Citrus Sinensis ID: 001110

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------1000------1010------1020------1030------1040------1050------1060------1070------1080------1090------1100------1110------1120------1130------1140------1150-----
MHTRGLQMRSLGHVVKLSEKLSHVQSLCIHEMIVRAFKHIIQAVISAVGNTQRMAVSIAAALNLMLGVHESDGLNKSHNVHPLVWRWLELFLMKRYEWDLNGLNFKDVRKFAILRGLCHKVGIELVSRDFDMDSPSPFRKIDVVSLVPVHKQAACSSADGRQLLESSKTALDKGKLEDAVTYGTKALAKLVAVCGPYHRMTAGAYSLLAVVLYHTGDFNQATIYQQKALDINERELGLDHPDTMKSYGDLAVFYYRLQHTELALKYVKRALYLLHLTCGPSHPNTAATYINVAMMEEGLGNVHVALRYLHKALKCNQRLLGPDHIQTAASYHAIAIALSLMEAYPLSVQHEQTTLQILRAKLGPDDLRTQDAAAWLEYFESKAFEQQEAARNGTRKPDASIASKGHLSVSDLLDYINPSHDTKGRNVSTLKRKTYVAKVKGNFYQDNNLTSPDGSSKEVLRESSDEETHAPEPESDTDVNQGSSIPFQQQELVVEESAVEKPNITEEISSAIHEEGDDGWQPVQRLRSAGSYGRRLKQRRATIGKVHSYQKRNADAVIDYSSAKSSHHSSRYYLLKKRAVSHGSSADHHPVTTFHGTKFGRRVVKAVAYRVKSMPSSAKTGTVEASINGSEPSSSPSESRPASAPNDTSSVKNSIISLGKSPSYKEVAVAPPGTIAMLQVRVPQSDNPDNQEFSFGKPEDGTMEEKENVNTNVTGAEKTNEEKSDSVLDATDNLKEETGVHPNREETHISDGLEDNPSVVVSESERGVGSVVDIHKVVQDGILINGIPNSIDSPTSEFYEKDSSESIESHDNTKSTLQVVDDLKEKPSVFNPGDTRGLPNRKLSASAVPFNPSPAVARASAVAINMTLPPGPGAVTAVAPWPVNMTLHPRPATVLPTVNPMCSSPHQPYPSPPSTPNMMQPLPFMYPPYTQPQGVPTSTFPVTTSAFHHNHFSWQCNGNSNVPEFIPGPFLPGYHPMEFSVPPPVVEPILDPIMQPKAQSGDLDSSCSASILPENIDAVGDAEKEVDLLASKSMDNANEVAGIGRETVRGEFVKENGHLNLCGTENAGSEPVHFTSQNQSLRRNVEREIEGEKTFSILVRGRRNRKQTLRIPISLLSRPYGSQSFKVIYNRVIRGSEAPKSFSFSSTGDSTATAV
cccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccccccccccccccccHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHcHHHHHHHHccccccccccccccccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHccccccccccccccccccccccccccccHHHHHHHHccccccHHHHHHHHccccccccHHHHHHcccccccccccccccccccccccccccHHHHHcccccccccccHHHHHHHHHcccccccccccccccccccccHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccHHHcccccccccccccccccccHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEEEccccccccccccccccccccccccEEEEEEEEccccccccccccccccccccccc
ccccccEHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHccccccHHHHHcHHHHHHHHHHHHHHccEEEEcHccccccccccHHHHHHccHccccccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHcccccccHHHHHHHccHHHccccccHHHHHHHHHHHHHHHHHccccccccHHHHHHHccccHHcccccEEcccccccccccccHHHccccccccccccccccccHHcccccccccccccccccccccccccccccccccccHHHHHHHHcccHHHHHHHccccccccccccccccccccccccccccccccccccccccHHHcHHccccccccccccccccccccccccccccccccccccccccccccccccEcccccccccEEEEEcccccEEEEEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEccccccEcccccccccccccccccEcccccccccccccccccccccccccccEEEEEEEEcccccccEEEcEEEHcccccccccEEEEEEEEEEcccccccccHccccccccccc
mhtrglqmrslGHVVKLSEKLSHVQSLCIHEMIVRAFKHIIQAVISAVGNTQRMAVSIAAALNLMLGvhesdglnkshnvHPLVWRWLELFLMKRYEwdlnglnfkdVRKFAILRGLCHKVGIELvsrdfdmdspspfrkidvvslvpvhkqaacssadgrqLLESSKtaldkgkledAVTYGTKALAKLVAVCGPYHRMTAGAYSLLAVVLYHtgdfnqatIYQQKALdinerelgldhpdtmksyGDLAVFYYRLQHTELALKYVKRALYLLHltcgpshpntaATYINVAMMEEGLGNVHVALRYLHKALKcnqrllgpdhiQTAASYHAIAIALSLMEAYPLSVQHEQTTLQILRAklgpddlrTQDAAAWLEYFESKAFEQQEAarngtrkpdasiaskghlsvsdlldyinpshdtkgrnvstlkRKTYVAKVKgnfyqdnnltspdgsskevlressdeethapepesdtdvnqgssipfqqqELVVEesavekpnitEEISSAIheegddgwqpvqRLRSAGSYGRRLKQRRATIGKVhsyqkrnadavidyssaksshhssRYYLLKKRAvshgssadhhpvttfhgtkfGRRVVKAVAYRVksmpssaktgtveasingsepssspsesrpasapndtssvKNSIislgkspsykevavappgtiamlqvrvpqsdnpdnqefsfgkpedgtmeekenvntnvtgaektneeksdsvLDATDNlkeetgvhpnreethisdglednpsvvvsesergvgsvvdIHKVVqdgilingipnsidsptsefyekdssesieshdntksTLQVVDdlkekpsvfnpgdtrglpnrklsasavpfnpspaVARASAVAInmtlppgpgavtavapwpvnmtlhprpatvlptvnpmcssphqpypsppstpnmmqplpfmyppytqpqgvptstfpvttsafhhnhfswqcngnsnvpefipgpflpgyhpmefsvpppvvepildpimqpkaqsgdldsscsasilpenidavgdAEKEVDLLASKSMDNAnevagigretvrgefvkenghlnlcgtenagsepvhftsqnqsLRRNVEREIEGEKTFSILVRGrrnrkqtlripisllsrpygsqsfKVIYNRvirgseapksfsfsstgdstatav
mhtrglqmrslgHVVKLSEKLSHVQSLCIHEMIVRAFKHIIQAVISAVGNTQRMAVSIAAALNLMLGVHESDGLNKSHNVHPLVWRWLELFLMKRYEWDLNGLNFKDVRKFAILRGLCHKVGIELVSRDFDMDSPSPFRKIDVVSLVPVHKQAacssadgrqllessktaldkgkledAVTYGTKALAKLVAVCGPYHRMTAGAYSLLAVVLYHTGDFNQATIYQQKALDINERELGLDHPDTMKSYGDLAVFYYRLQHTELALKYVKRALYLLHLTCGPSHPNTAATYINVAMMEEGLGNVHVALRYLHKALKCNQRLLGPDHIQTAASYHAIAIALSLMEAYPLSVQHEQTTLQILRAKLGPDDLRTQDAAAWLEYFESKAFEQQEAarngtrkpdasiaskghlsVSDLLDYINPshdtkgrnvstlkrktyvakvkgnfyqdnnltspdgsskEVLRESSDeethapepesdtdvnqgssIPFQQQELVVEESAVEKPNITEEISSaiheegddgwqpvQRLRSagsygrrlkqrratigkvhsyqkrnadavidyssaksshHSSRYYLLKKRAVSHgssadhhpvttfhgtkfgrRVVKAVAYRVksmpssaktgtveasingsepssspsesrpasapndtssVKNSIISLGKSPSYKEVAVAPPGTIAMLQVRVPQSDNPDNQEFsfgkpedgtmeekENVNtnvtgaektneeksdsvlDATDNLkeetgvhpnreethisdglednpsVVVSEsergvgsvvdIHKVVqdgilingipnsidsptSEFYEKDssesieshdntkstlqvvddlkekpsvfnpgdtrglpnRKLSASAVPFNPSPAVARASAVAINMTLPPGPGAVTAVAPWPVNMTLHPRPATVLPTVNPMCSSPHQPYPSPPSTPNMMQPLPFMYPPYTQPQGVPTSTFPVTTSAFHHNHFSWQCNGNSNVPEFIPGPFLPGYHPMEFSVPPPVVEPILDPIMQPKAQSGDLDSSCSASILPENIDAVGDAEKEVDLLASKSMDNANEVAGIGRETVRGEFVKENGHLNLCgtenagsepvhftsqnqslrrnvereiegektfsilvrgrrnrkqtlripisllsrpygsqsFKVIYNRVIRGseapksfsfsstgdstatav
MHTRGLQMRSLGHVVKLSEKLSHVQSLCIHEMIVRAFKHIIQAVISAVGNTQRMAVSIAAALNLMLGVHESDGLNKSHNVHPLVWRWLELFLMKRYEWDLNGLNFKDVRKFAILRGLCHKVGIELVSRDFDMDSPSPFRKIDVVSLVPVHKQAACSSADGRQLLESSKTALDKGKLEDAVTYGTKALAKLVAVCGPYHRMTAGAYSLLAVVLYHTGDFNQATIYQQKALDINERELGLDHPDTMKSYGDLAVFYYRLQHTELALKYVKRALYLLHLTCGPSHPNTAATYINVAMMEEGLGNVHVALRYLHKALKCNQRLLGPDHIQTAASYHAIAIALSLMEAYPLSVQHEQTTLQILRAKLGPDDLRTQDAAAWLEYFESKAFEQQEAARNGTRKPDASIASKGHLSVSDLLDYINPSHDTKGRNVSTLKRKTYVAKVKGNFYQDNNLTSPDGSSKEVLRESSDEETHAPEPESDTDVNQGSSIPFQQQELVVEESAVEKPNITEEISSAIHEEGDDGWQPVQRLRSAGSYGRRLKQRRATIGKVHSYQKRNADAVIDYssaksshhssRYYLLKKRAVSHGSSADHHPVTTFHGTKFGrrvvkavayrvkSMPSSAKTGTVEASINGsepssspsesrpasapNDTSSVKNSIISLGKSPSYKEVAVAPPGTIAMLQVRVPQSDNPDNQEFSFGKPEDGTMEEKENVNTNVTGAEKTNEEKSDSVLDATDNLKEETGVHPNREETHISDGLEDNPsvvvsesergvgsvvDIHKVVQDGILINGIPNSIDSPTSEFYEKDSSESIESHDNTKSTLQVVDDLKEKPSVFNPGDTRGLPNRKLSASAVPFNpspavarasavaINMTLppgpgavtavapwpvNMTLHPRPATVLPTVNPMCssphqpypsppstpNMMQPLPFMYPPYTQPQGVPTSTFPVTTSAFHHNHFSWQCNGNSNVPEFIPGPFLPGYHPMEFSVPPPVVEPILDPIMQPKAQSGDLDSSCSASILPENIDAVGDAEKEVDLLASKSMDNANEVAGIGRETVRGEFVKENGHLNLCGTENAGSEPVHFTSQNQSLRRNVEREIEGEKTFSILVRGRRNRKQTLRIPISLLSRPYGSQSFKVIYNRVIRGSEAPKSFSFSSTGDSTATAV
***********GHVVKLSEKLSHVQSLCIHEMIVRAFKHIIQAVISAVGNTQRMAVSIAAALNLMLGVHESDGLNKSHNVHPLVWRWLELFLMKRYEWDLNGLNFKDVRKFAILRGLCHKVGIELVSRDFDMDSPSPFRKIDVVSLVPVHKQAA********************KLEDAVTYGTKALAKLVAVCGPYHRMTAGAYSLLAVVLYHTGDFNQATIYQQKALDINERELGLDHPDTMKSYGDLAVFYYRLQHTELALKYVKRALYLLHLTCGPSHPNTAATYINVAMMEEGLGNVHVALRYLHKALKCNQRLLGPDHIQTAASYHAIAIALSLMEAYPLSVQHEQTTLQILRAKLGPDDLRTQDAAAWLEYFE*******************************LLDYI*************LKRKTYVAKVKGNFY*******************************************************************************************************************************YYLLKK***********HPVTTFHGTKFGRRVVKAVAYRV************************************************************************************************************************************************************VGSVVDIHKVVQDGILINGIP************************************************************************AVAINMTLPPGPGAVTAVAPWPVNMTLHPRPATVL*****************************************TSTFPVTTSAFHHNHFSWQCNGNSNVPEFIPGPFLPGYHPMEFSVPPPVVEPIL****************************************************IGRETVRGEFVKENGHLNLCG******************************TFSILVRGRRNRKQTLRIPISLLSRPYGSQSFKVIYNRVIR*********************
MHTRGLQMRSLGHVVKLSEKLSHVQSLCIHEMIVRAFKHIIQAVISAVGNTQRMAVSIAAALNLMLGVHESDG*N*SHNVHPLVWRWLELFLMKRYEWDLNGLNFKDVRKFAILRGLCHKVGIELVSRDFDMDSPSPFRKIDVVSLVPVHKQAACSSADGRQLLESSKTALDKGKLEDAVTYGTKALAKLVAVCGPYHRMTAGAYSLLAVVLYHTGDFNQATIYQQKALDINERELGLDHPDTMKSYGDLAVFYYRLQHTELALKYVKRALYLLHLTCGPSHPNTAATYINVAMMEEGLGNVHVALRYLHKALKCNQRLLGPDHIQTAASYHAIAIALSLMEAYPLSVQHEQTTLQILRAKLGPDDLRTQDAAAWLEYFESKAFEQQEAARN***K******SKGHLSVSDLLDYINPSHDTKGRNVSTLKRKTYV**********************************************************************************************************************************************************************************************************************************SYKEVAVAPPGTIAML***************************************************************************************************************************************************************************FNPSPAVARASAVA******P**GAVTAVAPWPVNMTLHPR*******************PSPPSTPNMMQPLPFMYPPY**********************FSW*CNGNSNVPEFIPGPFLPGY**************************************************************************************************************************ILV*********LRIPISLLSRPYGSQSFKVIYNRVIRGSE******************
********RSLGHVVKLSEKLSHVQSLCIHEMIVRAFKHIIQAVISAVGNTQRMAVSIAAALNLMLGVHESDGLNKSHNVHPLVWRWLELFLMKRYEWDLNGLNFKDVRKFAILRGLCHKVGIELVSRDFDMDSPSPFRKIDVVSLVPVHKQAACSSADGRQLLESSKTALDKGKLEDAVTYGTKALAKLVAVCGPYHRMTAGAYSLLAVVLYHTGDFNQATIYQQKALDINERELGLDHPDTMKSYGDLAVFYYRLQHTELALKYVKRALYLLHLTCGPSHPNTAATYINVAMMEEGLGNVHVALRYLHKALKCNQRLLGPDHIQTAASYHAIAIALSLMEAYPLSVQHEQTTLQILRAKLGPDDLRTQDAAAWLEYFESKAFE***************IASKGHLSVSDLLDYINPSHDTKGRNVSTLKRKTYVAKVKGNFYQDNNLTS******************************GSSIPFQQQELVVEESAVEKPNITEEISSAIHEEGDDGWQPVQRLRSAGSYGRRLKQRRATIGKVHSYQKRNADAVIDY*********SRYYLLKKR*********HHPVTTFHGTKFGRRVVKAVAYRVK***************************************KNSIISLGKSPSYKEVAVAPPGTIAMLQVRVPQSDNPDNQEFSFGKPEDGTMEEKENVNTNVTGAEKTNEEKSDSVLDATDNLKEETGVHPNREETHISDGLEDNPSVVVSESERGVGSVVDIHKVVQDGILINGIPNSIDSP*******************KSTLQVVDDLKEKPSVFNPGDTRGLPNRKLSASAVPFNPSPAVARASAVAINMTLPPGPGAVTAVAPWPVNMTLHPRPATVLPTVNPM************STPNMMQPLPFMYPPYTQPQGVPTSTFPVTTSAFHHNHFSWQCNGNSNVPEFIPGPFLPGYHPMEFSVPPPVVEPILDPIMQPK*********CSASILPENIDAVGDAEKEVDLLASKSMDNANEVAGIGRETVRGEFVKENGHLNLCGTENAGSEPVHFTSQNQSLRRNVEREIEGEKTFSILVRGRRNRKQTLRIPISLLSRPYGSQSFKVIYNRVIRGSEAPK***************
***RGLQMRSLGHVVKLSEKLSHVQSLCIHEMIVRAFKHIIQAVISAVGNTQRMAVSIAAALNLMLGVHESDGLNKSHNVHPLVWRWLELFLMKRYEWDLNGLNFKDVRKFAILRGLCHKVGIELVSRDFDMDSPSPFRKIDVVSLVPVHKQAACSSADGRQLLESSKTALDKGKLEDAVTYGTKALAKLVAVCGPYHRMTAGAYSLLAVVLYHTGDFNQATIYQQKALDINERELGLDHPDTMKSYGDLAVFYYRLQHTELALKYVKRALYLLHLTCGPSHPNTAATYINVAMMEEGLGNVHVALRYLHKALKCNQRLLGPDHIQTAASYHAIAIALSLMEAYPLSVQHEQTTLQILRAKLGPDDLRTQDAAAWLEYFESKAFEQQEAARNGTRKPDASIASKGHLSVSDLLDYINPSHDTKGRNVSTLKRKTYVAKVKGNFYQDNNLTSPDGSSKEVLRESSDEETHAPEP*********************************************************************IGKVHS*QKRNADAVIDYSS**********************************************************************************************SLGKSPSYKEVAVAPPGTIAMLQVRVP***********************************************************************************************************************************************************************NPSPAVARASAVAINMTLPPGPGAVTAVAPWPVNMTLHPRPATVLPTVNPMCSSPHQPYPSPPSTPNMMQPLPFMYPPYTQPQGVPTSTFPVTTSAFHHNHFSWQCNGNSNVPEFIPGPFLPGYHPMEFSVPPPVVEP******************************************************************************************************GEKTFSILVRGRRNRKQTLRIPISLLSRPYGSQSFKVIYNRVIRGS*******************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MHTRGLQMRSLGHVVKLSEKLSHVQSLCIHEMIVRAFKHIIQAVISAVGNTQRMAVSIAAALNLMLGVHESDGLNKSHNVHPLVWRWLELFLMKRYEWDLNGLNFKDVRKFAILRGLCHKVGIELVSRDFDMDSPSPFRKIDVVSLVPVHKQAACSSADGRQLLESSKTALDKGKLEDAVTYGTKALAKLVAVCGPYHRMTAGAYSLLAVVLYHTGDFNQATIYQQKALDINERELGLDHPDTMKSYGDLAVFYYRLQHTELALKYVKRALYLLHLTCGPSHPNTAATYINVAMMEEGLGNVHVALRYLHKALKCNQRLLGPDHIQTAASYHAIAIALSLMEAYPLSVQHEQTTLQILRAKLGPDDLRTQDAAAWLEYFESKAFEQQEAARNGTRKPDASIASKGHLSVSDLLDYINPSHDTKGRNVSTLKRKTYVAKVKGNFYQDNNLTSPDGSSKEVLRESSDEETHAPEPESDTDVNQGSSIPFQQQELVVEESAVEKPNITEEISSAIHEEGDDGWQPVQRLRSAGSYGRRLKQRRATIGKVHSYQKRNADAVIDYSSAKSSHHSSRYYLLKKRAVSHGSSADHHPVTTFHGTKFGRRVVKAVAYRVKSMPSSAKTGTVEASINGSEPSSSPSESRPASAPNDTSSVKNSIISLGKSPSYKEVAVAPPGTIAMLQVRVPQSDNPDNQEFSFGKPEDGTMEEKENVNTNVTGAEKTNEEKSDSVLDATDNLKEETGVHPNREETHISDGLEDNPSVVVSESERGVGSVVDIHKVVQDGILINGIPNSIDSPTSEFYEKDSSESIESHDNTKSTLQVVDDLKEKPSVFNPGDTRGLPNRKLSASAVPFNPSPAVARASAVAINMTLPPGPGAVTAVAPWPVNMTLHPRPATVLPTVNPMCSSPHQPYPSPPSTPNMMQPLPFMYPPYTQPQGVPTSTFPVTTSAFHHNHFSWQCNGNSNVPEFIPGPFLPGYHPMEFSVPPPVVEPILDPIMQPKAQSGDLDSSCSASILPENIDAVGDAEKEVDLLASKSMDNANEVAGIGRETVRGEFVKENGHLNLCGTENAGSEPVHFTSQNQSLRRNVEREIEGEKTFSILVRGRRNRKQTLRIPISLLSRPYGSQSFKVIYNRVIRGSEAPKSFSFSSTGDSTATAV
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query1155 2.2.26 [Sep-21-2011]
F4J5S11407 Clustered mitochondria pr no no 0.339 0.278 0.368 2e-78
O158181320 Clustered mitochondria pr yes no 0.356 0.312 0.300 2e-49
B4GAM11435 Protein clueless OS=Droso N/A no 0.330 0.266 0.260 4e-40
B0W2S01377 Clustered mitochondria pr N/A no 0.358 0.300 0.269 4e-40
Q291J51435 Protein clueless OS=Droso yes no 0.330 0.266 0.258 2e-39
Q17N711442 Clustered mitochondria pr N/A no 0.358 0.287 0.269 2e-39
B3MIW01450 Protein clueless OS=Droso N/A no 0.358 0.285 0.247 3e-38
B4MY631441 Protein clueless OS=Droso N/A no 0.289 0.231 0.286 5e-38
Q0IHW81296 Clustered mitochondria pr yes no 0.409 0.364 0.239 5e-38
B3NPV81452 Protein clueless OS=Droso N/A no 0.358 0.285 0.241 7e-38
>sp|F4J5S1|CLU_ARATH Clustered mitochondria protein OS=Arabidopsis thaliana GN=FMT PE=2 SV=1 Back     alignment and function desciption
 Score =  295 bits (754), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 160/434 (36%), Positives = 244/434 (56%), Gaps = 42/434 (9%)

Query: 1    MHTRGLQMRSLGHVVKLSEKLSHVQSLCIHEMIVRAFKHIIQAVISAVGNTQRMAVSIAA 60
            +H  G+ +R +G V    + L H+  LC++E+ VR+ KHI++ ++  + +   +  +++ 
Sbjct: 826  LHAHGVNVRYIGRVANGVKHLPHLWDLCLNEITVRSAKHILKDILRDIED-HDIGSAVSH 884

Query: 61   ALNLMLGVHESDGLNKSHNVHP-------------------------------------- 82
             LN   G +++ G   S N                                         
Sbjct: 885  FLNCFFGNYQTAGGKASANSSTAKNQKKFFGADQPITKKGQGRGKGKASSKKSFSSYMMV 944

Query: 83   ---LVWRWLELFLMKRYEWDLNGLNFKDVRKFAILRGLCHKVGIELVSRDFDMDSPSPFR 139
               ++W  ++ F   +YE++L  L+    +K ++LR LC KVG+ + +R +D  + +PF 
Sbjct: 945  DSNILWSDIQEFAKAKYEFELPELSRTTAKKVSVLRNLCQKVGVSIAARKYDFSANTPFE 1004

Query: 140  KIDVVSLVPVHKQAACSSADGRQLLESSKTALDKGKLEDAVTYGTKALAKLVAVCGPYHR 199
              D++ L PV K +    ++ + L+E  K  L +G L ++ T+ ++A + L  V GP HR
Sbjct: 1005 TSDILDLRPVIKHSVPVCSEAKDLVEMGKVQLAEGMLSESYTFFSEAFSILQQVTGPMHR 1064

Query: 200  MTAGAYSLLAVVLYHTGDFNQATIYQQKALDINERELGLDHPDTMKSYGDLAVFYYRLQH 259
              A     LA+VLYH GD   A + Q K L INER LGLDHPDT  SYG++A+FY+ L  
Sbjct: 1065 EVANCCRYLAMVLYHAGDMAGAIMQQHKELIINERCLGLDHPDTAHSYGNMALFYHGLNQ 1124

Query: 260  TELALKYVKRALYLLHLTCGPSHPNTAATYINVAMMEEGLGNVHVALRYLHKALKCNQRL 319
            TELAL+ + RAL LL L+ GP HP+ AAT+INVAMM + +G +  ALRYL +ALK N+RL
Sbjct: 1125 TELALQNMGRALLLLGLSSGPDHPDVAATFINVAMMYQDMGKMDTALRYLQEALKKNERL 1184

Query: 320  LGPDHIQTAASYHAIAIALSLMEAYPLSVQHEQTTLQILRAKLGPDDLRTQDAAAWLEYF 379
            LGP+HIQTA  YHA+AIA + M A+ LS QHE+ T  IL  +LG DD RT+D+  W++ F
Sbjct: 1185 LGPEHIQTAVCYHALAIAFNCMGAFKLSHQHEKKTYDILVKQLGDDDSRTRDSLNWMKTF 1244

Query: 380  ESKAFEQQEAARNG 393
            + +  +     + G
Sbjct: 1245 KMRELQMTAQKQKG 1258
Involved in proper cytoplasmic distribution of mitochondria.
Arabidopsis thaliana (taxid: 3702)
>sp|O15818|CLU_DICDI Clustered mitochondria protein homolog OS=Dictyostelium discoideum GN=clua PE=1 SV=2 Back     alignment and function description
>sp|B4GAM1|CLU_DROPE Protein clueless OS=Drosophila persimilis GN=clu PE=3 SV=1 Back     alignment and function description
>sp|B0W2S0|CLU_CULQU Clustered mitochondria protein homolog OS=Culex quinquefasciatus GN=CPIJ001445 PE=3 SV=1 Back     alignment and function description
>sp|Q291J5|CLU_DROPS Protein clueless OS=Drosophila pseudoobscura pseudoobscura GN=clu PE=3 SV=2 Back     alignment and function description
>sp|Q17N71|CLU_AEDAE Clustered mitochondria protein homolog OS=Aedes aegypti GN=AAEL000794 PE=3 SV=1 Back     alignment and function description
>sp|B3MIW0|CLU_DROAN Protein clueless OS=Drosophila ananassae GN=clu PE=3 SV=1 Back     alignment and function description
>sp|B4MY63|CLU_DROWI Protein clueless OS=Drosophila willistoni GN=clu PE=3 SV=1 Back     alignment and function description
>sp|Q0IHW8|CLU_XENTR Clustered mitochondria protein homolog OS=Xenopus tropicalis GN=cluh PE=2 SV=1 Back     alignment and function description
>sp|B3NPV8|CLU_DROER Protein clueless OS=Drosophila erecta GN=clu PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1155
255564713 1872 eukaryotic translation initiation factor 0.983 0.606 0.683 0.0
359489732 1863 PREDICTED: protein KIAA0664 homolog [Vit 0.979 0.607 0.683 0.0
356520282 1840 PREDICTED: uncharacterized protein LOC10 0.973 0.610 0.649 0.0
358349301 1350 hypothetical protein MTR_139s0028 [Medic 0.968 0.828 0.614 0.0
356560227 1846 PREDICTED: protein TIF31 homolog [Glycin 0.974 0.609 0.643 0.0
449487415 1856 PREDICTED: LOW QUALITY PROTEIN: uncharac 0.958 0.596 0.632 0.0
449445826 1856 PREDICTED: uncharacterized protein LOC10 0.958 0.596 0.632 0.0
334182214 1787 tetratricopeptide repeat-containing prot 0.889 0.574 0.566 0.0
42561588 1797 tetratricopeptide repeat-containing prot 0.892 0.573 0.562 0.0
297842986 1793 tetratricopeptide repeat-containing prot 0.898 0.578 0.564 0.0
>gi|255564713|ref|XP_002523351.1| eukaryotic translation initiation factor 3 subunit, putative [Ricinus communis] gi|223537439|gb|EEF39067.1| eukaryotic translation initiation factor 3 subunit, putative [Ricinus communis] Back     alignment and taxonomy information
 Score = 1542 bits (3993), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 790/1156 (68%), Positives = 920/1156 (79%), Gaps = 20/1156 (1%)

Query: 1    MHTRGLQMRSLGHVVKLSEKLSHVQSLCIHEMIVRAFKHIIQAVISAVGNTQRMAVSIAA 60
            MHTRGL+MRSLGHVVKLSEKLSHVQSLCIHEMIVRA+KHI+QAVI+AV N ++MA+SIAA
Sbjct: 734  MHTRGLRMRSLGHVVKLSEKLSHVQSLCIHEMIVRAYKHILQAVIAAVVNHEKMAISIAA 793

Query: 61   ALNLMLGVHESDGLNKSHNVHPLVWRWLELFLMKRYEWDLNGLNFKDVRKFAILRGLCHK 120
            ALNLMLGV E    +KS++V+ LVW+WLE+FL KRYEWDL+  NFKDVRKFAILRGLCHK
Sbjct: 794  ALNLMLGVPERGDSDKSYHVNSLVWKWLEVFLKKRYEWDLSRSNFKDVRKFAILRGLCHK 853

Query: 121  VGIELVSRDFDMDSPSPFRKIDVVSLVPVHKQAACSSADGRQLLESSKTALDKGKLEDAV 180
            VGIELV RDFDMDSP PFRK D+VSLVPVHKQAACSSADGRQLLESSKTALDKGKLEDAV
Sbjct: 854  VGIELVPRDFDMDSPHPFRKSDIVSLVPVHKQAACSSADGRQLLESSKTALDKGKLEDAV 913

Query: 181  TYGTKALAKLVAVCGPYHRMTAGAYSLLAVVLYHTGDFNQATIYQQKALDINERELGLDH 240
            TYGTKALAKLVAVCGPYHRMTAGAYSLLAVVLYHTGDFNQATIYQQKALDINERELGLDH
Sbjct: 914  TYGTKALAKLVAVCGPYHRMTAGAYSLLAVVLYHTGDFNQATIYQQKALDINERELGLDH 973

Query: 241  PDTMKSYGDLAVFYYRLQHTELALKYVKRALYLLHLTCGPSHPNTAATYINVAMMEEGLG 300
            PDTMKSYGDLAVFYYRLQHTELALKYVKRALYLLHLTCGPSHPNTAATYINVAMMEEGLG
Sbjct: 974  PDTMKSYGDLAVFYYRLQHTELALKYVKRALYLLHLTCGPSHPNTAATYINVAMMEEGLG 1033

Query: 301  NVHVALRYLHKALKCNQRLLGPDHIQTAASYHAIAIALSLMEAYPLSVQHEQTTLQILRA 360
            NVH+ALRYLHKALKCNQRLLGPDHIQTAASYHAIAIALSLMEAYPLSVQHEQTTLQILRA
Sbjct: 1034 NVHIALRYLHKALKCNQRLLGPDHIQTAASYHAIAIALSLMEAYPLSVQHEQTTLQILRA 1093

Query: 361  KLGPDDLRTQDAAAWLEYFESKAFEQQEAARNGTRKPDASIASKGHLSVSDLLDYINPSH 420
            KLGPDDLRTQDAAAWLEYFESKAFEQQEAARNGTRKPDASIASKGHLSVSDLLDYINPS 
Sbjct: 1094 KLGPDDLRTQDAAAWLEYFESKAFEQQEAARNGTRKPDASIASKGHLSVSDLLDYINPSR 1153

Query: 421  DTKGRNVSTLKRKTYVAKVKGNFYQDNNLTSPDGSSKEVLRESSDEETHAPEPESDTDVN 480
            DTKGR+  +++RK+Y+AK+K      ++L S + S +E+ +E+ DEETH P    +T   
Sbjct: 1154 DTKGRDFVSVRRKSYIAKMKEKTNPVSDLPSSNESPQEIPQEAIDEETHMPIASQET--- 1210

Query: 481  QGSSIPFQQQELVVEESAVEKPNITEEISSAIHEEGDDGWQPVQRLRSAGSYGRRLKQRR 540
              SS   Q Q+ +VEE+A +K  I  E+   I  EGDDGWQPVQR RSAGSYGRRLKQRR
Sbjct: 1211 --SSTQVQFQQPIVEETADKKSGIVSEVLPEILAEGDDGWQPVQRPRSAGSYGRRLKQRR 1268

Query: 541  ATIGKVHSYQKRNADAVIDYSSAKSSHHSSRYYLLKKRAVSHGSSADHHPVTTFHGTKFG 600
              I KV  YQK+  DA +DY   K++H ++RYYLLKKR +SHGS  DHH      GTKFG
Sbjct: 1269 GIISKV--YQKKIVDANMDYPPVKNTHQNNRYYLLKKRPLSHGSYVDHHASNPSQGTKFG 1326

Query: 601  RRVVKAVAYRVKSMPSSAKTGTVEASINGSEPSSSPSESRPASAPNDTSSVKNSIISLGK 660
            RR+VKAV YRVKS+PS  KT   E S +G +  SS  ES   SA +D   VK+S++SLGK
Sbjct: 1327 RRIVKAVTYRVKSIPSVNKTAPTENSKSGVKTFSS-LESAQLSASSDAGQVKSSVVSLGK 1385

Query: 661  SPSYKEVAVAPPGTIAMLQVRVPQSDNPDNQEFSFGKPEDGTMEEKENVNTNVTG-AEKT 719
            SPSYKEVA+APPGTIA  QV +PQ+DN DN++   G  ++ T+E  EN +  VT  A+K 
Sbjct: 1386 SPSYKEVALAPPGTIAKFQVWLPQNDNSDNKDIGVGGSKEETIEAIENASEVVTVLADKD 1445

Query: 720  NEEKSDSVLDATDNLKEETGVHPNREETHISDGLEDNPSVVVSESERGVGSVVDIHKVVQ 779
            N     S  D+ D+LK+ T V   +E++  ++  E+N  +V  ++      +V++H V+Q
Sbjct: 1446 N----SSATDSNDHLKDVTDVIEEKEDSQSNNAKEENALMVARKTIESESGIVEVHGVMQ 1501

Query: 780  DGILINGIPNSIDSPTSE-FYEKDSSESIESHDNTKSTLQVVDDLKEKPSVFNPGDTRGL 838
            + I I+ IPNSID P+ E  +EKDS+   E   N+  T   V+DL+++    + G+TRGL
Sbjct: 1502 NSISIDRIPNSIDFPSKEPPFEKDSAGEFEPQCNSNPTSPEVEDLRDRSLATSSGETRGL 1561

Query: 839  PNRKLSASAVPFNPSPAVARASAVAINMTLPPGPGAVTAVAPWPVNMTLHPRPATVLPTV 898
            PN+KLSASA PFNPSP++ARA+ V++N++LPPGPG+V AVAPWPVNMTLHP PATVLP V
Sbjct: 1562 PNKKLSASAAPFNPSPSIARAAPVSMNISLPPGPGSVPAVAPWPVNMTLHPGPATVLPPV 1621

Query: 899  NPMCSSPHQPYPSPPSTPNMMQPLPFMYPPYTQPQGVPTSTFPVTTSAFHHNHFSWQCNG 958
            +PM S  H PYPSPP+TPNMMQPLPF+YPPY+Q Q VPTSTFPVT++AFH NHFSWQCN 
Sbjct: 1622 SPMPSP-HHPYPSPPATPNMMQPLPFIYPPYSQSQAVPTSTFPVTSNAFHPNHFSWQCNV 1680

Query: 959  NSNVPEFIPGPFLPGYHPMEFSVPPPVVEPILDPIMQPKAQSGDLDSSCSASILPENIDA 1018
            N  V EFIP    PG H MEFSV PPV EPI D  ++PK Q  +  S+    +LP +I  
Sbjct: 1681 NHRVNEFIPSTIWPGCHGMEFSVLPPVTEPIPDSALEPKVQFENPGSASPPPVLPADIVN 1740

Query: 1019 VGDAEKEVDLLASKSMDNANEVAGIGRETVRGEFVKENGHLNLCGTENAGSEPVHFTSQN 1078
            V +A++EV+LLA ++ DNAN++AG     VR E VKENGH NL   E +G++  H+ S  
Sbjct: 1741 VEEAKREVNLLAPEATDNANDLAG-----VRLENVKENGHSNLGEVEISGNDSSHYKSFK 1795

Query: 1079 QSLRRNVEREIEGEKTFSILVRGRRNRKQTLRIPISLLSRPYGSQSFKVIYNRVIRGSEA 1138
            +      ER+I+GEKTFSIL+RGRRNRKQTLR+PISLL+RPYGSQSFKVIYNRV+RGSEA
Sbjct: 1796 KDGSNTDERKIDGEKTFSILIRGRRNRKQTLRMPISLLNRPYGSQSFKVIYNRVVRGSEA 1855

Query: 1139 PKSFSFSSTGDSTATA 1154
            PKS  F S  D TA+A
Sbjct: 1856 PKSTCFPSAKDCTASA 1871

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|359489732|ref|XP_002278370.2| PREDICTED: protein KIAA0664 homolog [Vitis vinifera] Back     alignment and taxonomy information
>gi|356520282|ref|XP_003528792.1| PREDICTED: uncharacterized protein LOC100808136 [Glycine max] Back     alignment and taxonomy information
>gi|358349301|ref|XP_003638677.1| hypothetical protein MTR_139s0028 [Medicago truncatula] gi|355504612|gb|AES85815.1| hypothetical protein MTR_139s0028 [Medicago truncatula] Back     alignment and taxonomy information
>gi|356560227|ref|XP_003548395.1| PREDICTED: protein TIF31 homolog [Glycine max] Back     alignment and taxonomy information
>gi|449487415|ref|XP_004157615.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC101229361 [Cucumis sativus] Back     alignment and taxonomy information
>gi|449445826|ref|XP_004140673.1| PREDICTED: uncharacterized protein LOC101210514 [Cucumis sativus] Back     alignment and taxonomy information
>gi|334182214|ref|NP_001184884.1| tetratricopeptide repeat-containing protein [Arabidopsis thaliana] gi|332189151|gb|AEE27272.1| tetratricopeptide repeat-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|42561588|ref|NP_171639.3| tetratricopeptide repeat-containing protein [Arabidopsis thaliana] gi|332189150|gb|AEE27271.1| tetratricopeptide repeat-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297842986|ref|XP_002889374.1| tetratricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297335216|gb|EFH65633.1| tetratricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1155
TAIR|locus:20353271797 AT1G01320 [Arabidopsis thalian 0.717 0.461 0.609 1.7e-295
TAIR|locus:20377831608 AT1G15290 [Arabidopsis thalian 0.473 0.340 0.607 2.7e-184
DICTYBASE|DDB_G02928061320 cluA "CluA protein" [Dictyoste 0.434 0.380 0.275 6.1e-41
UNIPROTKB|B4GAM11435 clu "Protein clueless" [Drosop 0.289 0.232 0.280 1.3e-34
UNIPROTKB|B4MY631441 clu "Protein clueless" [Drosop 0.289 0.231 0.286 1.5e-34
UNIPROTKB|Q291J51435 clu "Protein clueless" [Drosop 0.289 0.232 0.277 4.4e-34
UNIPROTKB|B4KT501487 clu "Protein clueless" [Drosop 0.321 0.249 0.274 1.4e-33
UNIPROTKB|B4JW991494 clu "Protein clueless" [Drosop 0.322 0.248 0.268 1.7e-33
UNIPROTKB|B3MIW01450 clu "Protein clueless" [Drosop 0.346 0.275 0.258 3.3e-33
UNIPROTKB|B4LQ231465 clu "Protein clueless" [Drosop 0.348 0.275 0.261 1.5e-32
TAIR|locus:2035327 AT1G01320 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 2445 (865.7 bits), Expect = 1.7e-295, Sum P(3) = 1.7e-295
 Identities = 540/886 (60%), Positives = 634/886 (71%)

Query:     1 MHTRGLQMRSLGHVVKLSEKLSHVQSLCIHEMIVRAFKHIIQAVISAVG-NTQRMAVSIA 59
             MHTRGL+MRSLG+VVKLS+KLSHVQSLC+HEMIVRA KHI+QAVISAV  +T ++A+ +A
Sbjct:   710 MHTRGLRMRSLGYVVKLSDKLSHVQSLCVHEMIVRALKHILQAVISAVATDTDKIAIKVA 769

Query:    60 AALNLMLGVHESDGLNKSH--NVHPLVWRWLELFLMKRYEWDLNGLNFKDVRKFAILRGL 117
             AALN+MLG+ E+      +  NVHPL++RWLE FL KRY++DLN  ++KD+RKFAILRGL
Sbjct:   770 AALNMMLGIPENVAATPHNPWNVHPLIFRWLEKFLKKRYDYDLNAFSYKDLRKFAILRGL 829

Query:   118 CHKVGIELVSRDFDMDSPSPFRKIDVVSLVPVHK--------QAACSSADGRQLLESSKT 169
             CHKVGIEL+ RDFDMDSP+PFRK DVVSLVPVHK        QAACSSADGRQLLESSKT
Sbjct:   830 CHKVGIELIPRDFDMDSPAPFRKTDVVSLVPVHKTFYFKSMQQAACSSADGRQLLESSKT 889

Query:   170 ALDKGKLEDAVTYGTKALAKLVAVCGPYHRMTAGAYSLLAVVLYHTGDFNQATIYQQKAL 229
             ALDKGKLEDAVTYGTKALAKLVAVCGPYHRMTAGAYSLLAVVLYHTGDFNQATIYQQKAL
Sbjct:   890 ALDKGKLEDAVTYGTKALAKLVAVCGPYHRMTAGAYSLLAVVLYHTGDFNQATIYQQKAL 949

Query:   230 DINERELGLDHPDTMKSYGDLAVFYYRLQHTELALKYVKRALYLLHLTCGPSHPNTAATY 289
             DINERELGLDHPDTMKSYGDLAVFYYRLQHTELALKYVKRALYLLHLTCGPSHPNTAATY
Sbjct:   950 DINERELGLDHPDTMKSYGDLAVFYYRLQHTELALKYVKRALYLLHLTCGPSHPNTAATY 1009

Query:   290 INVAMMEEGLGNVHVALRYLHKALKCNQRLLGPDHIQTAASYHAIAIALSLMEAYPLSVQ 349
             INVAMMEEGLGNVHVALRYLHKALKCNQRLLGPDHIQTAASYHAIAIALSLMEAY LSVQ
Sbjct:  1010 INVAMMEEGLGNVHVALRYLHKALKCNQRLLGPDHIQTAASYHAIAIALSLMEAYHLSVQ 1069

Query:   350 HEQTTLQILRAKLGPDDLRTQDAAAWLEYFESKAFEQQEAARNGTRKPDASIASKGHLSV 409
             HEQTTL+ILRAKLGPDDLRTQDAAAWLEYFESKAFEQQEAARNGT KPDASIASKGHLSV
Sbjct:  1070 HEQTTLRILRAKLGPDDLRTQDAAAWLEYFESKAFEQQEAARNGTPKPDASIASKGHLSV 1129

Query:   410 SDLLDYINPSHDTKGRNVSTLKRKTYVAKVKGNFYQDN---NLTS-PDGSSKEVLRESSD 465
             SDLLDYINPSH+ KG+     KRK Y+ K+K    Q N   +L   P    KE+  E + 
Sbjct:  1130 SDLLDYINPSHNAKGKESVAAKRKNYILKLKEKSKQSNVSEHLVEIPREKQKEMSEEDT- 1188

Query:   466 EETHAPEPESDTDVNQGSSIPFQQQEL--VVEESAVEKPN-ITE-EISSAI-HEEG-DDG 519
             EET + E +S  + ++    P ++     V+E++ ++  N IT  ++S+   H +G +DG
Sbjct:  1189 EETGSEEGKSSEENHETILAPVEEPPSPPVIEDATMDNSNPITSSDVSTEPQHPDGSEDG 1248

Query:   520 WQPVQRLRSAGSYGRRLKQRRATIGKVHSYQKRNADAVIDY-XXXXXXXXXXRYYLLKKR 578
             WQPVQR RSAGSYGRR+KQRRA+IGKV++YQK+N +A ID            +YY+LKKR
Sbjct:  1249 WQPVQRPRSAGSYGRRMKQRRASIGKVYTYQKKNVEADIDNPLFQNATQQNDKYYILKKR 1308

Query:   579 AVSHGSSADHH-PVTTFHGTKFGXXXXXXXXXXXXS-MPSS--AKTGTVEASINGXXXXX 634
               S+ S ADHH P  T  GTKFG            S  PSS  AKT    +  +G     
Sbjct:  1309 TASYSSYADHHSPGLTTQGTKFGRKIVKTLAYRVKSTQPSSGNAKTAGETSEEDGLKTDA 1368

Query:   635 XXXX--XXXXXXXNDTSSVKNSIISLGKSPSYKEVAVAPPGTIAMLQVRVPQSDNPDNQE 692
                          ++    KNS++SLGKSPSYKEVA+APPG+IA  QV VPQ++  D QE
Sbjct:  1369 SSVEPPTLSSTVQSEAYHTKNSVVSLGKSPSYKEVALAPPGSIAKYQVWVPQAEVSDKQE 1428

Query:   693 FSFGKPEDGTMEEKENVNTNVTGAEKTNEEKSDSVLDATDNLKEETGVHPNREETHISDG 752
                    D  ME+K    T++   E T +E+  + L+  + +K+E    P   E++I+ G
Sbjct:  1429 -------DDEMEKKTEQGTSM---ELTRDEQMITGLE--EEVKKEISADP---ESNITQG 1473

Query:   753 LEDNPXXXXXXXXXXXXXXXDIHKVVQDGILINGIPNSIDSPTSEFYEKDSSESIESHDN 812
              E+                  I++  + G    GI    +    E      ++ I S   
Sbjct:  1474 EEE--IKVELQPSEGVLGGSHINENDESG---GGIQVE-EQVEVELINDGVTDMIHSTRE 1527

Query:   813 TKSTLQVV---DDLKEKPSVF--NPGD-TRGL-PNRKLSASAVPFN 851
              +   Q+    +DLK K S+   + GD +RGL PN+KLSASA PFN
Sbjct:  1528 QQVIDQLAADSEDLKAKLSISTTDSGDASRGLLPNKKLSASAAPFN 1573
GO:0005737 "cytoplasm" evidence=ISM
GO:0016556 "mRNA modification" evidence=RCA
TAIR|locus:2037783 AT1G15290 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0292806 cluA "CluA protein" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
UNIPROTKB|B4GAM1 clu "Protein clueless" [Drosophila persimilis (taxid:7234)] Back     alignment and assigned GO terms
UNIPROTKB|B4MY63 clu "Protein clueless" [Drosophila willistoni (taxid:7260)] Back     alignment and assigned GO terms
UNIPROTKB|Q291J5 clu "Protein clueless" [Drosophila pseudoobscura pseudoobscura (taxid:46245)] Back     alignment and assigned GO terms
UNIPROTKB|B4KT50 clu "Protein clueless" [Drosophila mojavensis (taxid:7230)] Back     alignment and assigned GO terms
UNIPROTKB|B4JW99 clu "Protein clueless" [Drosophila grimshawi (taxid:7222)] Back     alignment and assigned GO terms
UNIPROTKB|B3MIW0 clu "Protein clueless" [Drosophila ananassae (taxid:7217)] Back     alignment and assigned GO terms
UNIPROTKB|B4LQ23 clu "Protein clueless" [Drosophila virilis (taxid:7244)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1155
pfam12807169 pfam12807, eIF3_p135, Translation initiation facto 2e-35
pfam1342478 pfam13424, TPR_12, Tetratricopeptide repeat 6e-15
pfam1342478 pfam13424, TPR_12, Tetratricopeptide repeat 4e-13
pfam1342478 pfam13424, TPR_12, Tetratricopeptide repeat 6e-12
cd00189100 cd00189, TPR, Tetratricopeptide repeat domain; typ 3e-11
COG0457291 COG0457, NrfG, FOG: TPR repeat [General function p 2e-09
COG0457291 COG0457, NrfG, FOG: TPR repeat [General function p 1e-08
cd00189100 cd00189, TPR, Tetratricopeptide repeat domain; typ 3e-08
pfam1337442 pfam13374, TPR_10, Tetratricopeptide repeat 5e-08
COG0457291 COG0457, NrfG, FOG: TPR repeat [General function p 7e-08
pfam1342478 pfam13424, TPR_12, Tetratricopeptide repeat 2e-07
cd00189100 cd00189, TPR, Tetratricopeptide repeat domain; typ 1e-06
pfam1337442 pfam13374, TPR_10, Tetratricopeptide repeat 1e-06
pfam13908177 pfam13908, Shisa, Wnt and FGF inhibitory regulator 8e-05
pfam1341469 pfam13414, TPR_11, TPR repeat 9e-05
PRK10263 1355 PRK10263, PRK10263, DNA translocase FtsK; Provisio 4e-04
TIGR02521234 TIGR02521, type_IV_pilW, type IV pilus biogenesis/ 0.001
PHA032473151 PHA03247, PHA03247, large tegument protein UL36; P 0.004
>gnl|CDD|221783 pfam12807, eIF3_p135, Translation initiation factor eIF3 subunit 135 Back     alignment and domain information 
 Score =  132 bits (334), Expect = 2e-35
 Identities = 46/154 (29%), Positives = 75/154 (48%), Gaps = 22/154 (14%)

Query: 1   MHTRGLQMRSLGHVVKLSEK-LSHVQSLCIHEMIVRAFKHIIQAVISAVGNTQRMAVSIA 59
           +H RG+ MR LG V KL+ K L H++ LC+ EMI RA KHI++  +  V     ++ +I+
Sbjct: 17  LHRRGINMRYLGKVAKLASKRLPHLKRLCVSEMIARAAKHILRTYLRGV-PAPDLSAAIS 75

Query: 60  AALNLMLGVH-ESDGLNKSHNVHPL----------------VWRWLELFLMKRYEWDLNG 102
             LN +LG     D   +                       +W  +E     R+ ++L  
Sbjct: 76  HFLNCLLGSESNPDPEAEIDESRSASYPEDDFAWEKLTPEELWSEIEKEAKDRFRYELKE 135

Query: 103 LNF---KDVRKFAILRGLCHKVGIELVSRDFDMD 133
                   ++K ++LR +C KVGI+L+ R++D D
Sbjct: 136 DWKDEQYGLQKISLLREICLKVGIQLLLREYDFD 169

Translation initiation factor eIF3 is a multi-subunit protein complex required for initiation of protein biosynthesis in eukaryotic cells. The complex promotes ribosome dissociation, the binding of the initiator methionyl-tRNA to the 40 S ribosomal subunit, and mRNA recruitment to the ribosome. The protein product from TIF31 genes in yeast is p135 which associates with the eIF3 but does not seem to be necessary for protein translation initiation. Length = 169
>gnl|CDD|205602 pfam13424, TPR_12, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|205602 pfam13424, TPR_12, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|205602 pfam13424, TPR_12, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here Back     alignment and domain information
>gnl|CDD|223533 COG0457, NrfG, FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|223533 COG0457, NrfG, FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here Back     alignment and domain information
>gnl|CDD|205553 pfam13374, TPR_10, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|223533 COG0457, NrfG, FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|205602 pfam13424, TPR_12, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here Back     alignment and domain information
>gnl|CDD|205553 pfam13374, TPR_10, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|222449 pfam13908, Shisa, Wnt and FGF inhibitory regulator Back     alignment and domain information
>gnl|CDD|222112 pfam13414, TPR_11, TPR repeat Back     alignment and domain information
>gnl|CDD|236669 PRK10263, PRK10263, DNA translocase FtsK; Provisional Back     alignment and domain information
>gnl|CDD|131573 TIGR02521, type_IV_pilW, type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 1155
KOG18391236 consensus Uncharacterized protein CLU1/cluA/TIF31 99.97
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 99.95
PF12807169 eIF3_p135: Translation initiation factor eIF3 subu 99.93
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 99.88
KOG4626966 consensus O-linked N-acetylglucosamine transferase 99.87
KOG4626966 consensus O-linked N-acetylglucosamine transferase 99.85
KOG18391236 consensus Uncharacterized protein CLU1/cluA/TIF31 99.77
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 99.77
KOG1130639 consensus Predicted G-alpha GTPase interaction pro 99.72
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 99.7
KOG1130639 consensus Predicted G-alpha GTPase interaction pro 99.68
KOG1126638 consensus DNA-binding cell division cycle control 99.64
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.62
PRK11788389 tetratricopeptide repeat protein; Provisional 99.57
PRK11788389 tetratricopeptide repeat protein; Provisional 99.57
PRK15174656 Vi polysaccharide export protein VexE; Provisional 99.55
PRK11189296 lipoprotein NlpI; Provisional 99.51
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 99.51
KOG20021018 consensus TPR-containing nuclear phosphoprotein th 99.51
PRK15174656 Vi polysaccharide export protein VexE; Provisional 99.5
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 99.5
PRK114471157 cellulose synthase subunit BcsC; Provisional 99.49
KOG0547606 consensus Translocase of outer mitochondrial membr 99.47
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 99.47
PRK114471157 cellulose synthase subunit BcsC; Provisional 99.47
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 99.46
KOG1126638 consensus DNA-binding cell division cycle control 99.43
PRK09782987 bacteriophage N4 receptor, outer membrane subunit; 99.42
PRK12370553 invasion protein regulator; Provisional 99.4
PRK12370553 invasion protein regulator; Provisional 99.39
PRK11189296 lipoprotein NlpI; Provisional 99.39
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 99.39
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 99.38
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 99.38
PRK09782987 bacteriophage N4 receptor, outer membrane subunit; 99.37
KOG2003840 consensus TPR repeat-containing protein [General f 99.35
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 99.35
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.35
PRK04841903 transcriptional regulator MalT; Provisional 99.33
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 99.27
KOG1129478 consensus TPR repeat-containing protein [General f 99.26
KOG0547606 consensus Translocase of outer mitochondrial membr 99.26
PRK10049765 pgaA outer membrane protein PgaA; Provisional 99.23
KOG20021018 consensus TPR-containing nuclear phosphoprotein th 99.23
KOG1125579 consensus TPR repeat-containing protein [General f 99.22
KOG1941518 consensus Acetylcholine receptor-associated protei 99.22
PRK10049765 pgaA outer membrane protein PgaA; Provisional 99.21
KOG2003840 consensus TPR repeat-containing protein [General f 99.2
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 99.19
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.18
cd05804355 StaR_like StaR_like; a well-conserved protein foun 99.17
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 99.17
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 99.17
KOG1125579 consensus TPR repeat-containing protein [General f 99.15
KOG0624504 consensus dsRNA-activated protein kinase inhibitor 99.14
PRK04841903 transcriptional regulator MalT; Provisional 99.14
KOG1941518 consensus Acetylcholine receptor-associated protei 99.14
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 99.12
cd05804355 StaR_like StaR_like; a well-conserved protein foun 99.06
KOG2076895 consensus RNA polymerase III transcription factor 99.06
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 99.05
KOG1129478 consensus TPR repeat-containing protein [General f 99.05
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 99.05
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.03
PRK15359144 type III secretion system chaperone protein SscB; 99.0
PRK15179694 Vi polysaccharide biosynthesis protein TviE; Provi 98.99
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 98.98
PRK10747398 putative protoheme IX biogenesis protein; Provisio 98.96
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 98.95
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 98.95
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 98.95
CHL00033168 ycf3 photosystem I assembly protein Ycf3 98.92
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 98.92
PRK15179694 Vi polysaccharide biosynthesis protein TviE; Provi 98.91
KOG4162799 consensus Predicted calmodulin-binding protein [Si 98.9
CHL00033168 ycf3 photosystem I assembly protein Ycf3 98.9
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 98.89
PRK10370198 formate-dependent nitrite reductase complex subuni 98.88
PRK15359144 type III secretion system chaperone protein SscB; 98.87
PRK10747398 putative protoheme IX biogenesis protein; Provisio 98.87
PRK10370198 formate-dependent nitrite reductase complex subuni 98.85
PLN02789320 farnesyltranstransferase 98.82
KOG0553304 consensus TPR repeat-containing protein [General f 98.79
PF12569517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 98.78
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 98.78
TIGR02552135 LcrH_SycD type III secretion low calcium response 98.77
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 98.77
PRK14574822 hmsH outer membrane protein; Provisional 98.75
PRK02603172 photosystem I assembly protein Ycf3; Provisional 98.74
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 98.73
KOG0495913 consensus HAT repeat protein [RNA processing and m 98.72
PRK14720906 transcript cleavage factor/unknown domain fusion p 98.7
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 98.7
KOG1156700 consensus N-terminal acetyltransferase [Chromatin 98.7
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 98.7
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 98.69
PRK02603172 photosystem I assembly protein Ycf3; Provisional 98.69
PLN032181060 maturation of RBCL 1; Provisional 98.69
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 98.67
TIGR02552135 LcrH_SycD type III secretion low calcium response 98.67
KOG2076895 consensus RNA polymerase III transcription factor 98.66
PLN03088356 SGT1, suppressor of G2 allele of SKP1; Provisional 98.65
PLN032181060 maturation of RBCL 1; Provisional 98.64
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 98.64
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 98.63
PLN02789320 farnesyltranstransferase 98.58
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 98.58
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 98.58
KOG0553304 consensus TPR repeat-containing protein [General f 98.58
PRK14574822 hmsH outer membrane protein; Provisional 98.56
KOG2376652 consensus Signal recognition particle, subunit Srp 98.56
KOG1128777 consensus Uncharacterized conserved protein, conta 98.53
PLN03081697 pentatricopeptide (PPR) repeat-containing protein; 98.52
KOG2376652 consensus Signal recognition particle, subunit Srp 98.51
KOG1585308 consensus Protein required for fusion of vesicles 98.51
PLN03081697 pentatricopeptide (PPR) repeat-containing protein; 98.51
PLN03088356 SGT1, suppressor of G2 allele of SKP1; Provisional 98.5
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 98.46
KOG11271238 consensus TPR repeat-containing protein [RNA proce 98.46
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 98.45
KOG0624504 consensus dsRNA-activated protein kinase inhibitor 98.43
KOG0495913 consensus HAT repeat protein [RNA processing and m 98.42
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 98.4
KOG1585308 consensus Protein required for fusion of vesicles 98.39
COG4783484 Putative Zn-dependent protease, contains TPR repea 98.38
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 98.37
cd00189100 TPR Tetratricopeptide repeat domain; typically con 98.37
PLN03077857 Protein ECB2; Provisional 98.35
KOG2047835 consensus mRNA splicing factor [RNA processing and 98.35
cd00189100 TPR Tetratricopeptide repeat domain; typically con 98.34
PRK10153517 DNA-binding transcriptional activator CadC; Provis 98.29
PLN03077857 Protein ECB2; Provisional 98.28
KOG36171416 consensus WD40 and TPR repeat-containing protein [ 98.28
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 98.25
KOG11271238 consensus TPR repeat-containing protein [RNA proce 98.24
KOG4162799 consensus Predicted calmodulin-binding protein [Si 98.24
KOG1128777 consensus Uncharacterized conserved protein, conta 98.22
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 98.21
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 98.21
KOG3060289 consensus Uncharacterized conserved protein [Funct 98.19
PRK14720906 transcript cleavage factor/unknown domain fusion p 98.19
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 98.18
COG0457291 NrfG FOG: TPR repeat [General function prediction 98.18
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 98.17
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 98.16
KOG36161636 consensus Selective LIM binding factor [Transcript 98.16
PF12688120 TPR_5: Tetratrico peptide repeat 98.16
PRK10803263 tol-pal system protein YbgF; Provisional 98.15
PRK10803263 tol-pal system protein YbgF; Provisional 98.15
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 98.14
PF12688120 TPR_5: Tetratrico peptide repeat 98.12
KOG3060289 consensus Uncharacterized conserved protein [Funct 98.08
KOG1156700 consensus N-terminal acetyltransferase [Chromatin 98.07
KOG4340459 consensus Uncharacterized conserved protein [Funct 98.05
KOG36171416 consensus WD40 and TPR repeat-containing protein [ 98.03
PRK10153517 DNA-binding transcriptional activator CadC; Provis 98.0
PRK11906458 transcriptional regulator; Provisional 98.0
KOG4555175 consensus TPR repeat-containing protein [Function 97.97
COG4783484 Putative Zn-dependent protease, contains TPR repea 97.95
COG4105254 ComL DNA uptake lipoprotein [General function pred 97.91
KOG3785557 consensus Uncharacterized conserved protein [Funct 97.89
KOG1586288 consensus Protein required for fusion of vesicles 97.88
KOG1586288 consensus Protein required for fusion of vesicles 97.88
PF12569517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 97.86
KOG36161636 consensus Selective LIM binding factor [Transcript 97.84
COG1729262 Uncharacterized protein conserved in bacteria [Fun 97.82
COG2909894 MalT ATP-dependent transcriptional regulator [Tran 97.8
KOG2300629 consensus Uncharacterized conserved protein [Funct 97.8
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 97.79
PRK15331165 chaperone protein SicA; Provisional 97.77
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 97.76
KOG2047835 consensus mRNA splicing factor [RNA processing and 97.76
KOG4555175 consensus TPR repeat-containing protein [Function 97.76
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 97.75
COG0457291 NrfG FOG: TPR repeat [General function prediction 97.75
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 97.74
PF08631278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 97.73
COG4785297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 97.71
KOG2300629 consensus Uncharacterized conserved protein [Funct 97.71
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 97.68
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 97.68
PLN03098453 LPA1 LOW PSII ACCUMULATION1; Provisional 97.64
COG1729262 Uncharacterized protein conserved in bacteria [Fun 97.62
COG4785297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 97.6
COG4235287 Cytochrome c biogenesis factor [Posttranslational 97.6
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 97.59
PRK11906458 transcriptional regulator; Provisional 97.59
KOG3785557 consensus Uncharacterized conserved protein [Funct 97.58
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 97.55
PLN03098453 LPA1 LOW PSII ACCUMULATION1; Provisional 97.52
COG5159421 RPN6 26S proteasome regulatory complex component [ 97.5
KOG4234271 consensus TPR repeat-containing protein [General f 97.47
KOG1915677 consensus Cell cycle control protein (crooked neck 97.44
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 97.43
KOG4648536 consensus Uncharacterized conserved protein, conta 97.43
PRK15331165 chaperone protein SicA; Provisional 97.42
PF13512142 TPR_18: Tetratricopeptide repeat 97.41
PF10345608 Cohesin_load: Cohesin loading factor; InterPro: IP 97.39
KOG4340459 consensus Uncharacterized conserved protein [Funct 97.37
COG4700251 Uncharacterized protein conserved in bacteria cont 97.36
KOG4234271 consensus TPR repeat-containing protein [General f 97.34
COG4235287 Cytochrome c biogenesis factor [Posttranslational 97.34
KOG2471696 consensus TPR repeat-containing protein [General f 97.33
PF13512142 TPR_18: Tetratricopeptide repeat 97.31
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 97.3
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 97.27
KOG2796366 consensus Uncharacterized conserved protein [Funct 97.21
KOG4642284 consensus Chaperone-dependent E3 ubiquitin protein 97.18
KOG1915677 consensus Cell cycle control protein (crooked neck 97.16
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 97.13
PF1337173 TPR_9: Tetratricopeptide repeat 97.12
COG4105254 ComL DNA uptake lipoprotein [General function pred 97.11
PF1337173 TPR_9: Tetratricopeptide repeat 97.1
PF12968144 DUF3856: Domain of Unknown Function (DUF3856); Int 97.1
PF09986214 DUF2225: Uncharacterized protein conserved in bact 97.09
COG2909894 MalT ATP-dependent transcriptional regulator [Tran 97.09
PF13281374 DUF4071: Domain of unknown function (DUF4071) 97.07
PF04184539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 97.04
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 96.97
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 96.96
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 96.96
PF10345608 Cohesin_load: Cohesin loading factor; InterPro: IP 96.96
PF09986214 DUF2225: Uncharacterized protein conserved in bact 96.95
KOG4648536 consensus Uncharacterized conserved protein, conta 96.95
KOG1463411 consensus 26S proteasome regulatory complex, subun 96.93
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 96.86
KOG20411189 consensus WD40 repeat protein [General function pr 96.84
COG4700251 Uncharacterized protein conserved in bacteria cont 96.83
PF12968144 DUF3856: Domain of Unknown Function (DUF3856); Int 96.8
PF02259352 FAT: FAT domain; InterPro: IPR003151 The FAT domai 96.8
KOG4642284 consensus Chaperone-dependent E3 ubiquitin protein 96.78
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 96.7
KOG2796366 consensus Uncharacterized conserved protein [Funct 96.62
COG3898531 Uncharacterized membrane-bound protein [Function u 96.6
PF03704146 BTAD: Bacterial transcriptional activator domain; 96.6
KOG2471696 consensus TPR repeat-containing protein [General f 96.54
PF08631278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 96.43
KOG1464440 consensus COP9 signalosome, subunit CSN2 [Posttran 96.34
PF03704146 BTAD: Bacterial transcriptional activator domain; 96.33
KOG2610491 consensus Uncharacterized conserved protein [Funct 96.33
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 96.32
PF04184539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 96.26
KOG0545329 consensus Aryl-hydrocarbon receptor-interacting pr 96.2
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 96.17
KOG1464440 consensus COP9 signalosome, subunit CSN2 [Posttran 96.09
KOG0551390 consensus Hsp90 co-chaperone CNS1 (contains TPR re 95.87
PF1286294 Apc5: Anaphase-promoting complex subunit 5 95.82
KOG1550552 consensus Extracellular protein SEL-1 and related 95.8
KOG0545329 consensus Aryl-hydrocarbon receptor-interacting pr 95.76
PF1286294 Apc5: Anaphase-promoting complex subunit 5 95.76
COG0790292 FOG: TPR repeat, SEL1 subfamily [General function 95.72
PF02259352 FAT: FAT domain; InterPro: IPR003151 The FAT domai 95.72
KOG2610491 consensus Uncharacterized conserved protein [Funct 95.63
COG3118304 Thioredoxin domain-containing protein [Posttransla 95.61
COG2976207 Uncharacterized protein conserved in bacteria [Fun 95.6
KOG09851666 consensus Vesicle coat protein clathrin, heavy cha 95.56
PF04910360 Tcf25: Transcriptional repressor TCF25; InterPro: 95.55
PF06552186 TOM20_plant: Plant specific mitochondrial import r 95.46
KOG0551390 consensus Hsp90 co-chaperone CNS1 (contains TPR re 95.46
COG2976207 Uncharacterized protein conserved in bacteria [Fun 95.46
PF11817247 Foie-gras_1: Foie gras liver health family 1; Inte 95.3
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 95.27
KOG2053932 consensus Mitochondrial inheritance and actin cyto 95.24
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 95.18
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 95.18
COG0790292 FOG: TPR repeat, SEL1 subfamily [General function 95.14
COG5159421 RPN6 26S proteasome regulatory complex component [ 95.13
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 95.02
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 94.98
COG3898531 Uncharacterized membrane-bound protein [Function u 94.93
PF05843280 Suf: Suppressor of forked protein (Suf); InterPro: 94.83
PF12739414 TRAPPC-Trs85: ER-Golgi trafficking TRAPP I complex 94.59
PF13281374 DUF4071: Domain of unknown function (DUF4071) 94.57
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 94.56
KOG0376476 consensus Serine-threonine phosphatase 2A, catalyt 94.5
PF00244236 14-3-3: 14-3-3 protein; InterPro: IPR023410 The 14 94.5
PF086261185 TRAPPC9-Trs120: Transport protein Trs120 or TRAPPC 94.36
PF06552186 TOM20_plant: Plant specific mitochondrial import r 94.35
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 94.25
KOG1550552 consensus Extracellular protein SEL-1 and related 94.17
PF05843280 Suf: Suppressor of forked protein (Suf); InterPro: 94.15
PF1342844 TPR_14: Tetratricopeptide repeat 94.14
KOG15381081 consensus Uncharacterized conserved protein WDR10, 94.1
PF1343134 TPR_17: Tetratricopeptide repeat 94.07
PF1342844 TPR_14: Tetratricopeptide repeat 94.0
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 93.72
PF1343134 TPR_17: Tetratricopeptide repeat 93.69
KOG4014248 consensus Uncharacterized conserved protein (conta 93.56
PF04910360 Tcf25: Transcriptional repressor TCF25; InterPro: 93.45
KOG4322482 consensus Anaphase-promoting complex (APC), subuni 93.41
KOG4322482 consensus Anaphase-promoting complex (APC), subuni 93.18
KOG1308377 consensus Hsp70-interacting protein Hip/Transient 93.14
KOG1463411 consensus 26S proteasome regulatory complex, subun 93.08
KOG4814872 consensus Uncharacterized conserved protein [Funct 92.95
KOG3783546 consensus Uncharacterized conserved protein [Funct 92.91
KOG2053932 consensus Mitochondrial inheritance and actin cyto 92.86
KOG0376476 consensus Serine-threonine phosphatase 2A, catalyt 92.84
KOG2581493 consensus 26S proteasome regulatory complex, subun 92.83
PF12739414 TRAPPC-Trs85: ER-Golgi trafficking TRAPP I complex 92.77
KOG15381081 consensus Uncharacterized conserved protein WDR10, 92.34
KOG20411189 consensus WD40 repeat protein [General function pr 92.25
PF08424321 NRDE-2: NRDE-2, necessary for RNA interference; In 92.18
KOG2581493 consensus 26S proteasome regulatory complex, subun 91.88
PF086261185 TRAPPC9-Trs120: Transport protein Trs120 or TRAPPC 91.84
KOG4014248 consensus Uncharacterized conserved protein (conta 91.79
KOG2561568 consensus Adaptor protein NUB1, contains UBA domai 91.71
PF09670379 Cas_Cas02710: CRISPR-associated protein (Cas_Cas02 91.62
PF11817247 Foie-gras_1: Foie gras liver health family 1; Inte 91.55
KOG4814872 consensus Uncharacterized conserved protein [Funct 91.32
KOG19201265 consensus IkappaB kinase complex, IKAP component [ 91.28
PF04190260 DUF410: Protein of unknown function (DUF410) ; Int 91.22
PF1057980 Rapsyn_N: Rapsyn N-terminal myristoylation and lin 91.02
KOG4563400 consensus Cell cycle-regulated histone H1-binding 91.02
KOG08902382 consensus Protein kinase of the PI-3 kinase family 91.01
KOG1914656 consensus mRNA cleavage and polyadenylation factor 90.99
PF11207203 DUF2989: Protein of unknown function (DUF2989); In 90.79
KOG1308377 consensus Hsp70-interacting protein Hip/Transient 90.66
COG52901243 IkappaB kinase complex, IKAP component [Transcript 90.52
COG3118304 Thioredoxin domain-containing protein [Posttransla 90.5
KOG09851666 consensus Vesicle coat protein clathrin, heavy cha 90.27
PF08424321 NRDE-2: NRDE-2, necessary for RNA interference; In 89.84
PF1057980 Rapsyn_N: Rapsyn N-terminal myristoylation and lin 89.69
PF04781111 DUF627: Protein of unknown function (DUF627); Inte 89.56
smart00101244 14_3_3 14-3-3 homologues. 14-3-3 homologues mediat 89.37
KOG45211480 consensus Nuclear pore complex, Nup160 component [ 88.57
KOG0686466 consensus COP9 signalosome, subunit CSN1 [Posttran 88.48
PF04190260 DUF410: Protein of unknown function (DUF410) ; Int 88.42
KOG2561568 consensus Adaptor protein NUB1, contains UBA domai 88.34
PF1317433 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ 88.11
KOG3783546 consensus Uncharacterized conserved protein [Funct 87.84
KOG4507886 consensus Uncharacterized conserved protein, conta 87.69
PF15015569 NYD-SP12_N: Spermatogenesis-associated, N-terminal 87.01
PF1317433 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ 86.47
KOG0687393 consensus 26S proteasome regulatory complex, subun 86.45
COG5187412 RPN7 26S proteasome regulatory complex component, 85.94
KOG1914656 consensus mRNA cleavage and polyadenylation factor 85.9
smart0002834 TPR Tetratricopeptide repeats. Repeats present in 85.63
PF04781111 DUF627: Protein of unknown function (DUF627); Inte 85.63
PF1051638 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetrat 85.45
KOG3807556 consensus Predicted membrane protein ST7 (tumor su 85.4
PF10952140 DUF2753: Protein of unknown function (DUF2753); In 85.39
PF1051638 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetrat 85.25
KOG0508615 consensus Ankyrin repeat protein [General function 85.07
KOG0508615 consensus Ankyrin repeat protein [General function 84.96
KOG1258577 consensus mRNA processing protein [RNA processing 84.73
KOG0686466 consensus COP9 signalosome, subunit CSN1 [Posttran 84.35
smart0002834 TPR Tetratricopeptide repeats. Repeats present in 84.32
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 84.29
COG5187412 RPN7 26S proteasome regulatory complex component, 83.87
KOG2422665 consensus Uncharacterized conserved protein [Funct 83.4
KOG1924 1102 consensus RhoA GTPase effector DIA/Diaphanous [Sig 83.13
KOG4507886 consensus Uncharacterized conserved protein, conta 82.8
COG4649221 Uncharacterized protein conserved in bacteria [Fun 82.24
KOG03071049 consensus Vesicle coat complex COPII, subunit SEC3 81.9
PF11207203 DUF2989: Protein of unknown function (DUF2989); In 81.6
KOG2114933 consensus Vacuolar assembly/sorting protein PEP5/V 81.41
PF09670379 Cas_Cas02710: CRISPR-associated protein (Cas_Cas02 80.97
PF1485353 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repe 80.84
PRK13184932 pknD serine/threonine-protein kinase; Reviewed 80.73
KOG19241102 consensus RhoA GTPase effector DIA/Diaphanous [Sig 80.38
PF15015569 NYD-SP12_N: Spermatogenesis-associated, N-terminal 80.2
KOG08902382 consensus Protein kinase of the PI-3 kinase family 80.19
KOG2908380 consensus 26S proteasome regulatory complex, subun 80.11
>KOG1839 consensus Uncharacterized protein CLU1/cluA/TIF31 involved in mitochondrial morphology/distribution, also found associated with eIF-3 [General function prediction only] Back     alignment and domain information 
Probab=99.97  E-value=9.8e-31  Score=324.77  Aligned_cols=389  Identities=29%  Similarity=0.437  Sum_probs=353.8

Q ss_pred             CCccCcchhhhHHHHHHhh-------chhHHHHHHHHHHHHHHHHHHHHHHHhhcCCHHHHHHHHHHHHHhhhcCcCCcc
Q 001110            1 MHTRGLQMRSLGHVVKLSE-------KLSHVQSLCIHEMIVRAFKHIIQAVISAVGNTQRMAVSIAAALNLMLGVHESDG   73 (1155)
Q Consensus         1 mH~rGINmRYLG~V~~l~~-------kl~hl~~L~~~EMIaRsaKhIlR~~l~~l~~~~~la~aIshfLNcLLG~~~~~~   73 (1155)
                      ||..|||+||||+++.++.       .+.++.+|++.|+++|++||+++.+++.+. ..++..+++|||||+|+..++..
T Consensus       727 L~~~g~n~ryLg~~~~~~~~~~~a~~~~v~l~~l~~~ei~~RslKhvlK~~~r~l~-~~~i~ta~SH~ln~~ls~~~~av  805 (1236)
T KOG1839|consen  727 LHYVGRNLRYLGKTCGLSHPNTAATYINVALMELGVGEIALRSLKHVLKDNLRLLG-ADHIQTAASHALNCLLSVMEAAV  805 (1236)
T ss_pred             HHHhhHHHHHhhccccccCccccchhhhHHHHHHHHHHHHHHHHHHHHHHHHhhcc-hhHHHHHHHHHHHHHhhcccccC
Confidence            7999999999999999763       367889999999999999999999999854 78999999999999999854411


Q ss_pred             Cc----------C---------------------CCCccHHHHHHHHHHHHHhhchhhcccccc------ccchHHHHHH
Q 001110           74 LN----------K---------------------SHNVHPLVWRWLELFLMKRYEWDLNGLNFK------DVRKFAILRG  116 (1155)
Q Consensus        74 ~~----------~---------------------s~~~~~llwk~I~~~lk~rf~y~l~~~~~~------~l~kl~LLre  116 (1155)
                      ..          +                     ..-....+|++|+...+.+|++.+......      ...++...+.
T Consensus       806 ~~~~t~~~~~ka~~~~~~~~~~g~~k~~~S~~s~~~l~~s~L~~~I~~d~~~~~~~~~~~~~~~~i~~~~~~~~~~~~~~  885 (1236)
T KOG1839|consen  806 QKEQTTLEILKAKDLRTQDAAAGTPKPDASISSKGHLSVSDLLKYITADSKNKFTAAHDVKSRETILLKNGKSKIAVEKL  885 (1236)
T ss_pred             CCccchHHHHhhhhhhhhhhccCCCCcccccccccccchhHHHHhccccccccccchhhhhHHHHHhhhcccchhHHHHH
Confidence            00          0                     011234699999999998898887754332      3457788899


Q ss_pred             HHHHHhHHHhhcccCCCCC---CCchHHhHHhhchhhhhhcCChHHHHHHHHHHHHHHHcCCHHHHHHHHHHHHHHHHHh
Q 001110          117 LCHKVGIELVSRDFDMDSP---SPFRKIDVVSLVPVHKQAACSSADGRQLLESSKTALDKGKLEDAVTYGTKALAKLVAV  193 (1155)
Q Consensus       117 L~~k~GiqL~ardY~fd~a---~~f~~eDI~~L~pi~K~~~~~s~~A~~Ll~lG~~yl~~GdyeeAle~~~eALel~e~i  193 (1155)
                      .|.+.|++..++.|+++..   ..|...||.++.|++++.......+...++.|+.....|.+.+|.+ .-+++.++..+
T Consensus       886 ~~~~~~i~~~~r~~~~e~~~~ks~f~~~Di~~~~p~ik~s~P~~~~a~~~~e~gq~~~~e~~~~~~~~-~~~slnl~~~v  964 (1236)
T KOG1839|consen  886 EKKKRELQKPARNYDFESSEPKSEFNDSDILNLRPVIKHSSPTVSEAKDSPEQGQEALLEDGFSEAYE-LPESLNLLNNV  964 (1236)
T ss_pred             HHHhhhcchhhhhccccccCCCCCCCcccccccccccccCCCccchhhhhhhhhhhhhcccchhhhhh-hhhhhhHHHHh
Confidence            9999999999999999884   7899999999999999999999999999999999999999999999 99999999999


Q ss_pred             cCCCChhhHHHHHHHHHHHHhcCCHHHHHHHHHHHHHHHHHhcCCCChhhHHHHHHHHHHHHHcCCHHHHHHHHHHHHHH
Q 001110          194 CGPYHRMTAGAYSLLAVVLYHTGDFNQATIYQQKALDINERELGLDHPDTMKSYGDLAVFYYRLQHTELALKYVKRALYL  273 (1155)
Q Consensus       194 ~G~d~p~~A~al~nLG~vy~~~GdydeAle~~eKALei~er~lG~D~p~~a~ay~nLA~iy~~lG~yeeAle~yekALei  273 (1155)
                      +|..|+..+.+|..|+.++..+|++++|+.+.++|.-+.++.+|.|++.+...|.+|+...+..++...|+..+.+++++
T Consensus       965 ~~~~h~~~~~~~~~La~l~~~~~d~~~Ai~~~~ka~ii~eR~~g~ds~~t~~~y~nlal~~f~~~~~~~al~~~~ra~~l 1044 (1236)
T KOG1839|consen  965 MGVLHPEVASKYRSLAKLSNRLGDNQEAIAQQRKACIISERVLGKDSPNTKLAYGNLALYEFAVKNLSGALKSLNRALKL 1044 (1236)
T ss_pred             hhhcchhHHHHHHHHHHHHhhhcchHHHHHhcccceeeechhccCCCHHHHHHhhHHHHHHHhccCccchhhhHHHHHHh
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHhcCCCChhHHHHHHHHHHHHHHCCChHHHHHHHHHHHHHHHHhcCCCcHHHHHHHHHHHHHHHHcCChhHHHHHHHH
Q 001110          274 LHLTCGPSHPNTAATYINVAMMEEGLGNVHVALRYLHKALKCNQRLLGPDHIQTAASYHAIAIALSLMEAYPLSVQHEQT  353 (1155)
Q Consensus       274 ~e~l~G~dhp~~a~a~~nLA~iy~~lG~~deAle~lekALei~ek~lG~dhp~~a~a~~nLA~iy~~lGdyeeAle~lkk  353 (1155)
                      +...+|++||..+.+..+++.++...++++.|+++++.|+++.++++|+.+..++.++..+|+++..++++..|+.+.+.
T Consensus      1045 ~~Ls~ge~hP~~a~~~~nle~l~~~v~e~d~al~~le~A~a~~~~v~g~~~l~~~~~~~~~a~l~~s~~dfr~al~~ek~ 1124 (1236)
T KOG1839|consen 1045 KLLSSGEDHPPTALSFINLELLLLGVEEADTALRYLESALAKNKKVLGPKELETALSYHALARLFESMKDFRNALEHEKV 1124 (1236)
T ss_pred             hccccCCCCCchhhhhhHHHHHHhhHHHHHHHHHHHHHHHHHHhhhcCccchhhhhHHHHHHHHHhhhHHHHHHHHHHhh
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHcCCCCHHHHHHHHHHHHHHHHhHHHHHHHH
Q 001110          354 TLQILRAKLGPDDLRTQDAAAWLEYFESKAFEQQEAAR  391 (1155)
Q Consensus       354 ALeI~kk~lG~dh~~t~~al~~La~l~qk~~e~AeAi~  391 (1155)
                      ++.+++..+|++|.++.++..|+..........++++.
T Consensus      1125 t~~iy~~qlg~~hsrt~~S~~~~~~~T~~~v~~Qk~~~ 1162 (1236)
T KOG1839|consen 1125 TYGIYKEQLGPDHSRTKESSEWLNLSTAIAVKIQKKLL 1162 (1236)
T ss_pred             HHHHHHHhhCCCcccchhhHHHHHHhhHHHHHHHHHHH
Confidence            99999999999999999999999877776666655443

>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>PF12807 eIF3_p135: Translation initiation factor eIF3 subunit 135 Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG1839 consensus Uncharacterized protein CLU1/cluA/TIF31 involved in mitochondrial morphology/distribution, also found associated with eIF-3 [General function prediction only] Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1586 consensus Protein required for fusion of vesicles in vesicular transport, alpha-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1586 consensus Protein required for fusion of vesicles in vesicular transport, alpha-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG2909 MalT ATP-dependent transcriptional regulator [Transcription] Back     alignment and domain information
>KOG2300 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG2300 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>COG5159 RPN6 26S proteasome regulatory complex component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4234 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>PF10345 Cohesin_load: Cohesin loading factor; InterPro: IPR019440 Cohesin loading factor is a conserved protein that has been characterised in fungi Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>KOG4234 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2471 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4642 consensus Chaperone-dependent E3 ubiquitin protein ligase (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>PF12968 DUF3856: Domain of Unknown Function (DUF3856); InterPro: IPR024552 This domain of unknown function is found in a small group of tetratricopeptide-like proteins, which includes the uncharacterised protein Q8KAL8 from SWISSPROT Back     alignment and domain information
>PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function Back     alignment and domain information
>COG2909 MalT ATP-dependent transcriptional regulator [Transcription] Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>PF10345 Cohesin_load: Cohesin loading factor; InterPro: IPR019440 Cohesin loading factor is a conserved protein that has been characterised in fungi Back     alignment and domain information
>PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function Back     alignment and domain information
>KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] Back     alignment and domain information
>KOG1463 consensus 26S proteasome regulatory complex, subunit RPN6/PSMD11 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>PF12968 DUF3856: Domain of Unknown Function (DUF3856); InterPro: IPR024552 This domain of unknown function is found in a small group of tetratricopeptide-like proteins, which includes the uncharacterised protein Q8KAL8 from SWISSPROT Back     alignment and domain information
>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases Back     alignment and domain information
>KOG4642 consensus Chaperone-dependent E3 ubiquitin protein ligase (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>KOG2471 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>KOG1464 consensus COP9 signalosome, subunit CSN2 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>KOG0545 consensus Aryl-hydrocarbon receptor-interacting protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>KOG1464 consensus COP9 signalosome, subunit CSN2 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG0551 consensus Hsp90 co-chaperone CNS1 (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12862 Apc5: Anaphase-promoting complex subunit 5 Back     alignment and domain information
>KOG1550 consensus Extracellular protein SEL-1 and related proteins [Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG0545 consensus Aryl-hydrocarbon receptor-interacting protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12862 Apc5: Anaphase-promoting complex subunit 5 Back     alignment and domain information
>COG0790 FOG: TPR repeat, SEL1 subfamily [General function prediction only] Back     alignment and domain information
>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG2976 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF04910 Tcf25: Transcriptional repressor TCF25; InterPro: IPR006994 This entry appears to represent a novel family of basic helix-loop-helix (bHLH) proteins that control differentiation and development of a variety of organs [, ] Back     alignment and domain information
>PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins Back     alignment and domain information
>KOG0551 consensus Hsp90 co-chaperone CNS1 (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG2976 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF11817 Foie-gras_1: Foie gras liver health family 1; InterPro: IPR021773 Mutating the gene foie gras in zebrafish has been shown to affect development; the mutants develop large, lipid-filled hepatocytes in the liver, resembling those in individuals with fatty liver disease [] Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>COG0790 FOG: TPR repeat, SEL1 subfamily [General function prediction only] Back     alignment and domain information
>COG5159 RPN6 26S proteasome regulatory complex component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>PF12739 TRAPPC-Trs85: ER-Golgi trafficking TRAPP I complex 85 kDa subunit; InterPro: IPR024420 This entry represents Trs85, a subunit of the TRAPP III complex [] Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>KOG0376 consensus Serine-threonine phosphatase 2A, catalytic subunit [General function prediction only] Back     alignment and domain information
>PF00244 14-3-3: 14-3-3 protein; InterPro: IPR023410 The 14-3-3 proteins are a large family of approximately 30kDa acidic proteins which exist primarily as homo- and heterodimeric within all eukaryotic cells [, ] Back     alignment and domain information
>PF08626 TRAPPC9-Trs120: Transport protein Trs120 or TRAPPC9, TRAPP II complex subunit; InterPro: IPR013935 The trafficking protein particle complex TRAPP is a multi-protein complex needed in the early stages of the secretory pathway Back     alignment and domain information
>PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>KOG1550 consensus Extracellular protein SEL-1 and related proteins [Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>KOG4014 consensus Uncharacterized conserved protein (contains TPR repeat) [Function unknown] Back     alignment and domain information
>PF04910 Tcf25: Transcriptional repressor TCF25; InterPro: IPR006994 This entry appears to represent a novel family of basic helix-loop-helix (bHLH) proteins that control differentiation and development of a variety of organs [, ] Back     alignment and domain information
>KOG4322 consensus Anaphase-promoting complex (APC), subunit 5 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4322 consensus Anaphase-promoting complex (APC), subunit 5 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1308 consensus Hsp70-interacting protein Hip/Transient component of progesterone receptor complexes and an Hsp70-binding protein [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG1463 consensus 26S proteasome regulatory complex, subunit RPN6/PSMD11 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4814 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3783 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>KOG0376 consensus Serine-threonine phosphatase 2A, catalytic subunit [General function prediction only] Back     alignment and domain information
>KOG2581 consensus 26S proteasome regulatory complex, subunit RPN3/PSMD3 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12739 TRAPPC-Trs85: ER-Golgi trafficking TRAPP I complex 85 kDa subunit; InterPro: IPR024420 This entry represents Trs85, a subunit of the TRAPP III complex [] Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF08424 NRDE-2: NRDE-2, necessary for RNA interference; InterPro: IPR013633 This is domain is found in eukaryotic proteins of unknown function Back     alignment and domain information
>KOG2581 consensus 26S proteasome regulatory complex, subunit RPN3/PSMD3 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF08626 TRAPPC9-Trs120: Transport protein Trs120 or TRAPPC9, TRAPP II complex subunit; InterPro: IPR013935 The trafficking protein particle complex TRAPP is a multi-protein complex needed in the early stages of the secretory pathway Back     alignment and domain information
>KOG4014 consensus Uncharacterized conserved protein (contains TPR repeat) [Function unknown] Back     alignment and domain information
>KOG2561 consensus Adaptor protein NUB1, contains UBA domain [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PF09670 Cas_Cas02710: CRISPR-associated protein (Cas_Cas02710) Back     alignment and domain information
>PF11817 Foie-gras_1: Foie gras liver health family 1; InterPro: IPR021773 Mutating the gene foie gras in zebrafish has been shown to affect development; the mutants develop large, lipid-filled hepatocytes in the liver, resembling those in individuals with fatty liver disease [] Back     alignment and domain information
>KOG4814 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information
>PF04190 DUF410: Protein of unknown function (DUF410) ; InterPro: IPR007317 This is a family of conserved eukaryotic proteins with undetermined function Back     alignment and domain information
>PF10579 Rapsyn_N: Rapsyn N-terminal myristoylation and linker region; InterPro: IPR019568 Neuromuscular junction formation relies upon the clustering of acetylcholine receptors and other proteins in the muscle membrane Back     alignment and domain information
>KOG4563 consensus Cell cycle-regulated histone H1-binding protein [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0890 consensus Protein kinase of the PI-3 kinase family involved in mitotic growth, DNA repair and meiotic recombination [Signal transduction mechanisms; Chromatin structure and dynamics; Replication, recombination and repair; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>PF11207 DUF2989: Protein of unknown function (DUF2989); InterPro: IPR021372 Some members in this bacterial family of proteins are annotated as lipoproteins however this cannot be confirmed Back     alignment and domain information
>KOG1308 consensus Hsp70-interacting protein Hip/Transient component of progesterone receptor complexes and an Hsp70-binding protein [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>COG5290 IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF08424 NRDE-2: NRDE-2, necessary for RNA interference; InterPro: IPR013633 This is domain is found in eukaryotic proteins of unknown function Back     alignment and domain information
>PF10579 Rapsyn_N: Rapsyn N-terminal myristoylation and linker region; InterPro: IPR019568 Neuromuscular junction formation relies upon the clustering of acetylcholine receptors and other proteins in the muscle membrane Back     alignment and domain information
>PF04781 DUF627: Protein of unknown function (DUF627); InterPro: IPR006866 This domain represents the N-terminal region of several plant proteins of unknown function Back     alignment and domain information
>smart00101 14_3_3 14-3-3 homologues Back     alignment and domain information
>KOG4521 consensus Nuclear pore complex, Nup160 component [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0686 consensus COP9 signalosome, subunit CSN1 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PF04190 DUF410: Protein of unknown function (DUF410) ; InterPro: IPR007317 This is a family of conserved eukaryotic proteins with undetermined function Back     alignment and domain information
>KOG2561 consensus Adaptor protein NUB1, contains UBA domain [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A Back     alignment and domain information
>KOG3783 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4507 consensus Uncharacterized conserved protein, contains TPR repeats [Function unknown] Back     alignment and domain information
>PF15015 NYD-SP12_N: Spermatogenesis-associated, N-terminal Back     alignment and domain information
>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A Back     alignment and domain information
>KOG0687 consensus 26S proteasome regulatory complex, subunit RPN7/PSMD6 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5187 RPN7 26S proteasome regulatory complex component, contains PCI domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>smart00028 TPR Tetratricopeptide repeats Back     alignment and domain information
>PF04781 DUF627: Protein of unknown function (DUF627); InterPro: IPR006866 This domain represents the N-terminal region of several plant proteins of unknown function Back     alignment and domain information
>PF10516 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetratrico peptide repeat region (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>KOG3807 consensus Predicted membrane protein ST7 (tumor suppressor in humans) [General function prediction only] Back     alignment and domain information
>PF10952 DUF2753: Protein of unknown function (DUF2753); InterPro: IPR020206 This entry represents a group of uncharacterised proteins Back     alignment and domain information
>PF10516 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetratrico peptide repeat region (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>KOG0508 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0508 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG1258 consensus mRNA processing protein [RNA processing and modification] Back     alignment and domain information
>KOG0686 consensus COP9 signalosome, subunit CSN1 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>smart00028 TPR Tetratricopeptide repeats Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>COG5187 RPN7 26S proteasome regulatory complex component, contains PCI domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2422 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1924 consensus RhoA GTPase effector DIA/Diaphanous [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG4507 consensus Uncharacterized conserved protein, contains TPR repeats [Function unknown] Back     alignment and domain information
>COG4649 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG0307 consensus Vesicle coat complex COPII, subunit SEC31 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF11207 DUF2989: Protein of unknown function (DUF2989); InterPro: IPR021372 Some members in this bacterial family of proteins are annotated as lipoproteins however this cannot be confirmed Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF09670 Cas_Cas02710: CRISPR-associated protein (Cas_Cas02710) Back     alignment and domain information
>PF14853 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repeat; PDB: 1IYG_A 1PC2_A 1NZN_A 3UUX_C 1Y8M_A 2PQR_A 2PQN_A 3O48_A Back     alignment and domain information
>PRK13184 pknD serine/threonine-protein kinase; Reviewed Back     alignment and domain information
>KOG1924 consensus RhoA GTPase effector DIA/Diaphanous [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PF15015 NYD-SP12_N: Spermatogenesis-associated, N-terminal Back     alignment and domain information
>KOG0890 consensus Protein kinase of the PI-3 kinase family involved in mitotic growth, DNA repair and meiotic recombination [Signal transduction mechanisms; Chromatin structure and dynamics; Replication, recombination and repair; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG2908 consensus 26S proteasome regulatory complex, subunit RPN9/PSMD13 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1155
3nf1_A311 Crystal Structure Of The Tpr Domain Of Kinesin Ligh 4e-10
3nf1_A311 Crystal Structure Of The Tpr Domain Of Kinesin Ligh 3e-09
3ceq_A283 The Tpr Domain Of Human Kinesin Light Chain 2 (Hklc 2e-09
3ceq_A283 The Tpr Domain Of Human Kinesin Light Chain 2 (Hklc 4e-07
3edt_B283 Crystal Structure Of The Mutated S328n Hklc2 Tpr Do 2e-09
3edt_B283 Crystal Structure Of The Mutated S328n Hklc2 Tpr Do 2e-07
2fo7_A136 Crystal Structure Of An 8 Repeat Consensus Tpr Supe 2e-04
2fo7_A136 Crystal Structure Of An 8 Repeat Consensus Tpr Supe 6e-04
2wqh_A125 Crystal Structure Of Ctpr3y3 Length = 125 3e-04
1na0_A125 Design Of Stable Alpha-Helical Arrays From An Ideal 8e-04
>pdb|3NF1|A Chain A, Crystal Structure Of The Tpr Domain Of Kinesin Light Chain 1 Length = 311 Back     alignment and structure 
Iteration: 1

 Score = 64.3 bits (155), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 49/163 (30%), Positives = 72/163 (44%)
Query: 173 KGKLEDAVTYGTKALAKLVAVCGPYHRMTAGAYSLLAVVLYHTGDFNQATIYQQKALDIN 232
           +G+ E AV    +AL  L    G  H   A   ++LA+V      +  A      AL I 
Sbjct: 40  QGRYEVAVPLCKQALEDLEKTSGHDHPDVATMLNILALVYRDQNKYKDAANLLNDALAIR 99
Query: 233 ERELGLDHPDTMKSYGDLAVFYYRLQHTELALKYVKRALYLLHLTCGPSHPNTAATYINV 292
           E+ LG DHP    +  +LAV Y +    + A    KRAL +     G  HP+ A    N+
Sbjct: 100 EKTLGKDHPAVAATLNNLAVLYGKRGKYKEAEPLCKRALEIREKVLGKDHPDVAKQLNNL 159
Query: 293 AMMEEGLGNVHVALRYLHKALKCNQRLLGPDHIQTAASYHAIA 335
           A++ +  G       Y  +AL+  Q  LGPD    A + + +A
Sbjct: 160 ALLCQNQGKYEEVEYYYQRALEIYQTKLGPDDPNVAKTKNNLA 202
>pdb|3NF1|A Chain A, Crystal Structure Of The Tpr Domain Of Kinesin Light Chain 1 Length = 311 Back     alignment and structure
>pdb|3CEQ|A Chain A, The Tpr Domain Of Human Kinesin Light Chain 2 (Hklc2) Length = 283 Back     alignment and structure
>pdb|3CEQ|A Chain A, The Tpr Domain Of Human Kinesin Light Chain 2 (Hklc2) Length = 283 Back     alignment and structure
>pdb|3EDT|B Chain B, Crystal Structure Of The Mutated S328n Hklc2 Tpr Domain Length = 283 Back     alignment and structure
>pdb|3EDT|B Chain B, Crystal Structure Of The Mutated S328n Hklc2 Tpr Domain Length = 283 Back     alignment and structure
>pdb|2FO7|A Chain A, Crystal Structure Of An 8 Repeat Consensus Tpr Superhelix (Trigonal Crystal Form) Length = 136 Back     alignment and structure
>pdb|2FO7|A Chain A, Crystal Structure Of An 8 Repeat Consensus Tpr Superhelix (Trigonal Crystal Form) Length = 136 Back     alignment and structure
>pdb|2WQH|A Chain A, Crystal Structure Of Ctpr3y3 Length = 125 Back     alignment and structure
>pdb|1NA0|A Chain A, Design Of Stable Alpha-Helical Arrays From An Idealized Tpr Motif Length = 125 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1155
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 5e-39
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 7e-36
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 7e-35
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 3e-34
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 5e-25
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 2e-06
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 9e-05
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 3e-37
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 1e-35
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 5e-35
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 1e-29
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 7e-06
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 4e-24
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 4e-09
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 7e-23
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 4e-22
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 4e-19
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 1e-18
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 3e-18
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 5e-18
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 1e-09
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 1e-09
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 3e-04
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 3e-22
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 1e-20
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 1e-20
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 4e-22
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 1e-21
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 5e-21
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 1e-19
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 5e-18
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 2e-17
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 4e-04
3q15_A378 PSP28, response regulator aspartate phosphatase H; 6e-22
3q15_A378 PSP28, response regulator aspartate phosphatase H; 5e-20
3q15_A378 PSP28, response regulator aspartate phosphatase H; 3e-15
3q15_A378 PSP28, response regulator aspartate phosphatase H; 4e-15
3q15_A378 PSP28, response regulator aspartate phosphatase H; 2e-12
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 1e-21
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 5e-11
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 2e-21
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 1e-20
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 4e-19
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 9e-14
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 3e-10
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 9e-09
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 1e-14
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 7e-11
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 1e-10
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 5e-04
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 1e-13
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 1e-12
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 1e-12
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 3e-12
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 1e-08
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 8e-04
3tax_A723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 1e-13
3tax_A723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 2e-09
3tax_A723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 4e-04
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 1e-13
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 1e-12
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 1e-11
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 2e-07
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 3e-13
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 2e-12
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 7e-11
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 2e-06
1vt4_I1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-13
1vt4_I1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-06
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 7e-13
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 2e-12
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 7e-12
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 1e-11
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 5e-10
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 2e-07
3u4t_A272 TPR repeat-containing protein; structural genomics 3e-12
3u4t_A272 TPR repeat-containing protein; structural genomics 2e-11
3u4t_A272 TPR repeat-containing protein; structural genomics 1e-09
4g1t_A472 Interferon-induced protein with tetratricopeptide 4e-12
4g1t_A472 Interferon-induced protein with tetratricopeptide 9e-09
4g1t_A472 Interferon-induced protein with tetratricopeptide 2e-08
4g1t_A472 Interferon-induced protein with tetratricopeptide 7e-06
4g1t_A472 Interferon-induced protein with tetratricopeptide 9e-05
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 7e-12
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 7e-07
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 8e-07
2gw1_A514 Mitochondrial precursor proteins import receptor; 1e-11
2gw1_A514 Mitochondrial precursor proteins import receptor; 2e-10
2gw1_A514 Mitochondrial precursor proteins import receptor; 1e-09
2gw1_A514 Mitochondrial precursor proteins import receptor; 2e-08
2gw1_A514 Mitochondrial precursor proteins import receptor; 2e-07
2gw1_A514 Mitochondrial precursor proteins import receptor; 2e-04
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 2e-11
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 2e-11
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 9e-10
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 1e-09
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 1e-07
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 8e-07
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 2e-11
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 4e-11
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 8e-10
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 2e-05
3qww_A433 SET and MYND domain-containing protein 2; methyltr 2e-10
3qww_A433 SET and MYND domain-containing protein 2; methyltr 6e-10
3qww_A433 SET and MYND domain-containing protein 2; methyltr 6e-06
3qww_A433 SET and MYND domain-containing protein 2; methyltr 2e-04
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 5e-10
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 1e-04
4eqf_A365 PEX5-related protein; accessory protein, tetratric 6e-10
4eqf_A365 PEX5-related protein; accessory protein, tetratric 6e-08
4eqf_A365 PEX5-related protein; accessory protein, tetratric 2e-05
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 7e-10
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 6e-09
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 1e-05
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 4e-05
2vsy_A568 XCC0866; transferase, glycosyl transferase, GT-B, 8e-10
2vsy_A568 XCC0866; transferase, glycosyl transferase, GT-B, 5e-08
2vsy_A568 XCC0866; transferase, glycosyl transferase, GT-B, 2e-06
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 9e-10
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 1e-09
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 1e-04
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 1e-09
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 2e-08
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 3e-08
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 6e-05
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 2e-09
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 5e-08
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 3e-04
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 3e-09
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 3e-08
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 5e-05
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 4e-09
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 8e-07
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 9e-05
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 1e-08
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 2e-08
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 1e-08
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 3e-08
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 7e-05
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 2e-04
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 3e-08
3k9i_A117 BH0479 protein; putative protein binding protein, 3e-08
3k9i_A117 BH0479 protein; putative protein binding protein, 1e-07
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 4e-08
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 2e-07
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 3e-05
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 4e-08
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 3e-04
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 4e-04
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 5e-08
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 2e-06
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 7e-06
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 3e-05
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 4e-05
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 4e-05
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 6e-08
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 7e-08
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 2e-06
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 3e-07
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 4e-07
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 6e-07
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 6e-07
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 8e-07
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 4e-06
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 3e-05
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 3e-06
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 3e-06
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 9e-05
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 1e-04
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 5e-06
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 1e-05
3ugm_A1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 1e-05
3ugm_A1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 8e-04
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 1e-04
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 4e-04
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 5e-04
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 7e-04
2kat_A115 Uncharacterized protein; NESG, structure, structur 7e-04
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 7e-04
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Length = 311 Back     alignment and structure
 Score =  146 bits (372), Expect = 5e-39
 Identities = 56/220 (25%), Positives = 88/220 (40%), Gaps = 3/220 (1%)

Query: 172 DKGKLEDAVTYGTKALAKLVAVCGPYHRMTAGAYSLLAVVLYHTGDFNQATIYQQKALDI 231
            +G+ E AV    +AL  L    G  H   A   ++LA+V      +  A      AL I
Sbjct: 39  SQGRYEVAVPLCKQALEDLEKTSGHDHPDVATMLNILALVYRDQNKYKDAANLLNDALAI 98

Query: 232 NERELGLDHPDTMKSYGDLAVFYYRL-QHTELALKYVKRALYLLHLTCGPSHPNTAATYI 290
            E+ LG DHP    +  +LAV Y +  ++ E A    KRAL +     G  HP+ A    
Sbjct: 99  REKTLGKDHPAVAATLNNLAVLYGKRGKYKE-AEPLCKRALEIREKVLGKDHPDVAKQLN 157

Query: 291 NVAMMEEGLGNVHVALRYLHKALKCNQRLLGPDHIQTAASYHAIAIALSLMEAYPLSVQH 350
           N+A++ +  G       Y  +AL+  Q  LGPD    A + + +A        +  +   
Sbjct: 158 NLALLCQNQGKYEEVEYYYQRALEIYQTKLGPDDPNVAKTKNNLASCYLKQGKFKQAETL 217

Query: 351 EQTTLQILRAK-LGPDDLRTQDAAAWLEYFESKAFEQQEA 389
            +  L     +  G  D   +      E  E    +Q++ 
Sbjct: 218 YKEILTRAHEREFGSVDDENKPIWMHAEEREECKGKQKDG 257
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Length = 311 Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Length = 311 Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Length = 311 Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Length = 311 Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Length = 311 Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Length = 311 Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Length = 283 Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Length = 283 Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Length = 283 Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Length = 283 Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Length = 283 Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Length = 203 Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Length = 203 Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Length = 406 Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Length = 406 Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Length = 406 Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Length = 406 Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Length = 406 Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Length = 406 Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Length = 406 Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Length = 406 Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Length = 406 Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Length = 338 Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Length = 338 Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Length = 338 Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Length = 411 Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Length = 411 Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Length = 411 Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Length = 411 Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Length = 411 Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Length = 411 Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Length = 411 Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Length = 378 Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Length = 378 Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Length = 378 Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Length = 378 Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Length = 378 Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Length = 164 Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Length = 164 Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Length = 383 Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Length = 383 Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Length = 383 Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Length = 383 Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Length = 383 Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Length = 383 Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Length = 307 Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Length = 307 Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Length = 307 Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Length = 307 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>3tax_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; thiocarbamate crosslink, covalent inhibitor, gylcosyltransfe inhibitor, O-GLCNAC transferase; HET: UDP; 1.88A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* Length = 723 Back     alignment and structure
>3tax_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; thiocarbamate crosslink, covalent inhibitor, gylcosyltransfe inhibitor, O-GLCNAC transferase; HET: UDP; 1.88A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* Length = 723 Back     alignment and structure
>3tax_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; thiocarbamate crosslink, covalent inhibitor, gylcosyltransfe inhibitor, O-GLCNAC transferase; HET: UDP; 1.88A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* Length = 723 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Length = 373 Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Length = 373 Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Length = 373 Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Length = 373 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Length = 208 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Length = 252 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Length = 252 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Length = 252 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Length = 225 Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Length = 490 Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Length = 490 Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Length = 490 Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Length = 433 Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Length = 433 Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Length = 433 Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Length = 433 Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Length = 142 Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Length = 142 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Length = 568 Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Length = 568 Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Length = 568 Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Length = 429 Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Length = 429 Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Length = 429 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Length = 177 Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Length = 148 Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Length = 148 Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Length = 148 Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Length = 293 Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Length = 117 Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Length = 117 Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Length = 136 Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Length = 136 Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Length = 136 Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Length = 151 Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Length = 151 Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Length = 151 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Length = 213 Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Length = 292 Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Length = 127 Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Length = 131 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Length = 121 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Length = 217 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Length = 217 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Length = 217 Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Length = 125 Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Length = 125 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Length = 474 Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Length = 372 Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Length = 112 Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Length = 291 Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Length = 115 Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Length = 99 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query1155
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.93
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 99.92
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 99.89
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.88
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 99.88
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 99.88
3q15_A378 PSP28, response regulator aspartate phosphatase H; 99.87
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.87
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 99.86
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 99.86
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 99.85
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.82
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.79
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.79
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.78
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 99.78
3u4t_A272 TPR repeat-containing protein; structural genomics 99.78
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 99.77
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.76
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.75
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.75
4g1t_A472 Interferon-induced protein with tetratricopeptide 99.75
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.75
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.74
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 99.74
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 99.74
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 99.74
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.74
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 99.73
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.73
4gyw_A723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.73
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.73
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 99.73
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.73
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.73
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 99.73
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 99.72
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.72
3q15_A378 PSP28, response regulator aspartate phosphatase H; 99.72
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.72
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 99.71
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.71
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.71
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.7
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 99.7
3u3w_A293 Transcriptional activator PLCR protein; ternary co 99.69
4gyw_A723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.69
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.69
4g1t_A472 Interferon-induced protein with tetratricopeptide 99.69
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 99.69
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.69
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.68
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 99.68
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 99.68
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 99.68
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 99.67
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 99.67
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 99.67
2gw1_A514 Mitochondrial precursor proteins import receptor; 99.66
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.66
2gw1_A514 Mitochondrial precursor proteins import receptor; 99.66
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.66
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.65
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.64
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.64
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.63
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.62
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.61
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 99.61
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.6
3qww_A433 SET and MYND domain-containing protein 2; methyltr 99.6
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.58
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 99.58
3u4t_A272 TPR repeat-containing protein; structural genomics 99.58
3qww_A433 SET and MYND domain-containing protein 2; methyltr 99.58
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 99.58
4b4t_Q434 26S proteasome regulatory subunit RPN6; hydrolase, 99.58
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 99.58
3u3w_A293 Transcriptional activator PLCR protein; ternary co 99.57
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 99.57
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 99.57
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 99.57
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.56
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 99.56
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 99.55
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.53
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.52
4b4t_Q434 26S proteasome regulatory subunit RPN6; hydrolase, 99.52
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.51
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 99.5
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.5
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 99.47
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 99.45
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.44
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 99.44
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 99.43
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 99.41
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.41
2vsy_A568 XCC0866; transferase, glycosyl transferase, GT-B, 99.4
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.4
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 99.4
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 99.39
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 99.38
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 99.38
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 99.38
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 99.38
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 99.36
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 99.35
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 99.33
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 99.32
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 99.32
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 99.31
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 99.31
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 99.3
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 99.29
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 99.28
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 99.27
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.27
2vsy_A568 XCC0866; transferase, glycosyl transferase, GT-B, 99.25
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 99.24
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 99.24
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 99.24
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 99.24
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 99.22
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 99.21
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 99.21
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 99.2
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 99.18
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 99.17
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 99.17
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 99.16
1wao_1477 Serine/threonine protein phosphatase 5; hydrolase, 99.16
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 99.16
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 99.15
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 99.15
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 99.14
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 99.14
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 99.14
1xi4_A1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 99.14
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 99.12
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 99.12
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 99.12
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 99.11
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 99.11
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 99.1
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 99.09
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 99.09
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 99.08
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 99.07
3q49_B137 STIP1 homology and U box-containing protein 1; E3 99.07
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 99.07
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 99.06
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 99.06
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 99.05
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 99.05
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 99.05
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 99.04
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 99.04
3q49_B137 STIP1 homology and U box-containing protein 1; E3 99.01
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 99.01
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 99.01
1wao_1477 Serine/threonine protein phosphatase 5; hydrolase, 99.01
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 99.01
1xi4_A1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 99.0
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 99.0
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 98.99
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 98.99
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 98.99
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 98.97
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 98.93
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 98.93
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 98.93
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 98.93
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 98.92
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 98.91
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 98.91
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 98.88
1b89_A449 Protein (clathrin heavy chain); triskelion, coated 98.86
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 98.85
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 98.79
3k9i_A117 BH0479 protein; putative protein binding protein, 98.74
3k9i_A117 BH0479 protein; putative protein binding protein, 98.73
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 98.72
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 98.7
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 98.65
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 98.61
2l6j_A111 TPR repeat-containing protein associated with HSP; 98.57
1b89_A449 Protein (clathrin heavy chain); triskelion, coated 98.55
2l6j_A111 TPR repeat-containing protein associated with HSP; 98.53
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 98.52
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 98.51
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 98.47
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 98.47
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 98.46
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 98.43
1klx_A138 Cysteine rich protein B; structural genomics, heli 98.42
2kat_A115 Uncharacterized protein; NESG, structure, structur 98.42
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 98.4
2kat_A115 Uncharacterized protein; NESG, structure, structur 98.38
1klx_A138 Cysteine rich protein B; structural genomics, heli 98.33
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 98.27
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 98.25
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 98.25
4e6h_A679 MRNA 3'-END-processing protein RNA14; HAT domain, 98.11
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 98.11
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 98.07
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 97.97
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 97.93
3txn_A394 26S proteasome regulatory complex subunit P42B; PC 97.82
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 97.81
4e6h_A679 MRNA 3'-END-processing protein RNA14; HAT domain, 97.81
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 97.75
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 97.56
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 97.43
4g26_A501 Pentatricopeptide repeat-containing protein AT2G3 97.36
3txn_A394 26S proteasome regulatory complex subunit P42B; PC 97.36
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 97.21
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 97.19
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 97.18
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 97.0
1pc2_A152 Mitochondria fission protein; unknown function; NM 96.9
1pc2_A152 Mitochondria fission protein; unknown function; NM 96.85
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 96.77
4b4t_P445 26S proteasome regulatory subunit RPN5; hydrolase, 96.47
4g26_A501 Pentatricopeptide repeat-containing protein AT2G3 96.41
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 95.43
4b4t_R429 RPN7, 26S proteasome regulatory subunit RPN7; hydr 95.36
4b4t_R429 RPN7, 26S proteasome regulatory subunit RPN7; hydr 95.17
3lpz_A336 GET4 (YOR164C homolog); protein targeting, tail-an 95.09
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 94.99
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 94.63
4b4t_P445 26S proteasome regulatory subunit RPN5; hydrolase, 94.37
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 94.09
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 93.93
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 93.73
2ff4_A388 Probable regulatory protein EMBR; winged-helix, te 93.58
2wpv_A312 GET4, UPF0363 protein YOR164C; golgi-ER traffickin 93.51
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 93.27
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 92.08
4gns_B754 Protein CSD3, chitin biosynthesis protein CHS6; FN 91.61
1o9d_A260 14-3-3-like protein C; protein-binding, fusicoccin 91.6
4fhn_B1139 Nucleoporin NUP120; protein complex,structural pro 91.15
3kae_A242 CDC27, possible protein of nuclear scaffold; tetra 91.04
1ya0_A497 SMG-7 transcript variant 2; alpha-helical repeat, 90.87
3ubw_A261 14-3-3E, 14-3-3 protein epsilon; adapter protein, 90.85
3lpz_A336 GET4 (YOR164C homolog); protein targeting, tail-an 90.78
4gns_B754 Protein CSD3, chitin biosynthesis protein CHS6; FN 90.6
4b4t_S523 RPN3, 26S proteasome regulatory subunit RPN3; hydr 90.5
1y8m_A144 FIS1; mitochondria, unknown function; NMR {Sacchar 90.37
2npm_A260 14-3-3 domain containing protein; cell regulator p 90.24
2ff4_A388 Probable regulatory protein EMBR; winged-helix, te 90.1
3uzd_A248 14-3-3 protein gamma; structural genomics, SGC, st 89.95
3o48_A134 Mitochondria fission 1 protein; tetratricopeptide 89.88
3kae_A242 CDC27, possible protein of nuclear scaffold; tetra 89.74
3o48_A134 Mitochondria fission 1 protein; tetratricopeptide 89.63
1ya0_A497 SMG-7 transcript variant 2; alpha-helical repeat, 88.89
1y8m_A144 FIS1; mitochondria, unknown function; NMR {Sacchar 88.48
2wpv_A312 GET4, UPF0363 protein YOR164C; golgi-ER traffickin 87.43
4b4t_O393 26S proteasome regulatory subunit RPN9; hydrolase, 86.98
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 86.45
4b4t_S523 RPN3, 26S proteasome regulatory subunit RPN3; hydr 85.88
2br9_A234 14-3-3E, 14-3-3 protein epsilon; cell regulator pr 85.86
3spa_A1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 85.25
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 85.0
1o9d_A260 14-3-3-like protein C; protein-binding, fusicoccin 84.07
3ubw_A261 14-3-3E, 14-3-3 protein epsilon; adapter protein, 83.23
4b4t_O393 26S proteasome regulatory subunit RPN9; hydrolase, 82.84
2o8p_A227 14-3-3 domain containing protein; signaling protei 82.12
3iqu_A236 14-3-3 protein sigma; signal transuction, nucleus, 81.8
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 81.55
4fhn_B1139 Nucleoporin NUP120; protein complex,structural pro 81.4
2npm_A260 14-3-3 domain containing protein; cell regulator p 81.32
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
Probab=99.93  E-value=3e-23  Score=223.79  Aligned_cols=287  Identities=22%  Similarity=0.223  Sum_probs=230.8

Q ss_pred             ChHHHHHHHHHHHHHHHcCCHHHHHHHHHHHHHHHHHhcCCCChhhHHHHHHHHHHHHhcCCHHHHHHHHHHHHHHHHHh
Q 001110          156 SSADGRQLLESSKTALDKGKLEDAVTYGTKALAKLVAVCGPYHRMTAGAYSLLAVVLYHTGDFNQATIYQQKALDINERE  235 (1155)
Q Consensus       156 ~s~~A~~Ll~lG~~yl~~GdyeeAle~~~eALel~e~i~G~d~p~~A~al~nLG~vy~~~GdydeAle~~eKALei~er~  235 (1155)
                      ....+..++.+|..++..|++++|+.+|++++++.....+.+++..+.++..+|.+|...|++++|+.++++++.+.++.
T Consensus        23 ~~~~~~~~~~l~~~~~~~g~~~~A~~~~~~a~~~~~~~~~~~~~~~~~~~~~la~~~~~~g~~~~A~~~~~~al~~~~~~  102 (311)
T 3nf1_A           23 IPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEKTSGHDHPDVATMLNILALVYRDQNKYKDAANLLNDALAIREKT  102 (311)
T ss_dssp             SCHHHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHHHHHHCSSSHHHHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHHHHH
T ss_pred             chHHHHHHHHHHHHHHHcCCHHHHHHHHHHHHHHHHHHcCCCCHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHH
Confidence            45668889999999999999999999999999999988777889999999999999999999999999999999999998


Q ss_pred             cCCCChhhHHHHHHHHHHHHHcCCHHHHHHHHHHHHHHHHHhcCCCChhHHHHHHHHHHHHHHCCChHHHHHHHHHHHHH
Q 001110          236 LGLDHPDTMKSYGDLAVFYYRLQHTELALKYVKRALYLLHLTCGPSHPNTAATYINVAMMEEGLGNVHVALRYLHKALKC  315 (1155)
Q Consensus       236 lG~D~p~~a~ay~nLA~iy~~lG~yeeAle~yekALei~e~l~G~dhp~~a~a~~nLA~iy~~lG~~deAle~lekALei  315 (1155)
                      .+.+++....++.++|.+|..+|++++|+.+|++++.+.+...+.+++....++.++|.+|...|++++|+.+|++++++
T Consensus       103 ~~~~~~~~~~~~~~l~~~~~~~g~~~~A~~~~~~a~~~~~~~~~~~~~~~~~~~~~la~~~~~~~~~~~A~~~~~~a~~~  182 (311)
T 3nf1_A          103 LGKDHPAVAATLNNLAVLYGKRGKYKEAEPLCKRALEIREKVLGKDHPDVAKQLNNLALLCQNQGKYEEVEYYYQRALEI  182 (311)
T ss_dssp             HCTTCHHHHHHHHHHHHHHHTTTCHHHHHHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHHHHTTTCHHHHHHHHHHHHHH
T ss_pred             hCCCChHHHHHHHHHHHHHHHcCcHHHHHHHHHHHHHHHHHhcCCCChHHHHHHHHHHHHHHHcCCHHHHHHHHHHHHHH
Confidence            88889999999999999999999999999999999999998888889999999999999999999999999999999999


Q ss_pred             HHHhcCCCcHHHHHHHHHHHHHHHHcCChhHHHHHHHHHHHHHHHH-cCCCCHHHHHHHHHHHHHHHHhHHHHHHHHhcC
Q 001110          316 NQRLLGPDHIQTAASYHAIAIALSLMEAYPLSVQHEQTTLQILRAK-LGPDDLRTQDAAAWLEYFESKAFEQQEAARNGT  394 (1155)
Q Consensus       316 ~ek~lG~dhp~~a~a~~nLA~iy~~lGdyeeAle~lkkALeI~kk~-lG~dh~~t~~al~~La~l~qk~~e~AeAi~~~~  394 (1155)
                      .++..+.+++....++..+|.+|..+|++++|+.++++++++.... ++..+.........+..+...............
T Consensus       183 ~~~~~~~~~~~~~~~~~~la~~~~~~g~~~~A~~~~~~al~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  262 (311)
T 3nf1_A          183 YQTKLGPDDPNVAKTKNNLASCYLKQGKFKQAETLYKEILTRAHEREFGSVDDENKPIWMHAEEREECKGKQKDGTSFGE  262 (311)
T ss_dssp             HHHTSCTTCHHHHHHHHHHHHHHHHHTCHHHHHHHHHHHHHHHHHHHHC------CCHHHHHHHHHHC-------CCSCC
T ss_pred             HHHHhCCCCHHHHHHHHHHHHHHHHcCCHHHHHHHHHHHHHHHHHhcCCCCCcchHHHHHHHHHHHHhcCchhhHHHHHH
Confidence            9988888889999999999999999999999999999999886552 122222211111111111111111100000000


Q ss_pred             CCCchhhhhcCCCcHHHHHHHHHHHHHHcCChHHHHHHHHHHHHHhhh
Q 001110          395 RKPDASIASKGHLSVSDLLDYINPSHDTKGRNVSTLKRKTYVAKVKGN  442 (1155)
Q Consensus       395 ~~~~~~~a~~~~~svaelL~~Lg~~y~~qGdyeeAle~yeKALeL~~k  442 (1155)
                      ...........++....++..+|.+|..+|++++|+.+|++++++.++
T Consensus       263 a~~~~~~~~~~~~~~~~~~~~la~~~~~~g~~~~A~~~~~~al~l~~~  310 (311)
T 3nf1_A          263 YGGWYKACKVDSPTVTTTLKNLGALYRRQGKFEAAETLEEAAMRSRKQ  310 (311)
T ss_dssp             CC---------CHHHHHHHHHHHHHHHHHTCHHHHHHHHHHHHHHHC-
T ss_pred             HHHHHhhcCCCCchHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHhhc
Confidence            000111112234567889999999999999999999999999998754
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>3txn_A 26S proteasome regulatory complex subunit P42B; PCI domain, alpha solenoid, regulatory PART LID, hydrolase, protein binding; 2.50A {Drosophila melanogaster} PDB: 3txm_A Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>3txn_A 26S proteasome regulatory complex subunit P42B; PCI domain, alpha solenoid, regulatory PART LID, hydrolase, protein binding; 2.50A {Drosophila melanogaster} PDB: 3txm_A Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>4b4t_R RPN7, 26S proteasome regulatory subunit RPN7; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_R RPN7, 26S proteasome regulatory subunit RPN7; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3lpz_A GET4 (YOR164C homolog); protein targeting, tail-anchored protein biogenesis, GET PAT GET5 binding, protein transport; 1.98A {Chaetomium thermophilum} Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>2wpv_A GET4, UPF0363 protein YOR164C; golgi-ER trafficking, tail-anchored protein, protein binding GET4; 1.99A {Saccharomyces cerevisiae} PDB: 3lku_A Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>1o9d_A 14-3-3-like protein C; protein-binding, fusicoccin, 14-3-3 family, activating drug; HET: TPO; 2.3A {Nicotiana tabacum} SCOP: a.118.7.1 PDB: 1o9c_A* 1o9e_A* 1o9f_A* 3e6y_A* Back     alignment and structure
>4fhn_B Nucleoporin NUP120; protein complex,structural protein,nuclear pore complex,mRNA transport,protein transport, WD repeat; 6.99A {Schizosaccharomyces pombe 972h-} Back     alignment and structure
>3kae_A CDC27, possible protein of nuclear scaffold; tetratricopeptide repeat protein, protein binding; 2.30A {Encephalitozoon cuniculi} Back     alignment and structure
>1ya0_A SMG-7 transcript variant 2; alpha-helical repeat, tetratricopetide repeat (TPR), 14-3-3, signaling protein; 2.55A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3ubw_A 14-3-3E, 14-3-3 protein epsilon; adapter protein, signaling protein, signaling protein-protei complex; HET: SEP; 1.90A {Homo sapiens} Back     alignment and structure
>3lpz_A GET4 (YOR164C homolog); protein targeting, tail-anchored protein biogenesis, GET PAT GET5 binding, protein transport; 1.98A {Chaetomium thermophilum} Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_S RPN3, 26S proteasome regulatory subunit RPN3; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>2npm_A 14-3-3 domain containing protein; cell regulator protein 14-3-3, struc genomics, structural genomics consortium, SGC, protein BIND; HET: SEP; 2.52A {Cryptosporidium parvum} Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>3uzd_A 14-3-3 protein gamma; structural genomics, SGC, structural genomics consortium, MA alpha, phosphoserine, phosphothreonine; HET: SEP; 1.86A {Homo sapiens} PDB: 4e2e_A 2b05_A* 2c63_A* 2c74_A* 4dnk_A 4gnt_A 2bq0_A 2c23_A 2c1n_A* 2c1j_A* 2btp_A* Back     alignment and structure
>3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A Back     alignment and structure
>3kae_A CDC27, possible protein of nuclear scaffold; tetratricopeptide repeat protein, protein binding; 2.30A {Encephalitozoon cuniculi} Back     alignment and structure
>3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A Back     alignment and structure
>1ya0_A SMG-7 transcript variant 2; alpha-helical repeat, tetratricopetide repeat (TPR), 14-3-3, signaling protein; 2.55A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>2wpv_A GET4, UPF0363 protein YOR164C; golgi-ER trafficking, tail-anchored protein, protein binding GET4; 1.99A {Saccharomyces cerevisiae} PDB: 3lku_A Back     alignment and structure
>4b4t_O 26S proteasome regulatory subunit RPN9; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_S RPN3, 26S proteasome regulatory subunit RPN3; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2br9_A 14-3-3E, 14-3-3 protein epsilon; cell regulator protein, 14-3-3, phosphoserine, structural GE consortium, SGC, ywhae; HET: SEP; 1.75A {Homo sapiens} PDB: 3ual_A* 2o98_A* 3m50_A* 3m51_A* 3axy_C* Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>1o9d_A 14-3-3-like protein C; protein-binding, fusicoccin, 14-3-3 family, activating drug; HET: TPO; 2.3A {Nicotiana tabacum} SCOP: a.118.7.1 PDB: 1o9c_A* 1o9e_A* 1o9f_A* 3e6y_A* Back     alignment and structure
>3ubw_A 14-3-3E, 14-3-3 protein epsilon; adapter protein, signaling protein, signaling protein-protei complex; HET: SEP; 1.90A {Homo sapiens} Back     alignment and structure
>4b4t_O 26S proteasome regulatory subunit RPN9; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2o8p_A 14-3-3 domain containing protein; signaling protein, 14-3-3, cell regulator protein, cryptospo parvum, structural genomics; HET: MSE; 1.82A {Cryptosporidium parvum} SCOP: a.118.7.1 Back     alignment and structure
>3iqu_A 14-3-3 protein sigma; signal transuction, nucleus, phosphoprotein, secreted, prote binding, signaling protein; HET: SEP; 1.05A {Homo sapiens} SCOP: a.118.7.1 PDB: 3iqj_A* 3iqv_A* 3mhr_A* 3lw1_A* 3o8i_A* 3p1n_A* 3p1o_A* 3t0l_A* 3t0m_A* 3u9x_A* 3ux0_A* 4dat_A* 4dau_A* 3p1s_A* 3p1r_A* 3smk_A* 3spr_A* 3p1q_A* 3p1p_A* 3sml_A* ... Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>4fhn_B Nucleoporin NUP120; protein complex,structural protein,nuclear pore complex,mRNA transport,protein transport, WD repeat; 6.99A {Schizosaccharomyces pombe 972h-} Back     alignment and structure
>2npm_A 14-3-3 domain containing protein; cell regulator protein 14-3-3, struc genomics, structural genomics consortium, SGC, protein BIND; HET: SEP; 2.52A {Cryptosporidium parvum} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 1155
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 4e-13
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 1e-09
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 9e-07
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 4e-06
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 8e-06
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 2e-04
d1hz4a_366 a.118.8.2 (A:) Transcription factor MalT domain II 6e-11
d1hz4a_366 a.118.8.2 (A:) Transcription factor MalT domain II 2e-10
d1hz4a_366 a.118.8.2 (A:) Transcription factor MalT domain II 5e-10
d1hz4a_366 a.118.8.2 (A:) Transcription factor MalT domain II 0.002
d1hh8a_192 a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF- 4e-07
d1fcha_323 a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting 8e-07
d1fcha_323 a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting 5e-05
d1fcha_323 a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting 8e-05
d1fcha_323 a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting 0.003
d1qqea_290 a.118.8.1 (A:) Vesicular transport protein sec17 { 9e-07
d1zbpa1264 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {V 3e-06
d1ya0a1497 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [T 5e-05
d2c2la1201 a.118.8.1 (A:24-224) STIP1 homology and U box-cont 3e-04
d1tjca_95 a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subuni 3e-04
d1elra_128 a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9 0.002
d1dcea1334 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltr 0.002
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure

class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: O-GlcNAc transferase p110 subunit, OGT
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 70.1 bits (170), Expect = 4e-13
 Identities = 34/172 (19%), Positives = 62/172 (36%), Gaps = 32/172 (18%)

Query: 171 LDKGKLEDAVTYGTKALAKLVAVCGPYHRMTAGAYSLLAVVLYHTGDFNQATIYQQKALD 230
            ++G ++ A+    +A+                AY  LA  L   G   +A      AL 
Sbjct: 248 YEQGLIDLAIDTYRRAIE--------LQPHFPDAYCNLANALKEKGSVAEAEDCYNTALR 299

Query: 231 INERELGLDHPDTMKSYGDLAVFYYRLQHTELALKYVKRALYLLHLTCGPSHPNTAATYI 290
                     P    S  +LA       + E A++  ++AL +         P  AA + 
Sbjct: 300 --------LCPTHADSLNNLANIKREQGNIEEAVRLYRKALEV--------FPEFAAAHS 343

Query: 291 NVAMMEEGLGNVHVALRYLHKALKCNQRLLGPDHIQTAASYHAIAIALSLME 342
           N+A + +  G +  AL +  +A++ +     P     A +Y  +   L  M+
Sbjct: 344 NLASVLQQQGKLQEALMHYKEAIRIS-----PTF---ADAYSNMGNTLKEMQ 387
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Length = 366 Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Length = 366 Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Length = 366 Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Length = 366 Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Length = 192 Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Length = 323 Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Length = 323 Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Length = 323 Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Length = 323 Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 290 Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Length = 264 Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Length = 497 Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 201 Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Length = 128 Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 334 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query1155
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.76
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.74
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.73
d1hz4a_366 Transcription factor MalT domain III {Escherichia 99.73
d1hz4a_366 Transcription factor MalT domain III {Escherichia 99.71
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 99.65
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 99.63
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.62
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 99.61
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 99.56
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 99.55
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 99.38
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 99.36
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 99.29
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 99.28
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 99.26
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.21
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 99.2
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 99.18
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 99.18
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 99.15
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 99.15
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.14
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.14
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 99.12
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.11
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 99.09
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 99.08
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 99.07
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 99.05
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 99.01
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 99.01
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 99.01
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 99.0
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.0
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 98.97
d1ya0a1497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 98.96
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 98.89
d1ya0a1497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 98.88
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 98.82
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 98.72
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 98.69
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 98.68
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 98.66
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 98.65
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 98.54
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 98.36
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 98.29
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 98.28
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 98.17
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 98.16
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 97.94
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 97.75
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 97.58
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 96.27
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 96.02
d2o02a1230 zeta isoform {Cow (Bos taurus) [TaxId: 9913]} 92.14
d1o9da_236 14-3-3-like protein C {Common tobacco (Nicotiana t 88.66
d2o8pa1220 14-3-3 domain containing protein cgd7_2470 {Crypto 87.89
d2o02a1230 zeta isoform {Cow (Bos taurus) [TaxId: 9913]} 84.31
d1o9da_236 14-3-3-like protein C {Common tobacco (Nicotiana t 80.02
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor)
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.76  E-value=2.5e-17  Score=178.68  Aligned_cols=247  Identities=13%  Similarity=0.054  Sum_probs=177.8

Q ss_pred             HHHHHHHHHHcCCHHHHHHHHHHHHHHHHHhcCCCChhhHHHHHHHHHHHHhcCCHHHHHHHHHHHHHHHHHhcCCCChh
Q 001110          163 LLESSKTALDKGKLEDAVTYGTKALAKLVAVCGPYHRMTAGAYSLLAVVLYHTGDFNQATIYQQKALDINERELGLDHPD  242 (1155)
Q Consensus       163 Ll~lG~~yl~~GdyeeAle~~~eALel~e~i~G~d~p~~A~al~nLG~vy~~~GdydeAle~~eKALei~er~lG~D~p~  242 (1155)
                      .++.|..++..|++++|+.+|+++++.        +|..+.+|..||.+|..+|++++|+.+|.+|+.+        .|.
T Consensus        22 ~~~~g~~~~~~g~~~~A~~~~~~al~~--------~P~~~~a~~~lg~~~~~~~~~~~A~~~~~~al~~--------~p~   85 (323)
T d1fcha_          22 PFEEGLRRLQEGDLPNAVLLFEAAVQQ--------DPKHMEAWQYLGTTQAENEQELLAISALRRCLEL--------KPD   85 (323)
T ss_dssp             HHHHHHHHHHTTCHHHHHHHHHHHHHS--------CTTCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHH--------CTT
T ss_pred             HHHHHHHHHHcCCHHHHHHHHHHHHHh--------CCCCHHHHHHHHHHHHHcCChHHHHHHHHhhhcc--------ccc
Confidence            467899999999999999999999976        6778899999999999999999999999999987        456


Q ss_pred             hHHHHHHHHHHHHHcCCHHHHHHHHHHHHHHHHHhcCC-CChhHHH------HHHHHHHHHHHCCChHHHHHHHHHHHHH
Q 001110          243 TMKSYGDLAVFYYRLQHTELALKYVKRALYLLHLTCGP-SHPNTAA------TYINVAMMEEGLGNVHVALRYLHKALKC  315 (1155)
Q Consensus       243 ~a~ay~nLA~iy~~lG~yeeAle~yekALei~e~l~G~-dhp~~a~------a~~nLA~iy~~lG~~deAle~lekALei  315 (1155)
                      ....+.++|.+|..+|++++|+++|++++.+....... .......      ........+...+.+.+|+..|.+++.+
T Consensus        86 ~~~~~~~la~~~~~~~~~~~A~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~a~~~~~~al~~  165 (323)
T d1fcha_          86 NQTALMALAVSFTNESLQRQACEILRDWLRYTPAYAHLVTPAEEGAGGAGLGPSKRILGSLLSDSLFLEVKELFLAAVRL  165 (323)
T ss_dssp             CHHHHHHHHHHHHHTTCHHHHHHHHHHHHHTSTTTGGGCC---------------CTTHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             cccccccccccccccccccccccchhhHHHhccchHHHHHhhhhhhhhcccccchhhHHHHHHhhHHHHHHHHHHHHHHH
Confidence            67899999999999999999999999998753210000 0000001      1112223344556788899999998876


Q ss_pred             HHHhcCCCcHHHHHHHHHHHHHHHHcCChhHHHHHHHHHHHHHHHHcCCCCHHHHHHHHHHHHHHHHhHHHHHHHHhcCC
Q 001110          316 NQRLLGPDHIQTAASYHAIAIALSLMEAYPLSVQHEQTTLQILRAKLGPDDLRTQDAAAWLEYFESKAFEQQEAARNGTR  395 (1155)
Q Consensus       316 ~ek~lG~dhp~~a~a~~nLA~iy~~lGdyeeAle~lkkALeI~kk~lG~dh~~t~~al~~La~l~qk~~e~AeAi~~~~~  395 (1155)
                      .     ++. ..+.++..+|.++..+|++++|+.+|++++..     .+++......+..+ +...+.++.+........
T Consensus       166 ~-----p~~-~~~~~~~~l~~~~~~~~~~~~A~~~~~~al~~-----~p~~~~~~~~lg~~-~~~~g~~~~A~~~~~~al  233 (323)
T d1fcha_         166 D-----PTS-IDPDVQCGLGVLFNLSGEYDKAVDCFTAALSV-----RPNDYLLWNKLGAT-LANGNQSEEAVAAYRRAL  233 (323)
T ss_dssp             S-----TTS-CCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHH-----CTTCHHHHHHHHHH-HHHTTCHHHHHHHHHHHH
T ss_pred             h-----hcc-cccccchhhHHHHHHHHHHhhhhccccccccc-----ccccccchhhhhhc-ccccccchhHHHHHHHHH
Confidence            4     222 23467788999999999999999999998865     45555544333322 233333333332222111


Q ss_pred             CCchhhhhcCCCcHHHHHHHHHHHHHHcCChHHHHHHHHHHHHHhhhhcC
Q 001110          396 KPDASIASKGHLSVSDLLDYINPSHDTKGRNVSTLKRKTYVAKVKGNFYQ  445 (1155)
Q Consensus       396 ~~~~~~a~~~~~svaelL~~Lg~~y~~qGdyeeAle~yeKALeL~~kl~~  445 (1155)
                      .        ..+...+++..+|.+|..+|++++|+.+|++|+++.+....
T Consensus       234 ~--------~~p~~~~a~~~lg~~~~~~g~~~~A~~~~~~al~l~p~~~~  275 (323)
T d1fcha_         234 E--------LQPGYIRSRYNLGISCINLGAHREAVEHFLEALNMQRKSRG  275 (323)
T ss_dssp             H--------HCTTCHHHHHHHHHHHHHHTCHHHHHHHHHHHHHHHHTC--
T ss_pred             H--------HhhccHHHHHHHHHHHHHCCCHHHHHHHHHHHHHhCCcChh
Confidence            0        11234678999999999999999999999999999887654
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2o02a1 a.118.7.1 (A:1-230) zeta isoform {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1o9da_ a.118.7.1 (A:) 14-3-3-like protein C {Common tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d2o8pa1 a.118.7.1 (A:8-227) 14-3-3 domain containing protein cgd7_2470 {Cryptosporidium parvum [TaxId: 5807]} Back     information, alignment and structure
>d2o02a1 a.118.7.1 (A:1-230) zeta isoform {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1o9da_ a.118.7.1 (A:) 14-3-3-like protein C {Common tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure