmonicolor} SCOP: c.2.1.2 PDB: 1ujm_A* 1zze_A | Back alignment and structure |
|---|
| >4aj2_A L-lactate dehydrogenase A chain; oxidoreductase-inhibitor complex, fragment-based LEAD genera inhibitors; HET: 52C; 1.75A {Rattus norvegicus} PDB: 4aj1_A* 4aje_A* 4ajh_A* 4aji_A* 4ajj_A* 4ajk_A* 4ajl_A* 4ajn_A* 4ajo_A* 4al4_A* 4aj4_A* 4ajp_A* 1i10_A* 3h3f_A* 9ldt_A* 9ldb_A* 1t2f_A* 1i0z_A* 5ldh_A* 1ldm_A* ... | Back alignment and structure |
|---|
| >1oju_A MDH, malate dehydrogenase; hyperthermophilic, oxidoreductase; HET: ENA; 2.79A {Archaeoglobus fulgidus} PDB: 1ojs_A* 2x0i_A* 2x0j_A* | Back alignment and structure |
|---|
| >1xg5_A ARPG836; short chain dehydrogenase, human, SGC, structural genomics, structural genomics consortium, oxidoreductase; HET: NAP; 1.53A {Homo sapiens} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3lf2_A Short chain oxidoreductase Q9HYA2; SDR, SCOR, rossmann fold; HET: NAP; 2.30A {Pseudomonas aeruginosa} PDB: 3lf1_A* | Back alignment and structure |
|---|
| >3dhn_A NAD-dependent epimerase/dehydratase; reductase, PF01370, Q89Z24_bactn, NESG, BTR310, structural genomics, PSI-2; 2.00A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >3l9w_A Glutathione-regulated potassium-efflux system Pro linker, ancillary protein KEFF; potassium channel regulation, domains, antiport; HET: FMN AMP GSH; 1.75A {Escherichia coli} PDB: 3eyw_A* 3l9x_A* | Back alignment and structure |
|---|
| >4e21_A 6-phosphogluconate dehydrogenase (decarboxylating; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.30A {Geobacter metallireducens} | Back alignment and structure |
|---|
| >2raf_A Putative dinucleotide-binding oxidoreductase; NP_786167.1, NADP oxidoreductase coenzyme F420-dependent, structural genomics; HET: MSE NAP; 1.60A {Lactobacillus plantarum WCFS1} | Back alignment and structure |
|---|
| >3fbt_A Chorismate mutase and shikimate 5-dehydrogenase fusion protein; structural genomics, oxidoreductase, amino-acid biosynthesis; 2.10A {Clostridium acetobutylicum} | Back alignment and structure |
|---|
| >2hk9_A Shikimate dehydrogenase; shikimate pathway, drug design, oxidoreductase; HET: ATR SKM NAP; 2.20A {Aquifex aeolicus} PDB: 2hk8_A 2hk7_A | Back alignment and structure |
|---|
| >4id9_A Short-chain dehydrogenase/reductase; putative dehydrogenase, enzyme function initiative, EFI, STR genomics, oxidoreductase; HET: NAD; 1.60A {Agrobacterium fabrum} PDB: 4idg_A* | Back alignment and structure |
|---|
| >2b69_A UDP-glucuronate decarboxylase 1; UDP-glucoronic acid decarboxylase, structural genomics, STRU genomics consortium, SGC, lyase; HET: MSE NAD UDP; 1.21A {Homo sapiens} SCOP: c.2.1.2 PDB: 4ef7_A* | Back alignment and structure |
|---|
| >2hjr_A Malate dehydrogenase; malaria, structural genomics, structural genomics consortium, SGC, oxidoreductase; HET: CIT APR; 2.20A {Cryptosporidium parvum} | Back alignment and structure |
|---|
| >3rku_A Oxidoreductase YMR226C; substrate fingerprint, short chain oxidoreductase, rossmann oxidoreductase; HET: NAP; 2.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3pqe_A L-LDH, L-lactate dehydrogenase; FBP, oxidoreductase; 2.20A {Bacillus subtilis} PDB: 3pqf_A* 3pqd_A* | Back alignment and structure |
|---|
| >3tl2_A Malate dehydrogenase; center for structural genomics of infectious diseases, csgid dehydrogenase, oxidoreductase, citric acid cycle; 1.70A {Bacillus anthracis} | Back alignment and structure |
|---|
| >3nyw_A Putative oxidoreductase; fatty acid synthesis,3-oxoacyl-[ACP] reductase, NADP+ bindin rossman fold, PSI-II, nysgxrc; 2.16A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >3gpi_A NAD-dependent epimerase/dehydratase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.44A {Methylobacillus flagellatus KT} | Back alignment and structure |
|---|
| >3ruf_A WBGU; rossmann fold, UDP-hexose 4-epimerase, isomerase; HET: NAD UDP; 2.00A {Plesiomonas shigelloides} SCOP: c.2.1.2 PDB: 3ru9_A* 3rud_A* 3rue_A* 3rua_A* 3ruh_A* 3ruc_A* 3ru7_A* 3lu1_A* | Back alignment and structure |
|---|
| >3qsg_A NAD-binding phosphogluconate dehydrogenase-like P; structural genomics, PSI-biology, midwest center for structu genomics; 1.90A {Alicyclobacillus acidocaldarius subsp} | Back alignment and structure |
|---|
| >3d1l_A Putative NADP oxidoreductase BF3122; structural genomics, PSI-2, protein structure initiative, M center for structural genomics, MCSG; 2.19A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >1ff9_A Saccharopine reductase; lysine biosynthesis, alpha-aminoadipate pathway, dehydrogenase, oxidoreductase; 2.00A {Magnaporthe grisea} SCOP: c.2.1.3 d.81.1.2 PDB: 1e5l_A* 1e5q_A | Back alignment and structure |
|---|
| >2x0j_A Malate dehydrogenase; oxidoreductase, hyperthermophilic, tricarboxylic acid cycle; HET: ENA; 2.79A {Archaeoglobus fulgidus dsm 4304} PDB: 2x0i_A* | Back alignment and structure |
|---|
| >3hg7_A D-isomer specific 2-hydroxyacid dehydrogenase FAM protein; structural genomics; 1.80A {Aeromonas salmonicida subsp} | Back alignment and structure |
|---|
| >4id9_A Short-chain dehydrogenase/reductase; putative dehydrogenase, enzyme function initiative, EFI, STR genomics, oxidoreductase; HET: NAD; 1.60A {Agrobacterium fabrum} PDB: 4idg_A* | Back alignment and structure |
|---|
| >3ldh_A Lactate dehydrogenase; oxidoreductase, CHOH donor, NAD acceptor; HET: NAD; 3.00A {Squalus acanthias} SCOP: i.12.1.1 | Back alignment and structure |
|---|
| >1iy8_A Levodione reductase; oxidoreductase; HET: NAD; 1.60A {Leifsonia aquatica} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >4egb_A DTDP-glucose 4,6-dehydratase; rhamnose pathway, center for structural genomics of infectio diseases, csgid, niaid; HET: NAD SUC; 3.00A {Bacillus anthracis} | Back alignment and structure |
|---|
| >4g65_A TRK system potassium uptake protein TRKA; structural genomics, center for structural genomics of infec diseases, csgid, niaid; HET: MSE; 2.09A {Vibrio vulnificus} | Back alignment and structure |
|---|
| >3evt_A Phosphoglycerate dehydrogenase; structural genomics, PSI-2, protein structure initiative; 2.20A {Lactobacillus plantarum} | Back alignment and structure |
|---|
| >4gbj_A 6-phosphogluconate dehydrogenase NAD-binding; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.05A {Dyadobacter fermentans} | Back alignment and structure |
|---|
| >2pzm_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, protein-nucleotide comple binding protein; HET: NAD UDP; 2.00A {Bordetella bronchiseptica} PDB: 2pzl_A* 2pzk_A* | Back alignment and structure |
|---|
| >3obb_A Probable 3-hydroxyisobutyrate dehydrogenase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics; HET: EPE; 2.20A {Pseudomonas aeruginosa} PDB: 3q3c_A* | Back alignment and structure |
|---|
| >3pp8_A Glyoxylate/hydroxypyruvate reductase A; structural genomics, center for structural genomics of infec diseases, csgid; 2.10A {Salmonella enterica subsp} PDB: 3kbo_A | Back alignment and structure |
|---|
| >1lu9_A Methylene tetrahydromethanopterin dehydrogenase; alpha/beta twisted open sheet structure, oxidoreductase; 1.90A {Methylobacterium extorquens} SCOP: c.2.1.7 c.58.1.4 PDB: 1lua_A* | Back alignment and structure |
|---|
| >3qiv_A Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR protein] reductase; structural genomics; 2.25A {Mycobacterium avium subsp} | Back alignment and structure |
|---|
| >4ezb_A Uncharacterized conserved protein; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 2.10A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >1lld_A L-lactate dehydrogenase; oxidoreductase(CHOH (D)-NAD (A)); HET: NAD; 2.00A {Bifidobacterium longum subsp} SCOP: c.2.1.5 d.162.1.1 PDB: 1lth_T* | Back alignment and structure |
|---|
| >2bka_A CC3, TAT-interacting protein TIP30; NADPH, PEG600, transcription; HET: NDP PE8; 1.7A {Homo sapiens} SCOP: c.2.1.2 PDB: 2fmu_A | Back alignment and structure |
|---|
| >4e12_A Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1.93A {Acinetobacter baylyi} PDB: 4dyd_A* 4e13_A* | Back alignment and structure |
|---|
| >1ur5_A Malate dehydrogenase; oxidoreductase, tricarboxylic acid cycle; HET: NAD; 1.75A {Chloroflexus aurantiacus} SCOP: c.2.1.5 d.162.1.1 PDB: 1uxg_A* 1guy_A* 1uxk_A* 1uxh_A* 1uxj_A* 1uxi_A* | Back alignment and structure |
|---|
| >3slg_A PBGP3 protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid, melioidosis, glanders; 2.10A {Burkholderia pseudomallei} | Back alignment and structure |
|---|
| >3o26_A Salutaridine reductase; short chain dehydrogenase/reductases, oxidoreductase; HET: NDP; 1.91A {Papaver somniferum} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >2cvz_A Dehydrogenase, 3-hydroxyisobutyrate dehydrogenase; valine catabolism, NADP+, structural GEN riken structural genomics/proteomics initiative; HET: NDP; 1.80A {Thermus thermophilus} SCOP: a.100.1.1 c.2.1.6 PDB: 1wp4_A* | Back alignment and structure |
|---|
| >2v6b_A L-LDH, L-lactate dehydrogenase; oxidoreductase, radioresistance, NAD, cytoplasm, mesophilic, glycolysis; 2.50A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >3d1l_A Putative NADP oxidoreductase BF3122; structural genomics, PSI-2, protein structure initiative, M center for structural genomics, MCSG; 2.19A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >3ew7_A LMO0794 protein; Q8Y8U8_lismo, putative NAD-dependent epimerase/dehydratase, LMR162, NESG, structural genomics, PSI-2; 2.73A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >3gvi_A Malate dehydrogenase; NAD, oxidoreductase, tricarboxylic acid cycle, structural genomics; HET: ADP; 2.25A {Brucella melitensis biovar ABORTUS2308} PDB: 3gvh_A* | Back alignment and structure |
|---|
| >3tri_A Pyrroline-5-carboxylate reductase; amino acid biosynthesis, oxidoreductase; HET: NAP; 2.50A {Coxiella burnetii} | Back alignment and structure |
|---|
| >4egb_A DTDP-glucose 4,6-dehydratase; rhamnose pathway, center for structural genomics of infectio diseases, csgid, niaid; HET: NAD SUC; 3.00A {Bacillus anthracis} | Back alignment and structure |
|---|
| >3r6d_A NAD-dependent epimerase/dehydratase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, veillo parvula; HET: MLZ; 1.25A {Veillonella parvula dsm 2008} PDB: 4hng_A 4hnh_A* 3r14_A* | Back alignment and structure |
|---|
| >3pef_A 6-phosphogluconate dehydrogenase, NAD-binding; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R geobacter metallireducens; HET: NAP; 2.07A {Geobacter metallireducens} | Back alignment and structure |
|---|
| >3dqp_A Oxidoreductase YLBE; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 1.40A {Lactococcus lactis subsp} | Back alignment and structure |
|---|
| >3m2p_A UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J, isomerase, structural genomics, PSI-2, protein structure initiative; HET: UDP; 2.95A {Bacillus cereus} | Back alignment and structure |
|---|
| >2gf2_A Hibadh, 3-hydroxyisobutyrate dehydrogenase; structural genomics, structural genomics consortium, SGC, oxidoreductase; 2.38A {Homo sapiens} PDB: 2i9p_A* | Back alignment and structure |
|---|
| >3l9w_A Glutathione-regulated potassium-efflux system Pro linker, ancillary protein KEFF; potassium channel regulation, domains, antiport; HET: FMN AMP GSH; 1.75A {Escherichia coli} PDB: 3eyw_A* 3l9x_A* | Back alignment and structure |
|---|
| >3g0o_A 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine catabolism, tartaric acid, target 11128H, NYSGXRC, PSI-2, structural genomics; HET: TLA; 1.80A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >3tri_A Pyrroline-5-carboxylate reductase; amino acid biosynthesis, oxidoreductase; HET: NAP; 2.50A {Coxiella burnetii} | Back alignment and structure |
|---|
| >1a5z_A L-lactate dehydrogenase; oxidoreductase, glycolysis, hyperthermophiles, thermotoga MA protein stability; HET: FBP NAD; 2.10A {Thermotoga maritima} SCOP: c.2.1.5 d.162.1.1 | Back alignment and structure |
|---|
| >1p77_A Shikimate 5-dehydrogenase; NADPH, oxidoreductase; HET: ATR; 1.95A {Haemophilus influenzae} SCOP: c.2.1.7 c.58.1.5 PDB: 1p74_A* | Back alignment and structure |
|---|
| >3ius_A Uncharacterized conserved protein; APC63810, silicibacter pomeroyi DSS, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.66A {Ruegeria pomeroyi dss-3} | Back alignment and structure |
|---|
| >3dtt_A NADP oxidoreductase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: NAP; 1.70A {Arthrobacter SP} | Back alignment and structure |
|---|
| >3pdu_A 3-hydroxyisobutyrate dehydrogenase family protein; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R glyoxylate metabolism; HET: NAP; 1.89A {Geobacter sulfurreducens} | Back alignment and structure |
|---|
| >3p7m_A Malate dehydrogenase; putative dehydrogenase, enzyme, structural genomics, center structural genomics of infectious diseases, csgid; 2.20A {Francisella tularensis} | Back alignment and structure |
|---|
| >3qvo_A NMRA family protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MNB; 2.30A {Shigella flexneri 2A} | Back alignment and structure |
|---|
| >1xu9_A Corticosteroid 11-beta-dehydrogenase, isozyme 1; hydroxysteroid, SDR, oxidoreductase; HET: NDP CPS MES; 1.55A {Homo sapiens} SCOP: c.2.1.2 PDB: 1xu7_A* 3bzu_A* 3czr_A* 3d3e_A* 3d4n_A* 3fco_A* 3frj_A* 3h6k_A* 3hfg_A* 3oq1_A* 3qqp_A* 3pdj_A* 3d5q_A* 2rbe_A* 3byz_A* 3ey4_A* 3tfq_A* 3ch6_A* 2irw_A* 2ilt_A* ... | Back alignment and structure |
|---|
| >2b69_A UDP-glucuronate decarboxylase 1; UDP-glucoronic acid decarboxylase, structural genomics, STRU genomics consortium, SGC, lyase; HET: MSE NAD UDP; 1.21A {Homo sapiens} SCOP: c.2.1.2 PDB: 4ef7_A* | Back alignment and structure |
|---|
| >2gn4_A FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann fold, TYK triad, SDR, enzyme, NADP, NADPH, lyase; HET: NDP UD1 MES; 1.90A {Helicobacter pylori} PDB: 2gn6_A* 2gn8_A* 2gn9_A* 2gna_A* | Back alignment and structure |
|---|
| >3phh_A Shikimate dehydrogenase; shikimate pathway, helicobacter PYL oxidoreductase, alpha/beta domain, rossmann fold; HET: SKM; 1.42A {Helicobacter pylori} PDB: 3phg_A* 3phi_A* 3phj_A* 4foo_A 4fpx_A 4fos_A* 4fr5_A* 4fq8_A* | Back alignment and structure |
|---|
| >3gt0_A Pyrroline-5-carboxylate reductase; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG; 2.00A {Bacillus cereus atcc 14579} | Back alignment and structure |
|---|
| >1ez4_A Lactate dehydrogenase; rossmann fold, oxidoreductase; HET: NAD; 2.30A {Lactobacillus pentosus} SCOP: c.2.1.5 d.162.1.1 | Back alignment and structure |
|---|
| >1sb8_A WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCNAC, SDR, G SYK, UDP, N-acetylglucosamine, N- acetylgalactosamine, UDP-GLC, isomerase; HET: NAD UD2; 2.10A {Pseudomonas aeruginosa} SCOP: c.2.1.2 PDB: 1sb9_A* | Back alignment and structure |
|---|
| >1y1p_A ARII, aldehyde reductase II; rossmann fold, short chain dehydrogenase reductase, oxidoreductase; HET: NMN AMP; 1.60A {Sporidiobolus salmonicolor} SCOP: c.2.1.2 PDB: 1ujm_A* 1zze_A | Back alignment and structure |
|---|
| >3ioy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structure initiative; 1.90A {Novosphingobium aromaticivorans DSM12444} | Back alignment and structure |
|---|
| >3ius_A Uncharacterized conserved protein; APC63810, silicibacter pomeroyi DSS, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.66A {Ruegeria pomeroyi dss-3} | Back alignment and structure |
|---|
| >3rkr_A Short chain oxidoreductase; rossmann fold; HET: NAP; 2.42A {Uncultured bacterium BIO5} | Back alignment and structure |
|---|
| >3qvo_A NMRA family protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MNB; 2.30A {Shigella flexneri 2A} | Back alignment and structure |
|---|
| >1nvt_A Shikimate 5'-dehydrogenase; structural genomics, PSI, protein structure initiative; HET: NAP; 2.35A {Methanocaldococcus jannaschii} SCOP: c.2.1.7 c.58.1.5 | Back alignment and structure |
|---|
| >3vps_A TUNA, NAD-dependent epimerase/dehydratase; tunicamycins, biosynthesis, EXO-glycal, rossman transferase; HET: UD1 NAD; 1.90A {Streptomyces chartreusis} | Back alignment and structure |
|---|
| >3svt_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 2.00A {Mycobacterium ulcerans} | Back alignment and structure |
|---|
| >3vku_A L-LDH, L-lactate dehydrogenase; rossmann fold, NADH binding, oxidoreductase; 1.96A {Lactobacillus casei} PDB: 2zqz_A 2zqy_A 3vkv_A* 1llc_A* | Back alignment and structure |
|---|
| >3i1j_A Oxidoreductase, short chain dehydrogenase/reducta; dimer, MIXE beta, structural genomics, PSI-2; 1.90A {Pseudomonas syringae PV} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >3m2p_A UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J, isomerase, structural genomics, PSI-2, protein structure initiative; HET: UDP; 2.95A {Bacillus cereus} | Back alignment and structure |
|---|
| >3gaf_A 7-alpha-hydroxysteroid dehydrogenase; seattle structural genomics center for infectious disease, ssgcid, oxidoreductase, structural genomics; 2.20A {Brucella melitensis} | Back alignment and structure |
|---|
| >3u62_A Shikimate dehydrogenase; shikimate pathway, oxidoreductase; 1.45A {Thermotoga maritima} | Back alignment and structure |
|---|
| >1ks9_A KPA reductase;, 2-dehydropantoate 2-reductase; PANE, APBA, ketopantoate reductase, rossman fold, monomer, APO, oxidoreductase; 1.70A {Escherichia coli} SCOP: a.100.1.7 c.2.1.6 PDB: 1yon_A* 1yjq_A* 2ofp_A* | Back alignment and structure |
|---|
| >3c85_A Putative glutathione-regulated potassium-efflux S protein KEFB; TRKA domain; HET: AMP; 1.90A {Vibrio parahaemolyticus rimd 2210633} | Back alignment and structure |
|---|
| >3fi9_A Malate dehydrogenase; structural genomics, oxidoreductase, PSI-2, protein structur initiative; 1.90A {Porphyromonas gingivalis} | Back alignment and structure |
|---|
| >2pzm_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, protein-nucleotide comple binding protein; HET: NAD UDP; 2.00A {Bordetella bronchiseptica} PDB: 2pzl_A* 2pzk_A* | Back alignment and structure |
|---|
| >1t2d_A LDH-P, L-lactate dehydrogenase; ternary complex, oxidoreductase; HET: NAD; 1.10A {Plasmodium falciparum} SCOP: c.2.1.5 d.162.1.1 PDB: 1t25_A* 1t26_A* 1t2c_A* 1t24_A* 2x8l_A 2ydn_A* 2a94_A* 1u4s_A* 1u5a_A* 1u5c_A* 1u4o_A* 1t2e_A* 1xiv_A* 1ceq_A 1ldg_A* 1cet_A* 1oc4_A* 2a92_A* 2aa3_A* | Back alignment and structure |
|---|
| >2z1n_A Dehydrogenase; reductase, SDR, oxidoreductase; 1.80A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >3ucx_A Short chain dehydrogenase; ssgcid, seattle structural genomics center for infectious DI dehydrogenase, oxidoreductase; HET: 1PE; 1.85A {Mycobacterium smegmatis} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >3uve_A Carveol dehydrogenase ((+)-trans-carveol dehydrog; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; HET: NAD PG4; 1.55A {Mycobacterium avium} SCOP: c.2.1.0 PDB: 3uwr_A* | Back alignment and structure |
|---|
| >3kkj_A Amine oxidase, flavin-containing; oxidoreductase, PSR10, Q888A4, X-RAY, structure, PSI, protein structure initiative; HET: FAD; 2.50A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >2hjr_A Malate dehydrogenase; malaria, structural genomics, structural genomics consortium, SGC, oxidoreductase; HET: CIT APR; 2.20A {Cryptosporidium parvum} | Back alignment and structure |
|---|
| >3ko8_A NAD-dependent epimerase/dehydratase; isomerase, UDP-galactose 4-epimerase; HET: NAD; 1.80A {Pyrobaculum calidifontis} SCOP: c.2.1.0 PDB: 3icp_A* 3aw9_A* | Back alignment and structure |
|---|
| >4dll_A 2-hydroxy-3-oxopropionate reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.11A {Polaromonas SP} | Back alignment and structure |
|---|
| >3ggo_A Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-beta, oxidoreductase; HET: NAI ENO; 2.15A {Aquifex aeolicus} PDB: 3ggg_D* 3ggp_A* | Back alignment and structure |
|---|
| >3sju_A Keto reductase; short-chain dehydrogenase, oxidoreductase; HET: NDP; 2.40A {Streptomyces griseoruber} | Back alignment and structure |
|---|
| >2ph5_A Homospermidine synthase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: NAD; 2.50A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >2gn4_A FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann fold, TYK triad, SDR, enzyme, NADP, NADPH, lyase; HET: NDP UD1 MES; 1.90A {Helicobacter pylori} PDB: 2gn6_A* 2gn8_A* 2gn9_A* 2gna_A* | Back alignment and structure |
|---|
| >1x7d_A Ornithine cyclodeaminase; binds NAD+, binds L-ornithine, binds L-proline, 2 bundle, beta barrel, rossmann fold, lyase; HET: NAD ORN MES; 1.60A {Pseudomonas putida} SCOP: c.2.1.13 PDB: 1u7h_A* | Back alignment and structure |
|---|
| >4e21_A 6-phosphogluconate dehydrogenase (decarboxylating; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.30A {Geobacter metallireducens} | Back alignment and structure |
|---|
| >3pk0_A Short-chain dehydrogenase/reductase SDR; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; 1.75A {Mycobacterium smegmatis} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >2bll_A Protein YFBG; decarboxylase, short chain dehydrogenase, L-ARA4N biosynthes methyltransferase, transferase; 2.3A {Escherichia coli} SCOP: c.2.1.2 PDB: 1u9j_A 1z73_A 1z75_A 1z7b_A 1z74_A | Back alignment and structure |
|---|
| >2d5c_A AROE, shikimate 5-dehydrogenase; substrate, dimer, structural genomics, NPPSFA, Na project on protein structural and functional analyses; HET: SKM; 1.65A {Thermus thermophilus} PDB: 1wxd_A* 2cy0_A* 2ev9_A* | Back alignment and structure |
|---|
| >3i6i_A Putative leucoanthocyanidin reductase 1; rossmann fold, short chain dehydrogenase reductase, flavonoi oxidoreductase; HET: NDP; 1.75A {Vitis vinifera} PDB: 3i5m_A 3i52_A* 3i6q_A* | Back alignment and structure |
|---|
| >3rft_A Uronate dehydrogenase; apoenzyme, rossmann fold, NAD binding, oxidoreductase; 1.90A {Agrobacterium tumefaciens} PDB: 3rfv_A* 3rfx_A* | Back alignment and structure |
|---|
| >2pv7_A T-protein [includes: chorismate mutase (EC 5.4.99 and prephenate dehydrogenase (EC...; 1574749, chorismate mutase type II; HET: MSE TYR NAD; 2.00A {Haemophilus influenzae} SCOP: a.100.1.12 c.2.1.6 | Back alignment and structure |
|---|
| >3tjr_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, SCD, NAD; HET: UNL; 1.60A {Mycobacterium avium subsp} | Back alignment and structure |
|---|
| >3pqe_A L-LDH, L-lactate dehydrogenase; FBP, oxidoreductase; 2.20A {Bacillus subtilis} PDB: 3pqf_A* 3pqd_A* | Back alignment and structure |
|---|
| >1sby_A Alcohol dehydrogenase; ternary complex, NAD, trifluoroethanol, oxidoreductase; HET: NAD; 1.10A {Scaptodrosophila lebanonensis} SCOP: c.2.1.2 PDB: 1b14_A* 1b15_A* 1a4u_A* 1b2l_A* 1b16_A* 3rj5_A* 3rj9_A* 1mg5_A* | Back alignment and structure |
|---|
| >1yb4_A Tartronic semialdehyde reductase; structural genomics, oxidoreductase, salmonella typhimurium LT2, PSI, protein ST initiative; 2.40A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >2d5c_A AROE, shikimate 5-dehydrogenase; substrate, dimer, structural genomics, NPPSFA, Na project on protein structural and functional analyses; HET: SKM; 1.65A {Thermus thermophilus} PDB: 1wxd_A* 2cy0_A* 2ev9_A* | Back alignment and structure |
|---|
| >3tox_A Short chain dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; HET: NAP; 1.93A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >2f1k_A Prephenate dehydrogenase; tyrosine synthesis, X-RA crystallography structure, oxidoreductase; HET: OMT NAP; 1.55A {Synechocystis SP} SCOP: a.100.1.12 c.2.1.6 | Back alignment and structure |
|---|
| >2uyy_A N-PAC protein; long-chain dehydrogenase, cytokine; HET: NA7; 2.5A {Homo sapiens} | Back alignment and structure |
|---|
| >3rwb_A TPLDH, pyridoxal 4-dehydrogenase; short chain dehydrogenase/reductase, 4-pyridoxola NAD+, oxidoreductase; HET: NAD 4PL; 1.70A {Mesorhizobium loti} PDB: 3ndr_A* 3nug_A* | Back alignment and structure |
|---|
| >4da9_A Short-chain dehydrogenase/reductase; structural genomics, protein structure initiative, PSI-biology; 2.50A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >4g65_A TRK system potassium uptake protein TRKA; structural genomics, center for structural genomics of infec diseases, csgid, niaid; HET: MSE; 2.09A {Vibrio vulnificus} | Back alignment and structure |
|---|
| >3l6d_A Putative oxidoreductase; structural genomics, protein structure initiative, oxidoredu PSI-2; HET: MSE; 1.90A {Pseudomonas putida} | Back alignment and structure |
|---|
| >3gvx_A Glycerate dehydrogenase related protein; NYSGXRC, PSI-II, 11143J, structural genomics, protein structure initiative; 2.20A {Thermoplasma acidophilum} | Back alignment and structure |
|---|
| >3vps_A TUNA, NAD-dependent epimerase/dehydratase; tunicamycins, biosynthesis, EXO-glycal, rossman transferase; HET: UD1 NAD; 1.90A {Streptomyces chartreusis} | Back alignment and structure |
|---|
| >2dc1_A L-aspartate dehydrogenase; NAD, oxidoreductase; HET: CIT NAD; 1.90A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >1bg6_A N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L) stereospecific opine dehydrogenase, oxidoreductase; 1.80A {Arthrobacter SP} SCOP: a.100.1.5 c.2.1.6 | Back alignment and structure |
|---|
| >2x4g_A Nucleoside-diphosphate-sugar epimerase; isomerase; 2.65A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >3tfo_A Putative 3-oxoacyl-(acyl-carrier-protein) reducta; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.08A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >2ew2_A 2-dehydropantoate 2-reductase, putative; alpha-structure, alpha-beta structure, structural genomics, protein structure initiative; HET: MSE; 2.00A {Enterococcus faecalis} | Back alignment and structure |
|---|
| >3pgx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.85A {Mycobacterium avium} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >3nep_X Malate dehydrogenase; halophIle, molecular adpatation, NAD, oxidoreductase, tricarboxylic acid cycle; 1.55A {Salinibacter ruber} | Back alignment and structure |
|---|
| >3phh_A Shikimate dehydrogenase; shikimate pathway, helicobacter PYL oxidoreductase, alpha/beta domain, rossmann fold; HET: SKM; 1.42A {Helicobacter pylori} PDB: 3phg_A* 3phi_A* 3phj_A* 4foo_A 4fpx_A 4fos_A* 4fr5_A* 4fq8_A* | Back alignment and structure |
|---|
| >4egf_A L-xylulose reductase; structural genomics, ssgcid, seattle structural genomics CEN infectious disease, oxidoreductase; 2.30A {Mycobacterium smegmatis} | Back alignment and structure |
|---|
| >3qlj_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis; 1.80A {Mycobacterium avium} | Back alignment and structure |
|---|
| >2xxj_A L-LDH, L-lactate dehydrogenase; oxidoreductase, hyperthermophIle; HET: NAD; 1.964A {Thermus thermophilus} PDB: 2xxb_A* 3zzn_A* 2v7p_A* 2e37_A* 2v6m_A* 2xxe_A 4a73_A | Back alignment and structure |
|---|
| >4e6p_A Probable sorbitol dehydrogenase (L-iditol 2-dehyd; NAD(P)-binding, structural genomics, PSI-biology; HET: MSE; 2.10A {Sinorhizobium meliloti} PDB: 1k2w_A | Back alignment and structure |
|---|
| >3sxp_A ADP-L-glycero-D-mannoheptose-6-epimerase; rossman fold, NAD binding, isomerase; HET: NAD; 2.55A {Helicobacter pylori} | Back alignment and structure |
|---|
| >1lnq_A MTHK channels, potassium channel related protein; rossman fold, helix bundle, membrane protein; 3.30A {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: c.2.1.9 d.286.1.1 f.14.1.1 PDB: 3rbz_A | Back alignment and structure |
|---|
| >2zqz_A L-LDH, L-lactate dehydrogenase; oxidoreductase, rossmann fold, cytoplasm, glycolysis, NAD, phosphoprotein; 2.50A {Lactobacillus casei} PDB: 2zqy_A 3vkv_A* 1llc_A* | Back alignment and structure |
|---|
| >3lk7_A UDP-N-acetylmuramoylalanine--D-glutamate ligase; agalacitae, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: MSE; 1.50A {Streptococcus agalactiae} | Back alignment and structure |
|---|
| >2rcy_A Pyrroline carboxylate reductase; malaria, structural genomics, pyrroline reductase, oxidoredu structural genomics consortium, SGC; HET: NAP; 2.30A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >2zat_A Dehydrogenase/reductase SDR family member 4; alpha/beta, oxidoreductase; HET: NAP; 1.50A {Sus scrofa} PDB: 3o4r_A* | Back alignment and structure |
|---|
| >2g5c_A Prephenate dehydrogenase; TYRA, oxidoreductase; HET: NAD; 1.90A {Aquifex aeolicus} SCOP: a.100.1.12 c.2.1.6 | Back alignment and structure |
|---|
| >4huj_A Uncharacterized protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, dinucleotide-binding; 1.77A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >3r1i_A Short-chain type dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.95A {Mycobacterium marinum} | Back alignment and structure |
|---|
| >4ibo_A Gluconate dehydrogenase; enzyme function initiative structural genomics, oxidoreductase; 2.10A {Agrobacterium fabrum} | Back alignment and structure |
|---|
| >3jtm_A Formate dehydrogenase, mitochondrial; mitochondrion, NAD, oxidoreductase, T peptide; 1.30A {Arabidopsis thaliana} PDB: 3n7u_A* 3naq_A | Back alignment and structure |
|---|
| >1gee_A Glucose 1-dehydrogenase; short-chain dehydrogenase/reductase, oxidoreductase; HET: NAD; 1.60A {Bacillus megaterium} SCOP: c.2.1.2 PDB: 1rwb_A* 1gco_A* 1g6k_A* 3aus_A 3aut_A* 3auu_A* | Back alignment and structure |
|---|
| >2pv7_A T-protein [includes: chorismate mutase (EC 5.4.99 and prephenate dehydrogenase (EC...; 1574749, chorismate mutase type II; HET: MSE TYR NAD; 2.00A {Haemophilus influenzae} SCOP: a.100.1.12 c.2.1.6 | Back alignment and structure |
|---|
| >3grp_A 3-oxoacyl-(acyl carrierprotein) reductase; structural genomics, oxidoreductase, S structural genomics center for infectious disease, ssgcid; 2.09A {Bartonella henselae} PDB: 3enn_A 3emk_A | Back alignment and structure |
|---|
| >2cvz_A Dehydrogenase, 3-hydroxyisobutyrate dehydrogenase; valine catabolism, NADP+, structural GEN riken structural genomics/proteomics initiative; HET: NDP; 1.80A {Thermus thermophilus} SCOP: a.100.1.1 c.2.1.6 PDB: 1wp4_A* | Back alignment and structure |
|---|
| >1x7d_A Ornithine cyclodeaminase; binds NAD+, binds L-ornithine, binds L-proline, 2 bundle, beta barrel, rossmann fold, lyase; HET: NAD ORN MES; 1.60A {Pseudomonas putida} SCOP: c.2.1.13 PDB: 1u7h_A* | Back alignment and structure |
|---|
| >1sb8_A WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCNAC, SDR, G SYK, UDP, N-acetylglucosamine, N- acetylgalactosamine, UDP-GLC, isomerase; HET: NAD UD2; 2.10A {Pseudomonas aeruginosa} SCOP: c.2.1.2 PDB: 1sb9_A* | Back alignment and structure |
|---|
| >3sxp_A ADP-L-glycero-D-mannoheptose-6-epimerase; rossman fold, NAD binding, isomerase; HET: NAD; 2.55A {Helicobacter pylori} | Back alignment and structure |
|---|
| >4dqv_A Probable peptide synthetase NRP (peptide synthase; GXXGXXG motif, rossmann fold, short chain dehydrogenase/REDU family, reductase; 2.30A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >2q1s_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NADH complex, sugar binding protein; HET: NAI; 1.50A {Bordetella bronchiseptica} PDB: 2pzj_A* 2q1t_A* 2q1u_A* | Back alignment and structure |
|---|
| >3tsc_A Putative oxidoreductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, nucleotide; HET: NAD; 2.05A {Mycobacterium avium subsp} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >1lu9_A Methylene tetrahydromethanopterin dehydrogenase; alpha/beta twisted open sheet structure, oxidoreductase; 1.90A {Methylobacterium extorquens} SCOP: c.2.1.7 c.58.1.4 PDB: 1lua_A* | Back alignment and structure |
|---|
| >3v2h_A D-beta-hydroxybutyrate dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 3.00A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >2x0j_A Malate dehydrogenase; oxidoreductase, hyperthermophilic, tricarboxylic acid cycle; HET: ENA; 2.79A {Archaeoglobus fulgidus dsm 4304} PDB: 2x0i_A* | Back alignment and structure |
|---|
| >3c24_A Putative oxidoreductase; YP_511008.1, structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.62A {Jannaschia SP} | Back alignment and structure |
|---|
| >2jah_A Clavulanic acid dehydrogenase; short-chain dehydrogenase/reductase, lactamase inhibitor, AN biosynthesis, NADPH, oxidoreductase; HET: MSE NDP; 1.80A {Streptomyces clavuligerus} PDB: 2jap_A* | Back alignment and structure |
|---|
| >2ae2_A Protein (tropinone reductase-II); oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to pseudotropine; HET: NAP PTO; 1.90A {Datura stramonium} SCOP: c.2.1.2 PDB: 2ae1_A* 1ipe_A* 1ipf_A* | Back alignment and structure |
|---|
| >3enk_A UDP-glucose 4-epimerase; seattle structural genomics center for infectious disease, ssgcid, isomerase, NAD; HET: NAD GUD; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >3r6d_A NAD-dependent epimerase/dehydratase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, veillo parvula; HET: MLZ; 1.25A {Veillonella parvula dsm 2008} PDB: 4hng_A 4hnh_A* 3r14_A* | Back alignment and structure |
|---|
| >3sx2_A Putative 3-ketoacyl-(acyl-carrier-protein) reduct; ssgcid, 3-ketoacyl-(acyl-carrier-protein) reductase, mycobac paratuberculosis; HET: NAD; 1.50A {Mycobacterium avium subsp} | Back alignment and structure |
|---|
| >2zyd_A 6-phosphogluconate dehydrogenase, decarboxylating; NADP, pentose phosphate pathway, oxidoreductase, 6-phosphogl dehydrogenase; HET: GLO; 1.50A {Escherichia coli} PDB: 2zya_A* 3fwn_A* 2zyg_A 2w8z_A* 2w90_A* | Back alignment and structure |
|---|
| >2bka_A CC3, TAT-interacting protein TIP30; NADPH, PEG600, transcription; HET: NDP PE8; 1.7A {Homo sapiens} SCOP: c.2.1.2 PDB: 2fmu_A | Back alignment and structure |
|---|
| >1p9l_A Dihydrodipicolinate reductase; oxidoreductase, lysine biosynthesis, NADH binding specificity, TB structural genomics consortium; HET: NAD PDC PG4; 2.30A {Mycobacterium tuberculosis} SCOP: c.2.1.3 d.81.1.3 PDB: 1c3v_A* 1yl5_A 1yl7_A* 1yl6_A* | Back alignment and structure |
|---|
| >1yb1_A 17-beta-hydroxysteroid dehydrogenase type XI; short chain dehydrogenase, HUM structural genomics, structural genomics consortium, SGC; HET: AE2; 1.95A {Homo sapiens} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3h7a_A Short chain dehydrogenase; oxidoreductase, PSI-2, NYSGXRC, structural genomics, protein structure initiative; 1.87A {Rhodopseudomonas palustris} | Back alignment and structure |
|---|
| >2q1s_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NADH complex, sugar binding protein; HET: NAI; 1.50A {Bordetella bronchiseptica} PDB: 2pzj_A* 2q1t_A* 2q1u_A* | Back alignment and structure |
|---|
| >3t4x_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, center for structural genomics of infec diseases, csgid; 2.80A {Bacillus anthracis} | Back alignment and structure |
|---|
| >1vl6_A Malate oxidoreductase; TM0542, NAD-dependent malic enzyme, structural genomics, JCS protein structure initiative, PSI; 2.61A {Thermotoga maritima} SCOP: c.2.1.7 c.58.1.3 PDB: 2hae_A* | Back alignment and structure |
|---|
| >3awd_A GOX2181, putative polyol dehydrogenase; oxidoreductase; 1.80A {Gluconobacter oxydans} | Back alignment and structure |
|---|
| >3ngx_A Bifunctional protein fold; methylenetetrahydrofolate dehydrogenase/cyclohydrolase; 2.30A {Thermoplasma acidophilum} PDB: 3ngl_A | Back alignment and structure |
|---|
| >4iin_A 3-ketoacyl-acyl carrier protein reductase (FABG); structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 2.40A {Helicobacter pylori} PDB: 4ijk_A | Back alignment and structure |
|---|
| >2yq5_A D-isomer specific 2-hydroxyacid dehydrogenase; oxidoreductase; HET: NAD; 2.75A {Lactobacillus delbrueckii subsp} PDB: 2yq4_A* | Back alignment and structure |
|---|
| >1guz_A Malate dehydrogenase; oxidoreductase, tricarboxylic acid cycle, NAD; HET: NAD; 2.0A {Chlorobium vibrioforme} SCOP: c.2.1.5 d.162.1.1 PDB: 1gv1_A 1gv0_A* | Back alignment and structure |
|---|
| >3obb_A Probable 3-hydroxyisobutyrate dehydrogenase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics; HET: EPE; 2.20A {Pseudomonas aeruginosa} PDB: 3q3c_A* | Back alignment and structure |
|---|
| >4imr_A 3-oxoacyl-(acyl-carrier-protein) reductase; oxidoreductase, nicotinamide adenine dinucleotide phosphate, structural genomics; HET: NAP; 1.96A {Agrobacterium fabrum} | Back alignment and structure |
|---|
| >3lyl_A 3-oxoacyl-(acyl-carrier-protein) reductase; alpha and beta protein, NAD(P)-binding rossmann fold, csgid, oxidoreductase; 1.95A {Francisella tularensis subsp} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >1oaa_A Sepiapterin reductase; tetrahydrobiopterin, oxidoreductase; HET: NAP; 1.25A {Mus musculus} SCOP: c.2.1.2 PDB: 1nas_A* 1sep_A* 1z6z_A* | Back alignment and structure |
|---|
| >4fc7_A Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossmann fold, peroxisomal beta-oxidation, oxidoreductas; HET: NAP COA; 1.84A {Homo sapiens} PDB: 4fc6_A* | Back alignment and structure |
|---|
| >1fmc_A 7 alpha-hydroxysteroid dehydrogenase; short-chain dehydrogenase/reductase, bIle acid catabolism, oxidoreductase; HET: CHO NAD; 1.80A {Escherichia coli} SCOP: c.2.1.2 PDB: 1ahi_A* 1ahh_A* | Back alignment and structure |
|---|
| >3v2g_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, protein structure initiati nysgrc; 2.30A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >4fn4_A Short chain dehydrogenase; NADH-binding, rossmann fold, oxidoreductase; HET: NAD; 1.75A {Sulfolobus acidocaldarius} | Back alignment and structure |
|---|
| >2d4a_B Malate dehydrogenase; archaea, hyperthermophIle, oxidoreductase; 2.87A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >3fbt_A Chorismate mutase and shikimate 5-dehydrogenase fusion protein; structural genomics, oxidoreductase, amino-acid biosynthesis; 2.10A {Clostridium acetobutylicum} | Back alignment and structure |
|---|
| >2x6t_A ADP-L-glycero-D-manno-heptose-6-epimerase; isomerase, carbohydrate metabolism, stress response; HET: NAP ADP BMA; 2.36A {Escherichia coli} PDB: 2x86_A* | Back alignment and structure |
|---|
| >1o0s_A NAD-ME, NAD-dependent malic enzyme; oxidoreductase, oxidative decarboxylase, rossmann fold, MAla dehydrogenase; HET: NAI; 2.00A {Ascaris suum} SCOP: c.2.1.7 c.58.1.3 PDB: 1llq_A* | Back alignment and structure |
|---|
| >3imf_A Short chain dehydrogenase; structural genomics, infectious D center for structural genomics of infectious diseases, oxidoreductase, csgid; HET: MSE; 1.99A {Bacillus anthracis str} | Back alignment and structure |
|---|
| >1ldn_A L-lactate dehydrogenase; oxidoreductase(CHOH(D)-NAD(A)); HET: FBP NAD; 2.50A {Geobacillus stearothermophilus} SCOP: c.2.1.5 d.162.1.1 PDB: 1ldb_A 2ldb_A* | Back alignment and structure |
|---|
| >3ggo_A Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-beta, oxidoreductase; HET: NAI ENO; 2.15A {Aquifex aeolicus} PDB: 3ggg_D* 3ggp_A* | Back alignment and structure |
|---|
| >2z1m_A GDP-D-mannose dehydratase; short-chain dehydrogenase/reductase, lyase, structural genom NPPSFA; HET: NDP GDP; 2.00A {Aquifex aeolicus} PDB: 2z95_A* | Back alignment and structure |
|---|
| >4a26_A Putative C-1-tetrahydrofolate synthase, cytoplasm; oxidoreductase, hydrolase, leishmaniasis; 2.70A {Leishmania major} | Back alignment and structure |
|---|
| >1o6z_A MDH, malate dehydrogenase; halophilic, ION-binding, protein-solvent interaction, oxidoreductase; HET: NAD; 1.95A {Haloarcula marismortui} SCOP: c.2.1.5 d.162.1.1 PDB: 1gt2_A* 2x0r_A* 2j5k_A 2j5q_A 2j5r_A 1d3a_A 1hlp_A* 2hlp_A | Back alignment and structure |
|---|
| >3nyw_A Putative oxidoreductase; fatty acid synthesis,3-oxoacyl-[ACP] reductase, NADP+ bindin rossman fold, PSI-II, nysgxrc; 2.16A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >1a4i_A Methylenetetrahydrofolate dehydrogenase / methenyltetrahydrofolate cyclohydrolase...; THF, bifunctional, oxidoreductase; HET: NDP; 1.50A {Homo sapiens} SCOP: c.2.1.7 c.58.1.2 PDB: 1dia_A* 1dib_A* 1dig_A* | Back alignment and structure |
|---|
| >3hn2_A 2-dehydropantoate 2-reductase; PSI-2, NYSGXRC, structural GE protein structure initiative; 2.50A {Geobacter metallireducens} | Back alignment and structure |
|---|
| >3v8b_A Putative dehydrogenase, possibly 3-oxoacyl-[acyl- protein] reductase; PSI-biology, structural genomics, protein structure initiati nysgrc; 2.70A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >3ew7_A LMO0794 protein; Q8Y8U8_lismo, putative NAD-dependent epimerase/dehydratase, LMR162, NESG, structural genomics, PSI-2; 2.73A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >2ywl_A Thioredoxin reductase related protein; uncharacterized conserved protein, rossmann fold, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2cvj_A* | Back alignment and structure |
|---|
| >3l77_A Short-chain alcohol dehydrogenase; oxidoreductase; HET: NJP PG4; 1.60A {Thermococcus sibiricus} SCOP: c.2.1.0 PDB: 3tn7_A* | Back alignment and structure |
|---|
| >3u62_A Shikimate dehydrogenase; shikimate pathway, oxidoreductase; 1.45A {Thermotoga maritima} | Back alignment and structure |
|---|
| >3ksu_A 3-oxoacyl-acyl carrier protein reductase; structural genomics, PSI-2, dehydrogenase, protein structure initiative; 2.30A {Oenococcus oeni psu-1} | Back alignment and structure |
|---|
| >1dih_A Dihydrodipicolinate reductase; oxidoreductase; HET: NDP; 2.20A {Escherichia coli} SCOP: c.2.1.3 d.81.1.3 PDB: 1arz_A* 1dru_A* 1drv_A* 1drw_A* | Back alignment and structure |
|---|
| >3ego_A Probable 2-dehydropantoate 2-reductase; structural genomics, PANE, unknown function, cytoplasm, NADP, oxidoreductase; 1.90A {Bacillus subtilis} | Back alignment and structure |
|---|
| >3i83_A 2-dehydropantoate 2-reductase; structural genomics, oxidoreductase, NADP, pantothenate BIOS PSI-2, protein structure initiative; 1.90A {Methylococcus capsulatus} | Back alignment and structure |
|---|
| >3ftp_A 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid, 3-ketoacyl-(acyl-carrier- protein) reductase, oxidoreductase, structural genomics; 2.05A {Burkholderia pseudomallei} | Back alignment and structure |
|---|
| >1mxh_A Pteridine reductase 2; SDR topology, protein-substrate complex, oxidoreductase; HET: NAP DHF; 2.20A {Trypanosoma cruzi} SCOP: c.2.1.2 PDB: 1mxf_A* | Back alignment and structure |
|---|
| >1oju_A MDH, malate dehydrogenase; hyperthermophilic, oxidoreductase; HET: ENA; 2.79A {Archaeoglobus fulgidus} PDB: 1ojs_A* 2x0i_A* 2x0j_A* | Back alignment and structure |
|---|
| >3g0o_A 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine catabolism, tartaric acid, target 11128H, NYSGXRC, PSI-2, structural genomics; HET: TLA; 1.80A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >1xg5_A ARPG836; short chain dehydrogenase, human, SGC, structural genomics, structural genomics consortium, oxidoreductase; HET: NAP; 1.53A {Homo sapiens} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >1yxm_A Pecra, peroxisomal trans 2-enoyl COA reductase; perioxisomes, fatty acid synthesis, short-chain dehydrogenases/reductases, structural genomics; HET: ADE; 1.90A {Homo sapiens} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >1t2d_A LDH-P, L-lactate dehydrogenase; ternary complex, oxidoreductase; HET: NAD; 1.10A {Plasmodium falciparum} SCOP: c.2.1.5 d.162.1.1 PDB: 1t25_A* 1t26_A* 1t2c_A* 1t24_A* 2x8l_A 2ydn_A* 2a94_A* 1u4s_A* 1u5a_A* 1u5c_A* 1u4o_A* 1t2e_A* 1xiv_A* 1ceq_A 1ldg_A* 1cet_A* 1oc4_A* 2a92_A* 2aa3_A* | Back alignment and structure |
|---|
| >3i6i_A Putative leucoanthocyanidin reductase 1; rossmann fold, short chain dehydrogenase reductase, flavonoi oxidoreductase; HET: NDP; 1.75A {Vitis vinifera} PDB: 3i5m_A 3i52_A* 3i6q_A* | Back alignment and structure |
|---|
| >1i36_A Conserved hypothetical protein MTH1747; NADP binding domain, protein NADP complex, structural genomics, PSI; HET: NAP; 2.00A {Methanothermobacterthermautotrophicus} SCOP: a.100.1.8 c.2.1.6 | Back alignment and structure |
|---|
| >1zcj_A Peroxisomal bifunctional enzyme; peroxisomal multifunctional enzyme type 1, L-bifunction enzyme, MFE-1, fatty acid beta oxidation; 1.90A {Rattus norvegicus} | Back alignment and structure |
|---|
| >1zem_A Xylitol dehydrogenase; rossmann fold, dinucleotide-binding domain, oxidoreductase; HET: NAD; 1.90A {Gluconobacter oxydans} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >1pzg_A LDH, lactate dehydrogenase; apicomplexa, APAD, tetramer, rossmann fold, oxidoreductase; HET: CME A3D; 1.60A {Toxoplasma gondii} SCOP: c.2.1.5 d.162.1.1 PDB: 1pzf_A* 1pze_A* 1pzh_A* 3om9_A* 1sov_A 1sow_A* 3czm_A* | Back alignment and structure |
|---|
| >3afn_B Carbonyl reductase; alpha/beta/alpha, rossmann-fold, oxidoreductase; HET: NAP; 1.63A {Sphingomonas SP} PDB: 3afm_A* | Back alignment and structure |
|---|
| >1rkx_A CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; 1.80A {Yersinia pseudotuberculosis} SCOP: c.2.1.2 PDB: 1wvg_A* | Back alignment and structure |
|---|
| >3u9l_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.10A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >1vl6_A Malate oxidoreductase; TM0542, NAD-dependent malic enzyme, structural genomics, JCS protein structure initiative, PSI; 2.61A {Thermotoga maritima} SCOP: c.2.1.7 c.58.1.3 PDB: 2hae_A* | Back alignment and structure |
|---|
| >3r3s_A Oxidoreductase; structural genomics, csgid, center for structural genomics O infectious diseases, 3-layer(ABA) sandwich, rossmann fold; HET: NAD; 1.25A {Salmonella enterica subsp} | Back alignment and structure |
|---|
| >1gq2_A Malic enzyme; oxidoreductase, pigeon liver, NADP-dependent, NAD-NADP selectivity, decarboxylase, malate, Mn2+; HET: NAP; 2.5A {Columba livia} SCOP: c.2.1.7 c.58.1.3 PDB: 2aw5_A | Back alignment and structure |
|---|
| >2v6b_A L-LDH, L-lactate dehydrogenase; oxidoreductase, radioresistance, NAD, cytoplasm, mesophilic, glycolysis; 2.50A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >2z1m_A GDP-D-mannose dehydratase; short-chain dehydrogenase/reductase, lyase, structural genom NPPSFA; HET: NDP GDP; 2.00A {Aquifex aeolicus} PDB: 2z95_A* | Back alignment and structure |
|---|
| >3doj_A AT3G25530, dehydrogenase-like protein; gamma-hydroxybutyrate dehydrogenase, 4-hydroxybutyrate dehydrogenase; 2.10A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2x4g_A Nucleoside-diphosphate-sugar epimerase; isomerase; 2.65A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >3gvc_A Oxidoreductase, probable short-chain type dehydrogenase/reductase; ssgcid, decode, niaid, UWPPG, SBRI, structural genomics; 2.45A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >2bgk_A Rhizome secoisolariciresinol dehydrogenase; oxidoreductase; 1.6A {Podophyllum peltatum} SCOP: c.2.1.2 PDB: 2bgl_A* 2bgm_A* | Back alignment and structure |
|---|
| >2j6i_A Formate dehydrogenase; oxidoreductase, D-specific-2- hydroxy acid dehydrogenase, cofactor regenerator, yeast, CBFDH; HET: PG4; 1.55A {Candida boidinii} PDB: 2fss_A | Back alignment and structure |
|---|
| >1ez4_A Lactate dehydrogenase; rossmann fold, oxidoreductase; HET: NAD; 2.30A {Lactobacillus pentosus} SCOP: c.2.1.5 d.162.1.1 | Back alignment and structure |
|---|
| >2a9f_A Putative malic enzyme ((S)-malate:NAD+ oxidoreductase (decarboxylating)); hypothetical protein, structural genomics, PSI; 2.50A {Streptococcus pyogenes} | Back alignment and structure |
|---|
| >4fs3_A Enoyl-[acyl-carrier-protein] reductase [NADPH] FA; rossmann fold, short chain dehydrogenase, NADPH binding, oxidoreductase; HET: 0WD 0WE; 1.80A {Staphylococcus aureus subsp} PDB: 3gr6_A* 3gns_A* 4all_A* 3gnt_A 4alk_A* 4alj_A* 4ali_A* 4alm_A 4aln_A | Back alignment and structure |
|---|
| >3p2o_A Bifunctional protein fold; structural genomics, center for structural genomics of infec diseases, csgid, alpha-beta-alpha sandwich; HET: NAD; 2.23A {Campylobacter jejuni subsp} | Back alignment and structure |
|---|
| >3hwr_A 2-dehydropantoate 2-reductase; YP_299159.1, PANE/APBA family ketopantoate reductase, struct genomics, joint center for structural genomics; HET: NDP BCN; 2.15A {Ralstonia eutropha} | Back alignment and structure |
|---|
| >2i99_A MU-crystallin homolog; thyroid hormine binding protein, oxidoreductase; HET: NDP; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >1y6j_A L-lactate dehydrogenase; southeast collaboratory for structural genomics, secsg, protein struc initiative, PSI, oxidoreductase; 3.01A {Clostridium thermocellum} SCOP: c.2.1.5 d.162.1.1 | Back alignment and structure |
|---|
| >3ai3_A NADPH-sorbose reductase; rossmann-fold, NADPH-dependent reductase, short chain dehydrogenase/reductase, oxidoreductase; HET: NAP SOL SOE; 1.80A {Gluconobacter frateurii} PDB: 3ai2_A* 3ai1_A* | Back alignment and structure |
|---|
| >2c5a_A GDP-mannose-3', 5'-epimerase; short chain dehydratase/reductase, GDP-gulose, GDP-galactose, keto intermediate, vitamin C, SDR; HET: GDC NAD BTB; 1.4A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2c59_A* 2c54_A* 2c5e_A* | Back alignment and structure |
|---|
| >3n74_A 3-ketoacyl-(acyl-carrier-protein) reductase; seattle structural genomics center for infectious disease, S brucellosis; 2.20A {Brucella melitensis biovar abortus} | Back alignment and structure |
|---|
| >3rih_A Short chain dehydrogenase or reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: PG5; 2.15A {Mycobacterium abscessus} | Back alignment and structure |
|---|
| >2qyt_A 2-dehydropantoate 2-reductase; APC81190, porphyromonas gingi W83, structural genomics, PSI-2; HET: MSE; 2.15A {Porphyromonas gingivalis} | Back alignment and structure |
|---|
| >2rhc_B Actinorhodin polyketide ketoreductase; oxidoreductase, combinatorial biosynthesis, short chain dehydrogenase/reductase; HET: NAP EMO; 2.10A {Streptomyces coelicolor} SCOP: c.2.1.2 PDB: 2rh4_A* 1w4z_A* 3csd_B* 3qrw_A* 3ri3_B* 2rhr_B* 1x7g_A* 1x7h_A* 1xr3_A* | Back alignment and structure |
|---|
| >3o38_A Short chain dehydrogenase; tuberculosis, ortholog from A non-pathogenic dehydrogenase, structural genomics; 1.95A {Mycobacterium smegmatis} | Back alignment and structure |
|---|
| >1b0a_A Protein (fold bifunctional protein); folate, dehydrogenase, cyclcohydrolase, channeling, oxidoreductase,hydrolase; 2.56A {Escherichia coli K12} SCOP: c.2.1.7 c.58.1.2 | Back alignment and structure |
|---|
| >2gdz_A NAD+-dependent 15-hydroxyprostaglandin dehydrogen; dehydrogenase, structural genomics, SH dehydrogenase/reductase, inflammation; HET: NAD; 1.65A {Homo sapiens} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >4hb9_A Similarities with probable monooxygenase; flavin, structural genomics, NEW YORK structural genomics RE consortium, nysgrc, PSI; HET: MSE FAD; 1.93A {Photorhabdus luminescens} | Back alignment and structure |
|---|
| >1omo_A Alanine dehydrogenase; two-domain, beta-sandwich-dimer, rossmann-fold NAD domain, human MU crystallin homolog; HET: NAD; 2.32A {Archaeoglobus fulgidus} SCOP: c.2.1.13 PDB: 1vll_A | Back alignment and structure |
|---|
| >1rkx_A CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; 1.80A {Yersinia pseudotuberculosis} SCOP: c.2.1.2 PDB: 1wvg_A* | Back alignment and structure |
|---|
| >3d0o_A L-LDH 1, L-lactate dehydrogenase 1; cytoplasm, glycolysis, NAD, oxidoreductase, phosphoprotein; 1.80A {Staphylococcus aureus} PDB: 3d4p_A* 3h3j_A* | Back alignment and structure |
|---|
| >2nac_A NAD-dependent formate dehydrogenase; oxidoreductase(aldehyde(D),NAD+(A)); 1.80A {Pseudomonas SP} SCOP: c.2.1.4 c.23.12.1 PDB: 2nad_A* 2go1_A 2gug_A* 2gsd_A* 3fn4_A | Back alignment and structure |
|---|
| >3e48_A Putative nucleoside-diphosphate-sugar epimerase; alpha-beta protein., structural genomics, PSI-2, protein STR initiative; 1.60A {Staphylococcus aureus subsp} | Back alignment and structure |
|---|
| >4f6c_A AUSA reductase domain protein; thioester reductase, oxidoreductase; 2.81A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >4gwg_A 6-phosphogluconate dehydrogenase, decarboxylating; 6-phosphoglyconate dehydrogenase, NADP, oxido; HET: MES; 1.39A {Homo sapiens} PDB: 4gwk_A* 2jkv_A* 2pgd_A 1pgo_A* 1pgp_A* 1pgq_A* 1pgn_A | Back alignment and structure |
|---|
| >3kkj_A Amine oxidase, flavin-containing; oxidoreductase, PSR10, Q888A4, X-RAY, structure, PSI, protein structure initiative; HET: FAD; 2.50A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >2izz_A Pyrroline-5-carboxylate reductase 1; amino-acid biosynthesis, NADP, oxidoreductase, proline biosy; HET: NAD; 1.95A {Homo sapiens} PDB: 2ger_A 2gr9_A* 2gra_A* | Back alignment and structure |
|---|
| >1wma_A Carbonyl reductase [NADPH] 1; oxidoreductase; HET: AB3 NDP PE5 P33; 1.24A {Homo sapiens} SCOP: c.2.1.2 PDB: 3bhi_A* 3bhj_A* 3bhm_A* 2pfg_A* 1n5d_A* 2hrb_A* | Back alignment and structure |
|---|
| >2qq5_A DHRS1, dehydrogenase/reductase SDR family member 1; short-chain, structura genomics consortium, SGC, oxidoreductase; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >4e5n_A Thermostable phosphite dehydrogenase; D-2-hydroxyacid dehydrogenase, oxidoreductase; HET: NAD; 1.70A {Pseudomonas stutzeri} PDB: 4e5k_A* 4ebf_A* 4e5p_A* 4e5m_A* | Back alignment and structure |
|---|
| >3ehe_A UDP-glucose 4-epimerase (GALE-1); PSI-II, NYSGXRC, ST genomics, protein structure initiative, NEW YORK SGX resear for structural genomics; HET: NAD; 1.87A {Archaeoglobus fulgidus} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >1spx_A Short-chain reductase family member (5L265); parallel beta-sheet of seven strands in the order 3214567; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3ko8_A NAD-dependent epimerase/dehydratase; isomerase, UDP-galactose 4-epimerase; HET: NAD; 1.80A {Pyrobaculum calidifontis} SCOP: c.2.1.0 PDB: 3icp_A* 3aw9_A* | Back alignment and structure |
|---|
| >2i99_A MU-crystallin homolog; thyroid hormine binding protein, oxidoreductase; HET: NDP; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >2axq_A Saccharopine dehydrogenase; rossmann fold variant, saccharopine reductase fold (domain II), alpha/beta protein; 1.70A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4gx0_A TRKA domain protein; membrane protein, ION channel, ADP binding, NAD binding, MEM transport protein; HET: MAL GLC; 2.60A {Geobacter sulfurreducens} PDB: 4gx1_A* 4gx2_A* 4gx5_A 4gvl_A* | Back alignment and structure |
|---|
| >3oet_A Erythronate-4-phosphate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 2.36A {Salmonella enterica subsp} | Back alignment and structure |
|---|
| >3lf2_A Short chain oxidoreductase Q9HYA2; SDR, SCOR, rossmann fold; HET: NAP; 2.30A {Pseudomonas aeruginosa} PDB: 3lf1_A* | Back alignment and structure |
|---|
| >3l07_A Bifunctional protein fold; structural genomics, IDP01849, methylenetetrahydrofolate dehydrogenase; 1.88A {Francisella tularensis} | Back alignment and structure |
|---|
| >2c5a_A GDP-mannose-3', 5'-epimerase; short chain dehydratase/reductase, GDP-gulose, GDP-galactose, keto intermediate, vitamin C, SDR; HET: GDC NAD BTB; 1.4A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2c59_A* 2c54_A* 2c5e_A* | Back alignment and structure |
|---|
| >2cuk_A Glycerate dehydrogenase/glyoxylate reductase; structural genomics, riken structur genomics/proteomics initiative, RSGI, NPPSFA; HET: NHE; 2.00A {Thermus thermophilus} | Back alignment and structure |
|---|
| >4fgs_A Probable dehydrogenase protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, three layer; 1.76A {Rhizobium etli} | Back alignment and structure |
|---|
| >3osu_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, csgid, center for structural genomics O infectious diseases; 1.90A {Staphylococcus aureus subsp} SCOP: c.2.1.0 PDB: 3sj7_A* | Back alignment and structure |
|---|
| >3qy9_A DHPR, dihydrodipicolinate reductase; rossmann fold, NADH, NADPH, oxidoreductase; 1.80A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >3enk_A UDP-glucose 4-epimerase; seattle structural genomics center for infectious disease, ssgcid, isomerase, NAD; HET: NAD GUD; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >1pjc_A Protein (L-alanine dehydrogenase); oxidoreductase, NAD; HET: NAD; 2.00A {Phormidium lapideum} SCOP: c.2.1.4 c.23.12.2 PDB: 1pjb_A* 1say_A | Back alignment and structure |
|---|
| >2q1w_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, sugar binding protein; HET: NAD; 2.19A {Bordetella bronchiseptica} | Back alignment and structure |
|---|
| >1jay_A Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossman fold, structural genomics; HET: NAP F42; 1.65A {Archaeoglobus fulgidus} SCOP: c.2.1.6 PDB: 1jax_A* | Back alignment and structure |
|---|
| >2ahr_A Putative pyrroline carboxylate reductase; pyrroline reductase, proline biosynthesis, NAD(P protein, rossmann fold, doain swapping; HET: NAP; 2.15A {Streptococcus pyogenes} SCOP: a.100.1.10 c.2.1.6 PDB: 2amf_A | Back alignment and structure |
|---|
| >4dyv_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.80A {Xanthobacter autotrophicus} | Back alignment and structure |
|---|
| >2jl1_A Triphenylmethane reductase; oxidoreductase, bioremediation; HET: NAP GOL; 1.96A {Citrobacter SP} PDB: 2vrb_A* 2vrc_A 2vrc_D | Back alignment and structure |
|---|
| >2o23_A HADH2 protein; HSD17B10, schad, ERAB, type II HADH, 2-methyl-3-hydroxybuTyr dehydrogenase, MHBD, structural genomics, structural genomi consortium; HET: NAD GOL; 1.20A {Homo sapiens} SCOP: c.2.1.2 PDB: 1so8_A 1u7t_A* 1e3s_A* 1e3w_B* 1e3w_A* 1e6w_A* | Back alignment and structure |
|---|
| >3dtt_A NADP oxidoreductase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: NAP; 1.70A {Arthrobacter SP} | Back alignment and structure |
|---|
| >4dry_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.50A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >2iz1_A 6-phosphogluconate dehydrogenase, decarboxylating; pentose shunt, oxidoreductase, gluconate utilization; HET: ATR RES P33; 2.30A {Lactococcus lactis} PDB: 2iz0_A* 2iyp_A* 2iyo_A* | Back alignment and structure |
|---|
| >2a9f_A Putative malic enzyme ((S)-malate:NAD+ oxidoreductase (decarboxylating)); hypothetical protein, structural genomics, PSI; 2.50A {Streptococcus pyogenes} | Back alignment and structure |
|---|
| >3hg7_A D-isomer specific 2-hydroxyacid dehydrogenase FAM protein; structural genomics; 1.80A {Aeromonas salmonicida subsp} | Back alignment and structure |
|---|
| >4dll_A 2-hydroxy-3-oxopropionate reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.11A {Polaromonas SP} | Back alignment and structure |
|---|
| >3eag_A UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-ME diaminopimelate ligase; UDP-N-acetylmuramate:L-alanyl-G glutamyl-MESO-diaminopimelate ligase; 2.55A {Neisseria meningitidis MC58} | Back alignment and structure |
|---|
| >4dqx_A Probable oxidoreductase protein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.00A {Rhizobium etli} | Back alignment and structure |
|---|
| >2nwq_A Probable short-chain dehydrogenase; oxidoreductase; 2.30A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >3b1f_A Putative prephenate dehydrogenase; enzyme, 4-hydroxyphenylpyruvate, oxidative decarboxylation pathway, tyrosine biosynthesis, oxidoreduct; HET: NAD; 2.10A {Streptococcus mutans} PDB: 3dzb_A | Back alignment and structure |
|---|
| >2pd6_A Estradiol 17-beta-dehydrogenase 8; short-chain dehydrogenase/reductase, steroid metabolism, LIP metabolism, structural genomics; HET: NAD; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1omo_A Alanine dehydrogenase; two-domain, beta-sandwich-dimer, rossmann-fold NAD domain, human MU crystallin homolog; HET: NAD; 2.32A {Archaeoglobus fulgidus} SCOP: c.2.1.13 PDB: 1vll_A | Back alignment and structure |
|---|
| >4eso_A Putative oxidoreductase; NADP, structural genomics, PSI-biology, NEW structural genomics research consortium, nysgrc; HET: MSE NAP; 1.91A {Sinorhizobium meliloti} PDB: 3vc7_A | Back alignment and structure |
|---|
| >3pef_A 6-phosphogluconate dehydrogenase, NAD-binding; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R geobacter metallireducens; HET: NAP; 2.07A {Geobacter metallireducens} | Back alignment and structure |
|---|
| >1sby_A Alcohol dehydrogenase; ternary complex, NAD, trifluoroethanol, oxidoreductase; HET: NAD; 1.10A {Scaptodrosophila lebanonensis} SCOP: c.2.1.2 PDB: 1b14_A* 1b15_A* 1a4u_A* 1b2l_A* 1b16_A* 3rj5_A* 3rj9_A* 1mg5_A* | Back alignment and structure |
|---|
| >4dmm_A 3-oxoacyl-[acyl-carrier-protein] reductase; rossmann fold, oxoacyl-ACP reductase, NADP binding, fatty AC biosynthsis, oxidoreductase; HET: NAP; 2.38A {Synechococcus elongatus} PDB: 4dml_A* | Back alignment and structure |
|---|
| >1npy_A Hypothetical shikimate 5-dehydrogenase-like protein HI0607; structural genomics, PSI, protein structure initiative; 1.75A {Haemophilus influenzae} SCOP: c.2.1.7 c.58.1.5 | Back alignment and structure |
|---|
| >3l6e_A Oxidoreductase, short-chain dehydrogenase/reducta; structural genomics, PSI-2, protein structure initiative; 2.30A {Aeromonas hydrophila subsp} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >1ur5_A Malate dehydrogenase; oxidoreductase, tricarboxylic acid cycle; HET: NAD; 1.75A {Chloroflexus aurantiacus} SCOP: c.2.1.5 d.162.1.1 PDB: 1uxg_A* 1guy_A* 1uxk_A* 1uxh_A* 1uxj_A* 1uxi_A* | Back alignment and structure |
|---|
| >1xq1_A Putative tropinone reducatse; structural genomics, protein structure initiative, CESG, AT1 reductively methylated protein; 2.10A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2q45_A | Back alignment and structure |
|---|
| >3e48_A Putative nucleoside-diphosphate-sugar epimerase; alpha-beta protein., structural genomics, PSI-2, protein STR initiative; 1.60A {Staphylococcus aureus subsp} | Back alignment and structure |
|---|
| >3rd5_A Mypaa.01249.C; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; HET: EPE; 1.50A {Mycobacterium paratuberculosis} | Back alignment and structure |
|---|
| >4gx0_A TRKA domain protein; membrane protein, ION channel, ADP binding, NAD binding, MEM transport protein; HET: MAL GLC; 2.60A {Geobacter sulfurreducens} PDB: 4gx1_A* 4gx2_A* 4gx5_A 4gvl_A* | Back alignment and structure |
|---|
| >2pnf_A 3-oxoacyl-[acyl-carrier-protein] reductase; short chain oxidoreductase, rossmann fold, oxidoreductase; HET: 1PE MES; 1.80A {Aquifex aeolicus} PDB: 2p68_A* | Back alignment and structure |
|---|
| >1ja9_A 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, oxidoreductase, chain dehydrogenase; HET: NDP PYQ; 1.50A {Magnaporthe grisea} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >2zqz_A L-LDH, L-lactate dehydrogenase; oxidoreductase, rossmann fold, cytoplasm, glycolysis, NAD, phosphoprotein; 2.50A {Lactobacillus casei} PDB: 2zqy_A 3vkv_A* 1llc_A* | Back alignment and structure |
|---|
| >2gas_A Isoflavone reductase; NADPH-dependent reductase, oxidoreductase; 1.60A {Medicago sativa} | Back alignment and structure |
|---|
| >3grk_A Enoyl-(acyl-carrier-protein) reductase (NADH); ssgcid, niaid, structural genomics, seattle structural genomics center for infectious disease; 2.35A {Brucella melitensis} PDB: 4eit_A* | Back alignment and structure |
|---|
| >1iy8_A Levodione reductase; oxidoreductase; HET: NAD; 1.60A {Leifsonia aquatica} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3hn2_A 2-dehydropantoate 2-reductase; PSI-2, NYSGXRC, structural GE protein structure initiative; 2.50A {Geobacter metallireducens} | Back alignment and structure |
|---|
| >2hk9_A Shikimate dehydrogenase; shikimate pathway, drug design, oxidoreductase; HET: ATR SKM NAP; 2.20A {Aquifex aeolicus} PDB: 2hk8_A 2hk7_A | Back alignment and structure |
|---|
| >2rcy_A Pyrroline carboxylate reductase; malaria, structural genomics, pyrroline reductase, oxidoredu structural genomics consortium, SGC; HET: NAP; 2.30A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >3svt_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 2.00A {Mycobacterium ulcerans} | Back alignment and structure |
|---|
| >3gt0_A Pyrroline-5-carboxylate reductase; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG; 2.00A {Bacillus cereus atcc 14579} | Back alignment and structure |
|---|
| >3is3_A 17BETA-hydroxysteroid dehydrogenase; short chain dehydrogenase/REDU SDR, fungi, oxidoreductase; HET: GOL; 1.48A {Cochliobolus lunatus} PDB: 3qwf_A* 3qwh_A* 3qwi_A* 3itd_A | Back alignment and structure |
|---|
| >3nv9_A Malic enzyme; rossmann fold, oxidoreductase; 2.25A {Entamoeba histolytica} | Back alignment and structure |
|---|
| >2uvd_A 3-oxoacyl-(acyl-carrier-protein) reductase; beta-ketoacyl- (acyl carrier protein) reductase, short-chain dehydrogenase/reductase (SDR); 2.4A {Bacillus anthracis} | Back alignment and structure |
|---|
| >2hrz_A AGR_C_4963P, nucleoside-diphosphate-sugar epimerase; agrobacterium tumefa structural genomics, PSI-2, protein structure initiative; 1.85A {Agrobacterium tumefaciens} | Back alignment and structure |
|---|
| >1ae1_A Tropinone reductase-I; oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to tropine, short-chain dehydrogenase; HET: NAP; 2.40A {Datura stramonium} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >1xkq_A Short-chain reductase family member (5D234); parrallel beta-sheet of seven strands in the order 3214567; HET: NDP; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >4iiu_A 3-oxoacyl-[acyl-carrier protein] reductase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAP; 2.10A {Escherichia coli} PDB: 4iiv_A* | Back alignment and structure |
|---|
| >2b4q_A Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier-protein] reductase; RHLG-NADP complex, oxidoreductase; HET: NAP; 2.30A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >1vl8_A Gluconate 5-dehydrogenase; TM0441, structural genomics, JCSG structure initiative, PSI, joint center for structural GENO oxidoreductase; HET: NAP; 2.07A {Thermotoga maritima} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >2ydy_A Methionine adenosyltransferase 2 subunit beta; oxidoreductase; 2.25A {Homo sapiens} PDB: 2ydx_A | Back alignment and structure |
|---|
| >2xxj_A L-LDH, L-lactate dehydrogenase; oxidoreductase, hyperthermophIle; HET: NAD; 1.964A {Thermus thermophilus} PDB: 2xxb_A* 3zzn_A* 2v7p_A* 2e37_A* 2v6m_A* 2xxe_A 4a73_A | Back alignment and structure |
|---|
| >3k96_A Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA, IDP01976, oxidoreductase, phospholipid biosynthesis; HET: EPE; 2.10A {Coxiella burnetii} | Back alignment and structure |
|---|
| >3st7_A Capsular polysaccharide synthesis enzyme CAP5F; rossmann fold, cupid domain, short-chain dehydrogenase/reduc NADPH; 2.45A {Staphylococcus aureus} PDB: 2zkl_A 3vhr_A | Back alignment and structure |
|---|
| >1txg_A Glycerol-3-phosphate dehydrogenase [NAD(P)+]; oxidoreductase; 1.70A {Archaeoglobus fulgidus} SCOP: a.100.1.6 c.2.1.6 | Back alignment and structure |
|---|
| >4f3y_A DHPR, dihydrodipicolinate reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.10A {Burkholderia thailandensis} | Back alignment and structure |
|---|
| >2x9g_A PTR1, pteridine reductase; short chain dehydrogenase, oxidoreductase; HET: NAP LYA; 1.10A {Trypanosoma brucei brucei} PDB: 2x9n_A* 2x9v_A* 3bmc_A* 3bmd_A* 3bme_A* 3bmf_A* 3bmg_A* 3bmh_A* 3bmi_A* 3bmj_A* 3bmk_A* 3bml_A* 3bmm_A* 3bmn_A* 3bmo_A* 3bmq_A* 3bmr_A* 3gn1_A* 3gn2_A* 3jq6_A* ... | Back alignment and structure |
|---|
| >3rkr_A Short chain oxidoreductase; rossmann fold; HET: NAP; 2.42A {Uncultured bacterium BIO5} | Back alignment and structure |
|---|
| >1nyt_A Shikimate 5-dehydrogenase; alpha/beta domains, WIDE cleft separation, oxidoreductase; HET: NAP; 1.50A {Escherichia coli} SCOP: c.2.1.7 c.58.1.5 | Back alignment and structure |
|---|
| >1gpj_A Glutamyl-tRNA reductase; tRNA-dependent tetrapyrrole biosynthesis; HET: GMC CIT; 1.95A {Methanopyrus kandleri} SCOP: a.151.1.1 c.2.1.7 d.58.39.1 | Back alignment and structure |
|---|
| >3k6j_A Protein F01G10.3, confirmed by transcript evidenc; rossmann fold, oxidoreductase; 2.20A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >3gvx_A Glycerate dehydrogenase related protein; NYSGXRC, PSI-II, 11143J, structural genomics, protein structure initiative; 2.20A {Thermoplasma acidophilum} | Back alignment and structure |
|---|
| >4aj2_A L-lactate dehydrogenase A chain; oxidoreductase-inhibitor complex, fragment-based LEAD genera inhibitors; HET: 52C; 1.75A {Rattus norvegicus} PDB: 4aj1_A* 4aje_A* 4ajh_A* 4aji_A* 4ajj_A* 4ajk_A* 4ajl_A* 4ajn_A* 4ajo_A* 4al4_A* 4aj4_A* 4ajp_A* 1i10_A* 3h3f_A* 9ldt_A* 9ldb_A* 1t2f_A* 1i0z_A* 5ldh_A* 1ldm_A* ... | Back alignment and structure |
|---|
| >2eez_A Alanine dehydrogenase; TTHA0216, structural genomic NPPSFA, national project on protein structural and function analyses; 2.71A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3op4_A 3-oxoacyl-[acyl-carrier protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase; HET: MSE NAP; 1.60A {Vibrio cholerae o1 biovar el tor} SCOP: c.2.1.2 PDB: 3rsh_A* 3rro_A* 4i08_A* 3tzk_A 3tzc_A* 3u09_A 3tzh_A 1q7b_A* 1i01_A* 1q7c_A* 2cf2_E | Back alignment and structure |
|---|
| >2aef_A Calcium-gated potassium channel MTHK; rossmann fold, helix-turn-helix, Ca2+ binding, flexible interface; 1.70A {Methanothermobacterthermautotrophicus} PDB: 2aej_A 2aem_A 3rbx_A 2ogu_A 2fy8_A 3kxd_A | Back alignment and structure |
|---|
| >1orr_A CDP-tyvelose-2-epimerase; rossmann fold, short-chain dehydrogenase/reductase, isomeras; HET: NAD CDP; 1.50A {Salmonella typhi} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >1z82_A Glycerol-3-phosphate dehydrogenase; TM0378, structural genom joint center for structural genomics, JCSG, protein structu initiative, PSI; HET: MSE NDP G3H G3P; 2.00A {Thermotoga maritima} | Back alignment and structure |
|---|
| >3k5p_A D-3-phosphoglycerate dehydrogenase; niaid, ssgcid, seattle structural genomics center for infect disease, brucellosis; 2.15A {Brucella melitensis biovar abortus} | Back alignment and structure |
|---|
| >3hhp_A Malate dehydrogenase; MDH, citric acid cycle, TCA cycle, NAD, oxidoreductase, tricarboxylic acid cycle; 1.45A {Escherichia coli k-12} PDB: 2pwz_A 2cmd_A* 1emd_A* 1ib6_A* 1ie3_A* 4e0b_A* | Back alignment and structure |
|---|
| >1nff_A Putative oxidoreductase RV2002; directed evolution, GFP, SDR, hydroxysteroid dehydrogenase, structural genomics, PSI; HET: NAD; 1.80A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1nfq_A* 1nfr_A* | Back alignment and structure |
|---|
| >3l6d_A Putative oxidoreductase; structural genomics, protein structure initiative, oxidoredu PSI-2; HET: MSE; 1.90A {Pseudomonas putida} | Back alignment and structure |
|---|
| >3ak4_A NADH-dependent quinuclidinone reductase; SDR, (R)-3-quinuclidinol, chiral alcohol, oxidoreductase; HET: NAD; 2.00A {Agrobacterium tumefaciens} | Back alignment and structure |
|---|
| >2iz1_A 6-phosphogluconate dehydrogenase, decarboxylating; pentose shunt, oxidoreductase, gluconate utilization; HET: ATR RES P33; 2.30A {Lactococcus lactis} PDB: 2iz0_A* 2iyp_A* 2iyo_A* | Back alignment and structure |
|---|
| >3pp8_A Glyoxylate/hydroxypyruvate reductase A; structural genomics, center for structural genomics of infec diseases, csgid; 2.10A {Salmonella enterica subsp} PDB: 3kbo_A | Back alignment and structure |
|---|
| >3a28_C L-2.3-butanediol dehydrogenase; chiral substrate recognition, oxidoreductase; HET: NAD; 2.00A {Brevibacterium saccharolyticum} | Back alignment and structure |
|---|
| >2i6t_A Ubiquitin-conjugating enzyme E2-like isoform A; L-lactate dehydrogenase, oxidoreductase, ubiquitin-protein L unknown function; 2.10A {Homo sapiens} PDB: 3dl2_A | Back alignment and structure |
|---|
| >3qiv_A Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR protein] reductase; structural genomics; 2.25A {Mycobacterium avium subsp} | Back alignment and structure |
|---|
| >3un1_A Probable oxidoreductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.45A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >3kb6_A D-lactate dehydrogenase; oxidoreductase, D-LDH, NAD, structural genomics, NPPSFA, NAT project on protein structural and functional analyses; HET: MSE NAD 1PE; 2.12A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >1zk4_A R-specific alcohol dehydrogenase; short chain reductases/dehydrogenases, magnesium dependence, oxidoreductase; HET: NAP; 1.00A {Lactobacillus brevis} SCOP: c.2.1.2 PDB: 1nxq_A* 1zjy_A* 1zjz_A* 1zk0_A* 1zk1_A* 1zk2_A 1zk3_A | Back alignment and structure |
|---|
| >3sc6_A DTDP-4-dehydrorhamnose reductase; RFBD, structural genomics, infectious diseases, bacillus anthracis STR. AMES, rhamnose biosynthetic pathway; HET: NAP; 2.65A {Bacillus anthracis} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >3gg2_A Sugar dehydrogenase, UDP-glucose/GDP-mannose dehydrogenase family; structural genomics, oxidoreductase, PSI-2; HET: UGA; 1.70A {Porphyromonas gingivalis} | Back alignment and structure |
|---|
| >1nyt_A Shikimate 5-dehydrogenase; alpha/beta domains, WIDE cleft separation, oxidoreductase; HET: NAP; 1.50A {Escherichia coli} SCOP: c.2.1.7 c.58.1.5 | Back alignment and structure |
|---|
| >3i83_A 2-dehydropantoate 2-reductase; structural genomics, oxidoreductase, NADP, pantothenate BIOS PSI-2, protein structure initiative; 1.90A {Methylococcus capsulatus} | Back alignment and structure |
|---|
| >1pj3_A NAD-dependent malic enzyme, mitochondrial; oxidative decarboxylase, oxidoreductase; HET: NAD; 2.10A {Homo sapiens} SCOP: c.2.1.7 c.58.1.3 PDB: 1pj2_A* 1do8_A* 1pj4_A* 1qr6_A* 1efl_A* 1pjl_A* 1efk_A* 1gz4_A* 1gz3_A* | Back alignment and structure |
|---|
| >2c07_A 3-oxoacyl-(acyl-carrier protein) reductase; oxidoreductase, FABG, short-chain alcohol reductase, fatty acid biosynthesis, apicoplast; 1.5A {Plasmodium falciparum} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >2hq1_A Glucose/ribitol dehydrogenase; CTH-1438, structural genomics, southeast collaboratory for structural genomics, secsg, PSI; 1.90A {Clostridium thermocellum} | Back alignment and structure |
|---|
| >2dvm_A Malic enzyme, 439AA long hypothetical malate oxidoreductase; NAD, structural genomics, NPPSFA; HET: NAD MES; 1.60A {Pyrococcus horikoshii} PDB: 1ww8_A* | Back alignment and structure |
|---|
| >3rft_A Uronate dehydrogenase; apoenzyme, rossmann fold, NAD binding, oxidoreductase; 1.90A {Agrobacterium tumefaciens} PDB: 3rfv_A* 3rfx_A* | Back alignment and structure |
|---|
| >3i1j_A Oxidoreductase, short chain dehydrogenase/reducta; dimer, MIXE beta, structural genomics, PSI-2; 1.90A {Pseudomonas syringae PV} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >3qlj_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis; 1.80A {Mycobacterium avium} | Back alignment and structure |
|---|
| >3cky_A 2-hydroxymethyl glutarate dehydrogenase; rossmann fold, two domain enzyme, oxidoreductase; 2.30A {Eubacterium barkeri} | Back alignment and structure |
|---|
| >3qha_A Putative oxidoreductase; seattle structural genomics center for infectious disease, S mycobacterium avium 104, rossmann fold; 2.25A {Mycobacterium avium} | Back alignment and structure |
|---|
| >3ehe_A UDP-glucose 4-epimerase (GALE-1); PSI-II, NYSGXRC, ST genomics, protein structure initiative, NEW YORK SGX resear for structural genomics; HET: NAD; 1.87A {Archaeoglobus fulgidus} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >3ghy_A Ketopantoate reductase protein; oxidoreductase, NAD-binding domain, PSI-2, NYSGXRC, structur genomics, protein structure initiative; 2.00A {Ralstonia solanacearum} | Back alignment and structure |
|---|
| >3ado_A Lambda-crystallin; L-gulonate 3-dehydrogenase, structural genomics, riken struc genomics/proteomics initiative, RSGI, acetylation; 1.70A {Oryctolagus cuniculus} PDB: 3adp_A* 3f3s_A* | Back alignment and structure |
|---|
| >1f0y_A HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive ternary complex, oxidoreductase; HET: CAA NAD; 1.80A {Homo sapiens} SCOP: a.100.1.3 c.2.1.6 PDB: 3rqs_A 1lsj_A* 1il0_A* 1lso_A* 1m76_A* 1m75_A* 1f14_A 1f12_A 1f17_A* 3had_A* 2hdh_A* 3hdh_A* | Back alignment and structure |
|---|
| >3s55_A Putative short-chain dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 2.10A {Mycobacterium abscessus} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >1vkn_A N-acetyl-gamma-glutamyl-phosphate reductase; TM1782, structu genomics, JCSG, PSI, protein structure initiative, joint CE structural genomics; 1.80A {Thermotoga maritima} SCOP: c.2.1.3 d.81.1.1 | Back alignment and structure |
|---|
| >2ejw_A HDH, homoserine dehydrogenase; NAD-dependent, oxidoreductase; 1.70A {Thermus thermophilus} | Back alignment and structure |
|---|
| >1geg_A Acetoin reductase; SDR family, oxidoreductase; HET: GLC NAD; 1.70A {Klebsiella pneumoniae} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3d4o_A Dipicolinate synthase subunit A; NP_243269.1, structural GEN joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: MSE TAR; 2.10A {Bacillus halodurans} | Back alignment and structure |
|---|
| >3ond_A Adenosylhomocysteinase; plant protein, enzyme-substrate complex, NAD cofactor, regul SAM-dependent methylation reactions; HET: NAD ADN; 1.17A {Lupinus luteus} PDB: 3one_A* 3onf_A* | Back alignment and structure |
|---|
| >3ldh_A Lactate dehydrogenase; oxidoreductase, CHOH donor, NAD acceptor; HET: NAD; 3.00A {Squalus acanthias} SCOP: i.12.1.1 | Back alignment and structure |
|---|
| >3nep_X Malate dehydrogenase; halophIle, molecular adpatation, NAD, oxidoreductase, tricarboxylic acid cycle; 1.55A {Salinibacter ruber} | Back alignment and structure |
|---|
| >2hun_A 336AA long hypothetical DTDP-glucose 4,6-dehydrat; rossmann fold, structural genomics, NPPSFA; HET: NAD; 2.07A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST
Original result of RPS-BLAST against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
E-value |
| 1163 | ||||
| d1yova1 | 529 | c.111.1.2 (A:6-534) Amyloid beta precursor protein | 3e-59 | |
| d1yova1 | 529 | c.111.1.2 (A:6-534) Amyloid beta precursor protein | 1e-43 | |
| d1yova1 | 529 | c.111.1.2 (A:6-534) Amyloid beta precursor protein | 2e-33 | |
| d1yovb1 | 426 | c.111.1.2 (B:12-437) UBA3 {Human (Homo sapiens) [T | 4e-44 | |
| d1yovb1 | 426 | c.111.1.2 (B:12-437) UBA3 {Human (Homo sapiens) [T | 2e-19 | |
| d1yovb1 | 426 | c.111.1.2 (B:12-437) UBA3 {Human (Homo sapiens) [T | 8e-16 | |
| d1jw9b_ | 247 | c.111.1.1 (B:) Molybdenum cofactor biosynthesis pr | 1e-20 | |
| d1jw9b_ | 247 | c.111.1.1 (B:) Molybdenum cofactor biosynthesis pr | 6e-14 |
| >d1yova1 c.111.1.2 (A:6-534) Amyloid beta precursor protein-binding protein 1, APPBP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 529 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Activating enzymes of the ubiquitin-like proteins superfamily: Activating enzymes of the ubiquitin-like proteins family: Ubiquitin activating enzymes (UBA) domain: Amyloid beta precursor protein-binding protein 1, APPBP1 species: Human (Homo sapiens) [TaxId: 9606]
Score = 210 bits (537), Expect = 3e-59
Identities = 81/517 (15%), Positives = 164/517 (31%), Gaps = 61/517 (11%)
Query: 555 NSRYDAQISVFGAKLQKKLEDAKVFIVGSGALGCEFLKNVALMGVSCGNQGKLTITDDDV 614
+YD Q+ ++G Q+ LE A V ++ + A G E LKN+ L G+ G TI D +
Sbjct: 5 EQKYDRQLRLWGDHGQEALESAHVCLINATATGTEILKNLVLPGI-----GSFTIIDGNQ 59
Query: 615 IEKSNLSRQFLFRDWNIGQAKSTVAASAATSINPRLNIEALQNRVGPETENVFDDTFWEN 674
+ + F + +IG+ ++ A +N ++ ++ +N D +F+
Sbjct: 60 VSGEDAGNNFFLQRSSIGKNRAEAAMEFLQELNSDVSGSFVEESPENLLDN--DPSFFCR 117
Query: 675 ITCVINALDNVNARLYVDQRCLYFQKPLLESGTLGAKCNTQMVIPHLTENYGASRDPPEK 734
T V+ + L + Q PLL T G +++I E+ P
Sbjct: 118 FTVVVATQLPESTSLRLADVLWNSQIPLLICRTYGLVGYMRIIIK---EHPVIESHPDNA 174
Query: 735 QAPMCTVHSFPHNIDHCLTWARSEFEG-LLEKTPAEVNAYLSNPVEYTTSMANAGDA--- 790
+ FP +H ++ E TP V Y+ +
Sbjct: 175 LEDLRLDKPFPELREHFQSYDLDHMEKKDHSHTPWIVIIAKYLAQWYSETNGRIPKTYKE 234
Query: 791 -----QARDNLERVLECLDKEKCEIFQDCITWARLKFEDY-FSNRVKQLIFTFPEDAATS 844
E E E F++ I + ++ + T
Sbjct: 235 KEDFRDLIRQGILKNENGAPEDEENFEEAIKNVNTALNTTQIPSSIEDIFNDDRCINITK 294
Query: 845 TGAPFW---SAPKRF-------PHPLQFSSAD--PSHLHFVMAASILRAETFGIPIPDWT 892
FW A K F P++ + D ++ ++ R + D
Sbjct: 295 QTPSFWILARALKEFVAKEGQGNLPVRGTIPDMIADSGKYIKLQNVYREK----AKKDAA 350
Query: 893 NNPKMLAEAVDKV-MVPDFLPKKDAKILTDE-------KATTLSTASVDDAAVINDLIIK 944
+A+ + + P+ + +K+ K+L + +L+ D +++I
Sbjct: 351 AVGNHVAKLLQSIGQAPESISEKELKLLCSNSAFLRVVRCRSLAEEYGLDTINKDEIISS 410
Query: 945 LEQCRKNLPSGFRL--------------KPIQFEKDDDTNYHMDMIAGLANMRARNYSIP 990
++ + L ++ ++D + G + +
Sbjct: 411 MDNPDNEIVLYLMLRAVDRFHKQQGRYPGVSNYQVEEDIGKLKSCLTGFLQEYGLSVMVK 470
Query: 991 EVDKLKAKFIAGRIIPAIATSTAMATGLVCLELYKVL 1027
+ + IA A G E+ K++
Sbjct: 471 DDYVHEFCRYGAAEPHTIA---AFLGGAAAQEVIKII 504
|
| >d1yova1 c.111.1.2 (A:6-534) Amyloid beta precursor protein-binding protein 1, APPBP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 529 | Back information, alignment and structure |
|---|
| >d1yova1 c.111.1.2 (A:6-534) Amyloid beta precursor protein-binding protein 1, APPBP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 529 | Back information, alignment and structure |
|---|
| >d1yovb1 c.111.1.2 (B:12-437) UBA3 {Human (Homo sapiens) [TaxId: 9606]} Length = 426 | Back information, alignment and structure |
|---|
| >d1yovb1 c.111.1.2 (B:12-437) UBA3 {Human (Homo sapiens) [TaxId: 9606]} Length = 426 | Back information, alignment and structure |
|---|
| >d1yovb1 c.111.1.2 (B:12-437) UBA3 {Human (Homo sapiens) [TaxId: 9606]} Length = 426 | Back information, alignment and structure |
|---|
| >d1jw9b_ c.111.1.1 (B:) Molybdenum cofactor biosynthesis protein MoeB {Escherichia coli [TaxId: 562]} Length = 247 | Back information, alignment and structure |
|---|
| >d1jw9b_ c.111.1.1 (B:) Molybdenum cofactor biosynthesis protein MoeB {Escherichia coli [TaxId: 562]} Length = 247 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch
Original result of HHsearch against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 1163 | |||
| d1yovb1 | 426 | UBA3 {Human (Homo sapiens) [TaxId: 9606]} | 100.0 | |
| d1yova1 | 529 | Amyloid beta precursor protein-binding protein 1, | 100.0 | |
| d1yova1 | 529 | Amyloid beta precursor protein-binding protein 1, | 100.0 | |
| d1yovb1 | 426 | UBA3 {Human (Homo sapiens) [TaxId: 9606]} | 100.0 | |
| d1jw9b_ | 247 | Molybdenum cofactor biosynthesis protein MoeB {Esc | 100.0 | |
| d1jw9b_ | 247 | Molybdenum cofactor biosynthesis protein MoeB {Esc | 99.96 | |
| d1pjqa1 | 113 | Siroheme synthase CysG, domain 1 {Salmonella typhi | 97.63 | |
| d1pjqa1 | 113 | Siroheme synthase CysG, domain 1 {Salmonella typhi | 97.14 | |
| d1y8xb1 | 92 | UBA3 {Human (Homo sapiens) [TaxId: 9606]} | 96.51 | |
| d1gpja2 | 159 | Glutamyl tRNA-reductase middle domain {Archaeon Me | 96.48 | |
| d1kyqa1 | 150 | Bifunctional dehydrogenase/ferrochelatase Met8p, N | 96.36 | |
| d1lssa_ | 132 | Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax | 96.11 | |
| d1kyqa1 | 150 | Bifunctional dehydrogenase/ferrochelatase Met8p, N | 96.1 | |
| d1vi2a1 | 182 | Putative shikimate dehydrogenase YdiB {Escherichia | 96.07 | |
| d1e5qa1 | 182 | Saccharopine reductase {Rice blast fungus (Magnapo | 95.98 | |
| d1gpja2 | 159 | Glutamyl tRNA-reductase middle domain {Archaeon Me | 95.95 | |
| d1vi2a1 | 182 | Putative shikimate dehydrogenase YdiB {Escherichia | 95.78 | |
| d1onfa2 | 117 | Glutathione reductase {Plasmodium falciparum [TaxI | 95.72 | |
| d2jfga1 | 93 | UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase | 95.71 | |
| d1e5qa1 | 182 | Saccharopine reductase {Rice blast fungus (Magnapo | 95.66 | |
| d1bg6a2 | 184 | N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {A | 95.56 | |
| d3cuma2 | 162 | Hydroxyisobutyrate dehydrogenase {Pseudomonas aeru | 95.52 | |
| d1lssa_ | 132 | Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax | 95.48 | |
| d1npya1 | 167 | Shikimate 5-dehydrogenase-like protein HI0607 {Hae | 95.39 | |
| d1qp8a1 | 181 | Putative formate dehydrogenase {Archaeon Pyrobacul | 95.33 | |
| d2ldxa1 | 159 | Lactate dehydrogenase {Mouse (Mus musculus) [TaxId | 95.29 | |
| d1gesa2 | 116 | Glutathione reductase {Escherichia coli [TaxId: 56 | 95.28 | |
| d2pgda2 | 176 | 6-phosphogluconate dehydrogenase {Sheep (Ovis orie | 95.27 | |
| d1nyta1 | 170 | Shikimate 5-dehydrogenase AroE {Escherichia coli [ | 95.26 | |
| d1nyta1 | 170 | Shikimate 5-dehydrogenase AroE {Escherichia coli [ | 95.19 | |
| d1ldna1 | 148 | Lactate dehydrogenase {Bacillus stearothermophilus | 95.18 | |
| d1pzga1 | 154 | Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5 | 95.11 | |
| d1xg5a_ | 257 | Putative dehydrogenase ARPG836 (MGC4172) {Human (H | 95.0 | |
| d1i0za1 | 160 | Lactate dehydrogenase {Human (Homo sapiens), heart | 94.97 | |
| d1hyha1 | 146 | L-2-hydroxyisocapronate dehydrogenase, L-HICDH {La | 94.85 | |
| d1ks9a2 | 167 | Ketopantoate reductase PanE {Escherichia coli [Tax | 94.74 | |
| d1bg6a2 | 184 | N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {A | 94.66 | |
| d1xg5a_ | 257 | Putative dehydrogenase ARPG836 (MGC4172) {Human (H | 94.52 | |
| d1pl8a2 | 171 | Ketose reductase (sorbitol dehydrogenase) {Human ( | 94.44 | |
| d1hyea1 | 145 | MJ0490, lactate/malate dehydrogenase {Archaeon Met | 94.43 | |
| d2f1ka2 | 165 | Prephenate dehydrogenase TyrA {Synechocystis sp. p | 94.43 | |
| d1v59a2 | 122 | Dihydrolipoamide dehydrogenase {Baker's yeast (Sac | 94.25 | |
| d1wdka3 | 186 | Fatty oxidation complex alpha subunit, middle doma | 94.19 | |
| d1npya1 | 167 | Shikimate 5-dehydrogenase-like protein HI0607 {Hae | 94.18 | |
| d1llda1 | 143 | Lactate dehydrogenase {Bifidobacterium longum, str | 94.15 | |
| d1d7ya2 | 121 | NADH-dependent ferredoxin reductase, BphA4 {Pseudo | 94.12 | |
| d2naca1 | 188 | Formate dehydrogenase {Pseudomonas sp., strain 101 | 94.12 | |
| d1h6va2 | 122 | Mammalian thioredoxin reductase {Rat (Rattus norve | 94.1 | |
| d2f1ka2 | 165 | Prephenate dehydrogenase TyrA {Synechocystis sp. p | 94.08 | |
| d1ps9a3 | 179 | 2,4-dienoyl-CoA reductase, middle domain {Escheric | 94.07 | |
| d1ebda2 | 117 | Dihydrolipoamide dehydrogenase {Bacillus stearothe | 94.05 | |
| d2g5ca2 | 171 | Prephenate dehydrogenase TyrA {Aquifex aeolicus [T | 94.04 | |
| d1jqba2 | 174 | Bacterial secondary alcohol dehydrogenase {Clostri | 94.02 | |
| d1t2da1 | 150 | Lactate dehydrogenase {Malaria parasite (Plasmodiu | 93.97 | |
| d2hmva1 | 134 | Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} | 93.96 | |
| d1iy8a_ | 258 | Levodione reductase {Corynebacterium aquaticum [Ta | 93.96 | |
| d1vm6a3 | 128 | Dihydrodipicolinate reductase {Thermotoga maritima | 93.92 | |
| d1mx3a1 | 193 | Transcription corepressor CtbP {Human (Homo sapien | 93.89 | |
| d1dxya1 | 199 | D-2-hydroxyisocaproate dehydrogenase {Lactobacillu | 93.87 | |
| d1vj0a2 | 182 | Hypothetical protein TM0436 {Thermotoga maritima [ | 93.85 | |
| d1j4aa1 | 197 | D-lactate dehydrogenase {Lactobacillus helveticus | 93.77 | |
| d1ez4a1 | 146 | Lactate dehydrogenase {Lactobacillus pentosus [Tax | 93.66 | |
| d1nhpa2 | 123 | NADH peroxidase {Enterococcus faecalis [TaxId: 135 | 93.59 | |
| d1xhca2 | 122 | NADH oxidase /nitrite reductase {Pyrococcus furios | 93.54 | |
| d1feca2 | 117 | Trypanothione reductase {Crithidia fasciculata [Ta | 93.53 | |
| d1lvla2 | 115 | Dihydrolipoamide dehydrogenase {Pseudomonas putida | 93.47 | |
| d1f0ya2 | 192 | Short chain L-3-hydroxyacyl CoA dehydrogenase {Hum | 93.47 | |
| d1luaa1 | 191 | Methylene-tetrahydromethanopterin dehydrogenase {M | 93.44 | |
| d1sc6a1 | 188 | Phosphoglycerate dehydrogenase {Escherichia coli [ | 93.4 | |
| d1nvta1 | 177 | Shikimate 5-dehydrogenase AroE {Archaeon Methanoco | 93.35 | |
| d3lada2 | 119 | Dihydrolipoamide dehydrogenase {Azotobacter vinela | 93.35 | |
| d3grsa2 | 125 | Glutathione reductase {Human (Homo sapiens) [TaxId | 93.33 | |
| d2hmva1 | 134 | Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} | 93.29 | |
| d1d1ta2 | 176 | Alcohol dehydrogenase {Human (Homo sapiens), diffe | 93.15 | |
| d1ojta2 | 125 | Dihydrolipoamide dehydrogenase {Neisseria meningit | 93.13 | |
| d1guza1 | 142 | Malate dehydrogenase {Chlorobium vibrioforme [TaxI | 93.11 | |
| d1vpda2 | 161 | Hydroxyisobutyrate dehydrogenase {Salmonella typhi | 93.11 | |
| d1mlda1 | 144 | Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 | 93.06 | |
| d1id1a_ | 153 | Rck domain from putative potassium channel Kch {Es | 93.05 | |
| d1a5za1 | 140 | Lactate dehydrogenase {Thermotoga maritima [TaxId: | 93.03 | |
| d1gdha1 | 191 | D-glycerate dehydrogenase {Hyphomicrobium methylov | 93.03 | |
| d1pgja2 | 178 | 6-phosphogluconate dehydrogenase {Trypanosoma bruc | 93.03 | |
| d2ldxa1 | 159 | Lactate dehydrogenase {Mouse (Mus musculus) [TaxId | 93.01 | |
| d1p77a1 | 171 | Shikimate 5-dehydrogenase AroE {Haemophilus influe | 92.97 | |
| d1p77a1 | 171 | Shikimate 5-dehydrogenase AroE {Haemophilus influe | 92.95 | |
| d1vpda2 | 161 | Hydroxyisobutyrate dehydrogenase {Salmonella typhi | 92.92 | |
| d3cuma2 | 162 | Hydroxyisobutyrate dehydrogenase {Pseudomonas aeru | 92.91 | |
| d1q1ra2 | 133 | Putidaredoxin reductase {Pseudomonas putida [TaxId | 92.88 | |
| d1f8fa2 | 174 | Benzyl alcohol dehydrogenase {Acinetobacter calcoa | 92.85 | |
| d1e3ja2 | 170 | Ketose reductase (sorbitol dehydrogenase) {Silverl | 92.8 | |
| d2jhfa2 | 176 | Alcohol dehydrogenase {Horse (Equus caballus) [Tax | 92.71 | |
| d2jfga1 | 93 | UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase | 92.64 | |
| d1ojua1 | 142 | Malate dehydrogenase {Archaeon Archaeoglobus fulgi | 92.63 | |
| d1hyha1 | 146 | L-2-hydroxyisocapronate dehydrogenase, L-HICDH {La | 92.59 | |
| d1zema1 | 260 | Xylitol dehydrogenase {Gluconobacter oxydans [TaxI | 92.59 | |
| d1nvta1 | 177 | Shikimate 5-dehydrogenase AroE {Archaeon Methanoco | 92.58 | |
| d1jqba2 | 174 | Bacterial secondary alcohol dehydrogenase {Clostri | 92.51 | |
| d1e3ia2 | 174 | Alcohol dehydrogenase {Mouse (Mus musculus), class | 92.5 | |
| d1aoga2 | 117 | Trypanothione reductase {Trypanosoma cruzi [TaxId: | 92.48 | |
| d1yqga2 | 152 | Pyrroline-5-carboxylate reductase ProC {Neisseria | 92.43 | |
| d1mo9a2 | 121 | NADH-dependent 2-ketopropyl coenzyme M oxidoreduct | 92.43 | |
| d1gtea4 | 196 | Dihydropyrimidine dehydrogenase, domain 2 {Pig (Su | 92.33 | |
| d1uxja1 | 142 | Malate dehydrogenase {Chloroflexus aurantiacus [Ta | 92.3 | |
| d1gtea4 | 196 | Dihydropyrimidine dehydrogenase, domain 2 {Pig (Su | 92.22 | |
| d1p3da1 | 96 | UDP-N-acetylmuramate-alanine ligase MurC {Haemophi | 92.15 | |
| d1guza1 | 142 | Malate dehydrogenase {Chlorobium vibrioforme [TaxI | 92.12 | |
| d1pzga1 | 154 | Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5 | 92.07 | |
| d1xhla_ | 274 | Hypothetical protein F25D1.5 {Caenorhabditis elega | 91.99 | |
| d1e3ja2 | 170 | Ketose reductase (sorbitol dehydrogenase) {Silverl | 91.97 | |
| d1a5za1 | 140 | Lactate dehydrogenase {Thermotoga maritima [TaxId: | 91.96 | |
| d1pl8a2 | 171 | Ketose reductase (sorbitol dehydrogenase) {Human ( | 91.95 | |
| d1ks9a2 | 167 | Ketopantoate reductase PanE {Escherichia coli [Tax | 91.95 | |
| d1hdoa_ | 205 | Biliverdin IX beta reductase {Human (Homo sapiens) | 91.83 | |
| d1i0za1 | 160 | Lactate dehydrogenase {Human (Homo sapiens), heart | 91.8 | |
| d1p0fa2 | 174 | Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: | 91.77 | |
| d2pgda2 | 176 | 6-phosphogluconate dehydrogenase {Sheep (Ovis orie | 91.75 | |
| d1yxma1 | 297 | Peroxisomal trans 2-enoyl CoA reductase {Human (Ho | 91.75 | |
| d1txga2 | 180 | Glycerol-3- phosphate dehydrogenase {Archaeoglobus | 91.61 | |
| d1i36a2 | 152 | Conserved hypothetical protein MTH1747 {Archaeon M | 91.6 | |
| d1dxla2 | 123 | Dihydrolipoamide dehydrogenase {Garden pea (Pisum | 91.35 | |
| d1spxa_ | 264 | Glucose dehydrogenase (5l265) {Nematode (Caenorhab | 91.21 | |
| d1xkqa_ | 272 | Hypothetical protein R05D8.7 {Caenorhabditis elega | 91.16 | |
| d1d7ya2 | 121 | NADH-dependent ferredoxin reductase, BphA4 {Pseudo | 90.97 | |
| d1o6za1 | 142 | Malate dehydrogenase {Archaeon Haloarcula marismor | 90.93 | |
| d1vj0a2 | 182 | Hypothetical protein TM0436 {Thermotoga maritima [ | 90.93 | |
| d2gdza1 | 254 | 15-hydroxyprostaglandin dehydrogenase, PGDH {Human | 90.92 | |
| d1llda1 | 143 | Lactate dehydrogenase {Bifidobacterium longum, str | 90.87 | |
| d1iy8a_ | 258 | Levodione reductase {Corynebacterium aquaticum [Ta | 90.85 | |
| d1fcda1 | 186 | Flavocytochrome c sulfide dehydrogenase, FCSD, fla | 90.8 | |
| d2b69a1 | 312 | UDP-glucuronate decarboxylase 1 {Human (Homo sapie | 90.8 | |
| d1hyea1 | 145 | MJ0490, lactate/malate dehydrogenase {Archaeon Met | 90.71 | |
| d2bgka1 | 268 | Rhizome secoisolariciresinol dehydrogenase {Mayapp | 90.63 | |
| d1y6ja1 | 142 | Lactate dehydrogenase {Clostridium thermocellum [T | 90.6 | |
| d1ojua1 | 142 | Malate dehydrogenase {Archaeon Archaeoglobus fulgi | 90.53 | |
| d1luaa1 | 191 | Methylene-tetrahydromethanopterin dehydrogenase {M | 90.53 | |
| d1ez4a1 | 146 | Lactate dehydrogenase {Lactobacillus pentosus [Tax | 90.44 | |
| d1ps9a3 | 179 | 2,4-dienoyl-CoA reductase, middle domain {Escheric | 90.37 | |
| d2ag5a1 | 245 | Dehydrogenase/reductase SDR family member 6, DHRS6 | 90.28 | |
| d1fmca_ | 255 | 7-alpha-hydroxysteroid dehydrogenase {Escherichia | 90.25 | |
| d1zk4a1 | 251 | R-specific alcohol dehydrogenase {Lactobacillus br | 89.92 | |
| d1vl8a_ | 251 | Gluconate 5-dehydrogenase {Thermotoga maritima [Ta | 89.8 | |
| d1ldna1 | 148 | Lactate dehydrogenase {Bacillus stearothermophilus | 89.79 | |
| d1sbya1 | 254 | Drosophila alcohol dehydrogenase {Fly (Drosophila | 89.73 | |
| d1ae1a_ | 258 | Tropinone reductase {Jimsonweed (Datura stramonium | 89.72 | |
| d1t2da1 | 150 | Lactate dehydrogenase {Malaria parasite (Plasmodiu | 89.59 | |
| d1hdoa_ | 205 | Biliverdin IX beta reductase {Human (Homo sapiens) | 89.54 | |
| d2cvza2 | 156 | Hydroxyisobutyrate dehydrogenase {Thermus thermoph | 89.49 | |
| d1ygya1 | 184 | Phosphoglycerate dehydrogenase {Mycobacterium tube | 89.49 | |
| d2vapa1 | 209 | Cell-division protein FtsZ {Archaeon Methanococcus | 89.43 | |
| d1pj5a2 | 305 | N,N-dimethylglycine oxidase {Arthrobacter globifor | 89.34 | |
| d1w6ua_ | 294 | 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {H | 89.33 | |
| d1o6za1 | 142 | Malate dehydrogenase {Archaeon Haloarcula marismor | 89.31 | |
| d2fzwa2 | 176 | Alcohol dehydrogenase {Human (Homo sapiens), diffe | 89.3 | |
| d1w5fa1 | 194 | Cell-division protein FtsZ {Thermotoga maritima [T | 89.29 | |
| d1uxja1 | 142 | Malate dehydrogenase {Chloroflexus aurantiacus [Ta | 89.25 | |
| d1k2wa_ | 256 | Sorbitol dehydrogenase {Rhodobacter sphaeroides [T | 89.22 | |
| d2pv7a2 | 152 | Prephenate dehydrogenase TyrA {Haemophilus influen | 89.22 | |
| d1j5pa4 | 132 | Hypothetical protein TM1643 {Thermotoga maritima [ | 89.16 | |
| d1c0pa1 | 268 | D-aminoacid oxidase, N-terminal domain {Rhodotorul | 89.08 | |
| d1yb1a_ | 244 | 17-beta-hydroxysteroid dehydrogenase type XI {Huma | 88.99 | |
| d1ofua1 | 198 | Cell-division protein FtsZ {Pseudomonas aeruginosa | 88.92 | |
| d1wdka3 | 186 | Fatty oxidation complex alpha subunit, middle doma | 88.73 | |
| d2bkaa1 | 232 | TAT-interacting protein TIP30 {Human (Homo sapiens | 88.72 | |
| d2cmda1 | 145 | Malate dehydrogenase {Escherichia coli [TaxId: 562 | 88.67 | |
| d1yl7a1 | 135 | Dihydrodipicolinate reductase {Mycobacterium tuber | 88.67 | |
| d1ebda2 | 117 | Dihydrolipoamide dehydrogenase {Bacillus stearothe | 88.56 | |
| d1f8fa2 | 174 | Benzyl alcohol dehydrogenase {Acinetobacter calcoa | 88.34 | |
| d2ew8a1 | 247 | (s)-1-phenylethanol dehydrogenase {Azoarcus sp. eb | 88.32 | |
| d1h2ba2 | 172 | Alcohol dehydrogenase {Archaeon Aeropyrum pernix [ | 88.27 | |
| d1j6ua1 | 89 | UDP-N-acetylmuramate-alanine ligase MurC {Thermoto | 88.18 | |
| d1zema1 | 260 | Xylitol dehydrogenase {Gluconobacter oxydans [TaxI | 88.18 | |
| d1e3ia2 | 174 | Alcohol dehydrogenase {Mouse (Mus musculus), class | 88.14 | |
| d2c07a1 | 251 | beta-keto acyl carrier protein reductase {Malaria | 88.11 | |
| d1mlda1 | 144 | Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 | 87.99 | |
| d1xhla_ | 274 | Hypothetical protein F25D1.5 {Caenorhabditis elega | 87.84 | |
| d1xhca2 | 122 | NADH oxidase /nitrite reductase {Pyrococcus furios | 87.83 | |
| d1id1a_ | 153 | Rck domain from putative potassium channel Kch {Es | 87.69 | |
| d1cdoa2 | 175 | Alcohol dehydrogenase {Cod (Gadus callarias) [TaxI | 87.65 | |
| d1i36a2 | 152 | Conserved hypothetical protein MTH1747 {Archaeon M | 87.62 | |
| d1b5qa1 | 347 | Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} | 87.6 | |
| d1nhpa2 | 123 | NADH peroxidase {Enterococcus faecalis [TaxId: 135 | 87.4 | |
| d2hjsa1 | 144 | Usg-1 protein homolog PA3116 {Pseudomonas aerugino | 87.35 | |
| d2jhfa2 | 176 | Alcohol dehydrogenase {Horse (Equus caballus) [Tax | 87.26 | |
| d1xhca1 | 167 | NADH oxidase /nitrite reductase {Pyrococcus furios | 87.13 | |
| d1geea_ | 261 | Glucose dehydrogenase {Bacillus megaterium [TaxId: | 87.07 | |
| d1seza1 | 373 | Protoporphyrinogen oxidase {Tobacco (Nicotiana tab | 87.01 | |
| d1pr9a_ | 244 | Carbonyl reductase {Human (Homo sapiens) [TaxId: 9 | 86.98 | |
| d1f0ya2 | 192 | Short chain L-3-hydroxyacyl CoA dehydrogenase {Hum | 86.98 | |
| d1pj5a2 | 305 | N,N-dimethylglycine oxidase {Arthrobacter globifor | 86.96 | |
| d2ae2a_ | 259 | Tropinone reductase {Jimsonweed (Datura stramonium | 86.95 | |
| d1xq1a_ | 259 | Tropinone reductase {Thale cress (Arabidopsis thal | 86.94 | |
| d1q1ra1 | 185 | Putidaredoxin reductase {Pseudomonas putida [TaxId | 86.75 | |
| d1u8xx1 | 167 | Maltose-6'-phosphate glucosidase GlvA {Bacillus su | 86.73 | |
| d1ydea1 | 250 | Retinal dehydrogenase/reductase 3 {Human (Homo sap | 86.53 | |
| d2pv7a2 | 152 | Prephenate dehydrogenase TyrA {Haemophilus influen | 86.43 | |
| d1onfa2 | 117 | Glutathione reductase {Plasmodium falciparum [TaxI | 86.42 | |
| d2rhca1 | 257 | beta-keto acyl carrier protein reductase {Streptom | 86.41 | |
| d1xkqa_ | 272 | Hypothetical protein R05D8.7 {Caenorhabditis elega | 86.41 | |
| d1k0ia1 | 292 | p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas a | 86.37 | |
| d1gesa2 | 116 | Glutathione reductase {Escherichia coli [TaxId: 56 | 86.36 | |
| d1bdba_ | 276 | Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Ps | 86.23 | |
| d2g5ca2 | 171 | Prephenate dehydrogenase TyrA {Aquifex aeolicus [T | 86.2 | |
| d1y6ja1 | 142 | Lactate dehydrogenase {Clostridium thermocellum [T | 86.08 | |
| d1djqa3 | 233 | Trimethylamine dehydrogenase, middle domain {Methy | 86.04 | |
| d1v59a2 | 122 | Dihydrolipoamide dehydrogenase {Baker's yeast (Sac | 86.03 | |
| d1g0oa_ | 272 | 1,3,8-trihydroxynaphtalene reductase (THNR, naphto | 85.99 | |
| d1spxa_ | 264 | Glucose dehydrogenase (5l265) {Nematode (Caenorhab | 85.89 | |
| d1up7a1 | 162 | 6-phospho-beta-glucosidase {Thermotoga maritima [T | 85.86 | |
| d1qp8a1 | 181 | Putative formate dehydrogenase {Archaeon Pyrobacul | 85.77 | |
| d1ryia1 | 276 | Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} | 85.67 | |
| d1d1ta2 | 176 | Alcohol dehydrogenase {Human (Homo sapiens), diffe | 85.67 | |
| d2voua1 | 265 | Dihydroxypyridine hydroxylase DhpH {Arthrobacter n | 85.62 | |
| d1txga2 | 180 | Glycerol-3- phosphate dehydrogenase {Archaeoglobus | 85.5 | |
| d1fcda1 | 186 | Flavocytochrome c sulfide dehydrogenase, FCSD, fla | 85.45 | |
| d1lvla2 | 115 | Dihydrolipoamide dehydrogenase {Pseudomonas putida | 85.45 | |
| d1gega_ | 255 | meso-2,3-butanediol dehydrogenase {Klebsiella pneu | 85.4 | |
| d1wmaa1 | 275 | Carbonyl reductase/20beta-hydroxysteroid dehydroge | 85.19 | |
| d1m6ia2 | 137 | Apoptosis-inducing factor (AIF) {Human (Homo sapie | 85.11 | |
| d1diha1 | 162 | Dihydrodipicolinate reductase {Escherichia coli [T | 85.07 | |
| d1c0pa1 | 268 | D-aminoacid oxidase, N-terminal domain {Rhodotorul | 85.04 | |
| d1j5pa4 | 132 | Hypothetical protein TM1643 {Thermotoga maritima [ | 84.98 | |
| d2vapa1 | 209 | Cell-division protein FtsZ {Archaeon Methanococcus | 84.98 | |
| d1p0fa2 | 174 | Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: | 84.89 | |
| d2fy8a1 | 129 | Potassium channel-related protein MthK {Archaeon M | 84.71 | |
| d1yxma1 | 297 | Peroxisomal trans 2-enoyl CoA reductase {Human (Ho | 84.68 | |
| d2b69a1 | 312 | UDP-glucuronate decarboxylase 1 {Human (Homo sapie | 84.58 | |
| d1c1da1 | 201 | Phenylalanine dehydrogenase {Rhodococcus sp., M4 [ | 84.56 | |
| d1nffa_ | 244 | Putative oxidoreductase Rv2002 {Mycobacterium tube | 84.49 | |
| d1seza1 | 373 | Protoporphyrinogen oxidase {Tobacco (Nicotiana tab | 84.44 | |
| d1obba1 | 171 | Alpha-glucosidase AglA {Thermotoga maritima [TaxId | 84.44 | |
| d1q1ra2 | 133 | Putidaredoxin reductase {Pseudomonas putida [TaxId | 84.43 | |
| d1vm6a3 | 128 | Dihydrodipicolinate reductase {Thermotoga maritima | 84.41 | |
| d1cyda_ | 242 | Carbonyl reductase {Mouse (Mus musculus) [TaxId: 1 | 84.33 | |
| d1n1ea2 | 189 | Glycerol-3- phosphate dehydrogenase {Trypanosome ( | 84.29 | |
| d1y7ta1 | 154 | Malate dehydrogenase {Thermus thermophilus [TaxId: | 84.28 | |
| d5mdha1 | 154 | Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 | 84.23 | |
| d3grsa2 | 125 | Glutathione reductase {Human (Homo sapiens) [TaxId | 84.22 | |
| d2a4ka1 | 241 | beta-keto acyl carrier protein reductase {Thermus | 84.18 | |
| d1pgja2 | 178 | 6-phosphogluconate dehydrogenase {Trypanosoma bruc | 84.18 | |
| d1db3a_ | 357 | GDP-mannose 4,6-dehydratase {Escherichia coli [Tax | 84.12 | |
| d1d7ya1 | 183 | NADH-dependent ferredoxin reductase, BphA4 {Pseudo | 84.12 | |
| d1b5qa1 | 347 | Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} | 84.1 | |
| d1jaya_ | 212 | Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archae | 84.08 | |
| d1u8xx1 | 167 | Maltose-6'-phosphate glucosidase GlvA {Bacillus su | 83.96 | |
| d1obba1 | 171 | Alpha-glucosidase AglA {Thermotoga maritima [TaxId | 83.95 | |
| d1w5fa1 | 194 | Cell-division protein FtsZ {Thermotoga maritima [T | 83.8 | |
| d1up7a1 | 162 | 6-phospho-beta-glucosidase {Thermotoga maritima [T | 83.77 | |
| d1fmca_ | 255 | 7-alpha-hydroxysteroid dehydrogenase {Escherichia | 83.6 | |
| d1h6va2 | 122 | Mammalian thioredoxin reductase {Rat (Rattus norve | 83.57 | |
| d2voua1 | 265 | Dihydroxypyridine hydroxylase DhpH {Arthrobacter n | 83.49 | |
| d1djqa3 | 233 | Trimethylamine dehydrogenase, middle domain {Methy | 83.44 | |
| d1sbya1 | 254 | Drosophila alcohol dehydrogenase {Fly (Drosophila | 83.14 | |
| d1ydwa1 | 184 | Probable oxidoreductase At4g09670 {Thale cress (Ar | 82.99 | |
| d1h5qa_ | 260 | Mannitol dehydrogenase {Mushroom (Agaricus bisporu | 82.96 | |
| d2bgka1 | 268 | Rhizome secoisolariciresinol dehydrogenase {Mayapp | 82.85 | |
| d2bi7a1 | 314 | UDP-galactopyranose mutase, N-terminal domain {Kle | 82.84 | |
| d1y1pa1 | 342 | Aldehyde reductase II {Sporobolomyces salmonicolor | 82.77 | |
| d1uufa2 | 168 | Hypothetical protein YahK {Escherichia coli [TaxId | 82.69 | |
| d1zk4a1 | 251 | R-specific alcohol dehydrogenase {Lactobacillus br | 82.66 | |
| d1w6ua_ | 294 | 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {H | 82.5 | |
| d7mdha1 | 175 | Malate dehydrogenase {Sorghum (Sorghum vulgare), c | 82.5 | |
| d1v8ba1 | 163 | S-adenosylhomocystein hydrolase {Plasmodium falcip | 82.45 | |
| d1qyda_ | 312 | Pinoresinol-lariciresinol reductase {Giant arborvi | 82.41 | |
| d2h7ma1 | 268 | Enoyl-ACP reductase {Mycobacterium tuberculosis, T | 82.41 | |
| d1uufa2 | 168 | Hypothetical protein YahK {Escherichia coli [TaxId | 82.24 | |
| d1yb1a_ | 244 | 17-beta-hydroxysteroid dehydrogenase type XI {Huma | 82.16 | |
| d1k0ia1 | 292 | p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas a | 82.12 | |
| d2iida1 | 370 | L-aminoacid oxidase {Malayan pit viper (Calloselas | 82.03 | |
| d1cjca2 | 230 | Adrenodoxin reductase of mitochondrial p450 system | 81.98 | |
| d2gdza1 | 254 | 15-hydroxyprostaglandin dehydrogenase, PGDH {Human | 81.82 | |
| d1cjca2 | 230 | Adrenodoxin reductase of mitochondrial p450 system | 81.61 | |
| d2pd4a1 | 274 | Enoyl-ACP reductase {Helicobacter pylori [TaxId: 2 | 81.58 | |
| d3lada2 | 119 | Dihydrolipoamide dehydrogenase {Azotobacter vinela | 81.31 | |
| d1kewa_ | 361 | dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus | 81.3 | |
| d1vl8a_ | 251 | Gluconate 5-dehydrogenase {Thermotoga maritima [Ta | 81.28 | |
| d1rq2a1 | 198 | Cell-division protein FtsZ {Mycobacterium tubercul | 81.26 | |
| d1t4ba1 | 146 | Aspartate beta-semialdehyde dehydrogenase {Escheri | 81.01 | |
| d1jvba2 | 170 | Alcohol dehydrogenase {Archaeon Sulfolobus solfata | 80.95 | |
| d1f06a1 | 170 | Diaminopimelic acid dehydrogenase (DAPDH) {Coryneb | 80.92 | |
| d1mo9a2 | 121 | NADH-dependent 2-ketopropyl coenzyme M oxidoreduct | 80.86 | |
| d1sc6a1 | 188 | Phosphoglycerate dehydrogenase {Escherichia coli [ | 80.86 | |
| d3c96a1 | 288 | Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: | 80.84 | |
| d3c96a1 | 288 | Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: | 80.81 | |
| d1pjca1 | 168 | L-alanine dehydrogenase {Phormidium lapideum [TaxI | 80.64 | |
| d1vl6a1 | 222 | Malate oxidoreductase (malic enzyme) {Thermotoga m | 80.6 | |
| d1xhca1 | 167 | NADH oxidase /nitrite reductase {Pyrococcus furios | 80.42 | |
| d1ojta2 | 125 | Dihydrolipoamide dehydrogenase {Neisseria meningit | 80.33 | |
| d2fzwa2 | 176 | Alcohol dehydrogenase {Human (Homo sapiens), diffe | 80.33 | |
| d2c07a1 | 251 | beta-keto acyl carrier protein reductase {Malaria | 80.25 | |
| d1gz6a_ | 302 | (3R)-hydroxyacyl-CoA dehydrogenase domain of estra | 80.17 | |
| d1xeaa1 | 167 | Putative oxidoreductase VCA1048 {Vibrio cholerae [ | 80.05 |
| >d1yovb1 c.111.1.2 (B:12-437) UBA3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Activating enzymes of the ubiquitin-like proteins superfamily: Activating enzymes of the ubiquitin-like proteins family: Ubiquitin activating enzymes (UBA) domain: UBA3 species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00 E-value=2.4e-63 Score=581.44 Aligned_cols=359 Identities=27% Similarity=0.446 Sum_probs=274.0
Q ss_pred CchhhhhhhcCH-HHHHHHhcCcEEEEecCcchHHHHHHHHHcccccCCCccEEEecCCcccccCcCcccCcccCcccch
Q 001074 556 SRYDAQISVFGA-KLQKKLEDAKVFIVGSGALGCEFLKNVALMGVSCGNQGKLTITDDDVIEKSNLSRQFLFRDWNIGQA 634 (1163)
Q Consensus 556 ~Rydrq~~l~G~-~~q~kL~~~kVlvVGaGglGce~lknLa~~Gv~~~~~g~i~ivD~D~Ie~SNLnRQfLf~~~dIG~~ 634 (1163)
.+|.++.-..|. ..|.+|+++||+||||||+|||++|+|+++|| |+|+|+|+|+|+.|||||||||+++|||++
T Consensus 17 ~~~~~~~~~~~~e~~~~~l~~~kVlvvG~GglG~ei~k~L~~~Gv-----g~i~lvD~D~Ve~sNL~RQflf~~~diG~~ 91 (426)
T d1yovb1 17 GPFTHPDFEPSTESLQFLLDTCKVLVIGAGGLGCELLKNLALSGF-----RQIHVIDMDTIDVSNLNRQFLFRPKDIGRP 91 (426)
T ss_dssp CTTCCTTCCCCSSHHHHHHHHCCEEEECSSTTHHHHHHHHHTTTC-----CCEEEECCCBCCGGGGGTCTTCCGGGTTSB
T ss_pred CCCcCcccccChHHHHHHHhcCeEEEECCCHHHHHHHHHHHHcCC-----CeEEEEECCCcchhhhcccccCChhHcCcH
Confidence 345555444554 45788999999999999999999999999999 999999999999999999999999999999
Q ss_pred HHHHHHHHHHhhCCCCeEEEEeccCCcccccccchhhhccCCEEEEccCchHHHHHHHhhcc------------cccccE
Q 001074 635 KSTVAASAATSINPRLNIEALQNRVGPETENVFDDTFWENITCVINALDNVNARLYVDQRCL------------YFQKPL 702 (1163)
Q Consensus 635 Ka~vaa~~l~~~np~~~I~~~~~~v~~~~e~~~~~~f~~~~DvVi~alDn~~aR~~v~~~c~------------~~~~Pl 702 (1163)
||++|+++++++||+++|+++..++.+ ++++|++++|+||+|+||+++|+++++.|+ ..++|+
T Consensus 92 Ka~~a~~~l~~~np~v~i~~~~~~i~~-----~~~~~~~~~DlVi~~~Dn~~aR~~in~~c~~l~k~~~~~~~~~~~iPl 166 (426)
T d1yovb1 92 KAEVAAEFLNDRVPNCNVVPHFNKIQD-----FNDTFYRQFHIIVCGLDSIIARRWINGMLISLLNYEDGVLDPSSIVPL 166 (426)
T ss_dssp HHHHHHHHHHHHSTTCCCEEECSCGGG-----BCHHHHTTCSEEEECCSCHHHHHHHHHHHHHTCCEETTEECGGGCCCE
T ss_pred HHHHHHHHHHhhCCCCceEeeeccccc-----hHHHHHHhcchheeccCcHHHHHHHHHHHHHhhcccccccccccCCce
Confidence 999999999999999999999988864 346789999999999999999999999997 456899
Q ss_pred EecCCCCcccceEEEeCCcccccCCCC--CCCCCCCCCccccCCCCChhhHHHHHHHHhhhhccCChhhhhhccCCchhh
Q 001074 703 LESGTLGAKCNTQMVIPHLTENYGASR--DPPEKQAPMCTVHSFPHNIDHCLTWARSEFEGLLEKTPAEVNAYLSNPVEY 780 (1163)
Q Consensus 703 I~sgt~G~~G~v~viip~~t~~y~~~~--dp~~~~~p~Ct~~~fP~~~~Hci~wAr~~F~~lF~~~~~~~n~~l~~~~~~ 780 (1163)
|++|+.|++|++++++|+.|+||.|.. .|+++.+|+||++++|+.++|||+|||.+.
T Consensus 167 I~gg~~G~~G~~~vi~p~~t~Cy~C~~~~~p~~~~~p~CTi~~~P~~~~hci~~ak~l~--------------------- 225 (426)
T d1yovb1 167 IDGGTEGFKGNARVILPGMTACIECTLELYPPQVNFPMCTIASMPRLPEHCIEYVRMLQ--------------------- 225 (426)
T ss_dssp EEEEEETTEEEEEEECTTTSCCGGGGGGGSCCCCCCCHHHHHHCCCSHHHHHHHHHHTH---------------------
T ss_pred EEeEEeeeEEEEEEECCCCCCCcCcCCCCCCCCCCCCcccccCCCCCchheeehhhhhc---------------------
Confidence 999999999999999999999999964 478889999999999999999999998631
Q ss_pred hhhhhhcCchhHHHHHHHHHHHhhhhcccchHHHHHHHHHHHHHHHHHHHHHHhhcCCccccccCCCCCccCCCCCCCcc
Q 001074 781 TTSMANAGDAQARDNLERVLECLDKEKCEIFQDCITWARLKFEDYFSNRVKQLIFTFPEDAATSTGAPFWSAPKRFPHPL 860 (1163)
Q Consensus 781 ~~~~~~~~~~~~~~~l~~~~~~l~~~~~~~~~dci~~a~~~f~~~F~~~I~~Ll~~~p~d~~t~~g~~fWs~~kr~P~pl 860 (1163)
|.+ .+..
T Consensus 226 ------------------------------------~~~---------------------------------~~~~---- 232 (426)
T d1yovb1 226 ------------------------------------WPK---------------------------------EQPF---- 232 (426)
T ss_dssp ------------------------------------HHH---------------------------------SCTT----
T ss_pred ------------------------------------ccc---------------------------------cccc----
Confidence 100 0000
Q ss_pred ccCCCCCcchhHHHHHHHHHHHHcCCCCCCCCCChHHHHHHhhhcCCCCcCCCCCcceecccccccccccCcCcHHHHHH
Q 001074 861 QFSSADPSHLHFVMAASILRAETFGIPIPDWTNNPKMLAEAVDKVMVPDFLPKKDAKILTDEKATTLSTASVDDAAVIND 940 (1163)
Q Consensus 861 ~fd~~~~~h~~fi~~~a~l~a~~~~i~~~~~~~~~~~~~~~~~~~~~~~f~~~~~~~i~~~e~~~~~~~~~~~~~~~~~~ 940 (1163)
T Consensus 233 -------------------------------------------------------------------------------- 232 (426)
T d1yovb1 233 -------------------------------------------------------------------------------- 232 (426)
T ss_dssp --------------------------------------------------------------------------------
T ss_pred --------------------------------------------------------------------------------
Confidence
Q ss_pred HHHHHHHhhhcCCCCCCcCCceeeccCCCCchhHHHHHHhhhhhhccCCCCccHHHHHHHhCcccchhhhhHHHHHHHHH
Q 001074 941 LIIKLEQCRKNLPSGFRLKPIQFEKDDDTNYHMDMIAGLANMRARNYSIPEVDKLKAKFIAGRIIPAIATSTAMATGLVC 1020 (1163)
Q Consensus 941 l~~~l~~~~~~~~~~~~~~p~~FeKDDd~n~hidFi~aasNlRa~ny~I~~~~~~~~k~iAG~IIPAIaTTtA~vaGl~~ 1020 (1163)
.....|++||+ .||+||+++||+||.+|+|+..+++.+|.+|||||||||||||||||+++
T Consensus 233 -----------------~~~~~~d~dd~--~~i~~i~~~a~~ra~~~~I~~~~~~~~k~ia~nIIPaiatTnAIVagl~~ 293 (426)
T d1yovb1 233 -----------------GEGVPLDGDDP--EHIQWIFQKSLERASQYNIRGVTYRLTQGVVKRIIPAVASTNAVIAAVCA 293 (426)
T ss_dssp -----------------STTCCCCTTCH--HHHHHHHHHHHHHHHHTTCCCCCHHHHHHHHTTCCCCCHHHHHHHHHHHH
T ss_pred -----------------cccCCCCCCCH--HHHHHHHHHHHHHHHhcCCCCccHHHHHHHhhccccccccHHHHHHHHHH
Confidence 00123556554 49999999999999999999999999999999999999999999999999
Q ss_pred HHHHHHhcCCCCccccccccc-ccccCcccccC---CCCCcccccCCcceeEEeEEEcCCCCcHHHHHHHHHHc-CCce-
Q 001074 1021 LELYKVLDGGHKLEDYRNTFA-NLALPLFSMAE---PVPPKVIKHRDMSWTVWDRWILKDNPTLRELIQWLKDK-GLNA- 1094 (1163)
Q Consensus 1021 lEl~K~l~~~~~~~~~rn~f~-nla~p~~~~~e---P~~~~~~~~~~~~~t~Wd~~~v~~~~TL~eli~~~~~k-~l~~- 1094 (1163)
+|++|++.+... ..+|.|+ +-..+.+..+. |.|.+..+ +. .|..+.+..++||+||+++++++ +++.
T Consensus 294 ~E~iK~lt~~~~--p~~n~~~~~~~~~~~~~~~~~~k~~~C~vC--~~---~~~~~~~~~~~tL~~li~~~~~~~~l~~~ 366 (426)
T d1yovb1 294 TEVFKIATSAYI--PLNNYLVFNDVDGLYTYTFEAERKENCPAC--SQ---LPQNIQFSPSAKLQEVLDYLTNSASLQMK 366 (426)
T ss_dssp HHHHHHHHCSSC--CCCSEEEEECSBSCEEEEECCCCCTTCTTT--CS---SCBCCC------CTTHHHHTTTCSSSCCS
T ss_pred HHHHHHHhcCCc--cccceEEEecCCCceEeeeeccCCCCCCee--CC---ceEEEEECCCCCHHHHHHHHHHhhCcCcc
Confidence 999999997532 2233332 32333333332 33332222 11 12234555689999999999987 6654
Q ss_pred -ee----eecCCceeecCCCc----chhhcccCcHHHHH
Q 001074 1095 -YS----ISCGSCLLFNSMFP----RHKERMDKKVVDLA 1124 (1163)
Q Consensus 1095 -~~----I~~g~~llY~~~~~----~~~~~l~~~l~~l~ 1124 (1163)
++ +..+.++||..+.| ..++||+|+|+||.
T Consensus 367 ~p~~~~~~~~~~~~Ly~~~~~~le~~~~~nl~k~L~eL~ 405 (426)
T d1yovb1 367 SPAITATLEGKNRTLYLQSVTSIEERTRPNLSKTLKELG 405 (426)
T ss_dssp SCCEECC-----CEECCCC----CGGGSTTC--------
T ss_pred CCcceeeecCCCcEEEecCCchhhHHhhhhhcCCHHHhC
Confidence 32 33467899987755 44789999999994
|
| >d1yova1 c.111.1.2 (A:6-534) Amyloid beta precursor protein-binding protein 1, APPBP1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1yova1 c.111.1.2 (A:6-534) Amyloid beta precursor protein-binding protein 1, APPBP1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1yovb1 c.111.1.2 (B:12-437) UBA3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jw9b_ c.111.1.1 (B:) Molybdenum cofactor biosynthesis protein MoeB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1jw9b_ c.111.1.1 (B:) Molybdenum cofactor biosynthesis protein MoeB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1pjqa1 c.2.1.11 (A:1-113) Siroheme synthase CysG, domain 1 {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1pjqa1 c.2.1.11 (A:1-113) Siroheme synthase CysG, domain 1 {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1y8xb1 c.111.1.2 (B:349-440) UBA3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gpja2 c.2.1.7 (A:144-302) Glutamyl tRNA-reductase middle domain {Archaeon Methanopyrus kandleri [TaxId: 2320]} | Back information, alignment and structure |
|---|
| >d1kyqa1 c.2.1.11 (A:1-150) Bifunctional dehydrogenase/ferrochelatase Met8p, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1kyqa1 c.2.1.11 (A:1-150) Bifunctional dehydrogenase/ferrochelatase Met8p, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1vi2a1 c.2.1.7 (A:107-288) Putative shikimate dehydrogenase YdiB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} | Back information, alignment and structure |
|---|
| >d1gpja2 c.2.1.7 (A:144-302) Glutamyl tRNA-reductase middle domain {Archaeon Methanopyrus kandleri [TaxId: 2320]} | Back information, alignment and structure |
|---|
| >d1vi2a1 c.2.1.7 (A:107-288) Putative shikimate dehydrogenase YdiB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} | Back information, alignment and structure |
|---|
| >d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]} | Back information, alignment and structure |
|---|
| >d3cuma2 c.2.1.6 (A:1-162) Hydroxyisobutyrate dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1npya1 c.2.1.7 (A:103-269) Shikimate 5-dehydrogenase-like protein HI0607 {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1qp8a1 c.2.1.4 (A:83-263) Putative formate dehydrogenase {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} | Back information, alignment and structure |
|---|
| >d2ldxa1 c.2.1.5 (A:1-159) Lactate dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2pgda2 c.2.1.6 (A:1-176) 6-phosphogluconate dehydrogenase {Sheep (Ovis orientalis aries) [TaxId: 9940]} | Back information, alignment and structure |
|---|
| >d1nyta1 c.2.1.7 (A:102-271) Shikimate 5-dehydrogenase AroE {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1nyta1 c.2.1.7 (A:102-271) Shikimate 5-dehydrogenase AroE {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ldna1 c.2.1.5 (A:15-162) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1pzga1 c.2.1.5 (A:14-163) Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5811]} | Back information, alignment and structure |
|---|
| >d1xg5a_ c.2.1.2 (A:) Putative dehydrogenase ARPG836 (MGC4172) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1i0za1 c.2.1.5 (A:1-160) Lactate dehydrogenase {Human (Homo sapiens), heart isoform (H chain) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hyha1 c.2.1.5 (A:21-166) L-2-hydroxyisocapronate dehydrogenase, L-HICDH {Lactobacillus confusus [TaxId: 1583]} | Back information, alignment and structure |
|---|
| >d1ks9a2 c.2.1.6 (A:1-167) Ketopantoate reductase PanE {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]} | Back information, alignment and structure |
|---|
| >d1xg5a_ c.2.1.2 (A:) Putative dehydrogenase ARPG836 (MGC4172) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hyea1 c.2.1.5 (A:1-145) MJ0490, lactate/malate dehydrogenase {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d2f1ka2 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {Synechocystis sp. pcc 6803 [TaxId: 1148]} | Back information, alignment and structure |
|---|
| >d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1wdka3 c.2.1.6 (A:311-496) Fatty oxidation complex alpha subunit, middle domain {Pseudomonas fragi [TaxId: 296]} | Back information, alignment and structure |
|---|
| >d1npya1 c.2.1.7 (A:103-269) Shikimate 5-dehydrogenase-like protein HI0607 {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1llda1 c.2.1.5 (A:7-149) Lactate dehydrogenase {Bifidobacterium longum, strain am101-2 [TaxId: 216816]} | Back information, alignment and structure |
|---|
| >d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} | Back information, alignment and structure |
|---|
| >d2naca1 c.2.1.4 (A:148-335) Formate dehydrogenase {Pseudomonas sp., strain 101 [TaxId: 306]} | Back information, alignment and structure |
|---|
| >d1h6va2 c.3.1.5 (A:171-292) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2f1ka2 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {Synechocystis sp. pcc 6803 [TaxId: 1148]} | Back information, alignment and structure |
|---|
| >d1ps9a3 c.4.1.1 (A:331-465,A:628-671) 2,4-dienoyl-CoA reductase, middle domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ebda2 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d2g5ca2 c.2.1.6 (A:30-200) Prephenate dehydrogenase TyrA {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1jqba2 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} | Back information, alignment and structure |
|---|
| >d1t2da1 c.2.1.5 (A:1-150) Lactate dehydrogenase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1iy8a_ c.2.1.2 (A:) Levodione reductase {Corynebacterium aquaticum [TaxId: 144185]} | Back information, alignment and structure |
|---|
| >d1vm6a3 c.2.1.3 (A:1-96,A:183-214) Dihydrodipicolinate reductase {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1mx3a1 c.2.1.4 (A:126-318) Transcription corepressor CtbP {Human (Homo sapiens), Ctbp1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dxya1 c.2.1.4 (A:101-299) D-2-hydroxyisocaproate dehydrogenase {Lactobacillus casei [TaxId: 1582]} | Back information, alignment and structure |
|---|
| >d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1j4aa1 c.2.1.4 (A:104-300) D-lactate dehydrogenase {Lactobacillus helveticus [TaxId: 1587]} | Back information, alignment and structure |
|---|
| >d1ez4a1 c.2.1.5 (A:16-162) Lactate dehydrogenase {Lactobacillus pentosus [TaxId: 1589]} | Back information, alignment and structure |
|---|
| >d1nhpa2 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d1xhca2 c.3.1.5 (A:104-225) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1feca2 c.3.1.5 (A:170-286) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} | Back information, alignment and structure |
|---|
| >d1lvla2 c.3.1.5 (A:151-265) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d1f0ya2 c.2.1.6 (A:12-203) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1luaa1 c.2.1.7 (A:98-288) Methylene-tetrahydromethanopterin dehydrogenase {Methylobacterium extorquens [TaxId: 408]} | Back information, alignment and structure |
|---|
| >d1sc6a1 c.2.1.4 (A:108-295) Phosphoglycerate dehydrogenase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1nvta1 c.2.1.7 (A:111-287) Shikimate 5-dehydrogenase AroE {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} | Back information, alignment and structure |
|---|
| >d3grsa2 c.3.1.5 (A:166-290) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1d1ta2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ojta2 c.3.1.5 (A:276-400) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} | Back information, alignment and structure |
|---|
| >d1guza1 c.2.1.5 (A:1-142) Malate dehydrogenase {Chlorobium vibrioforme [TaxId: 1098]} | Back information, alignment and structure |
|---|
| >d1vpda2 c.2.1.6 (A:3-163) Hydroxyisobutyrate dehydrogenase {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1mlda1 c.2.1.5 (A:1-144) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1id1a_ c.2.1.9 (A:) Rck domain from putative potassium channel Kch {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1a5za1 c.2.1.5 (A:22-163) Lactate dehydrogenase {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1gdha1 c.2.1.4 (A:101-291) D-glycerate dehydrogenase {Hyphomicrobium methylovorum [TaxId: 84]} | Back information, alignment and structure |
|---|
| >d1pgja2 c.2.1.6 (A:1-178) 6-phosphogluconate dehydrogenase {Trypanosoma brucei [TaxId: 5691]} | Back information, alignment and structure |
|---|
| >d2ldxa1 c.2.1.5 (A:1-159) Lactate dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1p77a1 c.2.1.7 (A:102-272) Shikimate 5-dehydrogenase AroE {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1p77a1 c.2.1.7 (A:102-272) Shikimate 5-dehydrogenase AroE {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1vpda2 c.2.1.6 (A:3-163) Hydroxyisobutyrate dehydrogenase {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d3cuma2 c.2.1.6 (A:1-162) Hydroxyisobutyrate dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1q1ra2 c.3.1.5 (A:115-247) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d1f8fa2 c.2.1.1 (A:163-336) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} | Back information, alignment and structure |
|---|
| >d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} | Back information, alignment and structure |
|---|
| >d2jhfa2 c.2.1.1 (A:164-339) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]} | Back information, alignment and structure |
|---|
| >d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ojua1 c.2.1.5 (A:22-163) Malate dehydrogenase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1hyha1 c.2.1.5 (A:21-166) L-2-hydroxyisocapronate dehydrogenase, L-HICDH {Lactobacillus confusus [TaxId: 1583]} | Back information, alignment and structure |
|---|
| >d1zema1 c.2.1.2 (A:3-262) Xylitol dehydrogenase {Gluconobacter oxydans [TaxId: 442]} | Back information, alignment and structure |
|---|
| >d1nvta1 c.2.1.7 (A:111-287) Shikimate 5-dehydrogenase AroE {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1jqba2 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} | Back information, alignment and structure |
|---|
| >d1e3ia2 c.2.1.1 (A:168-341) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1aoga2 c.3.1.5 (A:170-286) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} | Back information, alignment and structure |
|---|
| >d1yqga2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Neisseria meningitidis, serogroup B [TaxId: 487]} | Back information, alignment and structure |
|---|
| >d1mo9a2 c.3.1.5 (A:193-313) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} | Back information, alignment and structure |
|---|
| >d1gtea4 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine dehydrogenase, domain 2 {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1uxja1 c.2.1.5 (A:2-143) Malate dehydrogenase {Chloroflexus aurantiacus [TaxId: 1108]} | Back information, alignment and structure |
|---|
| >d1gtea4 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine dehydrogenase, domain 2 {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1p3da1 c.5.1.1 (A:11-106) UDP-N-acetylmuramate-alanine ligase MurC {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1guza1 c.2.1.5 (A:1-142) Malate dehydrogenase {Chlorobium vibrioforme [TaxId: 1098]} | Back information, alignment and structure |
|---|
| >d1pzga1 c.2.1.5 (A:14-163) Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5811]} | Back information, alignment and structure |
|---|
| >d1xhla_ c.2.1.2 (A:) Hypothetical protein F25D1.5 {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} | Back information, alignment and structure |
|---|
| >d1a5za1 c.2.1.5 (A:22-163) Lactate dehydrogenase {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ks9a2 c.2.1.6 (A:1-167) Ketopantoate reductase PanE {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1hdoa_ c.2.1.2 (A:) Biliverdin IX beta reductase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1i0za1 c.2.1.5 (A:1-160) Lactate dehydrogenase {Human (Homo sapiens), heart isoform (H chain) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1p0fa2 c.2.1.1 (A:1164-1337) Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 8403]} | Back information, alignment and structure |
|---|
| >d2pgda2 c.2.1.6 (A:1-176) 6-phosphogluconate dehydrogenase {Sheep (Ovis orientalis aries) [TaxId: 9940]} | Back information, alignment and structure |
|---|
| >d1yxma1 c.2.1.2 (A:7-303) Peroxisomal trans 2-enoyl CoA reductase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1txga2 c.2.1.6 (A:1-180) Glycerol-3- phosphate dehydrogenase {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1i36a2 c.2.1.6 (A:1-152) Conserved hypothetical protein MTH1747 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d1dxla2 c.3.1.5 (A:153-275) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} | Back information, alignment and structure |
|---|
| >d1spxa_ c.2.1.2 (A:) Glucose dehydrogenase (5l265) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1xkqa_ c.2.1.2 (A:) Hypothetical protein R05D8.7 {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} | Back information, alignment and structure |
|---|
| >d1o6za1 c.2.1.5 (A:22-162) Malate dehydrogenase {Archaeon Haloarcula marismortui [TaxId: 2238]} | Back information, alignment and structure |
|---|
| >d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2gdza1 c.2.1.2 (A:3-256) 15-hydroxyprostaglandin dehydrogenase, PGDH {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1llda1 c.2.1.5 (A:7-149) Lactate dehydrogenase {Bifidobacterium longum, strain am101-2 [TaxId: 216816]} | Back information, alignment and structure |
|---|
| >d1iy8a_ c.2.1.2 (A:) Levodione reductase {Corynebacterium aquaticum [TaxId: 144185]} | Back information, alignment and structure |
|---|
| >d1fcda1 c.3.1.5 (A:1-114,A:256-327) Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit {Purple phototrophic bacterium (Chromatium vinosum) [TaxId: 1049]} | Back information, alignment and structure |
|---|
| >d2b69a1 c.2.1.2 (A:4-315) UDP-glucuronate decarboxylase 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hyea1 c.2.1.5 (A:1-145) MJ0490, lactate/malate dehydrogenase {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d2bgka1 c.2.1.2 (A:11-278) Rhizome secoisolariciresinol dehydrogenase {Mayapple (Podophyllum peltatum) [TaxId: 35933]} | Back information, alignment and structure |
|---|
| >d1y6ja1 c.2.1.5 (A:7-148) Lactate dehydrogenase {Clostridium thermocellum [TaxId: 1515]} | Back information, alignment and structure |
|---|
| >d1ojua1 c.2.1.5 (A:22-163) Malate dehydrogenase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1luaa1 c.2.1.7 (A:98-288) Methylene-tetrahydromethanopterin dehydrogenase {Methylobacterium extorquens [TaxId: 408]} | Back information, alignment and structure |
|---|
| >d1ez4a1 c.2.1.5 (A:16-162) Lactate dehydrogenase {Lactobacillus pentosus [TaxId: 1589]} | Back information, alignment and structure |
|---|
| >d1ps9a3 c.4.1.1 (A:331-465,A:628-671) 2,4-dienoyl-CoA reductase, middle domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2ag5a1 c.2.1.2 (A:1-245) Dehydrogenase/reductase SDR family member 6, DHRS6 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fmca_ c.2.1.2 (A:) 7-alpha-hydroxysteroid dehydrogenase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1zk4a1 c.2.1.2 (A:1-251) R-specific alcohol dehydrogenase {Lactobacillus brevis [TaxId: 1580]} | Back information, alignment and structure |
|---|
| >d1vl8a_ c.2.1.2 (A:) Gluconate 5-dehydrogenase {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1ldna1 c.2.1.5 (A:15-162) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1sbya1 c.2.1.2 (A:1-254) Drosophila alcohol dehydrogenase {Fly (Drosophila lebanonensis) [TaxId: 7225]} | Back information, alignment and structure |
|---|
| >d1ae1a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), I [TaxId: 4076]} | Back information, alignment and structure |
|---|
| >d1t2da1 c.2.1.5 (A:1-150) Lactate dehydrogenase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1hdoa_ c.2.1.2 (A:) Biliverdin IX beta reductase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cvza2 c.2.1.6 (A:2-157) Hydroxyisobutyrate dehydrogenase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1ygya1 c.2.1.4 (A:99-282) Phosphoglycerate dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2vapa1 c.32.1.1 (A:23-231) Cell-division protein FtsZ {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1pj5a2 c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine oxidase {Arthrobacter globiformis [TaxId: 1665]} | Back information, alignment and structure |
|---|
| >d1w6ua_ c.2.1.2 (A:) 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {Human (Homo sapiens), [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1o6za1 c.2.1.5 (A:22-162) Malate dehydrogenase {Archaeon Haloarcula marismortui [TaxId: 2238]} | Back information, alignment and structure |
|---|
| >d2fzwa2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1w5fa1 c.32.1.1 (A:22-215) Cell-division protein FtsZ {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1uxja1 c.2.1.5 (A:2-143) Malate dehydrogenase {Chloroflexus aurantiacus [TaxId: 1108]} | Back information, alignment and structure |
|---|
| >d1k2wa_ c.2.1.2 (A:) Sorbitol dehydrogenase {Rhodobacter sphaeroides [TaxId: 1063]} | Back information, alignment and structure |
|---|
| >d2pv7a2 c.2.1.6 (A:92-243) Prephenate dehydrogenase TyrA {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1c0pa1 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxidase, N-terminal domain {Rhodotorula gracilis [TaxId: 5286]} | Back information, alignment and structure |
|---|
| >d1yb1a_ c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase type XI {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ofua1 c.32.1.1 (A:11-208) Cell-division protein FtsZ {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1wdka3 c.2.1.6 (A:311-496) Fatty oxidation complex alpha subunit, middle domain {Pseudomonas fragi [TaxId: 296]} | Back information, alignment and structure |
|---|
| >d2bkaa1 c.2.1.2 (A:5-236) TAT-interacting protein TIP30 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cmda1 c.2.1.5 (A:1-145) Malate dehydrogenase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1yl7a1 c.2.1.3 (A:2-105,A:215-245) Dihydrodipicolinate reductase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1ebda2 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1f8fa2 c.2.1.1 (A:163-336) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} | Back information, alignment and structure |
|---|
| >d2ew8a1 c.2.1.2 (A:3-249) (s)-1-phenylethanol dehydrogenase {Azoarcus sp. ebn1 [TaxId: 76114]} | Back information, alignment and structure |
|---|
| >d1h2ba2 c.2.1.1 (A:155-326) Alcohol dehydrogenase {Archaeon Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d1j6ua1 c.5.1.1 (A:0-88) UDP-N-acetylmuramate-alanine ligase MurC {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1zema1 c.2.1.2 (A:3-262) Xylitol dehydrogenase {Gluconobacter oxydans [TaxId: 442]} | Back information, alignment and structure |
|---|
| >d1e3ia2 c.2.1.1 (A:168-341) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2c07a1 c.2.1.2 (A:54-304) beta-keto acyl carrier protein reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1mlda1 c.2.1.5 (A:1-144) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1xhla_ c.2.1.2 (A:) Hypothetical protein F25D1.5 {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1xhca2 c.3.1.5 (A:104-225) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1id1a_ c.2.1.9 (A:) Rck domain from putative potassium channel Kch {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1cdoa2 c.2.1.1 (A:165-339) Alcohol dehydrogenase {Cod (Gadus callarias) [TaxId: 8053]} | Back information, alignment and structure |
|---|
| >d1i36a2 c.2.1.6 (A:1-152) Conserved hypothetical protein MTH1747 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} | Back information, alignment and structure |
|---|
| >d1nhpa2 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d2hjsa1 c.2.1.3 (A:3-129,A:320-336) Usg-1 protein homolog PA3116 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d2jhfa2 c.2.1.1 (A:164-339) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]} | Back information, alignment and structure |
|---|
| >d1xhca1 c.3.1.5 (A:1-103,A:226-289) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1geea_ c.2.1.2 (A:) Glucose dehydrogenase {Bacillus megaterium [TaxId: 1404]} | Back information, alignment and structure |
|---|
| >d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} | Back information, alignment and structure |
|---|
| >d1pr9a_ c.2.1.2 (A:) Carbonyl reductase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1f0ya2 c.2.1.6 (A:12-203) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pj5a2 c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine oxidase {Arthrobacter globiformis [TaxId: 1665]} | Back information, alignment and structure |
|---|
| >d2ae2a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), II [TaxId: 4076]} | Back information, alignment and structure |
|---|
| >d1xq1a_ c.2.1.2 (A:) Tropinone reductase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1q1ra1 c.3.1.5 (A:2-114,A:248-319) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d1u8xx1 c.2.1.5 (X:3-169) Maltose-6'-phosphate glucosidase GlvA {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1ydea1 c.2.1.2 (A:4-253) Retinal dehydrogenase/reductase 3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2pv7a2 c.2.1.6 (A:92-243) Prephenate dehydrogenase TyrA {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d2rhca1 c.2.1.2 (A:5-261) beta-keto acyl carrier protein reductase {Streptomyces coelicolor [TaxId: 1902]} | Back information, alignment and structure |
|---|
| >d1xkqa_ c.2.1.2 (A:) Hypothetical protein R05D8.7 {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1k0ia1 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1bdba_ c.2.1.2 (A:) Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Pseudomonas sp., lb400 [TaxId: 306]} | Back information, alignment and structure |
|---|
| >d2g5ca2 c.2.1.6 (A:30-200) Prephenate dehydrogenase TyrA {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1y6ja1 c.2.1.5 (A:7-148) Lactate dehydrogenase {Clostridium thermocellum [TaxId: 1515]} | Back information, alignment and structure |
|---|
| >d1djqa3 c.4.1.1 (A:341-489,A:646-729) Trimethylamine dehydrogenase, middle domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} | Back information, alignment and structure |
|---|
| >d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1g0oa_ c.2.1.2 (A:) 1,3,8-trihydroxynaphtalene reductase (THNR, naphtol reductase) {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} | Back information, alignment and structure |
|---|
| >d1spxa_ c.2.1.2 (A:) Glucose dehydrogenase (5l265) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1up7a1 c.2.1.5 (A:1-162) 6-phospho-beta-glucosidase {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1qp8a1 c.2.1.4 (A:83-263) Putative formate dehydrogenase {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} | Back information, alignment and structure |
|---|
| >d1ryia1 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} | Back information, alignment and structure |
|---|
| >d1d1ta2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} | Back information, alignment and structure |
|---|
| >d1txga2 c.2.1.6 (A:1-180) Glycerol-3- phosphate dehydrogenase {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1fcda1 c.3.1.5 (A:1-114,A:256-327) Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit {Purple phototrophic bacterium (Chromatium vinosum) [TaxId: 1049]} | Back information, alignment and structure |
|---|
| >d1lvla2 c.3.1.5 (A:151-265) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d1gega_ c.2.1.2 (A:) meso-2,3-butanediol dehydrogenase {Klebsiella pneumoniae [TaxId: 573]} | Back information, alignment and structure |
|---|
| >d1wmaa1 c.2.1.2 (A:2-276) Carbonyl reductase/20beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1m6ia2 c.3.1.5 (A:264-400) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1diha1 c.2.1.3 (A:2-130,A:241-273) Dihydrodipicolinate reductase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1c0pa1 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxidase, N-terminal domain {Rhodotorula gracilis [TaxId: 5286]} | Back information, alignment and structure |
|---|
| >d2vapa1 c.32.1.1 (A:23-231) Cell-division protein FtsZ {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1p0fa2 c.2.1.1 (A:1164-1337) Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 8403]} | Back information, alignment and structure |
|---|
| >d2fy8a1 c.2.1.9 (A:116-244) Potassium channel-related protein MthK {Archaeon Methanothermobacter thermautotrophicus [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d1yxma1 c.2.1.2 (A:7-303) Peroxisomal trans 2-enoyl CoA reductase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2b69a1 c.2.1.2 (A:4-315) UDP-glucuronate decarboxylase 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1c1da1 c.2.1.7 (A:149-349) Phenylalanine dehydrogenase {Rhodococcus sp., M4 [TaxId: 1831]} | Back information, alignment and structure |
|---|
| >d1nffa_ c.2.1.2 (A:) Putative oxidoreductase Rv2002 {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} | Back information, alignment and structure |
|---|
| >d1obba1 c.2.1.5 (A:2-172) Alpha-glucosidase AglA {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1q1ra2 c.3.1.5 (A:115-247) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d1vm6a3 c.2.1.3 (A:1-96,A:183-214) Dihydrodipicolinate reductase {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1cyda_ c.2.1.2 (A:) Carbonyl reductase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1n1ea2 c.2.1.6 (A:9-197) Glycerol-3- phosphate dehydrogenase {Trypanosome (Leishmania mexicana) [TaxId: 5665]} | Back information, alignment and structure |
|---|
| >d1y7ta1 c.2.1.5 (A:0-153) Malate dehydrogenase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d5mdha1 c.2.1.5 (A:1-154) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d3grsa2 c.3.1.5 (A:166-290) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2a4ka1 c.2.1.2 (A:2-242) beta-keto acyl carrier protein reductase {Thermus thermophilus, TTHB020 [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1pgja2 c.2.1.6 (A:1-178) 6-phosphogluconate dehydrogenase {Trypanosoma brucei [TaxId: 5691]} | Back information, alignment and structure |
|---|
| >d1db3a_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1d7ya1 c.3.1.5 (A:5-115,A:237-308) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} | Back information, alignment and structure |
|---|
| >d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} | Back information, alignment and structure |
|---|
| >d1jaya_ c.2.1.6 (A:) Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1u8xx1 c.2.1.5 (X:3-169) Maltose-6'-phosphate glucosidase GlvA {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1obba1 c.2.1.5 (A:2-172) Alpha-glucosidase AglA {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1w5fa1 c.32.1.1 (A:22-215) Cell-division protein FtsZ {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1up7a1 c.2.1.5 (A:1-162) 6-phospho-beta-glucosidase {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1fmca_ c.2.1.2 (A:) 7-alpha-hydroxysteroid dehydrogenase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1h6va2 c.3.1.5 (A:171-292) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} | Back information, alignment and structure |
|---|
| >d1djqa3 c.4.1.1 (A:341-489,A:646-729) Trimethylamine dehydrogenase, middle domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} | Back information, alignment and structure |
|---|
| >d1sbya1 c.2.1.2 (A:1-254) Drosophila alcohol dehydrogenase {Fly (Drosophila lebanonensis) [TaxId: 7225]} | Back information, alignment and structure |
|---|
| >d1ydwa1 c.2.1.3 (A:6-133,A:305-360) Probable oxidoreductase At4g09670 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1h5qa_ c.2.1.2 (A:) Mannitol dehydrogenase {Mushroom (Agaricus bisporus) [TaxId: 5341]} | Back information, alignment and structure |
|---|
| >d2bgka1 c.2.1.2 (A:11-278) Rhizome secoisolariciresinol dehydrogenase {Mayapple (Podophyllum peltatum) [TaxId: 35933]} | Back information, alignment and structure |
|---|
| >d2bi7a1 c.4.1.3 (A:2-247,A:317-384) UDP-galactopyranose mutase, N-terminal domain {Klebsiella pneumoniae [TaxId: 573]} | Back information, alignment and structure |
|---|
| >d1y1pa1 c.2.1.2 (A:2-343) Aldehyde reductase II {Sporobolomyces salmonicolor [TaxId: 5005]} | Back information, alignment and structure |
|---|
| >d1uufa2 c.2.1.1 (A:145-312) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1zk4a1 c.2.1.2 (A:1-251) R-specific alcohol dehydrogenase {Lactobacillus brevis [TaxId: 1580]} | Back information, alignment and structure |
|---|
| >d1w6ua_ c.2.1.2 (A:) 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {Human (Homo sapiens), [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d7mdha1 c.2.1.5 (A:23-197) Malate dehydrogenase {Sorghum (Sorghum vulgare), chloroplast [TaxId: 4558]} | Back information, alignment and structure |
|---|
| >d1v8ba1 c.2.1.4 (A:235-397) S-adenosylhomocystein hydrolase {Plasmodium falciparum, isolate 3D7 [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1qyda_ c.2.1.2 (A:) Pinoresinol-lariciresinol reductase {Giant arborvitae (Thuja plicata) [TaxId: 3316]} | Back information, alignment and structure |
|---|
| >d2h7ma1 c.2.1.2 (A:2-269) Enoyl-ACP reductase {Mycobacterium tuberculosis, TB, gene InhA [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1uufa2 c.2.1.1 (A:145-312) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1yb1a_ c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase type XI {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1k0ia1 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} | Back information, alignment and structure |
|---|
| >d1cjca2 c.4.1.1 (A:6-106,A:332-460) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d2gdza1 c.2.1.2 (A:3-256) 15-hydroxyprostaglandin dehydrogenase, PGDH {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1cjca2 c.4.1.1 (A:6-106,A:332-460) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d2pd4a1 c.2.1.2 (A:2-275) Enoyl-ACP reductase {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} | Back information, alignment and structure |
|---|
| >d1kewa_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]} | Back information, alignment and structure |
|---|
| >d1vl8a_ c.2.1.2 (A:) Gluconate 5-dehydrogenase {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1rq2a1 c.32.1.1 (A:8-205) Cell-division protein FtsZ {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1t4ba1 c.2.1.3 (A:1-133,A:355-367) Aspartate beta-semialdehyde dehydrogenase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1jvba2 c.2.1.1 (A:144-313) Alcohol dehydrogenase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1f06a1 c.2.1.3 (A:1-118,A:269-320) Diaminopimelic acid dehydrogenase (DAPDH) {Corynebacterium glutamicum [TaxId: 1718]} | Back information, alignment and structure |
|---|
| >d1mo9a2 c.3.1.5 (A:193-313) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} | Back information, alignment and structure |
|---|
| >d1sc6a1 c.2.1.4 (A:108-295) Phosphoglycerate dehydrogenase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d3c96a1 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d3c96a1 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1pjca1 c.2.1.4 (A:136-303) L-alanine dehydrogenase {Phormidium lapideum [TaxId: 32060]} | Back information, alignment and structure |
|---|
| >d1vl6a1 c.2.1.7 (A:155-376) Malate oxidoreductase (malic enzyme) {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1xhca1 c.3.1.5 (A:1-103,A:226-289) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1ojta2 c.3.1.5 (A:276-400) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} | Back information, alignment and structure |
|---|
| >d2fzwa2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2c07a1 c.2.1.2 (A:54-304) beta-keto acyl carrier protein reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1gz6a_ c.2.1.2 (A:) (3R)-hydroxyacyl-CoA dehydrogenase domain of estradiol 17 beta-Dehydrogenase 4 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1xeaa1 c.2.1.3 (A:2-122,A:267-312) Putative oxidoreductase VCA1048 {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|