Citrus Sinensis ID: 001080
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 1162 | ||||||
| 359476177 | 1187 | PREDICTED: uncharacterized protein LOC10 | 0.442 | 0.433 | 0.787 | 0.0 | |
| 296082128 | 1642 | unnamed protein product [Vitis vinifera] | 0.442 | 0.313 | 0.787 | 0.0 | |
| 449455693 | 1396 | PREDICTED: formin-like protein 18-like [ | 0.512 | 0.426 | 0.674 | 0.0 | |
| 449532675 | 683 | PREDICTED: formin-like protein 6-like [C | 0.512 | 0.871 | 0.672 | 0.0 | |
| 255548750 | 1266 | DNA binding protein, putative [Ricinus c | 0.517 | 0.474 | 0.651 | 0.0 | |
| 224143299 | 1092 | predicted protein [Populus trichocarpa] | 0.522 | 0.555 | 0.568 | 0.0 | |
| 359494891 | 1149 | PREDICTED: formin-like protein 13-like [ | 0.433 | 0.438 | 0.648 | 0.0 | |
| 356562131 | 1362 | PREDICTED: formin-like protein 18-like [ | 0.407 | 0.347 | 0.668 | 0.0 | |
| 357437113 | 1824 | Formin 2B [Medicago truncatula] gi|35547 | 0.356 | 0.226 | 0.712 | 0.0 | |
| 356554141 | 1659 | PREDICTED: LOW QUALITY PROTEIN: formin-l | 0.387 | 0.271 | 0.722 | 0.0 |
| >gi|359476177|ref|XP_002283272.2| PREDICTED: uncharacterized protein LOC100249142 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 842 bits (2176), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 415/527 (78%), Positives = 460/527 (87%), Gaps = 13/527 (2%)
Query: 1 MALFRKFFYRKPPDGLLEISERVFVFDCCFTTDILEEEEYKEYLGGIVGQLREYFPEASF 60
MALFRKFFYRKPPDGLLEISERV+VFDCCFTTD+LE+EEYK Y+G IVGQLRE+FP+ASF
Sbjct: 1 MALFRKFFYRKPPDGLLEISERVYVFDCCFTTDVLEDEEYKVYMGSIVGQLREHFPDASF 60
Query: 61 MVFNFREGEHQSQIGQVLSEYDMTVMDYPRHYEGCPLLTMETVHHFLRSSESWLSLGHQN 120
MVFNFREG+ QSQI +LSEYDMTVMDYPRHYEGCPLLTME +HHFLRSSESWLSLG QN
Sbjct: 61 MVFNFREGDSQSQISSILSEYDMTVMDYPRHYEGCPLLTMEMIHHFLRSSESWLSLGQQN 120
Query: 121 VLLMHCERGGWPVLAFMLAALLIYRKQFTGEQKTLDMIYKQAPRELLQLMSPLNPLPSQL 180
VLLMHCER GWP+LAFMLAALLIYRKQ+TGEQKTLDMIYKQAPRELLQLMSPLNPLPSQL
Sbjct: 121 VLLMHCERSGWPILAFMLAALLIYRKQYTGEQKTLDMIYKQAPRELLQLMSPLNPLPSQL 180
Query: 181 RYLQYVSRRNVGSEWPPLDRALTLDCVILRVIPNFDGEGGCCPIFRIYGQDPLMVADRTP 240
RYLQYVSRRNVGSEWPPLDRALTLDCVILR+IPN DGEGGC PIFRIYGQDP MVADRTP
Sbjct: 181 RYLQYVSRRNVGSEWPPLDRALTLDCVILRIIPNLDGEGGCRPIFRIYGQDPFMVADRTP 240
Query: 241 KVLFSTPKRSKLVRHYKQADCELVKIDIHCHIQGDVVLECISLDSDQEREEMMFRVMFNT 300
KVLFSTPKRSK VRHYKQ DCELVKIDIHCHIQGDVVLECISL+ D EREEMMFRVMFNT
Sbjct: 241 KVLFSTPKRSKTVRHYKQEDCELVKIDIHCHIQGDVVLECISLEEDMEREEMMFRVMFNT 300
Query: 301 AFIRSNILMLNRDEIDILWNSKDLFSKEFRAEVLFSEMDAATSLVSVDLPGIEEKDGLPI 360
AFIRSNILMLNRDEIDILWNSKD F K+FRAEVLFSEMD+ SL+++DL G+EEKDGLP+
Sbjct: 301 AFIRSNILMLNRDEIDILWNSKDQFPKDFRAEVLFSEMDSGNSLITIDLEGVEEKDGLPM 360
Query: 361 EAFAKVQEIFSNVDWLDPKLDVAVNMLQHFTPSNFIQENLET--ALNAEKGSIMIESALE 418
EAFAKVQEIFSNVDWLDPK DVA N+LQ T SN +QE LET A + E ++ E + E
Sbjct: 361 EAFAKVQEIFSNVDWLDPKTDVAFNVLQQITASNVLQE-LETDSAQSGETVGLLQELSPE 419
Query: 419 KDKEQLKLKAPD-NIGGLASISQGKPFMPSVKPALDANSFKKKNEPKELLVSLQQPAQPK 477
K +++ K KA + NI S++ GK M S KP++DAN ++K +P+EL V+LQ+PAQ K
Sbjct: 420 KVEDKPKPKAAENNISSTTSMALGKQHMTSAKPSVDANLIRRKIDPQELQVALQRPAQSK 479
Query: 478 IISPRLPQT-------SSSASQGS--PISRYHSAPSSLGITALLHDH 515
IIS R+PQT +S++ QGS PISRYHSAPS+LGITALLHDH
Sbjct: 480 IISQRIPQTPISNPVSNSNSLQGSPVPISRYHSAPSALGITALLHDH 526
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|296082128|emb|CBI21133.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|449455693|ref|XP_004145586.1| PREDICTED: formin-like protein 18-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|449532675|ref|XP_004173306.1| PREDICTED: formin-like protein 6-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|255548750|ref|XP_002515431.1| DNA binding protein, putative [Ricinus communis] gi|223545375|gb|EEF46880.1| DNA binding protein, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|224143299|ref|XP_002324908.1| predicted protein [Populus trichocarpa] gi|222866342|gb|EEF03473.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|359494891|ref|XP_002265146.2| PREDICTED: formin-like protein 13-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|356562131|ref|XP_003549327.1| PREDICTED: formin-like protein 18-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|357437113|ref|XP_003588832.1| Formin 2B [Medicago truncatula] gi|355477880|gb|AES59083.1| Formin 2B [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|356554141|ref|XP_003545407.1| PREDICTED: LOW QUALITY PROTEIN: formin-like protein 6-like [Glycine max] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 1162 | ||||||
| TAIR|locus:2034471 | 1230 | AFH14 "Formin Homology 14" [Ar | 0.423 | 0.4 | 0.470 | 6.7e-190 | |
| TAIR|locus:2160329 | 722 | AT5G07770 [Arabidopsis thalian | 0.153 | 0.246 | 0.539 | 5e-48 | |
| TAIR|locus:2177801 | 464 | FH19 "formin homolog 19" [Arab | 0.159 | 0.398 | 0.475 | 1.1e-40 | |
| TAIR|locus:504955862 | 232 | AT3G32410 "AT3G32410" [Arabido | 0.157 | 0.788 | 0.436 | 5.4e-29 | |
| TAIR|locus:2009869 | 299 | AT1G42980 "AT1G42980" [Arabido | 0.094 | 0.367 | 0.567 | 1.7e-27 | |
| DICTYBASE|DDB_G0285589 | 1087 | forH "formin H" [Dictyostelium | 0.157 | 0.168 | 0.345 | 6.1e-20 | |
| FB|FBgn0025641 | 1455 | DAAM "Dishevelled Associated A | 0.163 | 0.130 | 0.291 | 2e-15 | |
| UNIPROTKB|E2R292 | 1068 | DAAM1 "Uncharacterized protein | 0.169 | 0.184 | 0.263 | 4.4e-15 | |
| UNIPROTKB|A2VDK3 | 1068 | DAAM1 "Dishevelled associated | 0.169 | 0.184 | 0.263 | 7.2e-15 | |
| UNIPROTKB|F1NH09 | 1053 | F1NH09 "Uncharacterized protei | 0.175 | 0.193 | 0.241 | 2.6e-14 |
| TAIR|locus:2034471 AFH14 "Formin Homology 14" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 1192 (424.7 bits), Expect = 6.7e-190, Sum P(3) = 6.7e-190
Identities = 238/506 (47%), Positives = 334/506 (66%)
Query: 1 MALFRKFFYRKPPDGLLEISERVFVFDCCFTTDXXXXXXXXXXXXXXVGQLREYFPEASF 60
M+L +FFY++PPDGLLE ++RV+VFD CF T+ + L E FPE+SF
Sbjct: 1 MSLLSRFFYKRPPDGLLEFADRVYVFDSCFCTEVLADSLYQIFLHEVINDLHEEFPESSF 60
Query: 61 MVFNFREGEHQSQIGQVLSEYDMTVMDYPRHYEGCPLLTMETVHHFLRSSESWLSLGH-Q 119
+ FNFREGE +S + L EYD+TV++YPR YEGCP+L + + HFLR ESWL+ G+ Q
Sbjct: 61 LAFNFREGEKKSVFAETLCEYDVTVLEYPRQYEGCPMLPLSLIQHFLRVCESWLARGNRQ 120
Query: 120 NVLLMHCERGGWPVLAFMLAALLIYRKQFTGEQKTLDMIYKQAPRELLQLMSPLNPLPSQ 179
+V+L+HCERGGWP+LAF+LA+ LI+RK +GE++TL++++++AP+ LLQL+SPLNP PSQ
Sbjct: 121 DVILLHCERGGWPLLAFILASFLIFRKVHSGERRTLEIVHREAPKGLLQLLSPLNPFPSQ 180
Query: 180 LRYLQYVSRRNVGSEWPPLDRALTLDCVILRVIPNFDGEGGCCPIFRIYGQDPLMVADRT 239
LRYLQYV+RRN+ SEWPP +RAL+LDCVI+R IPNFD + GC PI RI+G++ + +
Sbjct: 181 LRYLQYVARRNINSEWPPPERALSLDCVIIRGIPNFDSQHGCRPIIRIFGRNYSSKSGLS 240
Query: 240 PKVLFSTPKRSKLVRHYKQADCELVKIDIHCHIQGDVVLECISLDSDQEREEMMFRVMFN 299
++++S + K +RHY+QA+C+++KIDI C +QGDVVLEC+ +D D ERE MMFRVMFN
Sbjct: 241 TEMVYSMSDKKKPLRHYRQAECDVIKIDIQCWVQGDVVLECVHMDLDPEREVMMFRVMFN 300
Query: 300 TAFIRSNILMLNRDEIDILWNSKDLFSKEFRAEVLFSEMD-AATSLVSVDLPGIEEKDGL 358
TAFIRSNILMLN D +DILW +KD + K FRAEVLF E++ A+ V + +E GL
Sbjct: 301 TAFIRSNILMLNSDNLDILWEAKDHYPKGFRAEVLFGEVENASPQKVPTPIVNGDETGGL 360
Query: 359 PIEAFAKVQEIFSNVDWLDPKLDVAVNMLQHFTPSNFIQENLETALNAEKGSIMIESALE 418
PIEAF++VQE+FS VD + D A+ +L+ N +E T KGS S
Sbjct: 361 PIEAFSRVQELFSGVDLAENGDDAALWLLKQLAAINDAKEF--TRFR-HKGSFYFNSPDS 417
Query: 419 KDKEQLKLKAPDNIGGLASISQGKPFMPSVKPALD----ANSFKKKNEPKELLVSLQQ-- 472
+++ A + G +I + + +P D + + + EP E
Sbjct: 418 EEETNTSSAADSSDEGFEAIQRPRIHIPFDNDDTDDITLSVAHESSEEPHEFSHHHHHEI 477
Query: 473 PAQPKIISP-RLPQTSSSASQGSPIS 497
PA+ + +P LP S S G ++
Sbjct: 478 PAKDSVDNPLNLP--SDPPSSGDHVT 501
|
|
| TAIR|locus:2160329 AT5G07770 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2177801 FH19 "formin homolog 19" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:504955862 AT3G32410 "AT3G32410" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2009869 AT1G42980 "AT1G42980" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| DICTYBASE|DDB_G0285589 forH "formin H" [Dictyostelium discoideum (taxid:44689)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0025641 DAAM "Dishevelled Associated Activator of Morphogenesis" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2R292 DAAM1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|A2VDK3 DAAM1 "Dishevelled associated activator of morphogenesis 1" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NH09 F1NH09 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 1162 | |||
| pfam02181 | 372 | pfam02181, FH2, Formin Homology 2 Domain | 2e-55 | |
| pfam10409 | 129 | pfam10409, PTEN_C2, C2 domain of PTEN tumour-suppr | 4e-40 | |
| smart00498 | 392 | smart00498, FH2, Formin Homology 2 Domain | 5e-27 | |
| PHA03247 | 3151 | PHA03247, PHA03247, large tegument protein UL36; P | 2e-25 | |
| PHA03247 | 3151 | PHA03247, PHA03247, large tegument protein UL36; P | 5e-24 | |
| PHA03247 | 3151 | PHA03247, PHA03247, large tegument protein UL36; P | 1e-21 | |
| PHA03307 | 1352 | PHA03307, PHA03307, transcriptional regulator ICP4 | 2e-16 | |
| PHA03247 | 3151 | PHA03247, PHA03247, large tegument protein UL36; P | 4e-16 | |
| PHA03247 | 3151 | PHA03247, PHA03247, large tegument protein UL36; P | 2e-14 | |
| PHA03307 | 1352 | PHA03307, PHA03307, transcriptional regulator ICP4 | 2e-14 | |
| PHA03307 | 1352 | PHA03307, PHA03307, transcriptional regulator ICP4 | 8e-14 | |
| pfam03154 | 979 | pfam03154, Atrophin-1, Atrophin-1 family | 2e-11 | |
| pfam04652 | 315 | pfam04652, DUF605, Vta1 like | 6e-10 | |
| pfam03154 | 979 | pfam03154, Atrophin-1, Atrophin-1 family | 2e-09 | |
| pfam03154 | 979 | pfam03154, Atrophin-1, Atrophin-1 family | 4e-09 | |
| pfam04652 | 315 | pfam04652, DUF605, Vta1 like | 5e-09 | |
| PRK12323 | 700 | PRK12323, PRK12323, DNA polymerase III subunits ga | 1e-08 | |
| pfam04652 | 315 | pfam04652, DUF605, Vta1 like | 2e-08 | |
| pfam05109 | 830 | pfam05109, Herpes_BLLF1, Herpes virus major outer | 5e-08 | |
| PRK07764 | 824 | PRK07764, PRK07764, DNA polymerase III subunits ga | 7e-08 | |
| pfam04652 | 315 | pfam04652, DUF605, Vta1 like | 1e-07 | |
| pfam04652 | 315 | pfam04652, DUF605, Vta1 like | 2e-07 | |
| PRK14948 | 620 | PRK14948, PRK14948, DNA polymerase III subunits ga | 2e-07 | |
| PHA03247 | 3151 | PHA03247, PHA03247, large tegument protein UL36; P | 3e-07 | |
| PRK12323 | 700 | PRK12323, PRK12323, DNA polymerase III subunits ga | 3e-07 | |
| PRK07764 | 824 | PRK07764, PRK07764, DNA polymerase III subunits ga | 3e-07 | |
| PRK14950 | 585 | PRK14950, PRK14950, DNA polymerase III subunits ga | 4e-07 | |
| pfam04652 | 315 | pfam04652, DUF605, Vta1 like | 5e-07 | |
| PRK12323 | 700 | PRK12323, PRK12323, DNA polymerase III subunits ga | 5e-07 | |
| pfam03154 | 979 | pfam03154, Atrophin-1, Atrophin-1 family | 1e-06 | |
| PRK07764 | 824 | PRK07764, PRK07764, DNA polymerase III subunits ga | 2e-06 | |
| PHA03247 | 3151 | PHA03247, PHA03247, large tegument protein UL36; P | 3e-06 | |
| PRK14971 | 614 | PRK14971, PRK14971, DNA polymerase III subunits ga | 3e-06 | |
| PRK14951 | 618 | PRK14951, PRK14951, DNA polymerase III subunits ga | 4e-06 | |
| pfam05109 | 830 | pfam05109, Herpes_BLLF1, Herpes virus major outer | 5e-06 | |
| PRK14948 | 620 | PRK14948, PRK14948, DNA polymerase III subunits ga | 7e-06 | |
| PHA03307 | 1352 | PHA03307, PHA03307, transcriptional regulator ICP4 | 1e-05 | |
| PRK14951 | 618 | PRK14951, PRK14951, DNA polymerase III subunits ga | 1e-05 | |
| PRK14951 | 618 | PRK14951, PRK14951, DNA polymerase III subunits ga | 1e-05 | |
| PRK07003 | 830 | PRK07003, PRK07003, DNA polymerase III subunits ga | 1e-05 | |
| PLN03209 | 576 | PLN03209, PLN03209, translocon at the inner envelo | 1e-05 | |
| PRK07764 | 824 | PRK07764, PRK07764, DNA polymerase III subunits ga | 2e-05 | |
| PRK14951 | 618 | PRK14951, PRK14951, DNA polymerase III subunits ga | 2e-05 | |
| PRK07994 | 647 | PRK07994, PRK07994, DNA polymerase III subunits ga | 2e-05 | |
| PRK07764 | 824 | PRK07764, PRK07764, DNA polymerase III subunits ga | 4e-05 | |
| PRK07764 | 824 | PRK07764, PRK07764, DNA polymerase III subunits ga | 4e-05 | |
| pfam11725 | 1771 | pfam11725, AvrE, Pathogenicity factor | 4e-05 | |
| PRK12323 | 700 | PRK12323, PRK12323, DNA polymerase III subunits ga | 5e-05 | |
| PHA03247 | 3151 | PHA03247, PHA03247, large tegument protein UL36; P | 6e-05 | |
| pfam05109 | 830 | pfam05109, Herpes_BLLF1, Herpes virus major outer | 6e-05 | |
| PHA03247 | 3151 | PHA03247, PHA03247, large tegument protein UL36; P | 7e-05 | |
| PRK14951 | 618 | PRK14951, PRK14951, DNA polymerase III subunits ga | 7e-05 | |
| pfam09770 | 804 | pfam09770, PAT1, Topoisomerase II-associated prote | 7e-05 | |
| PRK07764 | 824 | PRK07764, PRK07764, DNA polymerase III subunits ga | 8e-05 | |
| PRK14950 | 585 | PRK14950, PRK14950, DNA polymerase III subunits ga | 8e-05 | |
| COG5099 | 777 | COG5099, COG5099, RNA-binding protein of the Puf f | 8e-05 | |
| PHA03132 | 580 | PHA03132, PHA03132, thymidine kinase; Provisional | 9e-05 | |
| PHA03307 | 1352 | PHA03307, PHA03307, transcriptional regulator ICP4 | 1e-04 | |
| PRK07764 | 824 | PRK07764, PRK07764, DNA polymerase III subunits ga | 1e-04 | |
| PRK14948 | 620 | PRK14948, PRK14948, DNA polymerase III subunits ga | 1e-04 | |
| PRK14950 | 585 | PRK14950, PRK14950, DNA polymerase III subunits ga | 1e-04 | |
| pfam09770 | 804 | pfam09770, PAT1, Topoisomerase II-associated prote | 1e-04 | |
| PHA03247 | 3151 | PHA03247, PHA03247, large tegument protein UL36; P | 2e-04 | |
| PRK14950 | 585 | PRK14950, PRK14950, DNA polymerase III subunits ga | 2e-04 | |
| PRK07994 | 647 | PRK07994, PRK07994, DNA polymerase III subunits ga | 2e-04 | |
| PRK07994 | 647 | PRK07994, PRK07994, DNA polymerase III subunits ga | 2e-04 | |
| pfam07223 | 357 | pfam07223, DUF1421, Protein of unknown function (D | 2e-04 | |
| PHA03378 | 991 | PHA03378, PHA03378, EBNA-3B; Provisional | 2e-04 | |
| PHA03247 | 3151 | PHA03247, PHA03247, large tegument protein UL36; P | 3e-04 | |
| PRK14948 | 620 | PRK14948, PRK14948, DNA polymerase III subunits ga | 3e-04 | |
| PLN03209 | 576 | PLN03209, PLN03209, translocon at the inner envelo | 3e-04 | |
| PHA03132 | 580 | PHA03132, PHA03132, thymidine kinase; Provisional | 3e-04 | |
| PRK14948 | 620 | PRK14948, PRK14948, DNA polymerase III subunits ga | 4e-04 | |
| PRK07994 | 647 | PRK07994, PRK07994, DNA polymerase III subunits ga | 4e-04 | |
| pfam05539 | 408 | pfam05539, Pneumo_att_G, Pneumovirinae attachment | 4e-04 | |
| PRK14971 | 614 | PRK14971, PRK14971, DNA polymerase III subunits ga | 5e-04 | |
| PRK12270 | 1228 | PRK12270, kgd, alpha-ketoglutarate decarboxylase; | 5e-04 | |
| pfam12737 | 418 | pfam12737, Mating_C, C-terminal domain of homeodom | 5e-04 | |
| PRK07764 | 824 | PRK07764, PRK07764, DNA polymerase III subunits ga | 6e-04 | |
| PRK07003 | 830 | PRK07003, PRK07003, DNA polymerase III subunits ga | 6e-04 | |
| pfam07223 | 357 | pfam07223, DUF1421, Protein of unknown function (D | 6e-04 | |
| pfam03251 | 458 | pfam03251, Tymo_45kd_70kd, Tymovirus 45/70Kd prote | 6e-04 | |
| pfam07174 | 297 | pfam07174, FAP, Fibronectin-attachment protein (FA | 6e-04 | |
| pfam04502 | 321 | pfam04502, DUF572, Family of unknown function (DUF | 6e-04 | |
| PRK07003 | 830 | PRK07003, PRK07003, DNA polymerase III subunits ga | 7e-04 | |
| PRK07764 | 824 | PRK07764, PRK07764, DNA polymerase III subunits ga | 8e-04 | |
| PRK12270 | 1228 | PRK12270, kgd, alpha-ketoglutarate decarboxylase; | 8e-04 | |
| PRK14954 | 620 | PRK14954, PRK14954, DNA polymerase III subunits ga | 8e-04 | |
| PRK14948 | 620 | PRK14948, PRK14948, DNA polymerase III subunits ga | 9e-04 | |
| PLN02258 | 590 | PLN02258, PLN02258, 9-cis-epoxycarotenoid dioxygen | 0.001 | |
| pfam05518 | 753 | pfam05518, Totivirus_coat, Totivirus coat protein | 0.001 | |
| COG5178 | 2365 | COG5178, PRP8, U5 snRNP spliceosome subunit [RNA p | 0.001 | |
| pfam10428 | 419 | pfam10428, SOG2, RAM signalling pathway protein | 0.001 | |
| PRK14971 | 614 | PRK14971, PRK14971, DNA polymerase III subunits ga | 0.002 | |
| PLN03209 | 576 | PLN03209, PLN03209, translocon at the inner envelo | 0.002 | |
| pfam09770 | 804 | pfam09770, PAT1, Topoisomerase II-associated prote | 0.002 | |
| pfam12737 | 418 | pfam12737, Mating_C, C-terminal domain of homeodom | 0.002 | |
| pfam05518 | 753 | pfam05518, Totivirus_coat, Totivirus coat protein | 0.002 | |
| pfam05518 | 753 | pfam05518, Totivirus_coat, Totivirus coat protein | 0.002 | |
| PRK11633 | 226 | PRK11633, PRK11633, cell division protein DedD; Pr | 0.002 | |
| pfam03276 | 582 | pfam03276, Gag_spuma, Spumavirus gag protein | 0.002 | |
| COG5048 | 467 | COG5048, COG5048, FOG: Zn-finger [General function | 0.002 | |
| PRK13729 | 475 | PRK13729, PRK13729, conjugal transfer pilus assemb | 0.002 | |
| pfam09849 | 234 | pfam09849, DUF2076, Uncharacterized protein conser | 0.002 | |
| PHA03307 | 1352 | PHA03307, PHA03307, transcriptional regulator ICP4 | 0.003 | |
| PRK14951 | 618 | PRK14951, PRK14951, DNA polymerase III subunits ga | 0.003 | |
| PRK07003 | 830 | PRK07003, PRK07003, DNA polymerase III subunits ga | 0.003 | |
| PRK12270 | 1228 | PRK12270, kgd, alpha-ketoglutarate decarboxylase; | 0.003 | |
| pfam07174 | 297 | pfam07174, FAP, Fibronectin-attachment protein (FA | 0.003 | |
| PHA03379 | 935 | PHA03379, PHA03379, EBNA-3A; Provisional | 0.003 | |
| pfam08580 | 626 | pfam08580, KAR9, Yeast cortical protein KAR9 | 0.003 | |
| PRK14086 | 617 | PRK14086, dnaA, chromosomal replication initiation | 0.003 | |
| pfam13388 | 422 | pfam13388, DUF4106, Protein of unknown function (D | 0.003 | |
| PRK07764 | 824 | PRK07764, PRK07764, DNA polymerase III subunits ga | 0.004 | |
| pfam05539 | 408 | pfam05539, Pneumo_att_G, Pneumovirinae attachment | 0.004 | |
| PRK14954 | 620 | PRK14954, PRK14954, DNA polymerase III subunits ga | 0.004 | |
| pfam05518 | 753 | pfam05518, Totivirus_coat, Totivirus coat protein | 0.004 |
| >gnl|CDD|216919 pfam02181, FH2, Formin Homology 2 Domain | Back alignment and domain information |
|---|
Score = 197 bits (502), Expect = 2e-55
Identities = 76/192 (39%), Positives = 117/192 (60%), Gaps = 10/192 (5%)
Query: 970 KNNLKPYHWLKLTRA-MQGSLWAEAQKSDEASKAPEFDMSELESLFSAAAPN--SDLGGK 1026
K LKP HW K+ A +G++W E DE S + D+SELE LFSA A S K
Sbjct: 8 KKKLKPLHWDKVNPAQDRGTVWDEL---DEESFEKDLDLSELEELFSAKAKKKKSKKSEK 64
Query: 1027 SGKSNRRSGPKPERVQLIELRRANNCEIMLTKVKIPLPDLMGSVLALDDSALDIDQVDNL 1086
S + K + + +++ +R+ N I+L K+K+P +++ ++L +D+S L ++ ++NL
Sbjct: 65 KSSSKK----KKKEISVLDPKRSQNIAILLRKLKLPPEEIVQAILEMDESVLGLELLENL 120
Query: 1087 IKFCPTKEEMEVLKNYNGDKGNLGKCEQFFLELMKVPRVESKLRVFSFKIQFQTQVSDLR 1146
+K PTKEE++ LK Y GD LG+ EQF LEL K+PR+E +L FK F+ +V +L+
Sbjct: 121 LKMAPTKEELKKLKEYKGDPSKLGRAEQFLLELSKIPRLEERLEALLFKSTFEEEVEELK 180
Query: 1147 TSLNIINSASEE 1158
SL + +ASEE
Sbjct: 181 PSLETLEAASEE 192
|
Length = 372 |
| >gnl|CDD|220736 pfam10409, PTEN_C2, C2 domain of PTEN tumour-suppressor protein | Back alignment and domain information |
|---|
| >gnl|CDD|214697 smart00498, FH2, Formin Homology 2 Domain | Back alignment and domain information |
|---|
| >gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223039 PHA03307, PHA03307, transcriptional regulator ICP4; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223039 PHA03307, PHA03307, transcriptional regulator ICP4; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223039 PHA03307, PHA03307, transcriptional regulator ICP4; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|217393 pfam03154, Atrophin-1, Atrophin-1 family | Back alignment and domain information |
|---|
| >gnl|CDD|218191 pfam04652, DUF605, Vta1 like | Back alignment and domain information |
|---|
| >gnl|CDD|217393 pfam03154, Atrophin-1, Atrophin-1 family | Back alignment and domain information |
|---|
| >gnl|CDD|217393 pfam03154, Atrophin-1, Atrophin-1 family | Back alignment and domain information |
|---|
| >gnl|CDD|218191 pfam04652, DUF605, Vta1 like | Back alignment and domain information |
|---|
| >gnl|CDD|237057 PRK12323, PRK12323, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|218191 pfam04652, DUF605, Vta1 like | Back alignment and domain information |
|---|
| >gnl|CDD|218439 pfam05109, Herpes_BLLF1, Herpes virus major outer envelope glycoprotein (BLLF1) | Back alignment and domain information |
|---|
| >gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|218191 pfam04652, DUF605, Vta1 like | Back alignment and domain information |
|---|
| >gnl|CDD|218191 pfam04652, DUF605, Vta1 like | Back alignment and domain information |
|---|
| >gnl|CDD|237862 PRK14948, PRK14948, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237057 PRK12323, PRK12323, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|237864 PRK14950, PRK14950, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|218191 pfam04652, DUF605, Vta1 like | Back alignment and domain information |
|---|
| >gnl|CDD|237057 PRK12323, PRK12323, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|217393 pfam03154, Atrophin-1, Atrophin-1 family | Back alignment and domain information |
|---|
| >gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237874 PRK14971, PRK14971, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237865 PRK14951, PRK14951, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|218439 pfam05109, Herpes_BLLF1, Herpes virus major outer envelope glycoprotein (BLLF1) | Back alignment and domain information |
|---|
| >gnl|CDD|237862 PRK14948, PRK14948, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223039 PHA03307, PHA03307, transcriptional regulator ICP4; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237865 PRK14951, PRK14951, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237865 PRK14951, PRK14951, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235906 PRK07003, PRK07003, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|178748 PLN03209, PLN03209, translocon at the inner envelope of chloroplast subunit 62; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|237865 PRK14951, PRK14951, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236138 PRK07994, PRK07994, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|221188 pfam11725, AvrE, Pathogenicity factor | Back alignment and domain information |
|---|
| >gnl|CDD|237057 PRK12323, PRK12323, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|218439 pfam05109, Herpes_BLLF1, Herpes virus major outer envelope glycoprotein (BLLF1) | Back alignment and domain information |
|---|
| >gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237865 PRK14951, PRK14951, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|220392 pfam09770, PAT1, Topoisomerase II-associated protein PAT1 | Back alignment and domain information |
|---|
| >gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|237864 PRK14950, PRK14950, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|227430 COG5099, COG5099, RNA-binding protein of the Puf family, translational repressor [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >gnl|CDD|222997 PHA03132, PHA03132, thymidine kinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223039 PHA03307, PHA03307, transcriptional regulator ICP4; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|237862 PRK14948, PRK14948, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237864 PRK14950, PRK14950, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|220392 pfam09770, PAT1, Topoisomerase II-associated protein PAT1 | Back alignment and domain information |
|---|
| >gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237864 PRK14950, PRK14950, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236138 PRK07994, PRK07994, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|236138 PRK07994, PRK07994, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|219339 pfam07223, DUF1421, Protein of unknown function (DUF1421) | Back alignment and domain information |
|---|
| >gnl|CDD|223065 PHA03378, PHA03378, EBNA-3B; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237862 PRK14948, PRK14948, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|178748 PLN03209, PLN03209, translocon at the inner envelope of chloroplast subunit 62; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|222997 PHA03132, PHA03132, thymidine kinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237862 PRK14948, PRK14948, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236138 PRK07994, PRK07994, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|114270 pfam05539, Pneumo_att_G, Pneumovirinae attachment membrane glycoprotein G | Back alignment and domain information |
|---|
| >gnl|CDD|237874 PRK14971, PRK14971, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237030 PRK12270, kgd, alpha-ketoglutarate decarboxylase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|221745 pfam12737, Mating_C, C-terminal domain of homeodomain 1 | Back alignment and domain information |
|---|
| >gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|235906 PRK07003, PRK07003, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|219339 pfam07223, DUF1421, Protein of unknown function (DUF1421) | Back alignment and domain information |
|---|
| >gnl|CDD|217453 pfam03251, Tymo_45kd_70kd, Tymovirus 45/70Kd protein | Back alignment and domain information |
|---|
| >gnl|CDD|219321 pfam07174, FAP, Fibronectin-attachment protein (FAP) | Back alignment and domain information |
|---|
| >gnl|CDD|218115 pfam04502, DUF572, Family of unknown function (DUF572) | Back alignment and domain information |
|---|
| >gnl|CDD|235906 PRK07003, PRK07003, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|237030 PRK12270, kgd, alpha-ketoglutarate decarboxylase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|184918 PRK14954, PRK14954, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237862 PRK14948, PRK14948, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215145 PLN02258, PLN02258, 9-cis-epoxycarotenoid dioxygenase NCED | Back alignment and domain information |
|---|
| >gnl|CDD|218621 pfam05518, Totivirus_coat, Totivirus coat protein | Back alignment and domain information |
|---|
| >gnl|CDD|227505 COG5178, PRP8, U5 snRNP spliceosome subunit [RNA processing and modification] | Back alignment and domain information |
|---|
| >gnl|CDD|220749 pfam10428, SOG2, RAM signalling pathway protein | Back alignment and domain information |
|---|
| >gnl|CDD|237874 PRK14971, PRK14971, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|178748 PLN03209, PLN03209, translocon at the inner envelope of chloroplast subunit 62; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|220392 pfam09770, PAT1, Topoisomerase II-associated protein PAT1 | Back alignment and domain information |
|---|
| >gnl|CDD|221745 pfam12737, Mating_C, C-terminal domain of homeodomain 1 | Back alignment and domain information |
|---|
| >gnl|CDD|218621 pfam05518, Totivirus_coat, Totivirus coat protein | Back alignment and domain information |
|---|
| >gnl|CDD|218621 pfam05518, Totivirus_coat, Totivirus coat protein | Back alignment and domain information |
|---|
| >gnl|CDD|236940 PRK11633, PRK11633, cell division protein DedD; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|217469 pfam03276, Gag_spuma, Spumavirus gag protein | Back alignment and domain information |
|---|
| >gnl|CDD|227381 COG5048, COG5048, FOG: Zn-finger [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|184281 PRK13729, PRK13729, conjugal transfer pilus assembly protein TraB; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|220441 pfam09849, DUF2076, Uncharacterized protein conserved in bacteria (DUF2076) | Back alignment and domain information |
|---|
| >gnl|CDD|223039 PHA03307, PHA03307, transcriptional regulator ICP4; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237865 PRK14951, PRK14951, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235906 PRK07003, PRK07003, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|237030 PRK12270, kgd, alpha-ketoglutarate decarboxylase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|219321 pfam07174, FAP, Fibronectin-attachment protein (FAP) | Back alignment and domain information |
|---|
| >gnl|CDD|223066 PHA03379, PHA03379, EBNA-3A; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|219916 pfam08580, KAR9, Yeast cortical protein KAR9 | Back alignment and domain information |
|---|
| >gnl|CDD|237605 PRK14086, dnaA, chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|222095 pfam13388, DUF4106, Protein of unknown function (DUF4106) | Back alignment and domain information |
|---|
| >gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|114270 pfam05539, Pneumo_att_G, Pneumovirinae attachment membrane glycoprotein G | Back alignment and domain information |
|---|
| >gnl|CDD|184918 PRK14954, PRK14954, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|218621 pfam05518, Totivirus_coat, Totivirus coat protein | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 1162 | |||
| KOG2283 | 434 | consensus Clathrin coat dissociation kinase GAK/PT | 100.0 | |
| KOG1924 | 1102 | consensus RhoA GTPase effector DIA/Diaphanous [Sig | 100.0 | |
| smart00498 | 432 | FH2 Formin Homology 2 Domain. FH proteins control | 99.97 | |
| PF02181 | 370 | FH2: Formin Homology 2 Domain; InterPro: IPR015425 | 99.96 | |
| PF10409 | 134 | PTEN_C2: C2 domain of PTEN tumour-suppressor prote | 99.95 | |
| KOG1923 | 830 | consensus Rac1 GTPase effector FRL [Signal transdu | 99.88 | |
| KOG1925 | 817 | consensus Rac1 GTPase effector FHOS [Signal transd | 99.83 | |
| KOG1922 | 833 | consensus Rho GTPase effector BNI1 and related for | 99.75 | |
| PTZ00242 | 166 | protein tyrosine phosphatase; Provisional | 99.74 | |
| KOG1720 | 225 | consensus Protein tyrosine phosphatase CDC14 [Defe | 99.68 | |
| PTZ00393 | 241 | protein tyrosine phosphatase; Provisional | 99.62 | |
| PF05706 | 168 | CDKN3: Cyclin-dependent kinase inhibitor 3 (CDKN3) | 99.41 | |
| smart00195 | 138 | DSPc Dual specificity phosphatase, catalytic domai | 99.34 | |
| PF00782 | 133 | DSPc: Dual specificity phosphatase, catalytic doma | 99.22 | |
| cd00127 | 139 | DSPc Dual specificity phosphatases (DSP); Ser/Thr | 99.2 | |
| COG2453 | 180 | CDC14 Predicted protein-tyrosine phosphatase [Sign | 99.18 | |
| KOG1719 | 183 | consensus Dual specificity phosphatase [Defense me | 99.18 | |
| PRK12361 | 547 | hypothetical protein; Provisional | 99.16 | |
| KOG2836 | 173 | consensus Protein tyrosine phosphatase IVA1 [Signa | 99.07 | |
| PHA03247 | 3151 | large tegument protein UL36; Provisional | 98.95 | |
| smart00012 | 105 | PTPc_DSPc Protein tyrosine phosphatase, catalytic | 98.87 | |
| smart00404 | 105 | PTPc_motif Protein tyrosine phosphatase, catalytic | 98.87 | |
| PHA03247 | 3151 | large tegument protein UL36; Provisional | 98.87 | |
| KOG1924 | 1102 | consensus RhoA GTPase effector DIA/Diaphanous [Sig | 98.51 | |
| cd00047 | 231 | PTPc Protein tyrosine phosphatases (PTP) catalyze | 98.47 | |
| PRK15375 | 535 | pathogenicity island 1 effector protein StpP; Prov | 98.46 | |
| smart00194 | 258 | PTPc Protein tyrosine phosphatase, catalytic domai | 98.3 | |
| PF03162 | 164 | Y_phosphatase2: Tyrosine phosphatase family; Inter | 98.2 | |
| PF00102 | 235 | Y_phosphatase: Protein-tyrosine phosphatase; Inter | 98.07 | |
| KOG0792 | 1144 | consensus Protein tyrosine phosphatase PTPMEG, con | 98.0 | |
| KOG2386 | 393 | consensus mRNA capping enzyme, guanylyltransferase | 97.92 | |
| KOG1716 | 285 | consensus Dual specificity phosphatase [Defense me | 97.8 | |
| KOG0790 | 600 | consensus Protein tyrosine phosphatase Corkscrew a | 97.75 | |
| KOG3671 | 569 | consensus Actin regulatory protein (Wiskott-Aldric | 97.74 | |
| TIGR01244 | 135 | conserved hypothetical protein TIGR01244. No membe | 97.68 | |
| PHA02742 | 303 | protein tyrosine phosphatase; Provisional | 97.66 | |
| PHA02747 | 312 | protein tyrosine phosphatase; Provisional | 97.66 | |
| PHA02740 | 298 | protein tyrosine phosphatase; Provisional | 97.6 | |
| PLN02727 | 986 | NAD kinase | 97.56 | |
| KOG3671 | 569 | consensus Actin regulatory protein (Wiskott-Aldric | 97.51 | |
| PHA02746 | 323 | protein tyrosine phosphatase; Provisional | 97.49 | |
| PHA02738 | 320 | hypothetical protein; Provisional | 97.4 | |
| KOG1718 | 198 | consensus Dual specificity phosphatase [Defense me | 97.23 | |
| KOG1717 | 343 | consensus Dual specificity phosphatase [Defense me | 97.2 | |
| COG5599 | 302 | PTP2 Protein tyrosine phosphatase [Signal transduc | 97.17 | |
| PF14566 | 149 | PTPlike_phytase: Inositol hexakisphosphate; PDB: 1 | 97.17 | |
| KOG0791 | 374 | consensus Protein tyrosine phosphatase, contains f | 97.17 | |
| PF13350 | 164 | Y_phosphatase3: Tyrosine phosphatase family; PDB: | 96.56 | |
| KOG0789 | 415 | consensus Protein tyrosine phosphatase [Signal tra | 96.13 | |
| KOG1572 | 249 | consensus Predicted protein tyrosine phosphatase [ | 96.05 | |
| PF04273 | 110 | DUF442: Putative phosphatase (DUF442); InterPro: I | 95.9 | |
| COG2365 | 249 | Protein tyrosine/serine phosphatase [Signal transd | 95.6 | |
| KOG0793 | 1004 | consensus Protein tyrosine phosphatase [Signal tra | 95.36 | |
| COG5350 | 172 | Predicted protein tyrosine phosphatase [General fu | 95.16 | |
| KOG4228 | 1087 | consensus Protein tyrosine phosphatase [Signal tra | 94.81 | |
| PF14671 | 141 | DSPn: Dual specificity protein phosphatase, N-term | 94.28 | |
| KOG4228 | 1087 | consensus Protein tyrosine phosphatase [Signal tra | 93.66 | |
| KOG1830 | 518 | consensus Wiskott Aldrich syndrome proteins [Cytos | 90.95 | |
| PRK00142 | 314 | putative rhodanese-related sulfurtransferase; Prov | 80.54 |
| >KOG2283 consensus Clathrin coat dissociation kinase GAK/PTEN/Auxilin and related tyrosine phosphatases [Signal transduction mechanisms; General function prediction only] | Back alignment and domain information |
|---|
Probab=100.00 E-value=4.2e-54 Score=499.27 Aligned_cols=303 Identities=23% Similarity=0.363 Sum_probs=248.7
Q ss_pred hhhhcccCCCCCeeeecCceEEeccCCCCCCcchHHhhcChHHHHHHHHHhCCCCcEEEEecCCCCccccccccccccCc
Q 001080 4 FRKFFYRKPPDGLLEISERVFVFDCCFTTDILEEEEYKEYLGGIVGQLREYFPEASFMVFNFREGEHQSQIGQVLSEYDM 83 (1162)
Q Consensus 4 ~rr~~~~~~dlDLtyIT~RIiam~~~fP~~~~~e~~YRn~i~~V~~~L~~~h~~~~y~V~NL~~~~~~~~~~~~~s~f~~ 83 (1162)
.||++++|+||||+|||+||||| +||++++ |+.|||++++|++||+++|++| |+|||||.++++. ..+|++
T Consensus 3 k~r~~~~~~DLDltYIT~rIIam--sfPa~~~-es~yRN~l~dV~~fL~s~H~~~-y~vyNL~~er~yd-----~~~f~g 73 (434)
T KOG2283|consen 3 KRRYNEGGFDLDLTYITSRIIAM--SFPAEGI-ESLYRNNLEDVVLFLDSKHKDH-YKVYNLSSERLYD-----PSRFHG 73 (434)
T ss_pred cchhhhccccccceeeeeeEEEE--eCCCCcc-hhhhcCCHHHHHHHHhhccCCc-eEEEecCccccCC-----cccccc
Confidence 58999999999999999999999 7999999 8899999999999999999985 9999999544332 578999
Q ss_pred EEeeCCCCCCCCCCCCHHHHHHHHHHHHHHHHhCCCcEEEEEecCCCCchHHHHHHHHHHHhcCCCCHHHHHHHHHHhCc
Q 001080 84 TVMDYPRHYEGCPLLTMETVHHFLRSSESWLSLGHQNVLLMHCERGGWPVLAFMLAALLIYRKQFTGEQKTLDMIYKQAP 163 (1162)
Q Consensus 84 ~v~~~P~~d~~~P~p~L~~l~~~~~~i~~wL~~d~~nVVvVHCkaG~GR~tG~~ia~yLly~~~~~~~~eAL~~~~~~~~ 163 (1162)
+|..|+|.||++| +|++|+.||++|++||++|++||||||||+|+|| ||+||||||+|++.+.++++||++|..+|
T Consensus 74 ~V~~~~~~Dh~~P--~L~~l~~~c~~~~~WL~~d~~nVvvvHCk~Gkgr-tg~~icA~L~~~~~~~ta~eald~~~~kR- 149 (434)
T KOG2283|consen 74 RVARFGFDDHNPP--PLELLCPFCKSMDNWLSEDPKNVVVVHCKAGKGR-TGVMICAYLIYSGISATAEEALDYFNEKR- 149 (434)
T ss_pred ceeecCCCCCCCC--cHHHHHHHHHCHHHHHhcCccceEEEEccCCCcc-eEEEEeHHHHhhhhcCCHHHHHHHHhhhh-
Confidence 9999999999998 9999999999999999999999999999999999 99999999999999999999999986443
Q ss_pred hhhhccCCCCCCChHHHHHHHHHHHhhcCCCCCCCCC--ceeEEEEEEeecccc-CCCCcceeEEEEEecCCCcccCCCC
Q 001080 164 RELLQLMSPLNPLPSQLRYLQYVSRRNVGSEWPPLDR--ALTLDCVILRVIPNF-DGEGGCCPIFRIYGQDPLMVADRTP 240 (1162)
Q Consensus 164 ~~~~~~~s~~~~~PSQ~RYv~Yf~~ll~~~~~pp~~~--~l~L~~IiL~~iP~f-~~~~gcrP~~~Iy~~~~~~~~~~~~ 240 (1162)
+..+.+..+++|||+|||+||++++....+.++.+ .++|+.++|..||+| ...+||++++.||...
T Consensus 150 --~~~~~~~~~~~PSq~RYv~Y~~~~l~~~~~~~~~~~~~~f~~~~~~~~ip~~~~~~~~~~~~~~v~~~k--------- 218 (434)
T KOG2283|consen 150 --FDEGKSKGVTIPSQRRYVGYFSRVLLNGPLPPRSNSCPLFLHSFILISIPNFNSSRDGCRPAFPVYQGK--------- 218 (434)
T ss_pred --ccccccCCccCchhhHHHHHHHHHhhcCCcCcccccCceEeeeeeeeecCcccccCCCCCccceeeecc---------
Confidence 33333334499999999999999654445557776 899999999999994 4458999999999874
Q ss_pred cEEEecccccccceeecccCceEEEEccCCcccCcEEEEEEeCCCccc-------cCceEEEEEeecccccC--CEEEec
Q 001080 241 KVLFSTPKRSKLVRHYKQADCELVKIDIHCHIQGDVVLECISLDSDQE-------REEMMFRVMFNTAFIRS--NILMLN 311 (1162)
Q Consensus 241 k~lyss~~~~~~~r~y~~~d~~~i~~~i~~~v~GDV~I~~~h~~~~~~-------~~~~mFr~~FnT~FI~~--n~L~l~ 311 (1162)
+.+|+...+. .++.|.. ++ .|+|++++.++ ++|||.+...+ .+...|.++|||+++.. ..+.+.
T Consensus 219 ~~~~~~~s~~-~~~~~~~-~g-~~~i~~~~~~~----~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 291 (434)
T KOG2283|consen 219 KKVYSFSSDG-IMRLGEL-DG-KIVIPLGLRVD----VKCYHKRTSSGNRGILKDKEFKGCQIQFYTGPFPEDETVVRFF 291 (434)
T ss_pred eeeEEeccCC-ccccccc-cc-ceecccccccc----eEEEeeccccCCcceeeccccceEEEeccCCCccccceeeecc
Confidence 5788877666 7788877 54 37788887777 89999864432 35567888888888763 445566
Q ss_pred cCCccccccCCCCCCCCcEEEEEEecc
Q 001080 312 RDEIDILWNSKDLFSKEFRAEVLFSEM 338 (1162)
Q Consensus 312 k~eLD~~~~~k~~fp~dF~Vel~F~~~ 338 (1162)
..+++.-. ..+.+..-|.|.+.-.+.
T Consensus 292 ~~~~~~~~-~~e~~~~~~~~~~~~~~~ 317 (434)
T KOG2283|consen 292 QADLPIYV-SNEFVFNFFQVSLEVENT 317 (434)
T ss_pred cccCCccc-cccccccccceeeecccC
Confidence 66666532 234556666666555443
|
|
| >KOG1924 consensus RhoA GTPase effector DIA/Diaphanous [Signal transduction mechanisms; Cytoskeleton] | Back alignment and domain information |
|---|
| >smart00498 FH2 Formin Homology 2 Domain | Back alignment and domain information |
|---|
| >PF02181 FH2: Formin Homology 2 Domain; InterPro: IPR015425 Formin homology (FH) proteins play a crucial role in the reorganisation of the actin cytoskeleton, which mediates various functions of the cell cortex including motility, adhesion, and cytokinesis [] | Back alignment and domain information |
|---|
| >PF10409 PTEN_C2: C2 domain of PTEN tumour-suppressor protein; InterPro: IPR014020 Tensins constitute an eukaryotic family of lipid phosphatases that are defined by the presence of two adjacent domains: a lipid phosphatase domain and a C2-like domain | Back alignment and domain information |
|---|
| >KOG1923 consensus Rac1 GTPase effector FRL [Signal transduction mechanisms; Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG1925 consensus Rac1 GTPase effector FHOS [Signal transduction mechanisms; Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG1922 consensus Rho GTPase effector BNI1 and related formins [Signal transduction mechanisms; Cytoskeleton] | Back alignment and domain information |
|---|
| >PTZ00242 protein tyrosine phosphatase; Provisional | Back alignment and domain information |
|---|
| >KOG1720 consensus Protein tyrosine phosphatase CDC14 [Defense mechanisms] | Back alignment and domain information |
|---|
| >PTZ00393 protein tyrosine phosphatase; Provisional | Back alignment and domain information |
|---|
| >PF05706 CDKN3: Cyclin-dependent kinase inhibitor 3 (CDKN3); InterPro: IPR022778 This entry represents a domain found in cyclin-dependent kinase inhibitor 3 or kinase associated phosphatase proteins from several mammalian species | Back alignment and domain information |
|---|
| >smart00195 DSPc Dual specificity phosphatase, catalytic domain | Back alignment and domain information |
|---|
| >PF00782 DSPc: Dual specificity phosphatase, catalytic domain; InterPro: IPR000340 Protein tyrosine (pTyr) phosphorylation is a common post-translational modification which can create novel recognition motifs for protein interactions and cellular localisation, affect protein stability, and regulate enzyme activity | Back alignment and domain information |
|---|
| >cd00127 DSPc Dual specificity phosphatases (DSP); Ser/Thr and Tyr protein phosphatases | Back alignment and domain information |
|---|
| >COG2453 CDC14 Predicted protein-tyrosine phosphatase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1719 consensus Dual specificity phosphatase [Defense mechanisms] | Back alignment and domain information |
|---|
| >PRK12361 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG2836 consensus Protein tyrosine phosphatase IVA1 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PHA03247 large tegument protein UL36; Provisional | Back alignment and domain information |
|---|
| >smart00012 PTPc_DSPc Protein tyrosine phosphatase, catalytic domain, undefined specificity | Back alignment and domain information |
|---|
| >smart00404 PTPc_motif Protein tyrosine phosphatase, catalytic domain motif | Back alignment and domain information |
|---|
| >PHA03247 large tegument protein UL36; Provisional | Back alignment and domain information |
|---|
| >KOG1924 consensus RhoA GTPase effector DIA/Diaphanous [Signal transduction mechanisms; Cytoskeleton] | Back alignment and domain information |
|---|
| >cd00047 PTPc Protein tyrosine phosphatases (PTP) catalyze the dephosphorylation of phosphotyrosine peptides; they regulate phosphotyrosine levels in signal transduction pathways | Back alignment and domain information |
|---|
| >PRK15375 pathogenicity island 1 effector protein StpP; Provisional | Back alignment and domain information |
|---|
| >smart00194 PTPc Protein tyrosine phosphatase, catalytic domain | Back alignment and domain information |
|---|
| >PF03162 Y_phosphatase2: Tyrosine phosphatase family; InterPro: IPR004861 Protein tyrosine (pTyr) phosphorylation is a common post-translational modification which can create novel recognition motifs for protein interactions and cellular localisation, affect protein stability, and regulate enzyme activity | Back alignment and domain information |
|---|
| >PF00102 Y_phosphatase: Protein-tyrosine phosphatase; InterPro: IPR000242 Protein tyrosine (pTyr) phosphorylation is a common post-translational modification which can create novel recognition motifs for protein interactions and cellular localisation, affect protein stability, and regulate enzyme activity | Back alignment and domain information |
|---|
| >KOG0792 consensus Protein tyrosine phosphatase PTPMEG, contains FERM domain [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG2386 consensus mRNA capping enzyme, guanylyltransferase (alpha) subunit [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG1716 consensus Dual specificity phosphatase [Defense mechanisms] | Back alignment and domain information |
|---|
| >KOG0790 consensus Protein tyrosine phosphatase Corkscrew and related SH2 domain enzymes [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG3671 consensus Actin regulatory protein (Wiskott-Aldrich syndrome protein) [Signal transduction mechanisms; Cytoskeleton] | Back alignment and domain information |
|---|
| >TIGR01244 conserved hypothetical protein TIGR01244 | Back alignment and domain information |
|---|
| >PHA02742 protein tyrosine phosphatase; Provisional | Back alignment and domain information |
|---|
| >PHA02747 protein tyrosine phosphatase; Provisional | Back alignment and domain information |
|---|
| >PHA02740 protein tyrosine phosphatase; Provisional | Back alignment and domain information |
|---|
| >PLN02727 NAD kinase | Back alignment and domain information |
|---|
| >KOG3671 consensus Actin regulatory protein (Wiskott-Aldrich syndrome protein) [Signal transduction mechanisms; Cytoskeleton] | Back alignment and domain information |
|---|
| >PHA02746 protein tyrosine phosphatase; Provisional | Back alignment and domain information |
|---|
| >PHA02738 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG1718 consensus Dual specificity phosphatase [Defense mechanisms] | Back alignment and domain information |
|---|
| >KOG1717 consensus Dual specificity phosphatase [Defense mechanisms] | Back alignment and domain information |
|---|
| >COG5599 PTP2 Protein tyrosine phosphatase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF14566 PTPlike_phytase: Inositol hexakisphosphate; PDB: 1U24_A 2PSZ_B 3MOZ_A 3D1H_B 2B4P_B 3D1Q_A 2B4O_A 3MMJ_B 1U25_A 1U26_B | Back alignment and domain information |
|---|
| >KOG0791 consensus Protein tyrosine phosphatase, contains fn3 domain [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF13350 Y_phosphatase3: Tyrosine phosphatase family; PDB: 1YWF_A 2OZ5_B | Back alignment and domain information |
|---|
| >KOG0789 consensus Protein tyrosine phosphatase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1572 consensus Predicted protein tyrosine phosphatase [Defense mechanisms] | Back alignment and domain information |
|---|
| >PF04273 DUF442: Putative phosphatase (DUF442); InterPro: IPR005939 Although this domain is uncharacterised it seems likely that it performs a phosphatase function | Back alignment and domain information |
|---|
| >COG2365 Protein tyrosine/serine phosphatase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0793 consensus Protein tyrosine phosphatase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >COG5350 Predicted protein tyrosine phosphatase [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4228 consensus Protein tyrosine phosphatase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF14671 DSPn: Dual specificity protein phosphatase, N-terminal half; PDB: 1OHD_A 1OHE_A 1OHC_A | Back alignment and domain information |
|---|
| >KOG4228 consensus Protein tyrosine phosphatase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1830 consensus Wiskott Aldrich syndrome proteins [Cytoskeleton] | Back alignment and domain information |
|---|
| >PRK00142 putative rhodanese-related sulfurtransferase; Provisional | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 1162 | ||||
| 2z6e_A | 419 | Crystal Structure Of Human Daam1 Fh2 Length = 419 | 1e-15 | ||
| 2j1d_G | 483 | Crystallization Of Hdaam1 C-Terminal Fragment Lengt | 1e-15 | ||
| 3o4x_E | 467 | Crystal Structure Of Complex Between Amino And Carb | 2e-08 | ||
| 3obv_E | 457 | Autoinhibited Formin Mdia1 Structure Length = 457 | 4e-08 | ||
| 1v9d_A | 340 | Crystal Structure Of The Core Fh2 Domain Of Mouse M | 4e-08 | ||
| 4eah_A | 402 | Crystal Structure Of The Formin Homology 2 Domain O | 1e-07 | ||
| 1d5r_A | 324 | Crystal Structure Of The Pten Tumor Suppressor Leng | 8e-05 | ||
| 3n0a_A | 361 | Crystal Structure Of Auxilin (40-400) Length = 361 | 2e-04 | ||
| 3awf_A | 346 | Crystal Structure Of Pten-Like Domain Of Ci-Vsp (23 | 8e-04 |
| >pdb|2Z6E|A Chain A, Crystal Structure Of Human Daam1 Fh2 Length = 419 | Back alignment and structure |
|
| >pdb|2J1D|G Chain G, Crystallization Of Hdaam1 C-Terminal Fragment Length = 483 | Back alignment and structure |
| >pdb|3O4X|E Chain E, Crystal Structure Of Complex Between Amino And Carboxy Terminal Fragments Of Mdia1 Length = 467 | Back alignment and structure |
| >pdb|3OBV|E Chain E, Autoinhibited Formin Mdia1 Structure Length = 457 | Back alignment and structure |
| >pdb|1V9D|A Chain A, Crystal Structure Of The Core Fh2 Domain Of Mouse Mdia1 Length = 340 | Back alignment and structure |
| >pdb|4EAH|A Chain A, Crystal Structure Of The Formin Homology 2 Domain Of Fmnl3 Bound To Actin Length = 402 | Back alignment and structure |
| >pdb|1D5R|A Chain A, Crystal Structure Of The Pten Tumor Suppressor Length = 324 | Back alignment and structure |
| >pdb|3N0A|A Chain A, Crystal Structure Of Auxilin (40-400) Length = 361 | Back alignment and structure |
| >pdb|3AWF|A Chain A, Crystal Structure Of Pten-Like Domain Of Ci-Vsp (236-576) Length = 346 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 1162 | |||
| 3obv_E | 457 | Protein diaphanous homolog 1; autoinhibition, acti | 2e-54 | |
| 2j1d_G | 483 | DAAM1, disheveled-associated activator of morphoge | 9e-53 | |
| 1d5r_A | 324 | Phosphoinositide phosphotase PTEN; C2 domain, phos | 2e-52 | |
| 3v0d_A | 339 | Voltage-sensor containing phosphatase; PTP, hydrol | 1e-50 | |
| 3n0a_A | 361 | Tyrosine-protein phosphatase auxilin; phosphatase- | 1e-50 | |
| 1v9d_A | 340 | Diaphanous protein homolog 1; helix bundle, protei | 5e-44 | |
| 1ux5_A | 411 | BNI1 protein; structural protein, FH2 actin cytosk | 5e-43 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 1e-16 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 1e-08 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 1e-08 | |
| 1twf_A | 1733 | B220, DNA-directed RNA polymerase II largest subun | 2e-15 | |
| 1twf_A | 1733 | B220, DNA-directed RNA polymerase II largest subun | 5e-15 | |
| 1twf_A | 1733 | B220, DNA-directed RNA polymerase II largest subun | 2e-13 | |
| 1twf_A | 1733 | B220, DNA-directed RNA polymerase II largest subun | 3e-13 | |
| 1twf_A | 1733 | B220, DNA-directed RNA polymerase II largest subun | 3e-07 | |
| 1twf_A | 1733 | B220, DNA-directed RNA polymerase II largest subun | 9e-04 | |
| 3h0g_A | 1752 | DNA-directed RNA polymerase II subunit RPB1; trans | 1e-14 | |
| 3h0g_A | 1752 | DNA-directed RNA polymerase II subunit RPB1; trans | 8e-13 | |
| 3h0g_A | 1752 | DNA-directed RNA polymerase II subunit RPB1; trans | 3e-12 | |
| 1m2v_B | 926 | SEC24, protein transport protein SEC24, SEC24P, SE | 2e-10 | |
| 1m2v_B | 926 | SEC24, protein transport protein SEC24, SEC24P, SE | 4e-10 | |
| 1m2v_B | 926 | SEC24, protein transport protein SEC24, SEC24P, SE | 1e-08 | |
| 1m2v_B | 926 | SEC24, protein transport protein SEC24, SEC24P, SE | 1e-06 | |
| 1m2v_B | 926 | SEC24, protein transport protein SEC24, SEC24P, SE | 6e-06 | |
| 1m2v_B | 926 | SEC24, protein transport protein SEC24, SEC24P, SE | 3e-05 | |
| 1m2v_B | 926 | SEC24, protein transport protein SEC24, SEC24P, SE | 1e-04 | |
| 1pk8_A | 422 | RAT synapsin I; ATP binding, ATP grAsp, calcium (I | 3e-08 | |
| 1pk8_A | 422 | RAT synapsin I; ATP binding, ATP grAsp, calcium (I | 6e-04 | |
| 3dzy_A | 467 | Retinoic acid receptor RXR-alpha; DNA-binding, HOS | 5e-07 | |
| 3dzy_A | 467 | Retinoic acid receptor RXR-alpha; DNA-binding, HOS | 3e-06 | |
| 3dzy_A | 467 | Retinoic acid receptor RXR-alpha; DNA-binding, HOS | 6e-06 | |
| 3dzy_A | 467 | Retinoic acid receptor RXR-alpha; DNA-binding, HOS | 6e-06 | |
| 3dzy_A | 467 | Retinoic acid receptor RXR-alpha; DNA-binding, HOS | 4e-05 | |
| 3dzy_A | 467 | Retinoic acid receptor RXR-alpha; DNA-binding, HOS | 4e-05 | |
| 3dzy_A | 467 | Retinoic acid receptor RXR-alpha; DNA-binding, HOS | 6e-05 | |
| 3dzy_A | 467 | Retinoic acid receptor RXR-alpha; DNA-binding, HOS | 2e-04 | |
| 1deq_A | 390 | Fibrinogen (alpha chain); coiled-coil, blood clott | 5e-07 | |
| 1deq_A | 390 | Fibrinogen (alpha chain); coiled-coil, blood clott | 1e-06 | |
| 1deq_A | 390 | Fibrinogen (alpha chain); coiled-coil, blood clott | 3e-05 | |
| 1deq_A | 390 | Fibrinogen (alpha chain); coiled-coil, blood clott | 3e-04 | |
| 3v1v_A | 433 | 2-MIB synthase, 2-methylisoborneol synthase; class | 1e-06 | |
| 3v1v_A | 433 | 2-MIB synthase, 2-methylisoborneol synthase; class | 4e-06 | |
| 3v1v_A | 433 | 2-MIB synthase, 2-methylisoborneol synthase; class | 3e-05 | |
| 3v1v_A | 433 | 2-MIB synthase, 2-methylisoborneol synthase; class | 5e-05 | |
| 3v1v_A | 433 | 2-MIB synthase, 2-methylisoborneol synthase; class | 6e-05 | |
| 3v1v_A | 433 | 2-MIB synthase, 2-methylisoborneol synthase; class | 6e-04 | |
| 2wvr_C | 546 | DNA replication factor CDT1; DNA replication licen | 3e-06 | |
| 2wvr_C | 546 | DNA replication factor CDT1; DNA replication licen | 2e-04 | |
| 2xag_A | 852 | Lysine-specific histone demethylase 1; amine oxida | 6e-06 | |
| 2xag_A | 852 | Lysine-specific histone demethylase 1; amine oxida | 6e-05 | |
| 2xag_A | 852 | Lysine-specific histone demethylase 1; amine oxida | 1e-04 | |
| 3nwa_A | 703 | GB, GB-1, GB1, envelope glycoprotein B; coiled-coi | 1e-05 | |
| 3nwa_A | 703 | GB, GB-1, GB1, envelope glycoprotein B; coiled-coi | 8e-04 | |
| 3tx7_B | 352 | Nuclear receptor subfamily 5 group A member 2; LRH | 2e-05 | |
| 3tx7_B | 352 | Nuclear receptor subfamily 5 group A member 2; LRH | 3e-04 | |
| 2v5y_A | 731 | Receptor-type tyrosine-protein phosphatase MU; mem | 3e-05 | |
| 3pgw_B | 231 | SM B; protein-RNA complex, U1 snRNA, SM fold, SM c | 8e-05 | |
| 3pgw_B | 231 | SM B; protein-RNA complex, U1 snRNA, SM fold, SM c | 5e-04 | |
| 2grx_C | 229 | Protein TONB; beta barrel, outer membrane, heteroc | 2e-04 | |
| 3iox_A | 497 | AGI/II, PA; alpha helix, PPII helix, supersandwich | 9e-04 |
| >3obv_E Protein diaphanous homolog 1; autoinhibition, actin, nucleation, cytoskeleton, structural; HET: SUC; 2.75A {Mus musculus} PDB: 3o4x_E 2bap_D Length = 457 | Back alignment and structure |
|---|
Score = 196 bits (500), Expect = 2e-54
Identities = 43/194 (22%), Positives = 85/194 (43%), Gaps = 8/194 (4%)
Query: 970 KNNLKPYHWLKL--TRAMQGSLWAEAQKSDEASKAPEFDMSELESLFSAAAPNSDLGGKS 1027
+ L+ +W K Q W + E ++L FSA S
Sbjct: 7 EVQLRRPNWSKFVAEDLSQDCFWTKV---KEDRFENNELFAKLTLAFSAQTKTSKAKKDQ 63
Query: 1028 GKSNRRSGP---KPERVQLIELRRANNCEIMLTKVKIPLPDLMGSVLALDDSALDIDQVD 1084
+ K + +++++ + A N I L ++P ++ +L ++++ L +
Sbjct: 64 EGGEEKKSVQKKKVKELKVLDSKTAQNLSIFLGSFRMPYQEIKNVILEVNEAVLTESMIQ 123
Query: 1085 NLIKFCPTKEEMEVLKNYNGDKGNLGKCEQFFLELMKVPRVESKLRVFSFKIQFQTQVSD 1144
NLIK P E++++L + +L + EQF + + VPR+ +L FK+QF QV +
Sbjct: 124 NLIKQMPEPEQLKMLSELKEEYDDLAESEQFGVVMGTVPRLRPRLNAILFKLQFSEQVEN 183
Query: 1145 LRTSLNIINSASEE 1158
++ + + +A EE
Sbjct: 184 IKPEIVSVTAACEE 197
|
| >2j1d_G DAAM1, disheveled-associated activator of morphogenesis; actin assembly, protein binding; 2.55A {Homo sapiens} PDB: 2z6e_A Length = 483 | Back alignment and structure |
|---|
| >1d5r_A Phosphoinositide phosphotase PTEN; C2 domain, phosphotidylinositol, hydrolase; HET: TLA; 2.10A {Homo sapiens} SCOP: b.7.1.1 c.45.1.1 Length = 324 | Back alignment and structure |
|---|
| >3v0d_A Voltage-sensor containing phosphatase; PTP, hydrolase; HET: PO4; 1.10A {Ciona intestinalis} PDB: 3v0f_A* 3v0g_A 3v0h_A* 3awf_A 3v0j_A 3awe_A 3awg_A 3v0e_A 3v0i_A Length = 339 | Back alignment and structure |
|---|
| >3n0a_A Tyrosine-protein phosphatase auxilin; phosphatase-like domain, C2 domain, hydrolase; 2.20A {Bos taurus} Length = 361 | Back alignment and structure |
|---|
| >1v9d_A Diaphanous protein homolog 1; helix bundle, protein binding; 2.60A {Mus musculus} SCOP: a.207.1.1 Length = 340 | Back alignment and structure |
|---|
| >1ux5_A BNI1 protein; structural protein, FH2 actin cytoskeleton; 2.5A {Saccharomyces cerevisiae} SCOP: a.207.1.1 PDB: 1y64_B* 1ux4_A Length = 411 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 | Back alignment and structure |
|---|
| >1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 | Back alignment and structure |
|---|
| >1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 | Back alignment and structure |
|---|
| >1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 | Back alignment and structure |
|---|
| >1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 | Back alignment and structure |
|---|
| >1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 | Back alignment and structure |
|---|
| >3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 | Back alignment and structure |
|---|
| >3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 | Back alignment and structure |
|---|
| >3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 | Back alignment and structure |
|---|
| >1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 | Back alignment and structure |
|---|
| >1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 | Back alignment and structure |
|---|
| >1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 | Back alignment and structure |
|---|
| >1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 | Back alignment and structure |
|---|
| >1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 | Back alignment and structure |
|---|
| >1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 | Back alignment and structure |
|---|
| >1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 | Back alignment and structure |
|---|
| >1pk8_A RAT synapsin I; ATP binding, ATP grAsp, calcium (II) ION, membrane protein; HET: ATP; 2.10A {Rattus norvegicus} SCOP: c.30.1.5 d.142.1.3 PDB: 1px2_A* Length = 422 | Back alignment and structure |
|---|
| >1pk8_A RAT synapsin I; ATP binding, ATP grAsp, calcium (II) ION, membrane protein; HET: ATP; 2.10A {Rattus norvegicus} SCOP: c.30.1.5 d.142.1.3 PDB: 1px2_A* Length = 422 | Back alignment and structure |
|---|
| >3dzy_A Retinoic acid receptor RXR-alpha; DNA-binding, HOST-virus interaction, metal-binding, nucleus, receptor, transcription, transcription regulation, zinc-FIN activator; HET: DNA REA BRL; 3.10A {Homo sapiens} PDB: 3dzu_A* 3e00_A* Length = 467 | Back alignment and structure |
|---|
| >3dzy_A Retinoic acid receptor RXR-alpha; DNA-binding, HOST-virus interaction, metal-binding, nucleus, receptor, transcription, transcription regulation, zinc-FIN activator; HET: DNA REA BRL; 3.10A {Homo sapiens} PDB: 3dzu_A* 3e00_A* Length = 467 | Back alignment and structure |
|---|
| >3dzy_A Retinoic acid receptor RXR-alpha; DNA-binding, HOST-virus interaction, metal-binding, nucleus, receptor, transcription, transcription regulation, zinc-FIN activator; HET: DNA REA BRL; 3.10A {Homo sapiens} PDB: 3dzu_A* 3e00_A* Length = 467 | Back alignment and structure |
|---|
| >3dzy_A Retinoic acid receptor RXR-alpha; DNA-binding, HOST-virus interaction, metal-binding, nucleus, receptor, transcription, transcription regulation, zinc-FIN activator; HET: DNA REA BRL; 3.10A {Homo sapiens} PDB: 3dzu_A* 3e00_A* Length = 467 | Back alignment and structure |
|---|
| >3dzy_A Retinoic acid receptor RXR-alpha; DNA-binding, HOST-virus interaction, metal-binding, nucleus, receptor, transcription, transcription regulation, zinc-FIN activator; HET: DNA REA BRL; 3.10A {Homo sapiens} PDB: 3dzu_A* 3e00_A* Length = 467 | Back alignment and structure |
|---|
| >3dzy_A Retinoic acid receptor RXR-alpha; DNA-binding, HOST-virus interaction, metal-binding, nucleus, receptor, transcription, transcription regulation, zinc-FIN activator; HET: DNA REA BRL; 3.10A {Homo sapiens} PDB: 3dzu_A* 3e00_A* Length = 467 | Back alignment and structure |
|---|
| >3dzy_A Retinoic acid receptor RXR-alpha; DNA-binding, HOST-virus interaction, metal-binding, nucleus, receptor, transcription, transcription regulation, zinc-FIN activator; HET: DNA REA BRL; 3.10A {Homo sapiens} PDB: 3dzu_A* 3e00_A* Length = 467 | Back alignment and structure |
|---|
| >3dzy_A Retinoic acid receptor RXR-alpha; DNA-binding, HOST-virus interaction, metal-binding, nucleus, receptor, transcription, transcription regulation, zinc-FIN activator; HET: DNA REA BRL; 3.10A {Homo sapiens} PDB: 3dzu_A* 3e00_A* Length = 467 | Back alignment and structure |
|---|
| >3v1v_A 2-MIB synthase, 2-methylisoborneol synthase; class I terpenoid cyclase fold, DDXXXXD motif, NDXXSXXXE MOT methylisoborneol biosynthesis; HET: GST; 1.80A {Streptomyces coelicolor} PDB: 3v1x_A* Length = 433 | Back alignment and structure |
|---|
| >3v1v_A 2-MIB synthase, 2-methylisoborneol synthase; class I terpenoid cyclase fold, DDXXXXD motif, NDXXSXXXE MOT methylisoborneol biosynthesis; HET: GST; 1.80A {Streptomyces coelicolor} PDB: 3v1x_A* Length = 433 | Back alignment and structure |
|---|
| >3v1v_A 2-MIB synthase, 2-methylisoborneol synthase; class I terpenoid cyclase fold, DDXXXXD motif, NDXXSXXXE MOT methylisoborneol biosynthesis; HET: GST; 1.80A {Streptomyces coelicolor} PDB: 3v1x_A* Length = 433 | Back alignment and structure |
|---|
| >3v1v_A 2-MIB synthase, 2-methylisoborneol synthase; class I terpenoid cyclase fold, DDXXXXD motif, NDXXSXXXE MOT methylisoborneol biosynthesis; HET: GST; 1.80A {Streptomyces coelicolor} PDB: 3v1x_A* Length = 433 | Back alignment and structure |
|---|
| >3v1v_A 2-MIB synthase, 2-methylisoborneol synthase; class I terpenoid cyclase fold, DDXXXXD motif, NDXXSXXXE MOT methylisoborneol biosynthesis; HET: GST; 1.80A {Streptomyces coelicolor} PDB: 3v1x_A* Length = 433 | Back alignment and structure |
|---|
| >3v1v_A 2-MIB synthase, 2-methylisoborneol synthase; class I terpenoid cyclase fold, DDXXXXD motif, NDXXSXXXE MOT methylisoborneol biosynthesis; HET: GST; 1.80A {Streptomyces coelicolor} PDB: 3v1x_A* Length = 433 | Back alignment and structure |
|---|
| >2wvr_C DNA replication factor CDT1; DNA replication license, DNA replication inhibitor, phosphoprotein, UBL conjugation, DNA-binding, polymorphism; HET: DNA; 3.30A {Homo sapiens} PDB: 2klo_A* Length = 546 | Back alignment and structure |
|---|
| >2wvr_C DNA replication factor CDT1; DNA replication license, DNA replication inhibitor, phosphoprotein, UBL conjugation, DNA-binding, polymorphism; HET: DNA; 3.30A {Homo sapiens} PDB: 2klo_A* Length = 546 | Back alignment and structure |
|---|
| >2xag_A Lysine-specific histone demethylase 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_A* 2xah_A* 2xaj_A* 2xaq_A* 2xas_A* 2com_A Length = 852 | Back alignment and structure |
|---|
| >2xag_A Lysine-specific histone demethylase 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_A* 2xah_A* 2xaj_A* 2xaq_A* 2xas_A* 2com_A Length = 852 | Back alignment and structure |
|---|
| >2xag_A Lysine-specific histone demethylase 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_A* 2xah_A* 2xaj_A* 2xaq_A* 2xas_A* 2com_A Length = 852 | Back alignment and structure |
|---|
| >3nwa_A GB, GB-1, GB1, envelope glycoprotein B; coiled-coil, membrane fusion, viral P glycoprotein B, HSV-1, membrane; HET: NAG; 2.26A {Human herpesvirus 1} PDB: 3nwf_A* 3nw8_A* 3nwd_A* Length = 703 | Back alignment and structure |
|---|
| >3nwa_A GB, GB-1, GB1, envelope glycoprotein B; coiled-coil, membrane fusion, viral P glycoprotein B, HSV-1, membrane; HET: NAG; 2.26A {Human herpesvirus 1} PDB: 3nwf_A* 3nw8_A* 3nwd_A* Length = 703 | Back alignment and structure |
|---|
| >3tx7_B Nuclear receptor subfamily 5 group A member 2; LRH-1, beta-catenin, armadillo repeat, nuclear receptor LIGA binding domain, protein binding; HET: P6L; 2.76A {Homo sapiens} Length = 352 | Back alignment and structure |
|---|
| >3tx7_B Nuclear receptor subfamily 5 group A member 2; LRH-1, beta-catenin, armadillo repeat, nuclear receptor LIGA binding domain, protein binding; HET: P6L; 2.76A {Homo sapiens} Length = 352 | Back alignment and structure |
|---|
| >2v5y_A Receptor-type tyrosine-protein phosphatase MU; membrane, hydrolase, glycoprotein, receptor protei tyrosine phosphatase, cell adhesion; HET: NAG; 3.10A {Homo sapiens} Length = 731 | Back alignment and structure |
|---|
| >3pgw_B SM B; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_A Length = 231 | Back alignment and structure |
|---|
| >3pgw_B SM B; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_A Length = 231 | Back alignment and structure |
|---|
| >2grx_C Protein TONB; beta barrel, outer membrane, heterocomplex, inter-protein beta sheet, protein-protein, metal transport; HET: GCN KDO GMH FTT DAO MYR FCI; 3.30A {Escherichia coli} SCOP: d.212.1.2 PDB: 1xx3_A Length = 229 | Back alignment and structure |
|---|
| >3iox_A AGI/II, PA; alpha helix, PPII helix, supersandwich fold, surface adhesin WALL, peptidoglycan-anchor, cell adhesion; HET: PMS; 1.80A {Streptococcus mutans} PDB: 3ipk_A* 1jmm_A Length = 497 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 1162 | |||
| 3n0a_A | 361 | Tyrosine-protein phosphatase auxilin; phosphatase- | 100.0 | |
| 3v0d_A | 339 | Voltage-sensor containing phosphatase; PTP, hydrol | 100.0 | |
| 1d5r_A | 324 | Phosphoinositide phosphotase PTEN; C2 domain, phos | 100.0 | |
| 4eah_A | 402 | Formin-like protein 3, actin, alpha skeletal muscl | 99.98 | |
| 2j1d_G | 483 | DAAM1, disheveled-associated activator of morphoge | 99.98 | |
| 3obv_E | 457 | Protein diaphanous homolog 1; autoinhibition, acti | 99.97 | |
| 1ux5_A | 411 | BNI1 protein; structural protein, FH2 actin cytosk | 99.94 | |
| 1v9d_A | 340 | Diaphanous protein homolog 1; helix bundle, protei | 99.89 | |
| 2c46_A | 241 | MRNA capping enzyme; phosphatase, transferase, hyd | 99.8 | |
| 3rz2_A | 189 | Protein tyrosine phosphatase type IVA 1; tyrosine | 99.74 | |
| 1yn9_A | 169 | BVP, polynucleotide 5'-phosphatase; RNA triphospha | 99.7 | |
| 2img_A | 151 | Dual specificity protein phosphatase 23; DUSP23, V | 99.69 | |
| 4erc_A | 150 | Dual specificity protein phosphatase 23; alpha bet | 99.66 | |
| 1fpz_A | 212 | Cyclin-dependent kinase inhibitor 3; alpha-beta sa | 99.62 | |
| 1ohe_A | 348 | CDC14B, CDC14B2 phosphatase; protein phosphatase, | 99.59 | |
| 3s4o_A | 167 | Protein tyrosine phosphatase-like protein; structu | 99.57 | |
| 1rxd_A | 159 | Protein tyrosine phosphatase type IVA, member 1; p | 99.55 | |
| 3rgo_A | 157 | Protein-tyrosine phosphatase mitochondrial 1; phos | 99.5 | |
| 2i6j_A | 161 | Ssoptp, sulfolobus solfataricus protein tyrosine p | 99.48 | |
| 2y96_A | 219 | Dual specificity phosphatase DUPD1; hydrolase; 2.3 | 99.4 | |
| 1zzw_A | 149 | Dual specificity protein phosphatase 10; MKP, PTP, | 99.39 | |
| 3ezz_A | 144 | Dual specificity protein phosphatase 4; alpha/beta | 99.39 | |
| 2hcm_A | 164 | Dual specificity protein phosphatase; structural g | 99.38 | |
| 2wgp_A | 190 | Dual specificity protein phosphatase 14; MKP6, DUS | 99.37 | |
| 3f81_A | 183 | Dual specificity protein phosphatase 3; hydrolase, | 99.36 | |
| 2g6z_A | 211 | Dual specificity protein phosphatase 5; alpha/beta | 99.33 | |
| 1xri_A | 151 | AT1G05000; structural genomics, protein structure | 99.33 | |
| 2oud_A | 177 | Dual specificity protein phosphatase 10; A central | 99.32 | |
| 2esb_A | 188 | Dual specificity protein phosphatase 18; alpha/bet | 99.3 | |
| 2e0t_A | 151 | Dual specificity phosphatase 26; conserved hypothe | 99.27 | |
| 1wrm_A | 165 | Dual specificity phosphatase 22; DSP, JNK, hydrola | 99.27 | |
| 3emu_A | 161 | Leucine rich repeat and phosphatase domain contain | 99.26 | |
| 3s4e_A | 144 | Dual specificity protein phosphatase 19; PTP, prot | 99.26 | |
| 1yz4_A | 160 | DUSP15, dual specificity phosphatase-like 15 isofo | 99.26 | |
| 2hxp_A | 155 | Dual specificity protein phosphatase 9; human phos | 99.25 | |
| 2nt2_A | 145 | Protein phosphatase slingshot homolog 2; alpha/bet | 99.25 | |
| 2r0b_A | 154 | Serine/threonine/tyrosine-interacting protein; str | 99.2 | |
| 3cm3_A | 176 | Late protein H1, dual specificity protein phosphat | 99.16 | |
| 3nme_A | 294 | Ptpkis1 protein, SEX4 glucan phosphatase; dual spe | 99.14 | |
| 2q05_A | 195 | Late protein H1, dual specificity protein phosphat | 99.11 | |
| 2pq5_A | 205 | Dual specificity protein phosphatase 13; hydrolase | 99.08 | |
| 2j16_A | 182 | SDP-1, tyrosine-protein phosphatase YIL113W; hydro | 99.05 | |
| 1g4w_R | 383 | Protein tyrosine phosphatase SPTP; virulence facto | 98.74 | |
| 1p15_A | 253 | Protein-tyrosine phosphatase alpha; transmembrane, | 98.56 | |
| 3mmj_A | 314 | MYO-inositol hexaphosphate phosphohydrolase; phyta | 98.55 | |
| 1fpr_A | 284 | Protein-tyrosine phosphatase 1C; protein tyrosine | 98.49 | |
| 2hc1_A | 291 | Receptor-type tyrosine-protein phosphatase beta; p | 98.48 | |
| 2f46_A | 156 | Hypothetical protein; structural genomics, joint c | 98.46 | |
| 2b49_A | 287 | Protein tyrosine phosphatase, non-receptor type 3; | 98.46 | |
| 2i75_A | 320 | Tyrosine-protein phosphatase non-receptor type 4; | 98.45 | |
| 3m4u_A | 306 | Tyrosine specific protein phosphatase, putative; p | 98.42 | |
| 1jln_A | 297 | STEP-like ptpase, protein tyrosine phosphatase, re | 98.38 | |
| 2cm2_A | 304 | Tyrosine-protein phosphatase non-receptor type 1; | 98.38 | |
| 2bzl_A | 325 | Tyrosine-protein phosphatase, non-receptor type 14 | 98.36 | |
| 4az1_A | 302 | Tyrosine specific protein phosphatase; hydrolase, | 98.35 | |
| 3f41_A | 629 | Phytase; tandem repeat, protein tyrosine phosphata | 98.35 | |
| 3b7o_A | 316 | Tyrosine-protein phosphatase non-receptor type 11; | 98.35 | |
| 1l8k_A | 314 | T-cell protein-tyrosine phosphatase; hydrolase; 2. | 98.34 | |
| 2oc3_A | 303 | Tyrosine-protein phosphatase non-receptor type 18; | 98.33 | |
| 2i1y_A | 301 | Receptor-type tyrosine-protein phosphatase; recept | 98.33 | |
| 4grz_A | 288 | Tyrosine-protein phosphatase non-receptor type 6; | 98.31 | |
| 2ooq_A | 286 | Receptor-type tyrosine-protein phosphatase T; prot | 98.3 | |
| 1zc0_A | 309 | Tyrosine-protein phosphatase, non-receptor type 7; | 98.3 | |
| 1wch_A | 315 | Protein tyrosine phosphatase, non-receptor type 13 | 98.29 | |
| 2gjt_A | 295 | Receptor-type tyrosine-protein phosphatase PTPro; | 98.28 | |
| 3i36_A | 342 | Vascular protein tyrosine phosphatase 1; PTP, hydr | 98.23 | |
| 1yfo_A | 302 | D1, receptor protein tyrosine phosphatase alpha; h | 98.2 | |
| 3f41_A | 629 | Phytase; tandem repeat, protein tyrosine phosphata | 98.19 | |
| 2cjz_A | 305 | Human protein tyrosine phosphatase PTPN5; protein | 98.18 | |
| 4i8n_A | 354 | Tyrosine-protein phosphatase non-receptor type 1; | 98.17 | |
| 2p6x_A | 309 | Tyrosine-protein phosphatase non-receptor type 22; | 98.17 | |
| 2b3o_A | 532 | Tyrosine-protein phosphatase, non-receptor type 6; | 98.14 | |
| 2h4v_A | 320 | Receptor-type tyrosine-protein phosphatase gamma; | 98.08 | |
| 1ygr_A | 610 | CD45 protein tyrosine phosphatase; protein tyrosin | 98.06 | |
| 1lar_A | 575 | Protein (LAR); tyrosine phosphatease, LAR protein, | 98.06 | |
| 3s3e_A | 307 | Tyrosine-protein phosphatase 10D; differentiation, | 98.06 | |
| 2jjd_A | 599 | Receptor-type tyrosine-protein phosphatase epsilo; | 98.05 | |
| 1lyv_A | 306 | Protein-tyrosine phosphatase YOPH; toxin, hydrolas | 98.0 | |
| 3gxh_A | 157 | Putative phosphatase (DUF442); YP_001181608.1, str | 97.96 | |
| 2shp_A | 525 | SHP-2, SYP, SHPTP-2; tyrosine phosphatase, insulin | 97.94 | |
| 1lar_A | 575 | Protein (LAR); tyrosine phosphatease, LAR protein, | 97.91 | |
| 4ge6_A | 314 | Tyrosine-protein phosphatase non-receptor type 9; | 97.91 | |
| 3ps5_A | 595 | Tyrosine-protein phosphatase non-receptor type 6; | 97.71 | |
| 1ygr_A | 610 | CD45 protein tyrosine phosphatase; protein tyrosin | 97.69 | |
| 2jjd_A | 599 | Receptor-type tyrosine-protein phosphatase epsilo; | 97.66 | |
| 2nlk_A | 627 | Protein tyrosine phosphatase, receptor type, G VA | 97.63 | |
| 1ywf_A | 296 | Phosphotyrosine protein phosphatase PTPB; four str | 97.52 | |
| 2nlk_A | 627 | Protein tyrosine phosphatase, receptor type, G VA | 97.47 | |
| 1ohe_A | 348 | CDC14B, CDC14B2 phosphatase; protein phosphatase, | 95.35 |
| >3n0a_A Tyrosine-protein phosphatase auxilin; phosphatase-like domain, C2 domain, hydrolase; 2.20A {Bos taurus} | Back alignment and structure |
|---|
Probab=100.00 E-value=2.6e-72 Score=643.35 Aligned_cols=330 Identities=19% Similarity=0.366 Sum_probs=281.5
Q ss_pred cccCCCCCeeeecCceEEeccCCCCCCcchHHhhcChHHHHHHHHHhCCCCcEEEEecCCCCccccccccccccCcEEee
Q 001080 8 FYRKPPDGLLEISERVFVFDCCFTTDILEEEEYKEYLGGIVGQLREYFPEASFMVFNFREGEHQSQIGQVLSEYDMTVMD 87 (1162)
Q Consensus 8 ~~~~~dlDLtyIT~RIiam~~~fP~~~~~e~~YRn~i~~V~~~L~~~h~~~~y~V~NL~~~~~~~~~~~~~s~f~~~v~~ 87 (1162)
.|.+.||||+|||+||||| +||++++ |+.|||+|++|++||+++|++| |+|||||++.|+ .++|+++|++
T Consensus 16 ~~~~~~LDltyIT~riIam--~~P~~~~-e~~yrn~i~~v~~~L~~~H~~~-y~V~NLse~~Yd------~~~f~~~V~~ 85 (361)
T 3n0a_A 16 SYTKGDLDFTYVTSRIIVM--SFPLDSV-DIGFRNQVDDIRSFLDSRHLDH-YTVYNLSPKSYR------TAKFHSRVSE 85 (361)
T ss_dssp EEESSSCEEEESSSSEEEE--EC-------------CHHHHHHHHHHHTTC-EEEEECSSSCCG------GGSCGGGEEE
T ss_pred HhcCCCccEEEEcCCEEEE--ECCCCCc-hhhhcCCHHHHHHHHHHhCCCe-EEEEECCCCCCC------hhhcCCcEEE
Confidence 4778899999999999999 7999998 9999999999999999999995 999999998775 3578899999
Q ss_pred CCCCCCCCCCCCHHHHHHHHHHHHHHHHhCCCcEEEEEecCCCCchHHHHHHHHHHHhcCCCCHHHHHHHHHHhCchhhh
Q 001080 88 YPRHYEGCPLLTMETVHHFLRSSESWLSLGHQNVLLMHCERGGWPVLAFMLAALLIYRKQFTGEQKTLDMIYKQAPRELL 167 (1162)
Q Consensus 88 ~P~~d~~~P~p~L~~l~~~~~~i~~wL~~d~~nVVvVHCkaG~GR~tG~~ia~yLly~~~~~~~~eAL~~~~~~~~~~~~ 167 (1162)
|+|.||++| +++.|++||+.|++||+++++|+|+|||+||+|| ||+||||||+|++.+.++++||++|+.+|...
T Consensus 86 ~~~pD~~~P--~l~~l~~~~~~i~~~l~~~~~~~v~VHC~aG~GR-tg~~ia~~Li~~~~~~~~~eAl~~~~~~R~~~-- 160 (361)
T 3n0a_A 86 CSWPIRQAP--SLHNLFAVCRNMYNWLLQNPKNVCVVHCLDGRAA-SSILVGAMFIFCNLYSTPGPAVRLLYAKRPGI-- 160 (361)
T ss_dssp CCCCSSSCC--CHHHHHHHHHHHHHHHHHCTTCEEEEEECSCTHH-HHHHHHHHHHHTTSCSSHHHHHHHHHHHSTTC--
T ss_pred eecCCCCCC--CHHHHHHHHHHHHHHHhcCCCCeEEEEeCCCCcc-HHHHHHHHHHHhcCCCCHHHHHHHHHHhCCCC--
Confidence 999999998 8999999999999999999999999999999999 99999999999999999999999997665432
Q ss_pred ccCCCCCCChHHHHHHHHHHHhhcCCCCCCCCCceeEEEEEEeeccccCCC-CcceeEEEEEecCCCcccCCCCcEEEec
Q 001080 168 QLMSPLNPLPSQLRYLQYVSRRNVGSEWPPLDRALTLDCVILRVIPNFDGE-GGCCPIFRIYGQDPLMVADRTPKVLFST 246 (1162)
Q Consensus 168 ~~~s~~~~~PSQ~RYv~Yf~~ll~~~~~pp~~~~l~L~~IiL~~iP~f~~~-~gcrP~~~Iy~~~~~~~~~~~~k~lyss 246 (1162)
..+|||+|||+||++++.+..+.|+.++|+|++|+|++||+|++. +||||||+||+++ +.||++
T Consensus 161 ------~~~psQ~ryv~yf~~ll~~~~~~P~~~~L~L~~i~l~~iP~f~~~~~GCrP~~~Iy~~~---------~~v~ss 225 (361)
T 3n0a_A 161 ------GLSPSHRRYLGYMCDLLADKPYRPHFKPLTIKSITVSPVPFFNKQRNGCRPYCDVLIGE---------TKIYTT 225 (361)
T ss_dssp ------CCCHHHHHHHHHHHHHHSSSCCCCCCCCEEEEEEEEESCCCCSTTSSEECEEEEEEETT---------EEEEEC
T ss_pred ------CCCHHHHHHHHHHHHHHhcCCcCCCCceeEEEEEEEecCCcccCCCCCcceEEEEEeCC---------eEEEec
Confidence 169999999999999999877888899999999999999999974 8999999999975 689999
Q ss_pred ccccccceeecccCceEEEEccCCcccCcEEEEEEeCCCcc-------ccCceEEEEEeecccccCC--EEEeccCCccc
Q 001080 247 PKRSKLVRHYKQADCELVKIDIHCHIQGDVVLECISLDSDQ-------EREEMMFRVMFNTAFIRSN--ILMLNRDEIDI 317 (1162)
Q Consensus 247 ~~~~~~~r~y~~~d~~~i~~~i~~~v~GDV~I~~~h~~~~~-------~~~~~mFr~~FnT~FI~~n--~L~l~k~eLD~ 317 (1162)
.+.++.++.|.++++. |.|++++.|+|||+|+|||++... .++++||||||||+||++| +|+|+|+|||.
T Consensus 226 ~~~~~~~r~~~~~~~~-i~i~~~~~l~GDV~v~~~h~~~~~g~~l~~k~~~~~mFr~~FhT~FI~~~~~~l~~~k~eLD~ 304 (361)
T 3n0a_A 226 CADFERMKEYRVQDGK-IFIPLSITVQGDVVVSMYHLRSTIGSRLQAKVTNTQIFQLQFHTGFIPLDTTVLKFTKPELDA 304 (361)
T ss_dssp CCCGGGSCCEEGGGCC-EEEEEEEEECSEEEEEEEEEEEEECTTSCEEEEEEEEEEEEEEGGGSCTTCCEEEEEGGGCBS
T ss_pred CchhhccccccccCce-EEeCCCCeEECCEEEEEEeCCCccccccccccccceEEEEEeeeeEeeCCceEEEeEhhhccc
Confidence 8888889999888865 679999999999999999986422 3468999999999999977 89999999998
Q ss_pred cccCCCCCCCCcEEEEEEeccCCCCcC-cccCCCCCcccCCCCHHHHHHHHHh
Q 001080 318 LWNSKDLFSKEFRAEVLFSEMDAATSL-VSVDLPGIEEKDGLPIEAFAKVQEI 369 (1162)
Q Consensus 318 ~~~~k~~fp~dF~Vel~F~~~~~~~~~-~~~~~~~~~~~~~l~~e~~~~~~~i 369 (1162)
+ +.++|||+||+|||.|+........ .+..+...+.|+..++..|+..+|.
T Consensus 305 ~-~~~~rfp~~f~v~l~f~~~~~~r~~~~~~~w~~~~~~~~~~~~~fs~~~e~ 356 (361)
T 3n0a_A 305 C-DVPEKYPQLFQVTLDVELQPHDKVMELTPPWEHYCTKDVNPSILFSSHQEH 356 (361)
T ss_dssp C-CCGGGSCTTCEEEEEEEECSSCCCCSSCCGGGGCCCTTCCGGGGCSSHHHH
T ss_pred c-cccccCCCCeEEEEEEEecCCCCCCCCCCCcccCCccCCCchhhcCCHHHh
Confidence 4 4678999999999999887666533 3334777778887788888777664
|
| >3v0d_A Voltage-sensor containing phosphatase; PTP, hydrolase; HET: PO4; 1.10A {Ciona intestinalis} PDB: 3v0f_A* 3v0g_A 3v0h_A* 3awf_A 3v0j_A 3awe_A 3awg_A 3v0e_A 3v0i_A | Back alignment and structure |
|---|
| >1d5r_A Phosphoinositide phosphotase PTEN; C2 domain, phosphotidylinositol, hydrolase; HET: TLA; 2.10A {Homo sapiens} SCOP: b.7.1.1 c.45.1.1 | Back alignment and structure |
|---|
| >4eah_A Formin-like protein 3, actin, alpha skeletal muscle; ATP binding, cytoskeleton, FMNL3, protein BIN; HET: ATP; 3.40A {Mus musculus} | Back alignment and structure |
|---|
| >2j1d_G DAAM1, disheveled-associated activator of morphogenesis; actin assembly, protein binding; 2.55A {Homo sapiens} PDB: 2z6e_A | Back alignment and structure |
|---|
| >3obv_E Protein diaphanous homolog 1; autoinhibition, actin, nucleation, cytoskeleton, structural; HET: SUC; 2.75A {Mus musculus} PDB: 3o4x_E 2bap_D | Back alignment and structure |
|---|
| >1ux5_A BNI1 protein; structural protein, FH2 actin cytoskeleton; 2.5A {Saccharomyces cerevisiae} SCOP: a.207.1.1 PDB: 1y64_B* 1ux4_A | Back alignment and structure |
|---|
| >1v9d_A Diaphanous protein homolog 1; helix bundle, protein binding; 2.60A {Mus musculus} SCOP: a.207.1.1 | Back alignment and structure |
|---|
| >2c46_A MRNA capping enzyme; phosphatase, transferase, hydrolase, mRNA processing, multifunctional enzyme, nucleotidyltransferase; 1.6A {Homo sapiens} PDB: 1i9s_A 1i9t_A | Back alignment and structure |
|---|
| >3rz2_A Protein tyrosine phosphatase type IVA 1; tyrosine phosphatase, dual specific phosphatase, COMP with peptide, hydrolase; 2.80A {Rattus norvegicus} PDB: 1x24_A 1zcl_A | Back alignment and structure |
|---|
| >1yn9_A BVP, polynucleotide 5'-phosphatase; RNA triphosphatase, cysteine phosphatase, P-loop, hydrolase; HET: PO4; 1.50A {Autographa californicanucleopolyhedrovirus} | Back alignment and structure |
|---|
| >2img_A Dual specificity protein phosphatase 23; DUSP23, VHZ, LDP-3, dual specicity protein phosphatase 23, DUS23_human, malate, structural genomics, PSI; 1.93A {Homo sapiens} | Back alignment and structure |
|---|
| >4erc_A Dual specificity protein phosphatase 23; alpha beta, phosphatase(hydrolase), hydrolase; 1.15A {Homo sapiens} PDB: 2img_A | Back alignment and structure |
|---|
| >1fpz_A Cyclin-dependent kinase inhibitor 3; alpha-beta sandwich, hydrolase; 2.00A {Homo sapiens} SCOP: c.45.1.1 PDB: 1fq1_A* | Back alignment and structure |
|---|
| >1ohe_A CDC14B, CDC14B2 phosphatase; protein phosphatase, cell cycle, hydrolase; HET: SEP; 2.20A {Homo sapiens} SCOP: c.45.1.1 c.45.1.1 PDB: 1ohc_A 1ohd_A | Back alignment and structure |
|---|
| >3s4o_A Protein tyrosine phosphatase-like protein; structural genomics, medical structural genomics of pathogen protozoa, MSGPP, unknown function; HET: MSE EPE; 2.30A {Leishmania major} | Back alignment and structure |
|---|
| >1rxd_A Protein tyrosine phosphatase type IVA, member 1; protein tyrosine phosphatase IVA1...; structural genomics, NYSGXRC, unknown function, PSI; 1.90A {Homo sapiens} SCOP: c.45.1.1 PDB: 1xm2_A 1zck_A 1r6h_A 1v3a_A | Back alignment and structure |
|---|
| >3rgo_A Protein-tyrosine phosphatase mitochondrial 1; phosphatidylglycerol phosphate (PGP) phosphatase, hydrolase; 1.93A {Mus musculus} PDB: 3rgq_A* | Back alignment and structure |
|---|
| >2i6j_A Ssoptp, sulfolobus solfataricus protein tyrosine phosphatase; PTP domain, hydrolase; 1.66A {Sulfolobus solfataricus} PDB: 2i6i_A 2i6m_A 3ro1_A* 2i6o_A* 2dxp_A* 2i6p_A* | Back alignment and structure |
|---|
| >2y96_A Dual specificity phosphatase DUPD1; hydrolase; 2.38A {Homo sapiens} | Back alignment and structure |
|---|
| >1zzw_A Dual specificity protein phosphatase 10; MKP, PTP, hydrolase; 1.60A {Homo sapiens} | Back alignment and structure |
|---|
| >3ezz_A Dual specificity protein phosphatase 4; alpha/beta, hydrolase, nucleus; 2.90A {Homo sapiens} SCOP: c.45.1.1 PDB: 1m3g_A | Back alignment and structure |
|---|
| >2hcm_A Dual specificity protein phosphatase; structural genomics, PSI, protein structure INI NEW YORK SGX research center for structural genomics; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >2wgp_A Dual specificity protein phosphatase 14; MKP6, DUSP14, hydrolase, dual specifici phosphatase; 1.88A {Homo sapiens} | Back alignment and structure |
|---|
| >3f81_A Dual specificity protein phosphatase 3; hydrolase, protein dual-specificity phosphatase, inhibitor; HET: STT; 1.90A {Homo sapiens} SCOP: c.45.1.1 PDB: 1vhr_A* 1j4x_A* | Back alignment and structure |
|---|
| >2g6z_A Dual specificity protein phosphatase 5; alpha/beta, hydrolase; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >1xri_A AT1G05000; structural genomics, protein structure initiative, CESG for eukaryotic structural genomics, phosphoprote phosphatase; 3.30A {Arabidopsis thaliana} SCOP: c.45.1.1 PDB: 2q47_A | Back alignment and structure |
|---|
| >2oud_A Dual specificity protein phosphatase 10; A central five-stranded B-sheet, hydrolase; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2esb_A Dual specificity protein phosphatase 18; alpha/beta structure, hydrolase; HET: EPE; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2e0t_A Dual specificity phosphatase 26; conserved hypothetical protein, structural genomics, NPPSFA, project on protein structural and functional analyses; 1.67A {Homo sapiens} | Back alignment and structure |
|---|
| >1wrm_A Dual specificity phosphatase 22; DSP, JNK, hydrolase; HET: MES; 1.50A {Homo sapiens} | Back alignment and structure |
|---|
| >3emu_A Leucine rich repeat and phosphatase domain containing protein; structural genomics, hydrolase, PSI-2, protein structure initiative; 2.30A {Entamoeba histolytica} | Back alignment and structure |
|---|
| >3s4e_A Dual specificity protein phosphatase 19; PTP, protein tyrosine phosphatase, hydrolase; 1.26A {Homo sapiens} | Back alignment and structure |
|---|
| >1yz4_A DUSP15, dual specificity phosphatase-like 15 isoform A; hydrolase; HET: BOG; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >2hxp_A Dual specificity protein phosphatase 9; human phosphatase, structural genomics, PSI-2, protein structure initiative; 1.83A {Homo sapiens} PDB: 3lj8_A 1mkp_A | Back alignment and structure |
|---|
| >2nt2_A Protein phosphatase slingshot homolog 2; alpha/beta hydrolase; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2r0b_A Serine/threonine/tyrosine-interacting protein; structural genomics, phosphatase, PSI-2, protein structure initiative; 1.60A {Homo sapiens} | Back alignment and structure |
|---|
| >3cm3_A Late protein H1, dual specificity protein phosphatase; dual-specificity phosphatase, VH1, hydrolase; 1.32A {Vaccinia virus} PDB: 2rf6_A 2p4d_A | Back alignment and structure |
|---|
| >3nme_A Ptpkis1 protein, SEX4 glucan phosphatase; dual specificity phosphatase, carbohydrate BIND hydrolase; 2.40A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2q05_A Late protein H1, dual specificity protein phosphatase; structural genomics, APC7320, P protein structure initiative; HET: MSE; 2.57A {Vaccinia virus WR} | Back alignment and structure |
|---|
| >2pq5_A Dual specificity protein phosphatase 13; hydrolase, dual specificity phosphatase, DUSP13, testis and skeletal muscle specific DSP; 2.30A {Homo sapiens} PDB: 2gwo_A | Back alignment and structure |
|---|
| >1g4w_R Protein tyrosine phosphatase SPTP; virulence factor, GTPase activating protein, 4-helix bundle, disorder, signaling protein; 2.20A {Salmonella typhimurium} SCOP: a.24.11.1 c.45.1.2 PDB: 1g4u_S | Back alignment and structure |
|---|
| >1p15_A Protein-tyrosine phosphatase alpha; transmembrane, hydrolase, phosphorylation; 2.00A {Mus musculus} SCOP: c.45.1.2 | Back alignment and structure |
|---|
| >3mmj_A MYO-inositol hexaphosphate phosphohydrolase; phytase, protein tyrosine phosphatase, inositol phosphate, I phosphatase; HET: IHP; 1.60A {Selenomonas ruminantium} SCOP: c.45.1.4 PDB: 1u24_A 1u25_A* 1u26_A* 3o3l_A* 3moz_A* 2pt0_A 2psz_A 3d1h_A 3d1o_A 3d1q_A 2b4u_A 2b4p_A 2b4o_A | Back alignment and structure |
|---|
| >1fpr_A Protein-tyrosine phosphatase 1C; protein tyrosine phosphatase, substrate specificity, residue shift, signaling protein; HET: PTR; 2.50A {Homo sapiens} SCOP: c.45.1.2 PDB: 1gwz_A | Back alignment and structure |
|---|
| >2hc1_A Receptor-type tyrosine-protein phosphatase beta; protein tyrosine phosphatase, WPD-loop, sulfamic acid, inhibitor, drug design, hydrolase; 1.30A {Homo sapiens} PDB: 2h03_A 2hc2_A 2i4g_A* 2h04_A* 2h02_A 2i3u_A 2i3r_A 2i4e_A* 2i4h_A* 2i5x_A* 2ahs_A | Back alignment and structure |
|---|
| >2f46_A Hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, hydrolase; HET: MSE; 1.41A {Neisseria meningitidis Z2491} | Back alignment and structure |
|---|
| >2b49_A Protein tyrosine phosphatase, non-receptor type 3; human, STRU genomics, structural genomics consortium, SGC, hydrolase; 1.54A {Homo sapiens} | Back alignment and structure |
|---|
| >2i75_A Tyrosine-protein phosphatase non-receptor type 4; PTPN4, PTP, tyrosine phosphatase, MEG-1, structural genomics structural genomics consortium, SGC; 2.45A {Homo sapiens} | Back alignment and structure |
|---|
| >3m4u_A Tyrosine specific protein phosphatase, putative; protein tyrosine phosphatase, hydrolase; 2.39A {Trypanosoma brucei} | Back alignment and structure |
|---|
| >1jln_A STEP-like ptpase, protein tyrosine phosphatase, receptor type, R; PTP-SL, PTPBR7, ERK2-MAP kinase regulation, hydrolase; 1.81A {Mus musculus} SCOP: c.45.1.2 PDB: 2a8b_A | Back alignment and structure |
|---|
| >2cm2_A Tyrosine-protein phosphatase non-receptor type 1; polymorphism, phosphorylation, endoplasmic reticulum, oxidation, hydrolase, acetylation; 1.5A {Homo sapiens} SCOP: c.45.1.2 PDB: 2cm3_A 2cmb_A* 2cmc_A* 2cne_A* 3a5j_A 2cma_A 3a5k_A 3eu0_A 3sme_A 2azr_A* 2b07_A* 2h4g_A* 2h4k_A* 2hb1_A* 2qbp_A* 2qbq_A* 2qbr_A* 2qbs_A* 2zmm_A* 2zn7_A* ... | Back alignment and structure |
|---|
| >2bzl_A Tyrosine-protein phosphatase, non-receptor type 14; PTPN14, hydrolase; 1.65A {Homo sapiens} | Back alignment and structure |
|---|
| >4az1_A Tyrosine specific protein phosphatase; hydrolase, drug design; 2.18A {Trypanosoma cruzi} | Back alignment and structure |
|---|
| >3f41_A Phytase; tandem repeat, protein tyrosine phosphatase, inositol phosphatase, hydrolase; 2.30A {Mitsuokella multacida} | Back alignment and structure |
|---|
| >3b7o_A Tyrosine-protein phosphatase non-receptor type 11; SHP2, PTPN11, tyrosine phosphatase, structural genomics, STR genomics consortium, SGC, deafness; 1.60A {Homo sapiens} PDB: 3jrl_A* 3mow_A* 3o5x_A* | Back alignment and structure |
|---|
| >1l8k_A T-cell protein-tyrosine phosphatase; hydrolase; 2.56A {Homo sapiens} SCOP: c.45.1.2 | Back alignment and structure |
|---|
| >2oc3_A Tyrosine-protein phosphatase non-receptor type 18; protein tyrosine phosphatase, human, structural genomics, structural genomics consortium, SGC; 1.50A {Homo sapiens} | Back alignment and structure |
|---|
| >2i1y_A Receptor-type tyrosine-protein phosphatase; receptor-type protein tyrosine phosphatase precursor, phosph structural genomics, PSI; 2.23A {Homo sapiens} PDB: 2qep_A | Back alignment and structure |
|---|
| >4grz_A Tyrosine-protein phosphatase non-receptor type 6; phosphatase domain, hydrolase; 1.37A {Homo sapiens} PDB: 4gry_A 4gs0_A* 1gwz_A 1fpr_A* | Back alignment and structure |
|---|
| >2ooq_A Receptor-type tyrosine-protein phosphatase T; protein tyrosine phosphatase, human, structural GE structural genomics consortium, SGC, hydrolase; HET: B3P; 1.80A {Homo sapiens} PDB: 1rpm_A 2c7s_A | Back alignment and structure |
|---|
| >1zc0_A Tyrosine-protein phosphatase, non-receptor type 7; heptp, human tyrosine phosphatase catalytic domain, LC-PTP, hydrolase; 1.85A {Homo sapiens} PDB: 2gp0_A 2qdc_A 2hvl_A 2qdp_A 2qdm_A 3o4s_A 3o4t_A* 3o4u_A* 3d44_A* 3d42_A* 2a3k_A | Back alignment and structure |
|---|
| >1wch_A Protein tyrosine phosphatase, non-receptor type 13; hydrolase, phosphate ION, colorectal cancer alternative splicing, coiled coil, cytoskeleton; 1.85A {Homo sapiens} SCOP: c.45.1.2 | Back alignment and structure |
|---|
| >2gjt_A Receptor-type tyrosine-protein phosphatase PTPro; tyrosine phosphatase, glepp1, PTPU2, structural genom structural genomics consortium, SGC; 2.15A {Homo sapiens} PDB: 2g59_A 2pi7_A | Back alignment and structure |
|---|
| >3i36_A Vascular protein tyrosine phosphatase 1; PTP, hydrolase; 1.84A {Rattus norvegicus} PDB: 2nz6_A 2cfv_A | Back alignment and structure |
|---|
| >1yfo_A D1, receptor protein tyrosine phosphatase alpha; hydrolase, signal transduction, glycoprotein, phosphorylation, signal; 2.25A {Mus musculus} SCOP: c.45.1.2 | Back alignment and structure |
|---|
| >3f41_A Phytase; tandem repeat, protein tyrosine phosphatase, inositol phosphatase, hydrolase; 2.30A {Mitsuokella multacida} | Back alignment and structure |
|---|
| >2cjz_A Human protein tyrosine phosphatase PTPN5; protein phosphatase, STEP, hydrolase; HET: PTR; 1.70A {Homo sapiens} PDB: 2bij_A 2bv5_A* | Back alignment and structure |
|---|
| >4i8n_A Tyrosine-protein phosphatase non-receptor type 1; PTP1B, hydrolase-hydrolase inhibitor CO; HET: 1CG; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >2p6x_A Tyrosine-protein phosphatase non-receptor type 22; tyrosine phosphatase, lymphoid phosphatase, PEP, LYP, struct genomics; 1.90A {Homo sapiens} PDB: 3h2x_A 3brh_A 2qct_A* 2qcj_A* 3olr_A* 3omh_A* | Back alignment and structure |
|---|
| >2b3o_A Tyrosine-protein phosphatase, non-receptor type 6; protein tyrosine phosphatase, SHP-1, signaling, hydrolase; 2.80A {Homo sapiens} PDB: 1x6c_A 2rmx_A* 2yu7_A* | Back alignment and structure |
|---|
| >2h4v_A Receptor-type tyrosine-protein phosphatase gamma; tyrosine receptor phosphatase, human, structural GENO structural genomics consortium, SGC; HET: FLC; 1.55A {Homo sapiens} PDB: 3qcd_A 3qcc_A 3qcb_A 3qce_A* 3qcf_A* 3qcg_A* 3qch_A* 3qci_A* 3qcj_A* 3qck_A* 2pbn_A 2hy3_A 3qcm_A* 3qcl_A* 3qcn_A | Back alignment and structure |
|---|
| >1ygr_A CD45 protein tyrosine phosphatase; protein tyrosine phosphatase, RPTP, LCA, lymphocyte activation, hydrolase; HET: PTR; 2.90A {Homo sapiens} PDB: 1ygu_A* | Back alignment and structure |
|---|
| >1lar_A Protein (LAR); tyrosine phosphatease, LAR protein, hydrolase; 2.00A {Homo sapiens} SCOP: c.45.1.2 c.45.1.2 PDB: 2fh7_A 2nv5_A | Back alignment and structure |
|---|
| >3s3e_A Tyrosine-protein phosphatase 10D; differentiation, neurogenesis, signal transduction, developm protein, hydrolase; 2.40A {Drosophila melanogaster} PDB: 3s3f_A 3s3h_A* 3s3k_A* | Back alignment and structure |
|---|
| >2jjd_A Receptor-type tyrosine-protein phosphatase epsilo; transmembrane, phosphoprotein, consorti structural, glycoprotein, SGC, PTPRE, membrane genomics; 3.20A {Homo sapiens} | Back alignment and structure |
|---|
| >1lyv_A Protein-tyrosine phosphatase YOPH; toxin, hydrolase; 1.36A {Yersinia enterocolitica} SCOP: c.45.1.2 PDB: 1qz0_A* 1ytn_A 1ytw_A 2i42_A 2y2f_A* 2ydu_A* 1xxp_A* 3blu_A* 1ypt_A* 3blt_A* 1xxv_A* 3f9b_A 3f9a_A 3f99_A 3bm8_A* 1pa9_A* 1yts_A | Back alignment and structure |
|---|
| >3gxh_A Putative phosphatase (DUF442); YP_001181608.1, structural GE joint center for structural genomics, JCSG; HET: MSE; 1.40A {Shewanella putrefaciens cn-32} PDB: 3gxg_A* | Back alignment and structure |
|---|
| >2shp_A SHP-2, SYP, SHPTP-2; tyrosine phosphatase, insulin signaling, SH2 protein; HET: CAT; 2.00A {Homo sapiens} SCOP: c.45.1.2 d.93.1.1 d.93.1.1 | Back alignment and structure |
|---|
| >1lar_A Protein (LAR); tyrosine phosphatease, LAR protein, hydrolase; 2.00A {Homo sapiens} SCOP: c.45.1.2 c.45.1.2 PDB: 2fh7_A 2nv5_A | Back alignment and structure |
|---|
| >4ge6_A Tyrosine-protein phosphatase non-receptor type 9; hydrolase-hydrolase inhibitor complex; HET: B26; 1.40A {Homo sapiens} PDB: 4ge2_A* 4ge5_A* 2pa5_A* | Back alignment and structure |
|---|
| >3ps5_A Tyrosine-protein phosphatase non-receptor type 6; SH2, PTP, hydrolase, signaling protein; 3.10A {Homo sapiens} | Back alignment and structure |
|---|
| >1ygr_A CD45 protein tyrosine phosphatase; protein tyrosine phosphatase, RPTP, LCA, lymphocyte activation, hydrolase; HET: PTR; 2.90A {Homo sapiens} PDB: 1ygu_A* | Back alignment and structure |
|---|
| >2jjd_A Receptor-type tyrosine-protein phosphatase epsilo; transmembrane, phosphoprotein, consorti structural, glycoprotein, SGC, PTPRE, membrane genomics; 3.20A {Homo sapiens} | Back alignment and structure |
|---|
| >2nlk_A Protein tyrosine phosphatase, receptor type, G VA (fragment); PTPRG, R-PTP gamma, protein tyrosine phosphatase gamma, D3S1 HPTPG, RPTPG, PTPG; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >1ywf_A Phosphotyrosine protein phosphatase PTPB; four stranded parallel beta sheet with flanking helices, structural genomics, PSI; 1.71A {Mycobacterium tuberculosis} SCOP: c.45.1.5 PDB: 2oz5_A* | Back alignment and structure |
|---|
| >2nlk_A Protein tyrosine phosphatase, receptor type, G VA (fragment); PTPRG, R-PTP gamma, protein tyrosine phosphatase gamma, D3S1 HPTPG, RPTPG, PTPG; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >1ohe_A CDC14B, CDC14B2 phosphatase; protein phosphatase, cell cycle, hydrolase; HET: SEP; 2.20A {Homo sapiens} SCOP: c.45.1.1 c.45.1.1 PDB: 1ohc_A 1ohd_A | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 1162 | ||||
| d1v9da_ | 332 | a.207.1.1 (A:) Diaphanous protein homolog 1, dia1 | 7e-38 | |
| d1d5ra1 | 141 | b.7.1.1 (A:188-351) Pten tumor suppressor (Phoshph | 2e-35 | |
| d1ux5a_ | 411 | a.207.1.1 (A:) Bni1 {Baker's yeast (Saccharomyces | 1e-34 | |
| d1d5ra2 | 174 | c.45.1.1 (A:14-187) Phoshphoinositide phosphatase | 2e-20 |
| >d1v9da_ a.207.1.1 (A:) Diaphanous protein homolog 1, dia1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 332 | Back information, alignment and structure |
|---|
class: All alpha proteins fold: Formin homology 2 domain (FH2 domain) superfamily: Formin homology 2 domain (FH2 domain) family: Formin homology 2 domain (FH2 domain) domain: Diaphanous protein homolog 1, dia1 species: Mouse (Mus musculus) [TaxId: 10090]
Score = 142 bits (360), Expect = 7e-38
Identities = 31/118 (26%), Positives = 65/118 (55%)
Query: 1041 VQLIELRRANNCEIMLTKVKIPLPDLMGSVLALDDSALDIDQVDNLIKFCPTKEEMEVLK 1100
+++++ + A N I L ++P ++ +L ++++ L + NLIK P E++++L
Sbjct: 4 LKVLDSKTAQNLSIFLGSFRMPYQEIKNVILEVNEAVLTESMIQNLIKQMPEPEQLKMLS 63
Query: 1101 NYNGDKGNLGKCEQFFLELMKVPRVESKLRVFSFKIQFQTQVSDLRTSLNIINSASEE 1158
+ +L + EQF + + VPR+ +L FK+QF QV +++ + + +A EE
Sbjct: 64 ELKEEYDDLAESEQFGVVMGTVPRLRPRLNAILFKLQFSEQVENIKPEIVSVTAACEE 121
|
| >d1d5ra1 b.7.1.1 (A:188-351) Pten tumor suppressor (Phoshphoinositide phosphatase), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 141 | Back information, alignment and structure |
|---|
| >d1ux5a_ a.207.1.1 (A:) Bni1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 411 | Back information, alignment and structure |
|---|
| >d1d5ra2 c.45.1.1 (A:14-187) Phoshphoinositide phosphatase Pten (Pten tumor suppressor), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 174 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 1162 | |||
| d1d5ra2 | 174 | Phoshphoinositide phosphatase Pten (Pten tumor sup | 100.0 | |
| d1d5ra1 | 141 | Pten tumor suppressor (Phoshphoinositide phosphata | 99.96 | |
| d1ux5a_ | 411 | Bni1 {Baker's yeast (Saccharomyces cerevisiae) [Ta | 99.93 | |
| d1fpza_ | 176 | Kinase associated phosphatase (kap) {Human (Homo s | 99.89 | |
| d1v9da_ | 332 | Diaphanous protein homolog 1, dia1 {Mouse (Mus mus | 99.86 | |
| d1i9sa_ | 194 | mRNA capping enzyme, triphosphatase domain {Mouse | 99.84 | |
| d1ohea2 | 182 | Proline directed phosphatase CDC14b2 {Human (Homo | 99.83 | |
| d1rxda_ | 152 | Protein tyrosine phosphatase type IVa {Human (Homo | 99.8 | |
| d1mkpa_ | 144 | Mapk phosphatase {Human (Homo sapiens), pyst1 (mkp | 99.28 | |
| d1vhra_ | 178 | VH1-related dual-specificity phosphatase, VHR {Hum | 99.14 | |
| d1xria_ | 151 | Putative phosphatase At1g05000 {Thale cress (Arabi | 98.94 | |
| d1m3ga_ | 145 | Mapk phosphatase {Human (Homo sapiens), pac-1 [Tax | 98.91 | |
| d2pt0a1 | 313 | Myo-inositol hexaphosphate phosphohydrolase (phyta | 98.49 | |
| d1g4us2 | 243 | SptP tyrosine phosphatase, catalytic domain {Salmo | 98.4 | |
| d1jlna_ | 297 | Tyrosine phosphatase {Mouse (Mus musculus), ptp-sl | 97.93 | |
| d1l8ka_ | 273 | Tyrosine phosphatase {Human (Homo sapiens), T-cell | 97.9 | |
| d1wcha_ | 308 | Tyrosine-protein phosphatase, non-receptor type 13 | 97.86 | |
| d2shpa1 | 307 | Tyrosine phosphatase {Human (Homo sapiens), shp-2 | 97.85 | |
| d1yfoa_ | 288 | Tyrosine phosphatase {Mouse (Mus musculus) [TaxId: | 97.75 | |
| d1lara1 | 317 | RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} | 97.75 | |
| d1rpma_ | 278 | Tyrosine phosphatase {Human (Homo sapiens), mu [Ta | 97.73 | |
| d1p15a_ | 245 | Protein-tyrosine phosphatase alpha {Mouse (Mus mus | 97.68 | |
| d1lara2 | 249 | RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} | 97.67 | |
| d1lyva_ | 283 | Protein-tyrosine phosphatase YopH, catalytic domai | 97.67 | |
| d2f71a1 | 297 | Tyrosine phosphatase {Human (Homo sapiens), 1B [Ta | 97.63 | |
| d1fpra_ | 284 | Tyrosine phosphatase {Human (Homo sapiens), shp-1 | 97.61 | |
| d1ohea1 | 157 | Proline directed phosphatase CDC14b2 {Human (Homo | 94.3 | |
| d1ywfa1 | 272 | Phosphotyrosine protein phosphatase PtpB {Mycobact | 93.77 |
| >d1d5ra2 c.45.1.1 (A:14-187) Phoshphoinositide phosphatase Pten (Pten tumor suppressor), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: (Phosphotyrosine protein) phosphatases II superfamily: (Phosphotyrosine protein) phosphatases II family: Dual specificity phosphatase-like domain: Phoshphoinositide phosphatase Pten (Pten tumor suppressor), N-terminal domain species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00 E-value=4.6e-39 Score=333.02 Aligned_cols=172 Identities=23% Similarity=0.387 Sum_probs=154.6
Q ss_pred hhhcccCCCCCeeeecCceEEeccCCCCCCcchHHhhcChHHHHHHHHHhCCCCcEEEEecCCCCccccccccccccCcE
Q 001080 5 RKFFYRKPPDGLLEISERVFVFDCCFTTDILEEEEYKEYLGGIVGQLREYFPEASFMVFNFREGEHQSQIGQVLSEYDMT 84 (1162)
Q Consensus 5 rr~~~~~~dlDLtyIT~RIiam~~~fP~~~~~e~~YRn~i~~V~~~L~~~h~~~~y~V~NL~~~~~~~~~~~~~s~f~~~ 84 (1162)
|||+++||||||||||+||||| +||++.. |..|||++++|+++|+++|+++ |+||||++++.+. ..+|+.+
T Consensus 1 ~~~~~~~~~lDlt~It~riiv~--~~P~~~~-e~~~~~~i~~v~~~l~~~~~~~-~~v~nl~~~~~y~-----~~~~~~~ 71 (174)
T d1d5ra2 1 RRYQEDGFDLDLTYIYPNIIAM--GFPAERL-EGVYRNNIDDVVRFLDSKHKNH-YKIYNLCAERHYD-----TAKFNCR 71 (174)
T ss_dssp CCCCBTTTTBSEEEEETTEEEE--CCCBSSC-CTTCCCBHHHHHHHHHHHSSSC-EEEEEEESSCCCC-----TTSCSSC
T ss_pred CCcccCCcccceeEEeCCEEEE--eCCCCCc-HHhhcCCHHHHHHHHHhccCCc-EEEEecccCCCCC-----hHHcCCe
Confidence 8999999999999999999999 7999988 8899999999999999999995 9999998765432 3578999
Q ss_pred EeeCCCCCCCCCCCCHHHHHHHHHHHHHHHHhCCCcEEEEEecCCCCchHHHHHHHHHHHhcCCCCHHHHHHHHHHhCch
Q 001080 85 VMDYPRHYEGCPLLTMETVHHFLRSSESWLSLGHQNVLLMHCERGGWPVLAFMLAALLIYRKQFTGEQKTLDMIYKQAPR 164 (1162)
Q Consensus 85 v~~~P~~d~~~P~p~L~~l~~~~~~i~~wL~~d~~nVVvVHCkaG~GR~tG~~ia~yLly~~~~~~~~eAL~~~~~~~~~ 164 (1162)
+++++|.|+++| +++.|+.||+.|++|++.+.+|+|+|||++|+|| ||+++||||++++.+.++++||++|..+|..
T Consensus 72 ~~~~~~~d~~~P--s~~~i~~~~~~~~~~~~~~~~~~v~VHC~~G~gR-Sg~~~~ayL~~~~~~~~~~~al~~~~~~R~~ 148 (174)
T d1d5ra2 72 VAQYPFEDHNPP--QLELIKPFCEDLDQWLSEDDNHVAAIHCKAGKGR-TGVMICAYLLHRGKFLKAQEALDFYGEVRTR 148 (174)
T ss_dssp EEEEEECTTSCC--CHHHHHHHHHHHHHHHTTTSCSEEEEECSSSSHH-HHHHHHHHHHHHTSCSSHHHHHHHHHHHHCS
T ss_pred EEEeCCCCCCCc--CHHHHHHHHHHHHHHhccCCCCEEEEEeCCCcch-hHHHHHHHHHHHcCCCCHHHHHHHHHHHhCC
Confidence 999999999987 9999999999999999999999999999999999 9999999999999988999999999654422
Q ss_pred hhhccCCCCCCChHHHHHHHHHHHhhcCC
Q 001080 165 ELLQLMSPLNPLPSQLRYLQYVSRRNVGS 193 (1162)
Q Consensus 165 ~~~~~~s~~~~~PSQ~RYv~Yf~~ll~~~ 193 (1162)
+. .++ .+|||+|||+||+++|++.
T Consensus 149 ~~-~~v----~~psQ~ryl~yf~~~L~~~ 172 (174)
T d1d5ra2 149 DK-KGV----TIPSQRRYVYYYSYLLKNH 172 (174)
T ss_dssp SS-CSS----CSHHHHHHHHHHHHHHHHT
T ss_pred CC-CCC----CCHHHHHHHHHHHHHHHhh
Confidence 21 233 8999999999999998763
|
| >d1d5ra1 b.7.1.1 (A:188-351) Pten tumor suppressor (Phoshphoinositide phosphatase), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ux5a_ a.207.1.1 (A:) Bni1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1fpza_ c.45.1.1 (A:) Kinase associated phosphatase (kap) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v9da_ a.207.1.1 (A:) Diaphanous protein homolog 1, dia1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1i9sa_ c.45.1.1 (A:) mRNA capping enzyme, triphosphatase domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ohea2 c.45.1.1 (A:199-380) Proline directed phosphatase CDC14b2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rxda_ c.45.1.1 (A:) Protein tyrosine phosphatase type IVa {Human (Homo sapiens), pr-1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1mkpa_ c.45.1.1 (A:) Mapk phosphatase {Human (Homo sapiens), pyst1 (mkp3) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vhra_ c.45.1.1 (A:) VH1-related dual-specificity phosphatase, VHR {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xria_ c.45.1.1 (A:) Putative phosphatase At1g05000 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1m3ga_ c.45.1.1 (A:) Mapk phosphatase {Human (Homo sapiens), pac-1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2pt0a1 c.45.1.4 (A:34-346) Myo-inositol hexaphosphate phosphohydrolase (phytase) PhyA {Selenomonas ruminantium [TaxId: 971]} | Back information, alignment and structure |
|---|
| >d1g4us2 c.45.1.2 (S:297-539) SptP tyrosine phosphatase, catalytic domain {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1jlna_ c.45.1.2 (A:) Tyrosine phosphatase {Mouse (Mus musculus), ptp-sl/br7 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1l8ka_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), T-cell [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wcha_ c.45.1.2 (A:) Tyrosine-protein phosphatase, non-receptor type 13 (PTPL1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2shpa1 c.45.1.2 (A:219-525) Tyrosine phosphatase {Human (Homo sapiens), shp-2 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1yfoa_ c.45.1.2 (A:) Tyrosine phosphatase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1lara1 c.45.1.2 (A:1307-1623) RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rpma_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), mu [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1p15a_ c.45.1.2 (A:) Protein-tyrosine phosphatase alpha {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1lara2 c.45.1.2 (A:1628-1876) RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lyva_ c.45.1.2 (A:) Protein-tyrosine phosphatase YopH, catalytic domain {Yersinia enterocolitica [TaxId: 630]} | Back information, alignment and structure |
|---|
| >d2f71a1 c.45.1.2 (A:2-298) Tyrosine phosphatase {Human (Homo sapiens), 1B [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fpra_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), shp-1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ohea1 c.45.1.1 (A:42-198) Proline directed phosphatase CDC14b2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ywfa1 c.45.1.5 (A:4-275) Phosphotyrosine protein phosphatase PtpB {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|