Citrus Sinensis ID: 001164


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------1000------1010------1020------1030------1040------1050------1060------1070------1080------1090------1100------1110------1120------1130----
MDTAEQPLKKRKLYDLPPESPKPVEGPQSDVVPPQTPPPLSQDEIQSRRRNKDEIRSVYECYRRLKACIAQKDARRLPELEQAYLSLITASRGCTSVQRIVADLVPRYALYCPTALEAATEVVIYMHNSSVALINRGEDADGVAFQTASACIFGLGDICRTASSEVPTSSVIRGICSAVFHNVLDFFISSFDGKDIIHTVDKEITKMLDSDEVFLGLKKKFSDEDESSLIKLSKFRLLSLLQIFFSSPKNLLAACFELFNPSVLEGIHKGQYFFSQITSRFDDDNMTHSFIIKDDGPKFPETSTKGKEASSEQLVSDDNHVGTSVLKSCLLGLALGKNPSLRRWMFSRYKKLCNLSSSNALPELSSALKRIFESFSEVAKEEGSEVDSDEDDSDPSKYANQQYLVARSANQHETSRELSGNESNSRVNEESCDVSFADKFSGQYPRPHGSVGPRETDFHSNAGSSHDSGCTRSMEYDTGDPGDFSCGRSSMPRDLPNPQMLSPAARTPLHFRNNSFEGRNHFPGRSSSEGASNALLSPNHHLPVPYASTTSQIVWYFDEDPAAMDIFSASKQLWLGSFGPEASEAHIRFQIDRFGPLEHFFFFPIKGFALVEYINIIDAIRAREYIRNHFSWRVKFMDVGLGTKGVINGVAVGSCFHVYVGNIPNQWAKDEILHESYKVVYKGPYMVTDLSCEGALLMEFRTPEEATTAMAHLRQHRKSRSNYLPPNTGPANAAMSQIDGARSVPAAPIHVDIRSNRLGNISAGGFGSPHTAPFHSSQPGFHHATSFTVRPEISSMELSSPRVISENHGAAVQDGHSFQSNWSVSGRTEMPEAGFRKIDGHDSSIMVNPSQGGNMPCLPMATQGPIPPPQPIQPTQYLHPVYLPPNSSWDAGVAAPFIPPSVTPLAQIQGAPMQNYDQMFSHPVAPPHLSSLPPQPAELPPLPPSPPPLPQSQPPLVPPPPNSPPPPPPSPVVEPMQVERSGQLLQYQWQGALCKSGVHYCTIYAQREESDICKYTHDISEPAEWPAKLDMTKRTDFRHVKSTFTSTPPNKREVCRLVPSSPGDHKGFQDFVSYLKQRECAGVIKIPAVKSIWARLMFILPYSQDICSMLSIAPNSSDCLVALVLPKETNFEWV
cccccccccccccccccccccccccccccccccccccccccHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHccccHHHHHHHHHccccccccccHHHHHHHHHEEEEEcccEEEEccccccccHHHHHHHHHHccccHHcccccccccccccccccHHHHHHHHHHHHHHccccccEEEEcHHHHHcccccHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHcccccccccHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEcccccccccHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEcccccccccccccccccEEEEEccccccHHHHHHHHHHccccccEEEcccccEEEEEEcHHHHHHHHHHHHccccEEEEEEEccccccccccccEEEEccEEEEEcccccccHHHHHHHHHHHHHcccccEEEEcccccEEEEEEccHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEEEcccccccccccccccccccccccccccccccccHHcccccccccccEEEcccccccccHHHHHHHHHHHHcccccEEEcccccccccEEEEEccccHHHHHHccccccccccEEEEEcccccccccc
cccccccHHHcccccccccccccccccccccccccccccccHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHcHcHHHHHHHHHHHHHHHHccHHHEccccccccHHHHHHHHHHHHHHHHHHHHccccccccHHHcHHHHHHHHHHHHHHHHcccccEEEEEcHHHccccccHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccHHHEEcccccHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccEEEEcccHHcccccccccccHccccccccccccccccccEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEccccccEEEEEcccEEEEccccccHHHHHHHHHHHHHccHHHEEEcccccEEEEEEccHHHHHHHHHHHcccccHEEEEHHccccccccEcEEEEcccEEEEEEEcccHHHHHHHHHHHHHHHccccccEEEcccccEEEEEcccHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEEEEccccccccccccccccccccccccEEccHHcEEEcccccccccHHEEEEccccccccccHHHHHHHHHHcccccEEEEcccccHHHHHHHHccccHHHHHHcccccccccEEEEEEEccccccccc
mdtaeqplkkrklydlppespkpvegpqsdvvppqtppplsqdeiqsRRRNKDEIRSVYECYRRLKACIAQKDARRLPELEQAYLSLITASRGCTSVQRIVADlvpryalycpTALEAATEVVIYMHNSSVALinrgedadgvAFQTASACIFGLGdicrtassevptssviRGICSAVFHNVLDFfissfdgkdiIHTVDKEITKMldsdevflglkkkfsdedesslIKLSKFRLLSLLQIFFSSPKNLLAACFELfnpsvlegihkgqYFFSQitsrfdddnmthsfiikddgpkfpetstkgkeasseqlvsddnhvgtSVLKSCLLglalgknpslrRWMFSRYKKLCnlsssnalpELSSALKRIFESFSEVAKeegsevdsdeddsdpskyanQQYLVARSAnqhetsrelsgnesnsrvneescdvsfadkfsgqyprphgsvgpretdfhsnagsshdsgctrsmeydtgdpgdfscgrssmprdlpnpqmlspaartplhfrnnsfegrnhfpgrsssegasnallspnhhlpvpyasttSQIVwyfdedpaamDIFSASKQLwlgsfgpeaseAHIRFQidrfgplehffffpikgFALVEYINIIDAIRAREYIRNHFSWRVKFMDVGLGTKGVINGVAVGSCFHVYvgnipnqwakdeilHESYKVVYKGPYMVTDLSCEGallmefrtpeEATTAMAHLRQHRksrsnylppntgpanaamsqidgarsvpaapihvdirsnrlgnisaggfgsphtapfhssqpgfhhatsftvrpeissmelssprvisenhgaavqdghsfqsnwsvsgrtempeagfrkidghdssimvnpsqggnmpclpmatqgpipppqpiqptqylhpvylppnsswdagvaapfippsvtplaqiqgapmqnydqmfshpvapphlsslppqpaelpplppsppplpqsqpplvppppnsppppppspvvepmqversgQLLQYQWQGALCKSGVHYCTIYAQREEsdickythdisepaewpakldmtkrtdfrhvkstftstppnkrevcrlvpsspgdhkgFQDFVSYLKQREcagvikipAVKSIWARLMFILPYSQDICsmlsiapnssDCLVALvlpketnfewv
mdtaeqplkkrklydlppespkpvegpqsdvvppqtppplsqdeiqsrrrnkdeIRSVYECYRRLKAciaqkdarrlpELEQAYLSLitasrgctsVQRIVADLVPRYALYCPTALEAATEVVIYMHNSSVALINRGEDADGVAFQTASACIFGLGDICRTASSEVPTSSVIRGICSAVFHNVLDFFISSFDGKDIIHTVDKEITKMLDSDEVFLGLKkkfsdedesSLIKLSKFRLLSLLQIFFSSPKNLLAACFELFNPSVLEGIHKGQYFFSQITSRFDDDNMTHSFiikddgpkfPETSTkgkeasseqlvsddnhVGTSVLKSCLLGLALGKNPSLRRWMFSRYKKLCNLSSSNALPELSSALKRIFESFSEVAKeegsevdsdeddsdpsKYANQQYLVARSanqhetsrelsgnesnsrvnEESCDVSFADKFSGQYPRPHGSVGPRETDFHSNAGSSHDSGCTRSMEYDTGDPGDFSCGRSSMPRDLPNPQMLSPAARTPLHFRNNSFEGRNHFPGRSSSEGASNALLSPNHHLPVPYASTTSQIVWYFDEDPAAMDIFSASKQLWLGSFGPEASEAHIRFQIDRFGPLEHFFFFPIKGFALVEYINIIDAIRAREYIRNHFSWRVKFMDVGLGTKGVINGVAVGSCFHVYVGNIPNQWAKDEILHESYKVVYKGPYMVTDLSCEGALLMEFRTPEEATTAMAHLRQHRKSRSNYLPPNTGPANAAMSQIDGARSVPAAPIHVDIRSNRLGNISAGGFGSPHTAPFHSSQPGFHHATSFTVRPEISSMELSSPRVISENHGAAVQDGHSFQSNWSVSGRTEMPEAGFRKIDGHDSSIMVNPSQGGNMPCLPMATQGPIPPPQPIQPTQYLHPVYLPPNSSWDAGVAAPFIPPSVTPLAQIQGAPMQNYDQMFSHPVAPPHLSSLPPQPAELPPLPPSPPPLPQSQPPLVPPPPNSPPPPPPSPVVEPMQVERSGQLLQYQWQGALCKSGVHYCTIYAQREESDICKYTHdisepaewpakldmtkrtDFRHvkstftstppnkrevCRLVPSSPGDHKGFQDFVSYLKQRECAGVIKIPAVKSIWARLMFILPYSQDICSMLSIAPNSSDCLVALVLPketnfewv
MDTAEQPLKKRKLYDLPPESPKPVEGPQSDVVPPQTPPPLSQDEIQSRRRNKDEIRSVYECYRRLKACIAQKDARRLPELEQAYLSLITASRGCTSVQRIVADLVPRYALYCPTALEAATEVVIYMHNSSVALINRGEDADGVAFQTASACIFGLGDICRTASSEVPTSSVIRGICSAVFHNVLDFFISSFDGKDIIHTVDKEITKMLDSDEVFLGLKKKFSDEDESSLIKLSKFRLLSLLQIFFSSPKNLLAACFELFNPSVLEGIHKGQYFFSQITSRFDDDNMTHSFIIKDDGPKFPETSTKGKEASSEQLVSDDNHVGTSVLKSCLLGLALGKNPSLRRWMFSRYKKLCNLSSSNALPELSSALKRIFESFSEVAKeegsevdsdeddsdpsKYANQQYLVARSANQHETSRELSGNESNSRVNEESCDVSFADKFSGQYPRPHGSVGPRETDFHSNAGSSHDSGCTRSMEYDTGDPGDFSCGRSSMPRDLPNPQMLSPAARTPLHFRNNSFEGRNHFPGRSSSEGASNALLSPNHHLPVPYASTTSQIVWYFDEDPAAMDIFSASKQLWLGSFGPEASEAHIRFQIDRFGPLEHFFFFPIKGFALVEYINIIDAIRAREYIRNHFSWRVKFMDVGLGTKGVINGVAVGSCFHVYVGNIPNQWAKDEILHESYKVVYKGPYMVTDLSCEGALLMEFRTPEEATTAMAHLRQHRKSRSNYLPPNTGPANAAMSQIDGARSVPAAPIHVDIRSNRLGNISAGGFGSPHTAPFHSSQPGFHHATSFTVRPEISSMELSSPRVISENHGAAVQDGHSFQSNWSVSGRTEMPEAGFRKIDGHDSSIMVNPSQGGNMPCLPMATQGpipppqpiqpTQYLHPVYLPPNSSWDAGVAAPFIPPSVTPLAQIQGAPMQNYDQMFSHPVAPPHlsslppqpaelpplppsppplpqsqpplvppppnsppppppspvvepMQVERSGQLLQYQWQGALCKSGVHYCTIYAQREESDICKYTHDISEPAEWPAKLDMTKRTDFRHVKSTFTSTPPNKREVCRLVPSSPGDHKGFQDFVSYLKQRECAGVIKIPAVKSIWARLMFILPYSQDICSMLSIAPNSSDCLVALVLPKETNFEWV
******************************************************IRSVYECYRRLKACIAQKDARRLPELEQAYLSLITASRGCTSV***********ALYCPTALEAATEVVIYMHNSSVALINRGEDADGVAFQTASACIFGLGDICRTASSEVPTSSVIRGICSAVFHNVLDFFISSFDGKDIIHTVDKEITKMLDSDEVFLGLKKKFS****SSLIKLSKFRLLSLLQIFFSSPKNLLAACFELFNPSVLEGIHKGQYFFSQITSRFDDDNMTHSFII****************************VGTSVLKSCLLGLALGKNPSLRRWMFSRYKKLCNLS*****************************************************************************************************************************************************************************************LPVPYASTTSQIVWYFDEDPAAMDIFSASKQLWLGSFGPEASEAHIRFQIDRFGPLEHFFFFPIKGFALVEYINIIDAIRAREYIRNHFSWRVKFMDVGLGTKGVINGVAVGSCFHVYVGNIPNQWAKDEILHESYKVVYKGPYMVTDLSCEGALLMEFR******************************************************************************************************************************************************************************QYLHPVYLPPNSSWDAGVAAPFIPPSVTPL*****************************************************************************QLLQYQWQGALCKSGVHYCTIYAQREESDICKYTHDISEPAEWPAKL************************************KGFQDFVSYLKQRECAGVIKIPAVKSIWARLMFILPYSQDICSMLSIAPNSSDCLVALVLPKET*****
********************************************************SVYECYRRLKACIAQKDARRLPELEQAYLSLITASRGCTSVQRIVADLVPRYALYCPTALEAATEVVIYMHNSSVALINRGEDADGVAFQTASACIFGLGDICRTASSEVPTSSVIRGICSAVFHNVLDFFISSFDGKDIIHTVDKEITKMLDSDEV*******************SKFRLLSLLQIFFSSPKNLLAACFELFNPSVLEGIHKGQYFFSQITSRFDDDNMTHS*************************************KSCLLGLALGKNPSLRRWMFSRYKKLCNLSSSNALPELSSALKRIFESF************************NQQYLV**********************NEESCDVSFADKF**********************************************************QMLSPAAR*********************************************QIVWYFDEDPAAMDIFSASKQLWLGSFGPEASEAHIRFQIDRFGPLEHFFFFPIKGFALVEYINIIDAIRAREYIRNHFSWRVKFMDVGLGTKGVINGVAVGSCFHVYVGNIPNQWAKDEILHESYKVVYKGPYMVTDLSCEGALLMEFRTPEEATTAMAH**************************************VDI*************************************************************************************************************************************************************************************************************************************************KSGVHYCTIYAQR***************AEWPAKLDMTKRTDFRHVKSTFTSTPPNKREVCRLVPSSPGDHKGFQDFVSYLKQRECAGVIKIPAVKSIWARLMFILPYSQDICSMLSIAPNSSDCLVALVLPKET*F**V
MDTAEQPLKKRKLYDLPPE*********************************DEIRSVYECYRRLKACIAQKDARRLPELEQAYLSLITASRGCTSVQRIVADLVPRYALYCPTALEAATEVVIYMHNSSVALINRGEDADGVAFQTASACIFGLGDICRTASSEVPTSSVIRGICSAVFHNVLDFFISSFDGKDIIHTVDKEITKMLDSDEVFLGLKKKFSDEDESSLIKLSKFRLLSLLQIFFSSPKNLLAACFELFNPSVLEGIHKGQYFFSQITSRFDDDNMTHSFIIKDDGPKF*****************DDNHVGTSVLKSCLLGLALGKNPSLRRWMFSRYKKLCNLSSSNALPELSSALKRIFESFS********************KYANQQYLVARS***********************CDVSFADKFSGQYPRPHGSVGPRETDF***********CTRSMEYDTGDPGDFSCGRSSMPRDLPNPQMLSPAARTPLHFRNNSFEGRNHFPGRSSSEGASNALLSPNHHLPVPYASTTSQIVWYFDEDPAAMDIFSASKQLWLGSFGPEASEAHIRFQIDRFGPLEHFFFFPIKGFALVEYINIIDAIRAREYIRNHFSWRVKFMDVGLGTKGVINGVAVGSCFHVYVGNIPNQWAKDEILHESYKVVYKGPYMVTDLSCEGALLMEFRTPEEATTAMAHLRQHRKSRSNYLPPNTGPANAAMSQIDGARSVPAAPIHVDIRSNRLGNISAGGFGSPHTAPFHSSQPGFHHATSFTVRPEISSMELSSPRVISENHGAAVQDGHSFQSNWSVSGRTEMPEAGFRKIDGHDSSIMVNPSQGGNMPCLPMATQGPIPPPQPIQPTQYLHPVYLPPNSSWDAGVAAPFIPPSVTPLAQIQGAPMQNYDQMFSHPVAPPHLSSLPPQPAELPPLPPSPP************************VVEPMQVERSGQLLQYQWQGALCKSGVHYCTIYAQREESDICKYTHDISEPAEWPAKLDMTKRTDFRHVKSTFTSTPPNKREVCRLVPSSPGDHKGFQDFVSYLKQRECAGVIKIPAVKSIWARLMFILPYSQDICSMLSIAPNSSDCLVALVLPKETNFEWV
******************************************D*IQ**RRNKDEIRSVYECYRRLKACIAQKDARRLPELEQAYLSLITASRGCTSVQRIVADLVPRYALYCPTALEAATEVVIYMHNSSVALINRGEDADGVAFQTASACIFGLGDICRTASSEVPTSSVIRGICSAVFHNVLDFFISSFDGKDIIHTVDKEITKMLDSDEVFLGLKKKFSDEDESSLIKLSKFRLLSLLQIFFSSPKNLLAACFELFNPSVLEGIHKGQYFFSQITSRFDDDNMT**************************************LKSCLLGLALGKNPSLRRWMFSRYKKLCNLSSSNALPELSSALKRIFESFSEVAKE**************SKYANQQYLVARSANQHETSRELSGNESNSRVNEESCDVSFADKFSGQYPRP*********************************************************************************************H*PVPYASTTSQIVWYFDEDPAAMDIFSASKQLWLGSFGPEASEAHIRFQIDRFGPLEHFFFFPIKGFALVEYINIIDAIRAREYIRNHFSWRVKFMDVGLGTKGVINGVAVGSCFHVYVGNIPNQWAKDEILHESYKVVYKGPYMVTDLSCEGALLMEFRTPEEATTAMAHLRQHRKSRSN***************IDGARSVPAAPIHVDIRSNRLGNISAGGFGSPH*****************************SPRVISENHGAAVQDGHSFQSNWSVSGRTEMPEAGFRKIDGHDSSIMVNPSQGGNMPCLPMATQGPIPPPQPIQPTQYLHPVYLPPNSSWDAGVAAPFIPPSVTPLAQIQGAPMQNYDQMFSHPVAPPHLSSLPPQPAELPPLPPSPPPL*QSQPPLVPPPPNSPPPPPPSPVVEPMQ**R***LLQYQWQGALCKSGVHYCTIYAQREESDICKYTHDISEPAEWPAKLDMTKRTDFRHVKSTFTSTPPNKREVCRLVPSSPGDHKGFQDFVSYLKQRECAGVIKIPAVKSIWARLMFILPYSQDICSMLSIAPNSSDCLVALVLPKET*****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDTAEQPLKKRKLYDLPPESPKPVEGPQSDVVPPQTPPPLSQDEIQSRRRNKDEIRSVYECYRRLKACIAQKDARRLPELEQAYLSLITASRGCTSVQRIVADLVPRYALYCPTALEAATEVVIYMHNSSVALINRGEDADGVAFQTASACIFGLGDICRTASSEVPTSSVIRGICSAVFHNVLDFFISSFDGKDIIHTVDKEITKMLDSDEVFLGLKKKFSDEDESSLIKLSKFRLLSLLQIFFSSPKNLLAACFELFNPSVLEGIHKGQYFFSQITSRFDDDNMTHSFIIKDDGPKFPETSTKGKEASSEQLVSDDNHVGTSVLKSCLLGLALGKNPSLRRWMFSRYKKLCNLSSSNALPELSSALKRIFESFSEVAKEEGSEVDSDEDDSDPSKYANQQYLVARSANQHETSRELSGNESNSRVNEESCDVSFADKFSGQYPRPHGSVGPRETDFHSNAGSSHDSGCTRSMEYDTGDPGDFSCGRSSMPRDLPNPQMLSPAARTPLHFRNNSFEGRNHFPGRSSSEGASNALLSPNHHLPVPYASTTSQIVWYFDEDPAAMDIFSASKQLWLGSFGPEASEAHIRFQIDRFGPLEHFFFFPIKGFALVEYINIIDAIRAREYIRNHFSWRVKFMDVGLGTKGVINGVAVGSCFHVYVGNIPNQWAKDEILHESYKVVYKGPYMVTDLSCEGALLMEFRTPEEATTAMAHLRQHRKSRSNYLPPNTGPANAAMSQIDGARSVPAAPIHVDIRSNRLGNISAGGFGSPHTAPFHSSQPGFHHATSFTVRPEISSMELSSPRVISENHGAAVQDGHSFQSNWSVSGRTEMPEAGFRKIDGHDSSIMVNPSQGGNMPCLPMATQGPIPPPQPIQPTQYLHPVYLPPNSSWDAGVAAPFIPPSVTPLAQIQGAPMQNYDQMFSHPVAPPHLSSLPPQPAELPPLPPSPPPLPQSQPPLVPPPPNSPPPPPPSPVVEPMQVERSGQLLQYQWQGALCKSGVHYCTIYAQREESDICKYTHDISEPAEWPAKLDMTKRTDFRHVKSTFTSTPPNKREVCRLVPSSPGDHKGFQDFVSYLKQRECAGVIKIPAVKSIWARLMFILPYSQDICSMLSIAPNSSDCLVALVLPKETNFEWV
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

No hits with e-value below 0.001 by BLAST

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1134
3021422081077 unnamed protein product [Vitis vinifera] 0.886 0.933 0.538 0.0
224129874 1944 predicted protein [Populus trichocarpa] 0.888 0.518 0.531 0.0
359492549 1263 PREDICTED: uncharacterized protein LOC10 0.657 0.590 0.562 0.0
6693023 1840 T22C5.20 [Arabidopsis thaliana] 0.855 0.527 0.400 0.0
356562239 1310 PREDICTED: uncharacterized protein LOC10 0.638 0.552 0.513 0.0
449447293 1308 PREDICTED: uncharacterized protein LOC10 0.674 0.584 0.489 0.0
449515095 1308 PREDICTED: uncharacterized LOC101209442 0.674 0.584 0.489 0.0
356554000 1311 PREDICTED: uncharacterized protein LOC10 0.682 0.590 0.499 0.0
1453361811075 nucleic acid binding protein [Arabidopsi 0.718 0.758 0.407 0.0
297845734 1838 predicted protein [Arabidopsis lyrata su 0.710 0.438 0.408 0.0
>gi|302142208|emb|CBI19411.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score = 1150 bits (2974), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 646/1199 (53%), Positives = 776/1199 (64%), Gaps = 194/1199 (16%)

Query: 3    TAEQPLKKRKLYDLPPESPKPVEGPQSDVVPPQTP-PPLSQDEIQSRRRNKDEIRSVYEC 61
            +AEQPLKKRKL+D   E P   + P       ++  PPLSQ+EI  RRRN++EIR+VYEC
Sbjct: 2    SAEQPLKKRKLHDHVSEPPPEPQPPPQTAAQQRSATPPLSQEEIMRRRRNREEIRNVYEC 61

Query: 62   YRRLKACIAQKDARRLPELEQAYLSLITASRGCTSVQRIVADLVPRYALYCPTALEAATE 121
            Y+R+K+CIA +DAR +PELEQAYLSLITASRGCTS QRIVAD VPRYA YCPTALEAA +
Sbjct: 62   YKRIKSCIAHEDARLMPELEQAYLSLITASRGCTSAQRIVADFVPRYASYCPTALEAAAK 121

Query: 122  VVIYMHNSSVALINRGEDADGVAFQTASACIFGLGDICRTASSEVPTSSVIRGICSAVFH 181
            VVI MH  S+  INRGED++GVAF+TA ACIFGLGDIC  A+SE PTSSVIRGICSAVF 
Sbjct: 122  VVINMHKWSLTTINRGEDSNGVAFETAKACIFGLGDICSAAASEAPTSSVIRGICSAVFL 181

Query: 182  NVLDFFISSFDGKDIIHTVDKEITKMLDSDEVFLGLKKKFSDEDESSLIKLSKFRLLSLL 241
            NVL FF+SSF+GKDI   VDKE  K+ DS E+F  LK+KFSDED S L+KL KF  LS L
Sbjct: 182  NVLTFFLSSFEGKDIFQIVDKETLKIHDSPELFPRLKQKFSDEDGSPLLKLPKFSALSFL 241

Query: 242  QIFFSSPKNLLAACFELFNPSVLEGIHKGQYFF-SQITSRFDDDNMTHSFIIKDDGPK-- 298
            +IFFS  K LLAACFELFN +  EGI+K  YFF SQ+TSR D D+ TH+     DGPK  
Sbjct: 242  KIFFSCSKKLLAACFELFNSTTTEGINKEGYFFLSQVTSRLDADDATHTSNTTIDGPKSC 301

Query: 299  --FPETSTKGKEASSEQLVSDDNHV---GTSVLKSCLLGLALGKNPSLRRWMFSRYKKLC 353
                ETST+G + S E  V D NHV    + +  SCLL L L K+PSLR WMF +YKKLC
Sbjct: 302  PGSVETSTEGNKVSDEGFVRDGNHVLGKASPMSNSCLLRLVLDKDPSLRSWMFVKYKKLC 361

Query: 354  NLSSSNALPELSSALKRIFESFSEVAKEEGSEVDSDEDDSDPSKYANQQYLVARSANQHE 413
              +SS  + E +SAL+RIFESF+E+A+ E S+VDSDED SDPSKY N+            
Sbjct: 362  KSASSQVVSEFTSALERIFESFTELAQVEDSQVDSDEDTSDPSKYINRH----------- 410

Query: 414  TSRELSGNESNSRVNEESCDVSFADKFSGQYPRPHGSVGPRETDFHSNAGSSHDSGCTRS 473
                                                SVGP E D  S+  S+HD G +RS
Sbjct: 411  ------------------------------------SVGPMEADIRSSTSSNHDKGGSRS 434

Query: 474  MEYDTGDPGDFSCGRSSMPRDLPNPQMLSPAARTPLHFRNNSFEGRNHFPGRSSSEGASN 533
            M+++TG+ GD S GRSSMPRDL N  + SP  R    FR + FEGR+H            
Sbjct: 435  MDFETGEHGDLSHGRSSMPRDLLNNHLHSPVTRKSFEFRTDPFEGRSHL----------- 483

Query: 534  ALLSPNHHLPVPYASTTSQIVWYFDEDPAAMDIFSASKQLWLGSFGPEASEAHIRFQIDR 593
             + +  + + + Y++T+SQ +WYFD DPAAMD+FSASKQLWLGS  P+ASEA +RFQ++R
Sbjct: 484  -VQAEKNQMTISYSATSSQTIWYFDGDPAAMDVFSASKQLWLGSISPDASEALVRFQVER 542

Query: 594  FGPLEHFFFFPIKGFALVEYINIIDAIRAREYIRNHFSWRVKFMDVGLGTKGVINGVAVG 653
            FGP+EHFFFFPIKGFALVEY NI+DAIRAREY++ H  W +KF+D+GLGT+G INGVAVG
Sbjct: 543  FGPIEHFFFFPIKGFALVEYRNIMDAIRAREYMQGHSPWHIKFLDIGLGTRGAINGVAVG 602

Query: 654  SCFHVYVGNIPNQWAKDEILHESYKVVYKGPYMVTDLSCEGALLMEFRTPEEATTAMAHL 713
            S +HVYVGN+ +QWAKDEILHES KV+YKGP+MVTDL+   ALLMEF TPEEA + MAHL
Sbjct: 603  SSYHVYVGNVSSQWAKDEILHESMKVIYKGPHMVTDLTGGEALLMEFETPEEAASVMAHL 662

Query: 714  RQHRKSRSNYLPPNTGPANAAMSQIDGARSVPAAPIHVDIRSN-RLGNISA--------- 763
            RQ+R+   N L P     N A + +DGARS+ + PI +    N  +GN+ +         
Sbjct: 663  RQYRRENGNRLMPLNSVTNVARTHLDGARSM-SGPIPLMTMCNLAIGNVGSVVRLARANM 721

Query: 764  ------------------------GGFGSPHTAPFHSSQPGFHHATSFTVRPEISSMELS 799
                                    G  G      F  SQPG  HA  FT + E S++EL 
Sbjct: 722  QMGCCWFIECSNVDAAVTVLKNLRGCPGMFFQIEF--SQPGKPHA--FTKKSESSTLELV 777

Query: 800  SPRVISENHGAAVQDGHSFQSNWSVSGRTEMPEAGFRKIDGHDSSIMVN-PSQG------ 852
            SPRV  ENHG A+Q GH FQSNW+VSG TEMPE G RK DG+DSS++V  PS G      
Sbjct: 778  SPRVKLENHGTALQSGHGFQSNWAVSGSTEMPEVGVRKTDGYDSSMVVGLPSGGHAGSGA 837

Query: 853  ------------------GNMPCLPMATQGP-IPPPQPIQPTQYLHPVYLPPNSSWDAGV 893
                              GN+PC+P+ATQGP I PPQ                       
Sbjct: 838  AEQMWMYKKPEIELHSGQGNIPCMPIATQGPNIAPPQ----------------------- 874

Query: 894  AAPFIPPSVTPLAQIQGAPMQNYDQMFSHPVAPPHLSSLPPQPAELPPLPPSPPPLPQSQ 953
             APF+P SVTPLAQ+QG  MQ++DQMFS PV+ P L   PP                   
Sbjct: 875  -APFLPASVTPLAQMQGNSMQHFDQMFSLPVSLPPLVPPPPSSP-------------PPP 920

Query: 954  PPLVPPPPNSPPPPPPSPVVEPMQVERSGQLLQYQWQGALCKSGVHYCTIYAQREESDIC 1013
             P+               V+  +Q +  G L          KSGV+YCTI A R +SDIC
Sbjct: 921  TPI---------------VLSNLQYQWQGTL---------SKSGVNYCTIIAHRVDSDIC 956

Query: 1014 KYTHDISEPAEWPAKLDMTKRTDFRHVKSTFTSTPPNKREVCRLVPSSPGDHKGFQDFVS 1073
            KY  ++SEP EWPAKLDMTKRTDFRHVKSTFT TPP+KREVC+L P S  DHKGFQDF++
Sbjct: 957  KYLSNMSEPTEWPAKLDMTKRTDFRHVKSTFTGTPPHKREVCQLRPFSASDHKGFQDFIA 1016

Query: 1074 YLKQRECAGVIKIPAVKSIWARLMFILPYSQDICSMLSIAPNSSDCLVALVLPKETNFE 1132
            YLKQR+CAGVIKIPAVKS+WARL+FILPYS D CSMLSIAPN SDCL+A+VLPKET+FE
Sbjct: 1017 YLKQRDCAGVIKIPAVKSMWARLLFILPYSTDACSMLSIAPNPSDCLIAVVLPKETSFE 1075




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|224129874|ref|XP_002320692.1| predicted protein [Populus trichocarpa] gi|222861465|gb|EEE99007.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|359492549|ref|XP_002283309.2| PREDICTED: uncharacterized protein LOC100259158 [Vitis vinifera] Back     alignment and taxonomy information
>gi|6693023|gb|AAF24949.1|AC012375_12 T22C5.20 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|356562239|ref|XP_003549379.1| PREDICTED: uncharacterized protein LOC100780367 [Glycine max] Back     alignment and taxonomy information
>gi|449447293|ref|XP_004141403.1| PREDICTED: uncharacterized protein LOC101209442 [Cucumis sativus] Back     alignment and taxonomy information
>gi|449515095|ref|XP_004164585.1| PREDICTED: uncharacterized LOC101209442 [Cucumis sativus] Back     alignment and taxonomy information
>gi|356554000|ref|XP_003545338.1| PREDICTED: uncharacterized protein LOC100798033 [Glycine max] Back     alignment and taxonomy information
>gi|145336181|ref|NP_174096.3| nucleic acid binding protein [Arabidopsis thaliana] gi|20259447|gb|AAM13844.1| unknown protein [Arabidopsis thaliana] gi|332192751|gb|AEE30872.1| nucleic acid binding protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297845734|ref|XP_002890748.1| predicted protein [Arabidopsis lyrata subsp. lyrata] gi|297336590|gb|EFH67007.1| predicted protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1134
TAIR|locus:21992361075 AT1G27750 [Arabidopsis thalian 0.330 0.348 0.483 1.1e-233
TAIR|locus:2199236 AT1G27750 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 854 (305.7 bits), Expect = 1.1e-233, Sum P(4) = 1.1e-233
 Identities = 189/391 (48%), Positives = 255/391 (65%)

Query:     1 MDTAEQPLKKRKLYDLPPES--PKP--VEGPQ-SDVV---P-PQTPPPLSQDEIQSRRRN 51
             M  AEQP+KKR+LY+  PES  P P  +E    S VV   P P TP P SQ+EIQ+R RN
Sbjct:     1 MACAEQPIKKRRLYESIPESHPPPPPQLESQSPSTVVSSFPAPVTPSPPSQEEIQTRSRN 60

Query:    52 KDEIRSVYECYRRLKACIAQKDAR-RLPELEQAYLSLITASRGCTSVQRIVADLVPRYAL 110
             ++EIR V++CY+RLK+C+AQ+D   R   LEQAY SLI+ASRGCTSV+R+VADLVPRYAL
Sbjct:    61 REEIRRVHDCYKRLKSCVAQRDGGGRSANLEQAYRSLISASRGCTSVKRLVADLVPRYAL 120

Query:   111 YCPTALEAATEVVIYMHNSSVALINRGEDADGVAFQTASACIFGLGDICRTASSEVPTSS 170
             YCPTA+  A + VI MHN S+  + RG+DADGVAFQTA ACIFGL D+C  A S+  +S 
Sbjct:   121 YCPTAIGDAVQAVIDMHNFSLEALKRGQDADGVAFQTAKACIFGLVDLCSAALSKKTSSP 180

Query:   171 VIRGICSAVFHNVLDFFISSFDGKDIIHTVDKEITKMLDSDEVFLGLKKKFSDEDESSLI 230
               R ICSAVF NVL FF+ SF+GK+I   VDK   K+ D DE+F  L +K SD +   LI
Sbjct:   181 GARDICSAVFRNVLTFFVLSFEGKNIFQIVDKSDLKLQDPDEIFSQLMQKLSDGNSLPLI 240

Query:   231 KLSKFRLLSLLQIFFSSPKNLLAACFELFNPSVLEGIHKGQYFFSQITSRFDDDNMTHSF 290
             KLS+FR+L+LL++FF+ PK  +A CF  FN S  E +  G+Y  + +T + +D  +  + 
Sbjct:   241 KLSQFRVLALLKVFFNFPKKSIATCFGFFNSSSTEDVATGRYLITHMTEKIND--IDAAS 298

Query:   291 IIKDDGPKFPETSTKGKEASSEQLVSDDN-HVGTSVLKSCLLGLALGKNPSLRRWMFSRY 349
             I  +      +T +   EA+ +     +     ++ L SCLL + + K+ S+ RW F +Y
Sbjct:   299 IEPEVDENSGQTGSNNIEATGKNAEGLNGVQEASNSLTSCLLEMVIRKSSSIGRWAFFQY 358

Query:   350 KKLCNLSSSNALPELSSALKRIFESFSEVAK 380
             KK+C+LSS     ++SSA+  +   F  V K
Sbjct:   359 KKICSLSS---FVDISSAVTSLEGIFGFVGK 386


GO:0003676 "nucleic acid binding" evidence=IEA
GO:0005634 "nucleus" evidence=ISM
GO:0008150 "biological_process" evidence=ND

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
GSVIVG00014950001
SubName- Full=Chromosome chr18 scaffold_1, whole genome shotgun sequence; (1052 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1134
pfam07744109 pfam07744, SPOC, SPOC domain 4e-16
cd1231072 cd12310, RRM3_Spen, RNA recognition motif 3 in the 5e-13
pfam09770 804 pfam09770, PAT1, Topoisomerase II-associated prote 2e-10
PHA032473151 PHA03247, PHA03247, large tegument protein UL36; P 1e-08
pfam09770 804 pfam09770, PAT1, Topoisomerase II-associated prote 1e-07
PHA03247 3151 PHA03247, PHA03247, large tegument protein UL36; P 1e-07
PRK14950585 PRK14950, PRK14950, DNA polymerase III subunits ga 3e-07
pfam07223357 pfam07223, DUF1421, Protein of unknown function (D 5e-07
pfam09770 804 pfam09770, PAT1, Topoisomerase II-associated prote 1e-06
PHA03247 3151 PHA03247, PHA03247, large tegument protein UL36; P 1e-06
pfam03154 979 pfam03154, Atrophin-1, Atrophin-1 family 1e-06
pfam03276 582 pfam03276, Gag_spuma, Spumavirus gag protein 2e-06
PRK03427333 PRK03427, PRK03427, cell division protein ZipA; Pr 4e-06
PRK14951618 PRK14951, PRK14951, DNA polymerase III subunits ga 6e-06
smart00818165 smart00818, Amelogenin, Amelogenins, cell adhesion 7e-06
pfam04652315 pfam04652, DUF605, Vta1 like 8e-06
smart00818165 smart00818, Amelogenin, Amelogenins, cell adhesion 1e-05
pfam07174297 pfam07174, FAP, Fibronectin-attachment protein (FA 1e-05
PRK14950585 PRK14950, PRK14950, DNA polymerase III subunits ga 3e-05
cd1252378 cd12523, RRM2_MRN1, RNA recognition motif 2 of RNA 3e-05
pfam07174297 pfam07174, FAP, Fibronectin-attachment protein (FA 4e-05
PRK10263 1355 PRK10263, PRK10263, DNA translocase FtsK; Provisio 6e-05
PHA03247 3151 PHA03247, PHA03247, large tegument protein UL36; P 7e-05
smart00818165 smart00818, Amelogenin, Amelogenins, cell adhesion 9e-05
PRK11633226 PRK11633, PRK11633, cell division protein DedD; Pr 9e-05
pfam09770 804 pfam09770, PAT1, Topoisomerase II-associated prote 1e-04
PHA032473151 PHA03247, PHA03247, large tegument protein UL36; P 1e-04
pfam03154 979 pfam03154, Atrophin-1, Atrophin-1 family 1e-04
cd1252279 cd12522, RRM4_MRN1, RNA recognition motif 4 of RNA 1e-04
PHA03247 3151 PHA03247, PHA03247, large tegument protein UL36; P 2e-04
pfam07223357 pfam07223, DUF1421, Protein of unknown function (D 2e-04
pfam07174297 pfam07174, FAP, Fibronectin-attachment protein (FA 2e-04
PRK07764824 PRK07764, PRK07764, DNA polymerase III subunits ga 2e-04
PRK14948620 PRK14948, PRK14948, DNA polymerase III subunits ga 2e-04
COG3147226 COG3147, DedD, Uncharacterized protein conserved i 2e-04
PRK14965576 PRK14965, PRK14965, DNA polymerase III subunits ga 2e-04
PHA03247 3151 PHA03247, PHA03247, large tegument protein UL36; P 3e-04
PRK03427333 PRK03427, PRK03427, cell division protein ZipA; Pr 3e-04
PHA033771000 PHA03377, PHA03377, EBNA-3C; Provisional 3e-04
pfam13388422 pfam13388, DUF4106, Protein of unknown function (D 3e-04
PRK12323700 PRK12323, PRK12323, DNA polymerase III subunits ga 5e-04
PRK07764 824 PRK07764, PRK07764, DNA polymerase III subunits ga 7e-04
pfam07223357 pfam07223, DUF1421, Protein of unknown function (D 8e-04
COG5178 2365 COG5178, PRP8, U5 snRNP spliceosome subunit [RNA p 9e-04
pfam14179110 pfam14179, YppG, YppG-like protein 9e-04
PHA032473151 PHA03247, PHA03247, large tegument protein UL36; P 0.001
pfam03154 979 pfam03154, Atrophin-1, Atrophin-1 family 0.001
PRK10263 1355 PRK10263, PRK10263, DNA translocase FtsK; Provisio 0.001
TIGR01628562 TIGR01628, PABP-1234, polyadenylate binding protei 0.001
PHA03378991 PHA03378, PHA03378, EBNA-3B; Provisional 0.001
pfam02993238 pfam02993, MCPVI, Minor capsid protein VI 0.001
PRK10819246 PRK10819, PRK10819, transport protein TonB; Provis 0.001
TIGR01645612 TIGR01645, half-pint, poly-U binding splicing fact 0.001
TIGR02031 589 TIGR02031, BchD-ChlD, magnesium chelatase ATPase s 0.001
pfam07174297 pfam07174, FAP, Fibronectin-attachment protein (FA 0.002
PRK07764824 PRK07764, PRK07764, DNA polymerase III subunits ga 0.002
PRK12270 1228 PRK12270, kgd, alpha-ketoglutarate decarboxylase; 0.002
PRK07994647 PRK07994, PRK07994, DNA polymerase III subunits ga 0.002
PRK14971614 PRK14971, PRK14971, DNA polymerase III subunits ga 0.002
pfam04625 407 pfam04625, DEC-1_N, DEC-1 protein, N-terminal regi 0.002
pfam03153332 pfam03153, TFIIA, Transcription factor IIA, alpha/ 0.002
PRK14951618 PRK14951, PRK14951, DNA polymerase III subunits ga 0.003
smart00818165 smart00818, Amelogenin, Amelogenins, cell adhesion 0.003
PRK07764824 PRK07764, PRK07764, DNA polymerase III subunits ga 0.003
PHA03307 1352 PHA03307, PHA03307, transcriptional regulator ICP4 0.003
PRK12438991 PRK12438, PRK12438, hypothetical protein; Provisio 0.003
cd1234067 cd12340, RBD_RRM1_NPL3, RNA recognition motif 1 in 0.003
pfam04652315 pfam04652, DUF605, Vta1 like 0.004
PHA03378 991 PHA03378, PHA03378, EBNA-3B; Provisional 0.004
PRK07994647 PRK07994, PRK07994, DNA polymerase III subunits ga 0.004
cd0059072 cd00590, RRM_SF, RNA recognition motif (RRM) super 0.004
smart00817411 smart00817, Amelin, Ameloblastin precursor (Amelin 0.004
>gnl|CDD|219549 pfam07744, SPOC, SPOC domain Back     alignment and domain information
 Score = 75.0 bits (185), Expect = 4e-16
 Identities = 28/116 (24%), Positives = 49/116 (42%), Gaps = 10/116 (8%)

Query: 989  WQGALCKSGVHYCTIYAQREESDICKYTHDISEPAEWPAKLDMTKRTDFRHVKSTFTSTP 1048
            WQG L   GV   ++ A     D  K  +     +  P +L++  R D   V+       
Sbjct: 1    WQGTLAMKGVAEFSVRAHLVSGD-EKLVN-----SLLPLRLEIRGRLDLSQVEKYLRKLR 54

Query: 1049 PNK-REVC--RLVPSSPGDHKGFQDFVSYLKQRECAGVIKIPAVKSIWARLMFILP 1101
             +  + V    L P S  D   F + + YL+ ++ AGV K+    S   + ++++P
Sbjct: 55   KSSTKAVVVLALSPDSESDRAAFDELIDYLQSKQRAGVAKVGDPGS-QVKDLYLIP 109


The SPOC (Spen paralogue and orthologue C-terminal) domain is involved in developmental signalling. Length = 109

>gnl|CDD|240756 cd12310, RRM3_Spen, RNA recognition motif 3 in the Spen (split end) protein family Back     alignment and domain information
>gnl|CDD|220392 pfam09770, PAT1, Topoisomerase II-associated protein PAT1 Back     alignment and domain information
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
>gnl|CDD|220392 pfam09770, PAT1, Topoisomerase II-associated protein PAT1 Back     alignment and domain information
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
>gnl|CDD|237864 PRK14950, PRK14950, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|219339 pfam07223, DUF1421, Protein of unknown function (DUF1421) Back     alignment and domain information
>gnl|CDD|220392 pfam09770, PAT1, Topoisomerase II-associated protein PAT1 Back     alignment and domain information
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
>gnl|CDD|217393 pfam03154, Atrophin-1, Atrophin-1 family Back     alignment and domain information
>gnl|CDD|217469 pfam03276, Gag_spuma, Spumavirus gag protein Back     alignment and domain information
>gnl|CDD|235124 PRK03427, PRK03427, cell division protein ZipA; Provisional Back     alignment and domain information
>gnl|CDD|237865 PRK14951, PRK14951, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|197891 smart00818, Amelogenin, Amelogenins, cell adhesion proteins, play a role in the biomineralisation of teeth Back     alignment and domain information
>gnl|CDD|218191 pfam04652, DUF605, Vta1 like Back     alignment and domain information
>gnl|CDD|197891 smart00818, Amelogenin, Amelogenins, cell adhesion proteins, play a role in the biomineralisation of teeth Back     alignment and domain information
>gnl|CDD|219321 pfam07174, FAP, Fibronectin-attachment protein (FAP) Back     alignment and domain information
>gnl|CDD|237864 PRK14950, PRK14950, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|240967 cd12523, RRM2_MRN1, RNA recognition motif 2 of RNA-binding protein MRN1 and similar proteins Back     alignment and domain information
>gnl|CDD|219321 pfam07174, FAP, Fibronectin-attachment protein (FAP) Back     alignment and domain information
>gnl|CDD|236669 PRK10263, PRK10263, DNA translocase FtsK; Provisional Back     alignment and domain information
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
>gnl|CDD|197891 smart00818, Amelogenin, Amelogenins, cell adhesion proteins, play a role in the biomineralisation of teeth Back     alignment and domain information
>gnl|CDD|236940 PRK11633, PRK11633, cell division protein DedD; Provisional Back     alignment and domain information
>gnl|CDD|220392 pfam09770, PAT1, Topoisomerase II-associated protein PAT1 Back     alignment and domain information
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
>gnl|CDD|217393 pfam03154, Atrophin-1, Atrophin-1 family Back     alignment and domain information
>gnl|CDD|240966 cd12522, RRM4_MRN1, RNA recognition motif 4 of RNA-binding protein MRN1 and similar proteins Back     alignment and domain information
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
>gnl|CDD|219339 pfam07223, DUF1421, Protein of unknown function (DUF1421) Back     alignment and domain information
>gnl|CDD|219321 pfam07174, FAP, Fibronectin-attachment protein (FAP) Back     alignment and domain information
>gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|237862 PRK14948, PRK14948, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|225689 COG3147, DedD, Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>gnl|CDD|237871 PRK14965, PRK14965, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
>gnl|CDD|235124 PRK03427, PRK03427, cell division protein ZipA; Provisional Back     alignment and domain information
>gnl|CDD|177614 PHA03377, PHA03377, EBNA-3C; Provisional Back     alignment and domain information
>gnl|CDD|222095 pfam13388, DUF4106, Protein of unknown function (DUF4106) Back     alignment and domain information
>gnl|CDD|237057 PRK12323, PRK12323, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|219339 pfam07223, DUF1421, Protein of unknown function (DUF1421) Back     alignment and domain information
>gnl|CDD|227505 COG5178, PRP8, U5 snRNP spliceosome subunit [RNA processing and modification] Back     alignment and domain information
>gnl|CDD|222579 pfam14179, YppG, YppG-like protein Back     alignment and domain information
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
>gnl|CDD|217393 pfam03154, Atrophin-1, Atrophin-1 family Back     alignment and domain information
>gnl|CDD|236669 PRK10263, PRK10263, DNA translocase FtsK; Provisional Back     alignment and domain information
>gnl|CDD|130689 TIGR01628, PABP-1234, polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>gnl|CDD|223065 PHA03378, PHA03378, EBNA-3B; Provisional Back     alignment and domain information
>gnl|CDD|217310 pfam02993, MCPVI, Minor capsid protein VI Back     alignment and domain information
>gnl|CDD|236768 PRK10819, PRK10819, transport protein TonB; Provisional Back     alignment and domain information
>gnl|CDD|130706 TIGR01645, half-pint, poly-U binding splicing factor, half-pint family Back     alignment and domain information
>gnl|CDD|233692 TIGR02031, BchD-ChlD, magnesium chelatase ATPase subunit D Back     alignment and domain information
>gnl|CDD|219321 pfam07174, FAP, Fibronectin-attachment protein (FAP) Back     alignment and domain information
>gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|237030 PRK12270, kgd, alpha-ketoglutarate decarboxylase; Reviewed Back     alignment and domain information
>gnl|CDD|236138 PRK07994, PRK07994, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|237874 PRK14971, PRK14971, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|113398 pfam04625, DEC-1_N, DEC-1 protein, N-terminal region Back     alignment and domain information
>gnl|CDD|217392 pfam03153, TFIIA, Transcription factor IIA, alpha/beta subunit Back     alignment and domain information
>gnl|CDD|237865 PRK14951, PRK14951, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|197891 smart00818, Amelogenin, Amelogenins, cell adhesion proteins, play a role in the biomineralisation of teeth Back     alignment and domain information
>gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|223039 PHA03307, PHA03307, transcriptional regulator ICP4; Provisional Back     alignment and domain information
>gnl|CDD|171499 PRK12438, PRK12438, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|240786 cd12340, RBD_RRM1_NPL3, RNA recognition motif 1 in yeast nucleolar protein 3 (Npl3p) and similar proteins Back     alignment and domain information
>gnl|CDD|218191 pfam04652, DUF605, Vta1 like Back     alignment and domain information
>gnl|CDD|223065 PHA03378, PHA03378, EBNA-3B; Provisional Back     alignment and domain information
>gnl|CDD|236138 PRK07994, PRK07994, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|240668 cd00590, RRM_SF, RNA recognition motif (RRM) superfamily Back     alignment and domain information
>gnl|CDD|214832 smart00817, Amelin, Ameloblastin precursor (Amelin) Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 1134
KOG0107195 consensus Alternative splicing factor SRp20/9G8 (R 99.68
TIGR01661352 ELAV_HUD_SF ELAV/HuD family splicing factor. These 99.65
TIGR01659346 sex-lethal sex-lethal family splicing factor. This 99.62
TIGR01628562 PABP-1234 polyadenylate binding protein, human typ 99.6
TIGR01628562 PABP-1234 polyadenylate binding protein, human typ 99.57
TIGR01649481 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor 99.56
TIGR01645612 half-pint poly-U binding splicing factor, half-pin 99.55
TIGR01649481 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor 99.52
KOG3671569 consensus Actin regulatory protein (Wiskott-Aldric 99.52
KOG1924 1102 consensus RhoA GTPase effector DIA/Diaphanous [Sig 99.51
TIGR01622457 SF-CC1 splicing factor, CC1-like family. A homolog 99.5
TIGR01648578 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein 99.48
TIGR01642509 U2AF_lg U2 snRNP auxilliary factor, large subunit, 99.47
KOG0117506 consensus Heterogeneous nuclear ribonucleoprotein 99.46
TIGR01661352 ELAV_HUD_SF ELAV/HuD family splicing factor. These 99.45
TIGR01642509 U2AF_lg U2 snRNP auxilliary factor, large subunit, 99.43
TIGR01622457 SF-CC1 splicing factor, CC1-like family. A homolog 99.42
KOG0144510 consensus RNA-binding protein CUGBP1/BRUNO (RRM su 99.32
KOG0148321 consensus Apoptosis-promoting RNA-binding protein 99.31
TIGR01648578 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein 99.3
KOG0105241 consensus Alternative splicing factor ASF/SF2 (RRM 99.24
PF0007670 RRM_1: RNA recognition motif. (a.k.a. RRM, RBD, or 99.18
PLN03134144 glycine-rich RNA-binding protein 4; Provisional 99.13
KOG0117506 consensus Heterogeneous nuclear ribonucleoprotein 99.12
KOG0132894 consensus RNA polymerase II C-terminal domain-bind 99.0
PF1425970 RRM_6: RNA recognition motif (a.k.a. RRM, RBD, or 98.94
KOG0145360 consensus RNA-binding protein ELAV/HU (RRM superfa 98.94
smart0036272 RRM_2 RNA recognition motif. 98.86
PLN03120260 nucleic acid binding protein; Provisional 98.83
KOG0131203 consensus Splicing factor 3b, subunit 4 [RNA proce 98.78
TIGR01659346 sex-lethal sex-lethal family splicing factor. This 98.76
KOG0106216 consensus Alternative splicing factor SRp55/B52/SR 98.75
KOG0113335 consensus U1 small nuclear ribonucleoprotein (RRM 98.75
COG0724306 RNA-binding proteins (RRM domain) [General functio 98.74
KOG0124544 consensus Polypyrimidine tract-binding protein PUF 98.69
KOG0123369 consensus Polyadenylate-binding protein (RRM super 98.69
TIGR01645612 half-pint poly-U binding splicing factor, half-pin 98.68
smart0036071 RRM RNA recognition motif. 98.64
cd0059074 RRM RRM (RNA recognition motif), also known as RBD 98.64
KOG0109346 consensus RNA-binding protein LARK, contains RRM a 98.62
PLN03213 759 repressor of silencing 3; Provisional 98.62
KOG0148321 consensus Apoptosis-promoting RNA-binding protein 98.61
KOG0114124 consensus Predicted RNA-binding protein (RRM super 98.6
KOG0111298 consensus Cyclophilin-type peptidyl-prolyl cis-tra 98.6
KOG0122270 consensus Translation initiation factor 3, subunit 98.59
PF1389356 RRM_5: RNA recognition motif. (a.k.a. RRM, RBD, or 98.58
PLN03121243 nucleic acid binding protein; Provisional 98.55
KOG0144510 consensus RNA-binding protein CUGBP1/BRUNO (RRM su 98.55
KOG0121153 consensus Nuclear cap-binding protein complex, sub 98.51
KOG4207256 consensus Predicted splicing factor, SR protein su 98.45
KOG0125376 consensus Ataxin 2-binding protein (RRM superfamil 98.44
KOG1457284 consensus RNA binding protein (contains RRM repeat 98.4
KOG0110725 consensus RNA-binding protein (RRM superfamily) [G 98.39
KOG1924 1102 consensus RhoA GTPase effector DIA/Diaphanous [Sig 98.35
KOG0151 877 consensus Predicted splicing regulator, contains R 98.29
KOG4206221 consensus Spliceosomal protein snRNP-U1A/U2B [RNA 98.27
KOG0146371 consensus RNA-binding protein ETR-3 (RRM superfami 98.18
KOG0112975 consensus Large RNA-binding protein (RRM superfami 98.17
KOG4660549 consensus Protein Mei2, essential for commitment t 98.08
smart0036170 RRM_1 RNA recognition motif. 98.07
KOG0153377 consensus Predicted RNA-binding protein (RRM super 98.05
KOG0109346 consensus RNA-binding protein LARK, contains RRM a 98.03
KOG0149247 consensus Predicted RNA-binding protein SEB4 (RRM 98.01
KOG0123369 consensus Polyadenylate-binding protein (RRM super 97.95
KOG4205311 consensus RNA-binding protein musashi/mRNA cleavag 97.91
PHA032473151 large tegument protein UL36; Provisional 97.89
KOG0108435 consensus mRNA cleavage and polyadenylation factor 97.88
KOG0147549 consensus Transcriptional coactivator CAPER (RRM s 97.85
KOG0130170 consensus RNA-binding protein RBM8/Tsunagi (RRM su 97.82
KOG0127678 consensus Nucleolar protein fibrillarin NOP77 (RRM 97.81
KOG0126219 consensus Predicted RNA-binding protein (RRM super 97.66
KOG0145360 consensus RNA-binding protein ELAV/HU (RRM superfa 97.64
KOG0132894 consensus RNA polymerase II C-terminal domain-bind 97.53
KOG0147549 consensus Transcriptional coactivator CAPER (RRM s 97.52
PF07744119 SPOC: SPOC domain; InterPro: IPR012921 Spen (split 97.47
PHA03247 3151 large tegument protein UL36; Provisional 97.46
KOG1190492 consensus Polypyrimidine tract-binding protein [RN 97.44
KOG4208214 consensus Nucleolar RNA-binding protein NIFK [Gene 97.38
KOG3671569 consensus Actin regulatory protein (Wiskott-Aldric 97.36
KOG1457284 consensus RNA binding protein (contains RRM repeat 97.26
KOG0415479 consensus Predicted peptidyl prolyl cis-trans isom 97.18
KOG0120500 consensus Splicing factor U2AF, large subunit (RRM 97.17
KOG0110725 consensus RNA-binding protein (RRM superfamily) [G 97.12
KOG0131203 consensus Splicing factor 3b, subunit 4 [RNA proce 97.05
KOG0116419 consensus RasGAP SH3 binding protein rasputin, con 97.03
KOG0226290 consensus RNA-binding proteins [General function p 96.94
KOG0127678 consensus Nucleolar protein fibrillarin NOP77 (RRM 96.84
KOG1456494 consensus Heterogeneous nuclear ribonucleoprotein 96.67
KOG1190492 consensus Polypyrimidine tract-binding protein [RN 96.66
KOG4209231 consensus Splicing factor RNPS1, SR protein superf 96.65
KOG0124544 consensus Polypyrimidine tract-binding protein PUF 96.64
KOG0112975 consensus Large RNA-binding protein (RRM superfami 96.58
KOG4849498 consensus mRNA cleavage factor I subunit/CPSF subu 96.45
KOG0146371 consensus RNA-binding protein ETR-3 (RRM superfami 96.29
KOG0129520 consensus Predicted RNA-binding protein (RRM super 96.19
KOG0533243 consensus RRM motif-containing protein [RNA proces 96.11
PF0007670 RRM_1: RNA recognition motif. (a.k.a. RRM, RBD, or 96.02
KOG1830518 consensus Wiskott Aldrich syndrome proteins [Cytos 95.9
PF1425970 RRM_6: RNA recognition motif (a.k.a. RRM, RBD, or 95.89
KOG1830518 consensus Wiskott Aldrich syndrome proteins [Cytos 95.89
KOG4206221 consensus Spliceosomal protein snRNP-U1A/U2B [RNA 95.77
KOG4454267 consensus RNA binding protein (RRM superfamily) [G 95.71
PLN03134144 glycine-rich RNA-binding protein 4; Provisional 95.42
KOG1923 830 consensus Rac1 GTPase effector FRL [Signal transdu 95.41
KOG0107195 consensus Alternative splicing factor SRp20/9G8 (R 95.24
KOG4211510 consensus Splicing factor hnRNP-F and related RNA- 95.06
KOG4205311 consensus RNA-binding protein musashi/mRNA cleavag 94.9
cd01205105 WASP WASP-type EVH1 domain. WASP-type EVH1 domain. 94.82
PF0405997 RRM_2: RNA recognition motif 2; InterPro: IPR00720 94.73
KOG1923 830 consensus Rac1 GTPase effector FRL [Signal transdu 94.62
KOG1548382 consensus Transcription elongation factor TAT-SF1 94.13
KOG4661940 consensus Hsp27-ERE-TATA-binding protein/Scaffold 94.13
KOG0120500 consensus Splicing factor U2AF, large subunit (RRM 94.02
KOG4212608 consensus RNA-binding protein hnRNP-M [RNA process 93.93
smart0036272 RRM_2 RNA recognition motif. 93.75
KOG1855484 consensus Predicted RNA-binding protein [General f 93.39
cd0059074 RRM RRM (RNA recognition motif), also known as RBD 93.23
PF08777105 RRM_3: RNA binding motif; InterPro: IPR014886 This 93.09
KOG1548382 consensus Transcription elongation factor TAT-SF1 93.0
KOG1456494 consensus Heterogeneous nuclear ribonucleoprotein 92.99
PF05918556 API5: Apoptosis inhibitory protein 5 (API5); Inter 92.83
KOG0106216 consensus Alternative splicing factor SRp55/B52/SR 92.76
KOG4574 1007 consensus RNA-binding protein (contains RRM and Pu 92.24
KOG2314698 consensus Translation initiation factor 3, subunit 92.07
smart00461106 WH1 WASP homology region 1. Region of the Wiskott- 92.0
KOG0128881 consensus RNA-binding protein SART3 (RRM superfami 91.76
KOG4212608 consensus RNA-binding protein hnRNP-M [RNA process 91.75
KOG2193584 consensus IGF-II mRNA-binding protein IMP, contain 91.72
PF1460553 Nup35_RRM_2: Nup53/35/40-type RNA recognition moti 91.43
KOG4672487 consensus Uncharacterized conserved low complexity 91.43
PRK15319 2039 AIDA autotransporter-like protein ShdA; Provisiona 91.37
KOG2416718 consensus Acinus (induces apoptotic chromatin cond 90.89
smart0036071 RRM RNA recognition motif. 90.38
COG0724306 RNA-binding proteins (RRM domain) [General functio 90.29
KOG1996378 consensus mRNA splicing factor [RNA processing and 89.99
PLN03120260 nucleic acid binding protein; Provisional 89.45
KOG0121153 consensus Nuclear cap-binding protein complex, sub 89.26
cd00837104 EVH1 EVH1 (Enabled, Vasp-Homology) or WASP Homolog 89.15
KOG4672487 consensus Uncharacterized conserved low complexity 88.75
KOG0105241 consensus Alternative splicing factor ASF/SF2 (RRM 88.58
cd01207111 Ena-Vasp Enabled-VASP-type homology (EVH1) domain. 87.93
PF15023166 DUF4523: Protein of unknown function (DUF4523) 87.18
KOG3152278 consensus TBP-binding protein, activator of basal 87.08
KOG4849498 consensus mRNA cleavage factor I subunit/CPSF subu 86.77
PF15449 1287 Retinal: Retinal protein 86.59
PF04847184 Calcipressin: Calcipressin; InterPro: IPR006931 Ca 84.33
KOG4210285 consensus Nuclear localization sequence binding pr 82.46
KOG0114124 consensus Predicted RNA-binding protein (RRM super 82.2
PF00568111 WH1: WH1 domain; InterPro: IPR000697 The EVH1 (WH1 81.84
KOG0119554 consensus Splicing factor 1/branch point binding p 81.41
KOG1925 817 consensus Rac1 GTPase effector FHOS [Signal transd 81.03
KOG1922 833 consensus Rho GTPase effector BNI1 and related for 80.37
KOG0108435 consensus mRNA cleavage and polyadenylation factor 80.35
>KOG0107 consensus Alternative splicing factor SRp20/9G8 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
Probab=99.68  E-value=3.8e-17  Score=166.98  Aligned_cols=68  Identities=24%  Similarity=0.498  Sum_probs=64.1

Q ss_pred             cCceEEeccCCCccCHHHHHHHhhccCCcceEEEec-cCceEEEEecCHHHHHHHHHhhccCcce--EEEE
Q 001164          569 ASKQLWLGSFGPEASEAHIRFQIDRFGPLEHFFFFP-IKGFALVEYINIIDAIRAREYIRNHFSW--RVKF  636 (1134)
Q Consensus       569 ~s~~LWVGnL~~~vte~dL~~~F~~yGpLe~v~~~~-~rgfAFVeFr~i~DAi~A~~~L~G~~~~--RI~f  636 (1134)
                      -.++||||||+++|++.|||.+|.+||+|.+|||++ ++|||||||++..||.+|+++|+|+.+|  ||++
T Consensus         9 ~~~kVYVGnL~~~a~k~eLE~~F~~yG~lrsvWvArnPPGfAFVEFed~RDA~DAvr~LDG~~~cG~r~rV   79 (195)
T KOG0107|consen    9 GNTKVYVGNLGSRATKRELERAFSKYGPLRSVWVARNPPGFAFVEFEDPRDAEDAVRYLDGKDICGSRIRV   79 (195)
T ss_pred             CCceEEeccCCCCcchHHHHHHHHhcCcceeEEEeecCCCceEEeccCcccHHHHHhhcCCccccCceEEE
Confidence            368999999999999999999999999999999998 9999999999999999999999999998  4544



>TIGR01661 ELAV_HUD_SF ELAV/HuD family splicing factor Back     alignment and domain information
>TIGR01659 sex-lethal sex-lethal family splicing factor Back     alignment and domain information
>TIGR01628 PABP-1234 polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>TIGR01628 PABP-1234 polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>TIGR01649 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor family Back     alignment and domain information
>TIGR01645 half-pint poly-U binding splicing factor, half-pint family Back     alignment and domain information
>TIGR01649 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor family Back     alignment and domain information
>KOG3671 consensus Actin regulatory protein (Wiskott-Aldrich syndrome protein) [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG1924 consensus RhoA GTPase effector DIA/Diaphanous [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>TIGR01622 SF-CC1 splicing factor, CC1-like family Back     alignment and domain information
>TIGR01648 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein R, Q family Back     alignment and domain information
>TIGR01642 U2AF_lg U2 snRNP auxilliary factor, large subunit, splicing factor Back     alignment and domain information
>KOG0117 consensus Heterogeneous nuclear ribonucleoprotein R (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>TIGR01661 ELAV_HUD_SF ELAV/HuD family splicing factor Back     alignment and domain information
>TIGR01642 U2AF_lg U2 snRNP auxilliary factor, large subunit, splicing factor Back     alignment and domain information
>TIGR01622 SF-CC1 splicing factor, CC1-like family Back     alignment and domain information
>KOG0144 consensus RNA-binding protein CUGBP1/BRUNO (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0148 consensus Apoptosis-promoting RNA-binding protein TIA-1/TIAR (RRM superfamily) [RNA processing and modification; Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR01648 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein R, Q family Back     alignment and domain information
>KOG0105 consensus Alternative splicing factor ASF/SF2 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>PF00076 RRM_1: RNA recognition motif Back     alignment and domain information
>PLN03134 glycine-rich RNA-binding protein 4; Provisional Back     alignment and domain information
>KOG0117 consensus Heterogeneous nuclear ribonucleoprotein R (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0132 consensus RNA polymerase II C-terminal domain-binding protein RA4, contains RPR and RRM domains [RNA processing and modification; Transcription] Back     alignment and domain information
>PF14259 RRM_6: RNA recognition motif (a Back     alignment and domain information
>KOG0145 consensus RNA-binding protein ELAV/HU (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>smart00362 RRM_2 RNA recognition motif Back     alignment and domain information
>PLN03120 nucleic acid binding protein; Provisional Back     alignment and domain information
>KOG0131 consensus Splicing factor 3b, subunit 4 [RNA processing and modification] Back     alignment and domain information
>TIGR01659 sex-lethal sex-lethal family splicing factor Back     alignment and domain information
>KOG0106 consensus Alternative splicing factor SRp55/B52/SRp75 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0113 consensus U1 small nuclear ribonucleoprotein (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>COG0724 RNA-binding proteins (RRM domain) [General function prediction only] Back     alignment and domain information
>KOG0124 consensus Polypyrimidine tract-binding protein PUF60 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0123 consensus Polyadenylate-binding protein (RRM superfamily) [RNA processing and modification; Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR01645 half-pint poly-U binding splicing factor, half-pint family Back     alignment and domain information
>smart00360 RRM RNA recognition motif Back     alignment and domain information
>cd00590 RRM RRM (RNA recognition motif), also known as RBD (RNA binding domain) or RNP (ribonucleoprotein domain), is a highly abundant domain in eukaryotes found in proteins involved in post-transcriptional gene expression processes including mRNA and rRNA processing, RNA export, and RNA stability Back     alignment and domain information
>KOG0109 consensus RNA-binding protein LARK, contains RRM and retroviral-type Zn-finger domains [RNA processing and modification; General function prediction only] Back     alignment and domain information
>PLN03213 repressor of silencing 3; Provisional Back     alignment and domain information
>KOG0148 consensus Apoptosis-promoting RNA-binding protein TIA-1/TIAR (RRM superfamily) [RNA processing and modification; Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0114 consensus Predicted RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG0111 consensus Cyclophilin-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0122 consensus Translation initiation factor 3, subunit g (eIF-3g) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF13893 RRM_5: RNA recognition motif Back     alignment and domain information
>PLN03121 nucleic acid binding protein; Provisional Back     alignment and domain information
>KOG0144 consensus RNA-binding protein CUGBP1/BRUNO (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0121 consensus Nuclear cap-binding protein complex, subunit CBP20 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG4207 consensus Predicted splicing factor, SR protein superfamily [RNA processing and modification] Back     alignment and domain information
>KOG0125 consensus Ataxin 2-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG1457 consensus RNA binding protein (contains RRM repeats) [General function prediction only] Back     alignment and domain information
>KOG0110 consensus RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG1924 consensus RhoA GTPase effector DIA/Diaphanous [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG0151 consensus Predicted splicing regulator, contains RRM, SWAP and RPR domains [General function prediction only] Back     alignment and domain information
>KOG4206 consensus Spliceosomal protein snRNP-U1A/U2B [RNA processing and modification] Back     alignment and domain information
>KOG0146 consensus RNA-binding protein ETR-3 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0112 consensus Large RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG4660 consensus Protein Mei2, essential for commitment to meiosis, and related proteins [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>smart00361 RRM_1 RNA recognition motif Back     alignment and domain information
>KOG0153 consensus Predicted RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG0109 consensus RNA-binding protein LARK, contains RRM and retroviral-type Zn-finger domains [RNA processing and modification; General function prediction only] Back     alignment and domain information
>KOG0149 consensus Predicted RNA-binding protein SEB4 (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG0123 consensus Polyadenylate-binding protein (RRM superfamily) [RNA processing and modification; Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG4205 consensus RNA-binding protein musashi/mRNA cleavage and polyadenylation factor I complex, subunit HRP1 [RNA processing and modification] Back     alignment and domain information
>PHA03247 large tegument protein UL36; Provisional Back     alignment and domain information
>KOG0108 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA15 [RNA processing and modification] Back     alignment and domain information
>KOG0147 consensus Transcriptional coactivator CAPER (RRM superfamily) [Transcription] Back     alignment and domain information
>KOG0130 consensus RNA-binding protein RBM8/Tsunagi (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG0127 consensus Nucleolar protein fibrillarin NOP77 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0126 consensus Predicted RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG0145 consensus RNA-binding protein ELAV/HU (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0132 consensus RNA polymerase II C-terminal domain-binding protein RA4, contains RPR and RRM domains [RNA processing and modification; Transcription] Back     alignment and domain information
>KOG0147 consensus Transcriptional coactivator CAPER (RRM superfamily) [Transcription] Back     alignment and domain information
>PF07744 SPOC: SPOC domain; InterPro: IPR012921 Spen (split end) proteins regulate the expression of key transcriptional effectors in diverse signalling pathways Back     alignment and domain information
>PHA03247 large tegument protein UL36; Provisional Back     alignment and domain information
>KOG1190 consensus Polypyrimidine tract-binding protein [RNA processing and modification] Back     alignment and domain information
>KOG4208 consensus Nucleolar RNA-binding protein NIFK [General function prediction only] Back     alignment and domain information
>KOG3671 consensus Actin regulatory protein (Wiskott-Aldrich syndrome protein) [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG1457 consensus RNA binding protein (contains RRM repeats) [General function prediction only] Back     alignment and domain information
>KOG0415 consensus Predicted peptidyl prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0120 consensus Splicing factor U2AF, large subunit (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0110 consensus RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG0131 consensus Splicing factor 3b, subunit 4 [RNA processing and modification] Back     alignment and domain information
>KOG0116 consensus RasGAP SH3 binding protein rasputin, contains NTF2 and RRM domains [Signal transduction mechanisms] Back     alignment and domain information
>KOG0226 consensus RNA-binding proteins [General function prediction only] Back     alignment and domain information
>KOG0127 consensus Nucleolar protein fibrillarin NOP77 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG1456 consensus Heterogeneous nuclear ribonucleoprotein L (contains RRM repeats) [RNA processing and modification] Back     alignment and domain information
>KOG1190 consensus Polypyrimidine tract-binding protein [RNA processing and modification] Back     alignment and domain information
>KOG4209 consensus Splicing factor RNPS1, SR protein superfamily [RNA processing and modification] Back     alignment and domain information
>KOG0124 consensus Polypyrimidine tract-binding protein PUF60 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0112 consensus Large RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG4849 consensus mRNA cleavage factor I subunit/CPSF subunit [RNA processing and modification] Back     alignment and domain information
>KOG0146 consensus RNA-binding protein ETR-3 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0129 consensus Predicted RNA-binding protein (RRM superfamily) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0533 consensus RRM motif-containing protein [RNA processing and modification] Back     alignment and domain information
>PF00076 RRM_1: RNA recognition motif Back     alignment and domain information
>KOG1830 consensus Wiskott Aldrich syndrome proteins [Cytoskeleton] Back     alignment and domain information
>PF14259 RRM_6: RNA recognition motif (a Back     alignment and domain information
>KOG1830 consensus Wiskott Aldrich syndrome proteins [Cytoskeleton] Back     alignment and domain information
>KOG4206 consensus Spliceosomal protein snRNP-U1A/U2B [RNA processing and modification] Back     alignment and domain information
>KOG4454 consensus RNA binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>PLN03134 glycine-rich RNA-binding protein 4; Provisional Back     alignment and domain information
>KOG1923 consensus Rac1 GTPase effector FRL [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG0107 consensus Alternative splicing factor SRp20/9G8 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG4211 consensus Splicing factor hnRNP-F and related RNA-binding proteins [RNA processing and modification] Back     alignment and domain information
>KOG4205 consensus RNA-binding protein musashi/mRNA cleavage and polyadenylation factor I complex, subunit HRP1 [RNA processing and modification] Back     alignment and domain information
>cd01205 WASP WASP-type EVH1 domain Back     alignment and domain information
>PF04059 RRM_2: RNA recognition motif 2; InterPro: IPR007201 This RNA recognition motif 2 is found in Meiosis protein mei2 Back     alignment and domain information
>KOG1923 consensus Rac1 GTPase effector FRL [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG1548 consensus Transcription elongation factor TAT-SF1 [Transcription] Back     alignment and domain information
>KOG4661 consensus Hsp27-ERE-TATA-binding protein/Scaffold attachment factor (SAF-B) [Transcription] Back     alignment and domain information
>KOG0120 consensus Splicing factor U2AF, large subunit (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG4212 consensus RNA-binding protein hnRNP-M [RNA processing and modification] Back     alignment and domain information
>smart00362 RRM_2 RNA recognition motif Back     alignment and domain information
>KOG1855 consensus Predicted RNA-binding protein [General function prediction only] Back     alignment and domain information
>cd00590 RRM RRM (RNA recognition motif), also known as RBD (RNA binding domain) or RNP (ribonucleoprotein domain), is a highly abundant domain in eukaryotes found in proteins involved in post-transcriptional gene expression processes including mRNA and rRNA processing, RNA export, and RNA stability Back     alignment and domain information
>PF08777 RRM_3: RNA binding motif; InterPro: IPR014886 This domain is found in protein La which functions as an RNA chaperone during RNA polymerase III transcription, and can also stimulate translation initiation Back     alignment and domain information
>KOG1548 consensus Transcription elongation factor TAT-SF1 [Transcription] Back     alignment and domain information
>KOG1456 consensus Heterogeneous nuclear ribonucleoprotein L (contains RRM repeats) [RNA processing and modification] Back     alignment and domain information
>PF05918 API5: Apoptosis inhibitory protein 5 (API5); InterPro: IPR008383 This family consists of apoptosis inhibitory protein 5 (API5) sequences from several organisms Back     alignment and domain information
>KOG0106 consensus Alternative splicing factor SRp55/B52/SRp75 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG4574 consensus RNA-binding protein (contains RRM and Pumilio-like repeats) [General function prediction only] Back     alignment and domain information
>KOG2314 consensus Translation initiation factor 3, subunit b (eIF-3b) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>smart00461 WH1 WASP homology region 1 Back     alignment and domain information
>KOG0128 consensus RNA-binding protein SART3 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG4212 consensus RNA-binding protein hnRNP-M [RNA processing and modification] Back     alignment and domain information
>KOG2193 consensus IGF-II mRNA-binding protein IMP, contains RRM and KH domains [RNA processing and modification; General function prediction only] Back     alignment and domain information
>PF14605 Nup35_RRM_2: Nup53/35/40-type RNA recognition motif Back     alignment and domain information
>KOG4672 consensus Uncharacterized conserved low complexity protein [Function unknown] Back     alignment and domain information
>PRK15319 AIDA autotransporter-like protein ShdA; Provisional Back     alignment and domain information
>KOG2416 consensus Acinus (induces apoptotic chromatin condensation) [Chromatin structure and dynamics] Back     alignment and domain information
>smart00360 RRM RNA recognition motif Back     alignment and domain information
>COG0724 RNA-binding proteins (RRM domain) [General function prediction only] Back     alignment and domain information
>KOG1996 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>PLN03120 nucleic acid binding protein; Provisional Back     alignment and domain information
>KOG0121 consensus Nuclear cap-binding protein complex, subunit CBP20 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>cd00837 EVH1 EVH1 (Enabled, Vasp-Homology) or WASP Homology (WH1) domain Back     alignment and domain information
>KOG4672 consensus Uncharacterized conserved low complexity protein [Function unknown] Back     alignment and domain information
>KOG0105 consensus Alternative splicing factor ASF/SF2 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>cd01207 Ena-Vasp Enabled-VASP-type homology (EVH1) domain Back     alignment and domain information
>PF15023 DUF4523: Protein of unknown function (DUF4523) Back     alignment and domain information
>KOG3152 consensus TBP-binding protein, activator of basal transcription (contains rrm motif) [Transcription] Back     alignment and domain information
>KOG4849 consensus mRNA cleavage factor I subunit/CPSF subunit [RNA processing and modification] Back     alignment and domain information
>PF15449 Retinal: Retinal protein Back     alignment and domain information
>PF04847 Calcipressin: Calcipressin; InterPro: IPR006931 Calcipressin 1 negatively regulates calcineurin (IPR015757 from INTERPRO) by direct binding and is essential for the survival of T helper type 1 cells Back     alignment and domain information
>KOG4210 consensus Nuclear localization sequence binding protein [Transcription] Back     alignment and domain information
>KOG0114 consensus Predicted RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>PF00568 WH1: WH1 domain; InterPro: IPR000697 The EVH1 (WH1, RanBP1-WASP) domain is found in multi-domain proteins implicated in a diverse range of signalling, nuclear transport and cytoskeletal events Back     alignment and domain information
>KOG0119 consensus Splicing factor 1/branch point binding protein (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG1925 consensus Rac1 GTPase effector FHOS [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG1922 consensus Rho GTPase effector BNI1 and related formins [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG0108 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA15 [RNA processing and modification] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1134
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-13
1vt4_I1221 APAF-1 related killer DARK; drosophila apoptosome, 9e-08
1m2v_B 926 SEC24, protein transport protein SEC24, SEC24P, SE 2e-09
1m2v_B 926 SEC24, protein transport protein SEC24, SEC24P, SE 5e-08
1m2v_B 926 SEC24, protein transport protein SEC24, SEC24P, SE 3e-07
1m2v_B 926 SEC24, protein transport protein SEC24, SEC24P, SE 3e-04
1m2v_B 926 SEC24, protein transport protein SEC24, SEC24P, SE 3e-04
3pgw_B231 SM B; protein-RNA complex, U1 snRNA, SM fold, SM c 2e-08
3pgw_B231 SM B; protein-RNA complex, U1 snRNA, SM fold, SM c 8e-07
1why_A97 Hypothetical protein riken cDNA 1810017N16; RNA re 1e-07
3r27_A100 HnRNP L, heterogeneous nuclear ribonucleoprotein L 2e-06
2ytc_A85 PRE-mRNA-splicing factor RBM22; RRM domain, RBD, s 4e-06
1wex_A104 Hypothetical protein (riken cDNA 2810036L13); stru 6e-06
2grx_C229 Protein TONB; beta barrel, outer membrane, heteroc 9e-06
2grx_C229 Protein TONB; beta barrel, outer membrane, heteroc 1e-04
2grx_C229 Protein TONB; beta barrel, outer membrane, heteroc 3e-04
2grx_C229 Protein TONB; beta barrel, outer membrane, heteroc 3e-04
2cq2_A114 Hypothetical protein LOC91801; RRM domain, structu 2e-05
3v1v_A 433 2-MIB synthase, 2-methylisoborneol synthase; class 5e-05
3v1v_A 433 2-MIB synthase, 2-methylisoborneol synthase; class 7e-05
3v1v_A 433 2-MIB synthase, 2-methylisoborneol synthase; class 3e-04
3v1v_A 433 2-MIB synthase, 2-methylisoborneol synthase; class 8e-04
1deq_A390 Fibrinogen (alpha chain); coiled-coil, blood clott 6e-05
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 2e-04
1mv3_A213 MYC box dependent interacting protein 1; tumor sup 2e-04
2cq1_A101 PTB-like protein L; RRM domain, structural genomic 2e-04
2la4_A101 Nuclear and cytoplasmic polyadenylated RNA-bindin 4e-04
2cpd_A99 Apobec-1 stimulating protein; RNA recognition moti 4e-04
1sjq_A105 Polypyrimidine tract-binding protein 1; babbab mot 4e-04
3tx7_B352 Nuclear receptor subfamily 5 group A member 2; LRH 6e-04
2ad9_A119 Polypyrimidine tract-binding protein 1; RBD, RRM, 7e-04
1x4g_A109 Nucleolysin TIAR; structural genomics, RRM domain, 8e-04
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
 Score = 73.0 bits (178), Expect = 4e-13
 Identities = 91/651 (13%), Positives = 174/651 (26%), Gaps = 178/651 (27%)

Query: 181 HNVLDFFISSFD--GKDIIHTVDKEITKMLDSDEVFLGLKKKFSDEDESSLIKLS--KFR 236
           H+ +DF         KDI+   +       D  +V    K   S E+   +I        
Sbjct: 4   HHHMDFETGEHQYQYKDILSVFEDAFVDNFDCKDVQDMPKSILSKEEIDHIIMSKDAVSG 63

Query: 237 LLSLLQIFFSSPKNLLAACFELFNPSVLEGIHKGQYFF--SQITSRFDDDNM-THSFI-- 291
            L L     S  + +     + F    +E + +  Y F  S I +     +M T  +I  
Sbjct: 64  TLRLFWTLLSKQEEM----VQKF----VEEVLRINYKFLMSPIKTEQRQPSMMTRMYIEQ 115

Query: 292 ---IKDDGPKF-------PETSTKGKEASSEQLVSDDNHVGTSVL------KSCLLGLAL 335
              + +D   F        +   K ++A    L+         +       K+ +     
Sbjct: 116 RDRLYNDNQVFAKYNVSRLQPYLKLRQA----LLELRPAKNVLIDGVLGSGKTWVALDVC 171

Query: 336 GKNPSLRR------WMFSRYKKLCNLSSSNALPELSSALKRIFESFSEVAKEEGSEVDSD 389
                  +      W+      L N +S   + E+   L+++                + 
Sbjct: 172 LSYKVQCKMDFKIFWL-----NLKNCNSPETVLEM---LQKLLYQIDPNWTSRSDHSSNI 223

Query: 390 EDDSDPSKYANQQYLVARSANQHETS----RELSGNESNSRVNEE---SC-------DVS 435
           +      +   ++ L ++    +E        +     N++       SC          
Sbjct: 224 KLRIHSIQAELRRLLKSK---PYENCLLVLLNV----QNAKAWNAFNLSCKILLTTRFKQ 276

Query: 436 FADKFSGQYPRPHGSVGPRETDFHSNAGSSHDSGCTRSMEYDTGDPGDFSCGRSSMPRDL 495
             D  S      H S+                                        P+DL
Sbjct: 277 VTDFLSAAT-TTHISLDHHSMTLTP----------DEVKSL-------LLKYLDCRPQDL 318

Query: 496 P------NPQMLSPAARTPLHFRNNSFEGRNHFPGRSSSEGASNAL--LSPN-------- 539
           P      NP+ LS  A + +     +++   H      +    ++L  L P         
Sbjct: 319 PREVLTTNPRRLSIIAES-IRDGLATWDNWKHVNCDKLTTIIESSLNVLEPAEYRKMFDR 377

Query: 540 -----HHLPVPYASTTSQIVWYFDEDPAAMDIFS-------ASKQLWLGSFG-------- 579
                    +P  +    ++W+       M + +         KQ    +          
Sbjct: 378 LSVFPPSAHIP--TILLSLIWFDVIKSDVMVVVNKLHKYSLVEKQPKESTISIPSIYLEL 435

Query: 580 ----PEASEAHIRFQIDRFGPLEHFFFFPIKGFALVEYINIIDAIRAREYIRNHFS---- 631
                     H    +D +   + F    +    L +Y           +I +H      
Sbjct: 436 KVKLENEYALHRSI-VDHYNIPKTFDSDDLIPPYLDQYF--------YSHIGHHLKNIEH 486

Query: 632 ------WRVKFMDVG-LGTKGVINGVAVGSC---------FHVYVGNIPNQWAKDEILHE 675
                 +R+ F+D   L  K   +  A  +             Y   I +   K E L  
Sbjct: 487 PERMTLFRMVFLDFRFLEQKIRHDSTAWNASGSILNTLQQLKFYKPYICDNDPKYERLVN 546

Query: 676 SYK--------VVYKGPYMVTDLSCEGALLMEFRTPEEATTAMAHLRQHRK 718
           +           +    Y  TDL     L +     +EA    AH +Q ++
Sbjct: 547 AILDFLPKIEENLICSKY--TDL-----LRIALMAEDEAIFEEAH-KQVQR 589


>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 Back     alignment and structure
>1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 Back     alignment and structure
>1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 Back     alignment and structure
>1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 Back     alignment and structure
>1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 Back     alignment and structure
>3pgw_B SM B; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_A Length = 231 Back     alignment and structure
>3pgw_B SM B; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_A Length = 231 Back     alignment and structure
>1why_A Hypothetical protein riken cDNA 1810017N16; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Length = 97 Back     alignment and structure
>3r27_A HnRNP L, heterogeneous nuclear ribonucleoprotein L; RBD fold, protein binding, nucleus; 2.04A {Homo sapiens} Length = 100 Back     alignment and structure
>2ytc_A PRE-mRNA-splicing factor RBM22; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 85 Back     alignment and structure
>1wex_A Hypothetical protein (riken cDNA 2810036L13); structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>2grx_C Protein TONB; beta barrel, outer membrane, heterocomplex, inter-protein beta sheet, protein-protein, metal transport; HET: GCN KDO GMH FTT DAO MYR FCI; 3.30A {Escherichia coli} SCOP: d.212.1.2 PDB: 1xx3_A Length = 229 Back     alignment and structure
>2grx_C Protein TONB; beta barrel, outer membrane, heterocomplex, inter-protein beta sheet, protein-protein, metal transport; HET: GCN KDO GMH FTT DAO MYR FCI; 3.30A {Escherichia coli} SCOP: d.212.1.2 PDB: 1xx3_A Length = 229 Back     alignment and structure
>2grx_C Protein TONB; beta barrel, outer membrane, heterocomplex, inter-protein beta sheet, protein-protein, metal transport; HET: GCN KDO GMH FTT DAO MYR FCI; 3.30A {Escherichia coli} SCOP: d.212.1.2 PDB: 1xx3_A Length = 229 Back     alignment and structure
>2grx_C Protein TONB; beta barrel, outer membrane, heterocomplex, inter-protein beta sheet, protein-protein, metal transport; HET: GCN KDO GMH FTT DAO MYR FCI; 3.30A {Escherichia coli} SCOP: d.212.1.2 PDB: 1xx3_A Length = 229 Back     alignment and structure
>2cq2_A Hypothetical protein LOC91801; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>3v1v_A 2-MIB synthase, 2-methylisoborneol synthase; class I terpenoid cyclase fold, DDXXXXD motif, NDXXSXXXE MOT methylisoborneol biosynthesis; HET: GST; 1.80A {Streptomyces coelicolor} PDB: 3v1x_A* Length = 433 Back     alignment and structure
>3v1v_A 2-MIB synthase, 2-methylisoborneol synthase; class I terpenoid cyclase fold, DDXXXXD motif, NDXXSXXXE MOT methylisoborneol biosynthesis; HET: GST; 1.80A {Streptomyces coelicolor} PDB: 3v1x_A* Length = 433 Back     alignment and structure
>3v1v_A 2-MIB synthase, 2-methylisoborneol synthase; class I terpenoid cyclase fold, DDXXXXD motif, NDXXSXXXE MOT methylisoborneol biosynthesis; HET: GST; 1.80A {Streptomyces coelicolor} PDB: 3v1x_A* Length = 433 Back     alignment and structure
>3v1v_A 2-MIB synthase, 2-methylisoborneol synthase; class I terpenoid cyclase fold, DDXXXXD motif, NDXXSXXXE MOT methylisoborneol biosynthesis; HET: GST; 1.80A {Streptomyces coelicolor} PDB: 3v1x_A* Length = 433 Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Length = 292 Back     alignment and structure
>1mv3_A MYC box dependent interacting protein 1; tumor suppressor, endocytosis/exocytosis complex; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 213 Back     alignment and structure
>2cq1_A PTB-like protein L; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 101 Back     alignment and structure
>2la4_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNA recognition, stress granules, nucleus, RNA-binding, transcription; NMR {Saccharomyces cerevisiae} Length = 101 Back     alignment and structure
>2cpd_A Apobec-1 stimulating protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 99 Back     alignment and structure
>1sjq_A Polypyrimidine tract-binding protein 1; babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 105 Back     alignment and structure
>3tx7_B Nuclear receptor subfamily 5 group A member 2; LRH-1, beta-catenin, armadillo repeat, nuclear receptor LIGA binding domain, protein binding; HET: P6L; 2.76A {Homo sapiens} Length = 352 Back     alignment and structure
>2ad9_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 119 Back     alignment and structure
>1x4g_A Nucleolysin TIAR; structural genomics, RRM domain, TIA-1 related protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query1134
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 99.76
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 99.76
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.75
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 99.74
3tyt_A205 Heterogeneous nuclear ribonucleoprotein L; ferredo 99.73
4f02_A213 Polyadenylate-binding protein 1; mRNA, eukaryotic 99.73
2qfj_A216 FBP-interacting repressor; protein-DNA complex; HE 99.71
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 99.7
2adc_A229 Polypyrimidine tract-binding protein 1; RBD, RRM, 99.7
3sde_A261 Paraspeckle component 1; RRM, anti parallel right 99.7
3pgw_A282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 99.7
1qm9_A198 Polypyrimidine tract-binding protein; ribonucleopr 99.7
1l3k_A196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 99.7
2yh0_A198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 99.69
2cjk_A167 Nuclear polyadenylated RNA-binding protein 4; HRP1 99.66
1fje_B175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 99.66
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 99.65
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 99.62
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 99.6
4f25_A115 Polyadenylate-binding protein 1; RRM fold, transla 99.59
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 99.57
2hvz_A101 Splicing factor, arginine/serine-rich 7; RRM, RNA 99.51
2cpj_A99 Non-POU domain-containing octamer-binding protein; 99.51
3r27_A100 HnRNP L, heterogeneous nuclear ribonucleoprotein L 99.5
1wex_A104 Hypothetical protein (riken cDNA 2810036L13); stru 99.49
1x4d_A102 Matrin 3; structural genomics, RRM domain, NPPSFA, 99.47
2cq1_A101 PTB-like protein L; RRM domain, structural genomic 99.47
4fxv_A99 ELAV-like protein 1; RNA recognition motif, putati 99.46
2cq2_A114 Hypothetical protein LOC91801; RRM domain, structu 99.45
2ytc_A85 PRE-mRNA-splicing factor RBM22; RRM domain, RBD, s 99.45
2wbr_A89 GW182, gawky, LD47780P; DNA-binding protein, RRM, 99.43
1x4f_A112 Matrin 3; structural genomics, RRM domain, NPPSFA, 99.43
2ad9_A119 Polypyrimidine tract-binding protein 1; RBD, RRM, 99.43
1why_A97 Hypothetical protein riken cDNA 1810017N16; RNA re 99.43
1sjq_A105 Polypyrimidine tract-binding protein 1; babbab mot 99.43
1x5s_A102 Cold-inducible RNA-binding protein; structure geno 99.42
2cqi_A103 Nucleolysin TIAR; RNA recognition motif, RRM, RNA 99.42
2la4_A101 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.41
2x1f_A96 MRNA 3'-END-processing protein RNA15; transcriptio 99.41
3mdf_A85 Peptidyl-prolyl CIS-trans isomerase E; RRM domain, 99.41
2dnz_A95 Probable RNA-binding protein 23; RNA recognition m 99.41
3lqv_A115 PRE-mRNA branch site protein P14; cysless mutant, 99.41
3md1_A83 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.41
3bs9_A87 Nucleolysin TIA-1 isoform P40; RNA recognition mot 99.4
1x4g_A109 Nucleolysin TIAR; structural genomics, RRM domain, 99.4
2cqc_A95 Arginine/serine-rich splicing factor 10; RNA recog 99.4
2cqb_A102 Peptidyl-prolyl CIS-trans isomerase E; RNA recogni 99.4
2ywk_A95 Putative RNA-binding protein 11; RRM-domain, struc 99.4
2dnq_A90 RNA-binding protein 4B; RRM domain,RBD, structural 99.4
2kvi_A96 Nuclear polyadenylated RNA-binding protein 3; RNA- 99.4
3s8s_A110 Histone-lysine N-methyltransferase SETD1A; chromat 99.39
1whx_A111 Hypothetical protein riken cDNA 1200009A02; RNA re 99.39
2cph_A107 RNA binding motif protein 19; RNA recognition moti 99.39
1x5t_A96 Splicing factor 3B subunit 4; structure genomics, 99.39
2cpf_A98 RNA binding motif protein 19; RNA recognition moti 99.39
2cq3_A103 RNA-binding protein 9; RRM domain, structural geno 99.38
2xnq_A97 Nuclear polyadenylated RNA-binding protein 3; tran 99.38
1x4a_A109 Splicing factor, arginine/serine-rich 1 (splicing 99.37
2dgx_A96 KIAA0430 protein; RRM domain, structural genomics, 99.37
4a8x_A88 RNA-binding protein with serine-rich domain 1; tra 99.37
2dnh_A105 Bruno-like 5, RNA binding protein; RRM domain, RBD 99.37
2d9p_A103 Polyadenylate-binding protein 3; RRM domain, struc 99.37
2dgt_A92 RNA-binding protein 30; RRM domain, structural gen 99.37
2dnp_A90 RNA-binding protein 14; RRM domain, RBD, structura 99.37
2fy1_A116 RNA-binding motif protein, Y chromosome, family 1 99.37
1p27_B106 RNA-binding protein 8A; nuclear protein, mRNA spli 99.36
2e5h_A94 Zinc finger CCHC-type and RNA-binding motif- conta 99.36
1u6f_A139 Tcubp1, RNA-binding protein UBP1; trypanosome, mRN 99.36
2dgv_A92 HnRNP M, heterogeneous nuclear ribonucleoprotein M 99.36
1x4e_A85 RNA binding motif, single-stranded interacting pro 99.36
2dgp_A106 Bruno-like 4, RNA binding protein; RRM domain, str 99.36
2cqh_A93 IGF-II mRNA-binding protein 2 isoform A; RNA recog 99.36
2div_A99 TRNA selenocysteine associated protein; structural 99.36
1whw_A99 Hypothetical protein riken cDNA 1200009A02; RNA re 99.36
1fjc_A96 Nucleolin RBD2, protein C23; RNP, RRM, RNA binding 99.36
2la6_A99 RNA-binding protein FUS; structural genomics, nort 99.36
2err_A109 Ataxin-2-binding protein 1; protein-RNA complex, R 99.35
2do0_A114 HnRNP M, heterogeneous nuclear ribonucleoprotein M 99.35
2jvo_A108 Nucleolar protein 3; nucleus, phosphorylation, rib 99.35
2dgo_A115 Cytotoxic granule-associated RNA binding protein 1 99.35
2cpe_A113 RNA-binding protein EWS; RNA recognition motif, RR 99.35
2do4_A100 Squamous cell carcinoma antigen recognized by T- c 99.34
1nu4_A97 U1A RNA binding domain; RNA recognition motif, U1 99.34
1wf1_A110 RNA-binding protein RALY; structural genomics, RRM 99.34
2a3j_A127 U1 small nuclear ribonucleoprotein A; computationa 99.34
2dgs_A99 DAZ-associated protein 1; RRM domain, structural g 99.34
3ex7_B126 RNA-binding protein 8A; protein-RNA complex, mRNA 99.34
2e5i_A124 Heterogeneous nuclear ribonucleoprotein L-like; RR 99.34
2e5j_A97 Methenyltetrahydrofolate synthetase domain contain 99.34
2dis_A109 Unnamed protein product; structural genomics, RRM 99.33
1oo0_B110 CG8781-PA, drosophila Y14; RNA recognition motif, 99.33
2cq0_A103 Eukaryotic translation initiation factor 3 subunit 99.33
2dgu_A103 Heterogeneous nuclear ribonucleoprotein Q; RRM dom 99.33
2dnm_A103 SRP46 splicing factor; RRM domain, RBD, structural 99.33
2hzc_A87 Splicing factor U2AF 65 kDa subunit; RNA splicing, 99.33
1x4h_A111 RNA-binding protein 28; structural genomics, RRM d 99.33
1p1t_A104 Cleavage stimulation factor, 64 kDa subunit; RNA r 99.33
2cpz_A115 CUG triplet repeat RNA-binding protein 1; RRM doma 99.32
2lxi_A91 RNA-binding protein 10; NMR {Homo sapiens} 99.32
1x5p_A97 Negative elongation factor E; structure genomics, 99.32
1x5u_A105 Splicing factor 3B subunit 4 (spliceosome associat 99.32
2cpd_A99 Apobec-1 stimulating protein; RNA recognition moti 99.32
1x5o_A114 RNA binding motif, single-stranded interacting pro 99.32
2khc_A118 Testis-specific RNP-type RNA binding protein; RRM, 99.32
2krb_A81 Eukaryotic translation initiation factor 3 subunit 99.32
3ulh_A107 THO complex subunit 4; nuclear protein, RNA bindin 99.32
2ek1_A95 RNA-binding protein 12; RNA recognition motif, dim 99.31
2kt5_A124 RNA and export factor-binding protein 2; chaperone 99.31
2cpi_A111 CCR4-NOT transcription complex subunit 4; RNA reco 99.31
3zzy_A130 Polypyrimidine tract-binding protein 1; protein bi 99.3
2jrs_A108 RNA-binding protein 39; RNA binding motif of RBM39 99.3
2ku7_A140 MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio 99.3
2i2y_A150 Fusion protein consists of immunoglobin G- binding 99.3
2dhg_A104 TRNA selenocysteine associated protein (SECP43); R 99.3
1sjr_A164 Polypyrimidine tract-binding protein 1; extended b 99.3
3ucg_A89 Polyadenylate-binding protein 2; ferredoxin-like, 99.29
1x4c_A108 Splicing factor, arginine/serine-rich 1; structura 99.29
2kxn_B129 Transformer-2 protein homolog beta; SR protein, RR 99.27
1wi8_A104 EIF-4B, eukaryotic translation initiation factor 4 99.27
2cqd_A116 RNA-binding region containing protein 1; RNA recog 99.27
3tht_A345 Alkylated DNA repair protein ALKB homolog 8; struc 99.27
1wg1_A88 KIAA1579 protein, homolog EXC-7; RBD, structural g 99.26
2lkz_A95 RNA-binding protein 5; RRM; NMR {Homo sapiens} 99.26
3p5t_L90 Cleavage and polyadenylation specificity factor S; 99.26
2cpx_A115 Hypothetical protein FLJ11016; RRM domain, structu 99.25
1h2v_Z156 20 kDa nuclear CAP binding protein; CAP-binding-co 99.25
2jvr_A111 Nucleolar protein 3; RNA recognition motif, nucleu 99.25
2cqp_A98 RNA-binding protein 12; RNA recognition motif, RRM 99.25
2bz2_A121 Negative elongation factor E; NELF E, RNA recognit 99.24
3ns6_A100 Eukaryotic translation initiation factor 3 subuni; 99.24
2cq4_A114 RNA binding motif protein 23; RRM domain, structur 99.24
1s79_A103 Lupus LA protein; RRM, alpha/beta, RNA binding pro 99.24
2jwn_A124 Embryonic polyadenylate-binding protein 2-B; epabp 99.24
2ki2_A90 SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA 99.24
2nlw_A105 Eukaryotic translation initiation factor 3 subunit 99.23
2dng_A103 Eukaryotic translation initiation factor 4H; RRM d 99.23
2m2b_A131 RNA-binding protein 10; T-cell, JCSG, MPP, PSI-bio 99.23
2kn4_A158 Immunoglobulin G-binding protein G, splicing FACT 99.23
2j76_E100 EIF-4B, EIF4B, eukaryotic translation initiation f 99.22
2rs2_A109 Musashi-1, RNA-binding protein musashi homolog 1; 99.22
1fj7_A101 Nucleolin RBD1, protein C23; RNP, RRM, RNA binding 99.22
3egn_A143 RNA-binding protein 40; RNA recognition motif (RRM 99.22
3s7r_A87 Heterogeneous nuclear ribonucleoprotein A/B; ferre 99.22
2fc9_A101 NCL protein; structure genomics, RRM_1 domain, str 99.21
3d2w_A89 TAR DNA-binding protein 43; DP-43 proteinopathy, T 99.21
3n9u_C156 Cleavage and polyadenylation specificity factor S; 99.21
1uaw_A77 Mouse-musashi-1; RNP-type structure, RNA binding p 99.21
2mss_A75 Protein (musashi1); RNA-binding domain, RNA bindin 99.21
3u1l_A240 PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 99.2
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 99.2
2lea_A135 Serine/arginine-rich splicing factor 2; SR protein 99.2
2dh8_A105 DAZ-associated protein 1; RRM domain, structural g 99.2
3beg_B115 Splicing factor, arginine/serine-rich 1; kinase, S 99.2
1rk8_A165 CG8781-PA, CG8781-PA protein; mRNA processing, RRM 99.19
1x4b_A116 Heterogeneous nuclear ribonucleoproteins A2/B1; st 99.18
2cpy_A114 RNA-binding protein 12; RRM domain, structural gen 99.18
2e5g_A94 U6 snRNA-specific terminal uridylyltransferase 1; 99.17
2e44_A96 Insulin-like growth factor 2 mRNA binding protein 99.17
2dnl_A114 Cytoplasmic polyadenylation element binding protei 99.16
2cqg_A103 TDP-43, TAR DNA-binding protein-43; RNA recognitio 99.16
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.16
2fc8_A102 NCL protein; structure genomics, RRM_1 domain, str 99.16
1wf0_A88 TDP-43, TAR DNA-binding protein-43; structural gen 99.15
1qm9_A198 Polypyrimidine tract-binding protein; ribonucleopr 99.15
1iqt_A75 AUF1, heterogeneous nuclear ribonucleoprotein D0; 99.15
1wez_A102 HnRNP H', FTP-3, heterogeneous nuclear ribonucleop 99.15
2dgw_A91 Probable RNA-binding protein 19; RRM domain, struc 99.12
2lcw_A116 RNA-binding protein FUS; RRM, nucleic acid binding 98.73
2xs2_A102 Deleted in azoospermia-like; RNA binding protein-R 99.12
2qfj_A216 FBP-interacting repressor; protein-DNA complex; HE 99.12
2f3j_A177 RNA and export factor binding protein 2; RRM domai 99.12
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 99.12
1wel_A124 RNA-binding protein 12; structural genomics, NPPSF 99.11
2adc_A229 Polypyrimidine tract-binding protein 1; RBD, RRM, 99.11
3pgw_A282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 99.11
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 99.1
3q2s_C229 Cleavage and polyadenylation specificity factor S; 99.08
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 99.08
2yh0_A198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 99.07
4f02_A213 Polyadenylate-binding protein 1; mRNA, eukaryotic 99.07
2db1_A118 Heterogeneous nuclear ribonucleoprotein F; RRM dom 99.07
1wg5_A104 Heterogeneous nuclear ribonucleoprotein H; structu 99.06
2hgl_A136 HNRPF protein, heterogeneous nuclear ribonucleopro 99.04
3tyt_A205 Heterogeneous nuclear ribonucleoprotein L; ferredo 99.04
2lmi_A107 GRSF-1, G-rich sequence factor 1; G-rich RNA seque 99.04
2pe8_A105 Splicing factor 45; RRM, protein binding; 2.00A {H 99.03
2cjk_A167 Nuclear polyadenylated RNA-binding protein 4; HRP1 99.02
3pgw_S437 U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM 99.01
1l3k_A196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 98.98
2dit_A112 HIV TAT specific factor 1 variant; structural geno 98.97
1fje_B175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 98.97
2diu_A96 KIAA0430 protein; structural genomics, RRM domain, 98.96
3sde_A261 Paraspeckle component 1; RRM, anti parallel right 98.95
2dnn_A109 RNA-binding protein 12; RRM domain, RBD, structura 98.94
2hgn_A139 Heterogeneous nuclear ribonucleoprotein F; RNA rec 98.94
2dha_A123 FLJ20171 protein; RRM domain, structural genomics, 98.91
2voo_A193 Lupus LA protein; RNA-binding protein, RNA recogni 98.83
2hgm_A126 HNRPF protein, heterogeneous nuclear ribonucleopro 98.79
3v4m_A105 Splicing factor U2AF 65 kDa subunit; canonical RNA 98.78
3ue2_A118 Poly(U)-binding-splicing factor PUF60; RNA recogni 98.75
2d9o_A100 DNAJ (HSP40) homolog, subfamily C, member 17; RRM 98.73
2j8a_A136 Histone-lysine N-methyltransferase, H3 lysine-4 sp 98.7
1jmt_A104 Splicing factor U2AF 35 kDa subunit; RRM, RNA spli 98.68
3s6e_A114 RNA-binding protein 39; ferredoxin-like, structura 98.65
1owx_A121 Lupus LA protein, SS-B, LA; RRM, transcription; NM 98.43
2kn4_A158 Immunoglobulin G-binding protein G, splicing FACT 98.4
2i2y_A150 Fusion protein consists of immunoglobin G- binding 98.29
3dxb_A222 Thioredoxin N-terminally fused to PUF60(UHM); spli 97.95
2dnr_A91 Synaptojanin-1; RRM domain, RBD, structural genomi 97.58
2lea_A135 Serine/arginine-rich splicing factor 2; SR protein 97.54
3pgw_S437 U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM 97.31
1ufw_A95 Synaptojanin 2; RNP domain, structural genomics, r 97.29
1why_A97 Hypothetical protein riken cDNA 1810017N16; RNA re 97.19
1rk8_A165 CG8781-PA, CG8781-PA protein; mRNA processing, RRM 97.15
3r27_A100 HnRNP L, heterogeneous nuclear ribonucleoprotein L 97.12
1wex_A104 Hypothetical protein (riken cDNA 2810036L13); stru 97.1
1x4d_A102 Matrin 3; structural genomics, RRM domain, NPPSFA, 97.06
2e5h_A94 Zinc finger CCHC-type and RNA-binding motif- conta 97.03
2ad9_A119 Polypyrimidine tract-binding protein 1; RBD, RRM, 97.01
2cq1_A101 PTB-like protein L; RRM domain, structural genomic 96.97
2cpj_A99 Non-POU domain-containing octamer-binding protein; 96.95
1x4a_A109 Splicing factor, arginine/serine-rich 1 (splicing 96.93
2e5j_A97 Methenyltetrahydrofolate synthetase domain contain 96.92
2do0_A114 HnRNP M, heterogeneous nuclear ribonucleoprotein M 96.91
2x1f_A96 MRNA 3'-END-processing protein RNA15; transcriptio 96.89
2dnq_A90 RNA-binding protein 4B; RRM domain,RBD, structural 96.88
1sjq_A105 Polypyrimidine tract-binding protein 1; babbab mot 96.88
2hzc_A87 Splicing factor U2AF 65 kDa subunit; RNA splicing, 96.88
3mdf_A85 Peptidyl-prolyl CIS-trans isomerase E; RRM domain, 96.88
2dnz_A95 Probable RNA-binding protein 23; RNA recognition m 96.84
2cqh_A93 IGF-II mRNA-binding protein 2 isoform A; RNA recog 96.83
1x4e_A85 RNA binding motif, single-stranded interacting pro 96.83
2cq3_A103 RNA-binding protein 9; RRM domain, structural geno 96.83
2cqc_A95 Arginine/serine-rich splicing factor 10; RNA recog 96.8
2dgu_A103 Heterogeneous nuclear ribonucleoprotein Q; RRM dom 96.8
2la4_A101 Nuclear and cytoplasmic polyadenylated RNA-bindin 96.79
1x4f_A112 Matrin 3; structural genomics, RRM domain, NPPSFA, 96.73
2cqi_A103 Nucleolysin TIAR; RNA recognition motif, RRM, RNA 96.72
4a8x_A88 RNA-binding protein with serine-rich domain 1; tra 96.71
2div_A99 TRNA selenocysteine associated protein; structural 96.71
1whw_A99 Hypothetical protein riken cDNA 1200009A02; RNA re 96.71
2dnh_A105 Bruno-like 5, RNA binding protein; RRM domain, RBD 96.7
2jvo_A108 Nucleolar protein 3; nucleus, phosphorylation, rib 96.68
3bs9_A87 Nucleolysin TIA-1 isoform P40; RNA recognition mot 96.64
2hgl_A136 HNRPF protein, heterogeneous nuclear ribonucleopro 96.64
3md1_A83 Nuclear and cytoplasmic polyadenylated RNA-bindin 96.63
1p27_B106 RNA-binding protein 8A; nuclear protein, mRNA spli 96.63
2cph_A107 RNA binding motif protein 19; RNA recognition moti 96.63
2kvi_A96 Nuclear polyadenylated RNA-binding protein 3; RNA- 96.63
2lkz_A95 RNA-binding protein 5; RRM; NMR {Homo sapiens} 96.63
1x5s_A102 Cold-inducible RNA-binding protein; structure geno 96.62
1x5t_A96 Splicing factor 3B subunit 4; structure genomics, 96.62
2dgv_A92 HnRNP M, heterogeneous nuclear ribonucleoprotein M 96.62
2ytc_A85 PRE-mRNA-splicing factor RBM22; RRM domain, RBD, s 96.61
2cqb_A102 Peptidyl-prolyl CIS-trans isomerase E; RNA recogni 96.61
2dgp_A106 Bruno-like 4, RNA binding protein; RRM domain, str 96.6
1x4c_A108 Splicing factor, arginine/serine-rich 1; structura 96.6
2cpf_A98 RNA binding motif protein 19; RNA recognition moti 96.6
2ywk_A95 Putative RNA-binding protein 11; RRM-domain, struc 96.6
2cpe_A113 RNA-binding protein EWS; RNA recognition motif, RR 96.6
2dgt_A92 RNA-binding protein 30; RRM domain, structural gen 96.6
2ek1_A95 RNA-binding protein 12; RNA recognition motif, dim 96.58
1nu4_A97 U1A RNA binding domain; RNA recognition motif, U1 96.57
4f25_A115 Polyadenylate-binding protein 1; RRM fold, transla 96.56
1x4g_A109 Nucleolysin TIAR; structural genomics, RRM domain, 96.55
2la6_A99 RNA-binding protein FUS; structural genomics, nort 96.55
3lqv_A115 PRE-mRNA branch site protein P14; cysless mutant, 96.54
2d9p_A103 Polyadenylate-binding protein 3; RRM domain, struc 96.53
2hvz_A101 Splicing factor, arginine/serine-rich 7; RRM, RNA 96.53
2xnq_A97 Nuclear polyadenylated RNA-binding protein 3; tran 96.52
2dgx_A96 KIAA0430 protein; RRM domain, structural genomics, 96.51
2fc9_A101 NCL protein; structure genomics, RRM_1 domain, str 96.5
2dnl_A114 Cytoplasmic polyadenylation element binding protei 96.49
2dnp_A90 RNA-binding protein 14; RRM domain, RBD, structura 96.48
2dgo_A115 Cytotoxic granule-associated RNA binding protein 1 96.48
1x4h_A111 RNA-binding protein 28; structural genomics, RRM d 96.48
2cq2_A114 Hypothetical protein LOC91801; RRM domain, structu 96.47
2cpx_A115 Hypothetical protein FLJ11016; RRM domain, structu 96.47
1wf1_A110 RNA-binding protein RALY; structural genomics, RRM 96.47
2dnm_A103 SRP46 splicing factor; RRM domain, RBD, structural 96.47
2lxi_A91 RNA-binding protein 10; NMR {Homo sapiens} 96.46
2dis_A109 Unnamed protein product; structural genomics, RRM 96.43
1wey_A104 Calcipressin 1; structural genomics, RRM domain, r 96.43
2cpz_A115 CUG triplet repeat RNA-binding protein 1; RRM doma 96.41
2dgs_A99 DAZ-associated protein 1; RRM domain, structural g 96.39
2e44_A96 Insulin-like growth factor 2 mRNA binding protein 96.39
2cpi_A111 CCR4-NOT transcription complex subunit 4; RNA reco 96.38
2cpd_A99 Apobec-1 stimulating protein; RNA recognition moti 96.38
2err_A109 Ataxin-2-binding protein 1; protein-RNA complex, R 96.37
2cqp_A98 RNA-binding protein 12; RNA recognition motif, RRM 96.37
1p1t_A104 Cleavage stimulation factor, 64 kDa subunit; RNA r 96.36
2kt5_A124 RNA and export factor-binding protein 2; chaperone 96.35
3ulh_A107 THO complex subunit 4; nuclear protein, RNA bindin 96.35
1whx_A111 Hypothetical protein riken cDNA 1200009A02; RNA re 96.35
2cq0_A103 Eukaryotic translation initiation factor 3 subunit 96.35
3s8s_A110 Histone-lysine N-methyltransferase SETD1A; chromat 96.34
2do4_A100 Squamous cell carcinoma antigen recognized by T- c 96.34
2cqg_A103 TDP-43, TAR DNA-binding protein-43; RNA recognitio 96.33
2ku7_A140 MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio 96.29
1u6f_A139 Tcubp1, RNA-binding protein UBP1; trypanosome, mRN 96.29
1x5u_A105 Splicing factor 3B subunit 4 (spliceosome associat 96.26
2z73_A448 Rhodopsin; visual pigment, GQ-type, G-protein coup 96.24
4fxv_A99 ELAV-like protein 1; RNA recognition motif, putati 96.23
1oo0_B110 CG8781-PA, drosophila Y14; RNA recognition motif, 96.23
3ex7_B126 RNA-binding protein 8A; protein-RNA complex, mRNA 96.23
2cqd_A116 RNA-binding region containing protein 1; RNA recog 96.23
1wf0_A88 TDP-43, TAR DNA-binding protein-43; structural gen 96.22
2fy1_A116 RNA-binding motif protein, Y chromosome, family 1 96.18
2dh8_A105 DAZ-associated protein 1; RRM domain, structural g 96.16
3beg_B115 Splicing factor, arginine/serine-rich 1; kinase, S 96.16
2kxn_B129 Transformer-2 protein homolog beta; SR protein, RR 96.15
2jrs_A108 RNA-binding protein 39; RNA binding motif of RBM39 96.15
3s7r_A87 Heterogeneous nuclear ribonucleoprotein A/B; ferre 96.12
2a3j_A127 U1 small nuclear ribonucleoprotein A; computationa 96.12
1fjc_A96 Nucleolin RBD2, protein C23; RNP, RRM, RNA binding 96.11
2dhg_A104 TRNA selenocysteine associated protein (SECP43); R 96.09
2khc_A118 Testis-specific RNP-type RNA binding protein; RRM, 96.07
1wg1_A88 KIAA1579 protein, homolog EXC-7; RBD, structural g 96.03
1uaw_A77 Mouse-musashi-1; RNP-type structure, RNA binding p 96.03
2e5g_A94 U6 snRNA-specific terminal uridylyltransferase 1; 95.99
1fj7_A101 Nucleolin RBD1, protein C23; RNP, RRM, RNA binding 95.98
2krb_A81 Eukaryotic translation initiation factor 3 subunit 95.96
3ns6_A100 Eukaryotic translation initiation factor 3 subuni; 95.95
1wi8_A104 EIF-4B, eukaryotic translation initiation factor 4 95.94
1h2v_Z156 20 kDa nuclear CAP binding protein; CAP-binding-co 95.94
2jvr_A111 Nucleolar protein 3; RNA recognition motif, nucleu 95.92
3ucg_A89 Polyadenylate-binding protein 2; ferredoxin-like, 95.89
2hgn_A139 Heterogeneous nuclear ribonucleoprotein F; RNA rec 95.86
3d2w_A89 TAR DNA-binding protein 43; DP-43 proteinopathy, T 95.83
2cq4_A114 RNA binding motif protein 23; RRM domain, structur 95.81
2rs2_A109 Musashi-1, RNA-binding protein musashi homolog 1; 95.8
2fc8_A102 NCL protein; structure genomics, RRM_1 domain, str 95.79
1x5o_A114 RNA binding motif, single-stranded interacting pro 95.77
3egn_A143 RNA-binding protein 40; RNA recognition motif (RRM 95.76
3p5t_L90 Cleavage and polyadenylation specificity factor S; 95.74
1x4b_A116 Heterogeneous nuclear ribonucleoproteins A2/B1; st 95.74
2m2b_A131 RNA-binding protein 10; T-cell, JCSG, MPP, PSI-bio 95.73
1s79_A103 Lupus LA protein; RRM, alpha/beta, RNA binding pro 95.7
2dng_A103 Eukaryotic translation initiation factor 4H; RRM d 95.65
2wbr_A89 GW182, gawky, LD47780P; DNA-binding protein, RRM, 95.61
2db1_A118 Heterogeneous nuclear ribonucleoprotein F; RRM dom 95.55
3u1l_A240 PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 95.48
2mss_A75 Protein (musashi1); RNA-binding domain, RNA bindin 95.39
2j76_E100 EIF-4B, EIF4B, eukaryotic translation initiation f 95.36
2cpy_A114 RNA-binding protein 12; RRM domain, structural gen 95.33
1uw4_A91 UPF3X; nonsense mediated mRNA decay protein, RNA-b 95.31
1sjr_A164 Polypyrimidine tract-binding protein 1; extended b 95.3
3tht_A345 Alkylated DNA repair protein ALKB homolog 8; struc 95.28
3n9u_C156 Cleavage and polyadenylation specificity factor S; 95.28
2f3j_A177 RNA and export factor binding protein 2; RRM domai 95.14
2dgw_A91 Probable RNA-binding protein 19; RRM domain, struc 95.09
2jwn_A124 Embryonic polyadenylate-binding protein 2-B; epabp 95.07
1iqt_A75 AUF1, heterogeneous nuclear ribonucleoprotein D0; 95.06
1x5p_A97 Negative elongation factor E; structure genomics, 95.06
2nlw_A105 Eukaryotic translation initiation factor 3 subunit 95.02
3zzy_A130 Polypyrimidine tract-binding protein 1; protein bi 94.89
1wel_A124 RNA-binding protein 12; structural genomics, NPPSF 94.87
2lmi_A107 GRSF-1, G-rich sequence factor 1; G-rich RNA seque 94.85
2ki2_A90 SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA 94.84
2xs2_A102 Deleted in azoospermia-like; RNA binding protein-R 94.7
2lcw_A116 RNA-binding protein FUS; RRM, nucleic acid binding 93.71
1wg5_A104 Heterogeneous nuclear ribonucleoprotein H; structu 94.62
1wez_A102 HnRNP H', FTP-3, heterogeneous nuclear ribonucleop 94.57
2bz2_A121 Negative elongation factor E; NELF E, RNA recognit 94.51
2l9w_A117 U4/U6 snRNA-associated-splicing factor PRP24; RRM, 94.5
1mke_A152 WIP - N-WAsp, fusion protein consisting of wiskott 94.44
2diu_A96 KIAA0430 protein; structural genomics, RRM domain, 94.21
2e5i_A124 Heterogeneous nuclear ribonucleoprotein L-like; RR 94.02
3q2s_C229 Cleavage and polyadenylation specificity factor S; 93.92
2hgm_A126 HNRPF protein, heterogeneous nuclear ribonucleopro 93.91
2ifs_A169 N-WAsp, wiskott-aldrich syndrome protien ineractin 93.84
3pq1_A464 Poly(A) RNA polymerase; nucleotidyl transferase, R 93.33
2dha_A123 FLJ20171 protein; RRM domain, structural genomics, 93.06
2dit_A112 HIV TAT specific factor 1 variant; structural geno 92.2
2voo_A193 Lupus LA protein; RNA-binding protein, RNA recogni 92.1
2pe8_A105 Splicing factor 45; RRM, protein binding; 2.00A {H 91.57
2dnn_A109 RNA-binding protein 12; RRM domain, RBD, structura 91.49
3u0r_A507 Apoptosis inhibitor 5; heat repeat, armadillo repe 90.64
2l08_A97 Regulator of nonsense transcripts 3A; NESG, nonsen 90.0
1whv_A100 Poly(A)-specific ribonuclease; RNA recognition mot 89.15
2dhx_A104 Poly (ADP-ribose) polymerase family, member 10 var 86.9
1wwh_A119 Nucleoporin 35, nucleoporin; structural genomics, 86.63
3ctr_A101 Poly(A)-specific ribonuclease PARN; protein-RNA-co 85.75
1qc6_A130 EVH1 domain from ENA/VAsp-like protein; AN incompl 85.19
3s6e_A114 RNA-binding protein 39; ferredoxin-like, structura 84.67
1owx_A121 Lupus LA protein, SS-B, LA; RRM, transcription; NM 83.14
3v4m_A105 Splicing factor U2AF 65 kDa subunit; canonical RNA 82.96
3ue2_A118 Poly(U)-binding-splicing factor PUF60; RNA recogni 82.78
3h0g_A1752 DNA-directed RNA polymerase II subunit RPB1; trans 82.53
1evh_A112 WH1 domain, protein (MENA EVH1 domain); molecular 80.71
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Back     alignment and structure
Probab=99.76  E-value=5.3e-18  Score=163.48  Aligned_cols=139  Identities=17%  Similarity=0.219  Sum_probs=112.4

Q ss_pred             ccCceEEeccCCCccCHHHHHHHhhccCCcceEEEe--------ccCceEEEEecCHHHHHHHHHhhccCcce-------
Q 001164          568 SASKQLWLGSFGPEASEAHIRFQIDRFGPLEHFFFF--------PIKGFALVEYINIIDAIRAREYIRNHFSW-------  632 (1134)
Q Consensus       568 ~~s~~LWVGnL~~~vte~dL~~~F~~yGpLe~v~~~--------~~rgfAFVeFr~i~DAi~A~~~L~G~~~~-------  632 (1134)
                      +.+++||||||+.++||++|+++|++||+|.++++.        ..+|||||+|.+.++|.+|++.|+|..+.       
T Consensus         1 s~~~~l~V~nLp~~~te~~l~~~F~~~G~i~~v~i~~~~~~~~~~~~g~afV~f~~~~~A~~A~~~l~~~~~~~~~~~~~   80 (175)
T 3nmr_A            1 SDAIKMFVGQVPRTWSEKDLRELFEQYGAVYEINVLRDRSQNPPQSKGCCFVTFYTRKAALEAQNALHNMKVLPGMHHPI   80 (175)
T ss_dssp             CCCEEEEEESCCTTCCHHHHHHHHHTTSCEEEEEEEEECSSSSCEEEEEEEEEESSHHHHHHHHHHHTTTCCCTTCSSCC
T ss_pred             CCceEEEEeCCCCCCCHHHHHHHHHhCCCEEEEEEEecCCCCCCCcceEEEEEECCHHHHHHHHHHhcCcEEccCCccce
Confidence            357899999999999999999999999999999986        46799999999999999999999997653       


Q ss_pred             EEEEeeccCCCCcccccccccccceEEEccCCChhhHHHHHHHHhhccccCCcee-EecC--CCceeeEeecCHHHHHHH
Q 001164          633 RVKFMDVGLGTKGVINGVAVGSCFHVYVGNIPNQWAKDEILHESYKVVYKGPYMV-TDLS--CEGALLMEFRTPEEATTA  709 (1134)
Q Consensus       633 RI~f~r~~lGa~G~~~Gva~~~s~~LwVG~iss~~~keeilhELykfglk~p~~f-tfls--de~~a~LEFeSeEEAa~a  709 (1134)
                      ++.+.+..-.        .....+.|||++++..+++++|...|.++|....+.+ ++..  .++.++++|.+.++|..|
T Consensus        81 ~~~~~~~~~~--------~~~~~~~l~v~nl~~~~t~~~l~~~F~~~G~i~~v~~~~~~~g~~~g~afV~f~~~~~A~~A  152 (175)
T 3nmr_A           81 QMKPADSEKN--------NAVEDRKLFIGMISKKCTENDIRVMFSSFGQIEECRILRGPDGLSRGCAFVTFTTRAMAQTA  152 (175)
T ss_dssp             EEEECGGGCC--------SCGGGSEEEEESCCTTCCHHHHHHHHGGGSCEEEEEEEECTTSCEEEEEEEEESSHHHHHHH
T ss_pred             EEcccccccc--------ccCCCCeEEEcCCCCcCCHHHHHHHHHhCCCEEEEEEEECCCCCEEEEEEEEECCHHHHHHH
Confidence            4444433111        1236889999999999999999999998775444333 2211  145699999999999999


Q ss_pred             HHHHH
Q 001164          710 MAHLR  714 (1134)
Q Consensus       710 k~~IR  714 (1134)
                      +..+.
T Consensus       153 ~~~l~  157 (175)
T 3nmr_A          153 IKAMH  157 (175)
T ss_dssp             HHHHT
T ss_pred             HHHhc
Confidence            98874



>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Back     alignment and structure
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Back     alignment and structure
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Back     alignment and structure
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3vf0_B* 3h2u_B 3h2v_E Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3vf0_B* 3h2u_B 3h2v_E Back     alignment and structure
>4f25_A Polyadenylate-binding protein 1; RRM fold, translation initiation, RNA-binding, EIF4G-binding translation; 1.90A {Homo sapiens} PDB: 4f26_A 2k8g_A Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Back     alignment and structure
>2hvz_A Splicing factor, arginine/serine-rich 7; RRM, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>2cpj_A Non-POU domain-containing octamer-binding protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>3r27_A HnRNP L, heterogeneous nuclear ribonucleoprotein L; RBD fold, protein binding, nucleus; 2.04A {Homo sapiens} Back     alignment and structure
>1wex_A Hypothetical protein (riken cDNA 2810036L13); structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1x4d_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2cq1_A PTB-like protein L; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>4fxv_A ELAV-like protein 1; RNA recognition motif, putative RNA-binding domain, transcri structural genomics, joint center for structural genomics; 1.90A {Homo sapiens} Back     alignment and structure
>2cq2_A Hypothetical protein LOC91801; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2ytc_A PRE-mRNA-splicing factor RBM22; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2wbr_A GW182, gawky, LD47780P; DNA-binding protein, RRM, RBD, TNRC6A, mirnas, P-bodies, argonaute, mRNA decay; NMR {Drosophila melanogaster} Back     alignment and structure
>1x4f_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2ad9_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1why_A Hypothetical protein riken cDNA 1810017N16; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1sjq_A Polypyrimidine tract-binding protein 1; babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x5s_A Cold-inducible RNA-binding protein; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cqi_A Nucleolysin TIAR; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, ST genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2la4_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNA recognition, stress granules, nucleus, RNA-binding, transcription; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2x1f_A MRNA 3'-END-processing protein RNA15; transcription-RNA complex, mRNA processing; 1.60A {Saccharomyces cerevisiae} PDB: 2x1b_A 2x1a_A 2km8_B Back     alignment and structure
>3mdf_A Peptidyl-prolyl CIS-trans isomerase E; RRM domain, PHD finger, CYP33, MLL, RNA binding protein, ISO mRNA processing, mRNA splicing, nucleus; 1.85A {Homo sapiens} SCOP: d.58.7.1 PDB: 2kyx_A 3lpy_A* Back     alignment and structure
>2dnz_A Probable RNA-binding protein 23; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3lqv_A PRE-mRNA branch site protein P14; cysless mutant, PRE-mRNA splicing, adenine, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: ADE; 2.38A {Homo sapiens} SCOP: d.58.7.1 PDB: 2f9d_A 2f9j_A 2fho_B Back     alignment and structure
>3md1_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RBD, RNP, poly(U) binding, nucleus, RNA-binding, binding protein; 1.60A {Saccharomyces cerevisiae} SCOP: d.58.7.0 Back     alignment and structure
>3bs9_A Nucleolysin TIA-1 isoform P40; RNA recognition motif, RRM, RNA binding domain, RBD, RNA splicing, apoptosis, phosphoprotein, RNA-binding; 1.95A {Homo sapiens} Back     alignment and structure
>1x4g_A Nucleolysin TIAR; structural genomics, RRM domain, TIA-1 related protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cqc_A Arginine/serine-rich splicing factor 10; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cqb_A Peptidyl-prolyl CIS-trans isomerase E; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2ywk_A Putative RNA-binding protein 11; RRM-domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.54A {Homo sapiens} Back     alignment and structure
>2dnq_A RNA-binding protein 4B; RRM domain,RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2kvi_A Nuclear polyadenylated RNA-binding protein 3; RNA-binding motif, RRM, transcription termination, NUC phosphoprotein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3s8s_A Histone-lysine N-methyltransferase SETD1A; chromatin modification, transcription regulation, structural genomics, structural genomics consortium; 1.30A {Homo sapiens} Back     alignment and structure
>1whx_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2cph_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1x5t_A Splicing factor 3B subunit 4; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cpf_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2cq3_A RNA-binding protein 9; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2xnq_A Nuclear polyadenylated RNA-binding protein 3; transcription termination, RNA processi recognition, RRM; HET: CAF; 1.30A {Saccharomyces cerevisiae} PDB: 2xnr_A 2l41_A Back     alignment and structure
>1x4a_A Splicing factor, arginine/serine-rich 1 (splicing factor 2, alternate splicing factor)...; structure genomics, SURP domain, splicing factor SF2; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dgx_A KIAA0430 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>4a8x_A RNA-binding protein with serine-rich domain 1; transcription, splicing, RNA processing, nonsense mediated D NMD, HDAC, histone deacetylation; 1.90A {Homo sapiens} Back     alignment and structure
>2dnh_A Bruno-like 5, RNA binding protein; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dnk_A 2dno_A Back     alignment and structure
>2d9p_A Polyadenylate-binding protein 3; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dgt_A RNA-binding protein 30; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dnp_A RNA-binding protein 14; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2fy1_A RNA-binding motif protein, Y chromosome, family 1 member A1; RNA binding protein, structure, protein-RNA complex, RNA stem-loop, structural protein/RNA complex; NMR {Homo sapiens} Back     alignment and structure
>1p27_B RNA-binding protein 8A; nuclear protein, mRNA splicing; 2.00A {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2e5h_A Zinc finger CCHC-type and RNA-binding motif- containing protein 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1u6f_A Tcubp1, RNA-binding protein UBP1; trypanosome, mRNA-binding protein, GU-rich RNA, structure; NMR {Trypanosoma cruzi} SCOP: d.58.7.1 Back     alignment and structure
>2dgv_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dh9_A Back     alignment and structure
>1x4e_A RNA binding motif, single-stranded interacting protein 2; structural genomics, RRM domain, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dgp_A Bruno-like 4, RNA binding protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dgq_A Back     alignment and structure
>2cqh_A IGF-II mRNA-binding protein 2 isoform A; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2div_A TRNA selenocysteine associated protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1whw_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1fjc_A Nucleolin RBD2, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Back     alignment and structure
>2la6_A RNA-binding protein FUS; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, RNA recognition; NMR {Homo sapiens} Back     alignment and structure
>2err_A Ataxin-2-binding protein 1; protein-RNA complex, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2do0_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RNA recognition motif, RRM, RNA binding domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2jvo_A Nucleolar protein 3; nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding, rRNA processing; NMR {Saccharomyces cerevisiae} PDB: 2osq_A Back     alignment and structure
>2dgo_A Cytotoxic granule-associated RNA binding protein 1; RRM domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2rne_A 2dh7_A Back     alignment and structure
>2cpe_A RNA-binding protein EWS; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2do4_A Squamous cell carcinoma antigen recognized by T- cells 3; RRM domaim, RDB, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1nu4_A U1A RNA binding domain; RNA recognition motif, U1 small nuclear ribonucleoprotein, R binding domain, RNA binding protein; HET: MLA; 1.80A {Homo sapiens} SCOP: d.58.7.1 PDB: 1drz_A* 1urn_A 3hhn_B* 3egz_A* 1zzn_A* 1u6b_A* 3cun_A* 3cul_A* 3g8s_A* 3g8t_A* 3g96_A* 3g9c_A* 3irw_P* 3mum_P* 3mur_P* 3mut_P* 3muv_P* 3mxh_P* 3p49_B 3r1h_A* ... Back     alignment and structure
>1wf1_A RNA-binding protein RALY; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wf2_A Back     alignment and structure
>2a3j_A U1 small nuclear ribonucleoprotein A; computationally designed protein, RRM, U1A, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>2dgs_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3ex7_B RNA-binding protein 8A; protein-RNA complex, mRNA processing, mRNA splicing, mRNA transport, nonsense-mediated mRNA decay, nucleus; HET: ADP; 2.30A {Homo sapiens} PDB: 2j0q_D* Back     alignment and structure
>2e5i_A Heterogeneous nuclear ribonucleoprotein L-like; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2e5j_A Methenyltetrahydrofolate synthetase domain containing; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dis_A Unnamed protein product; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1oo0_B CG8781-PA, drosophila Y14; RNA recognition motif, splicing, protein complex, EXON junct complex, signaling protein; 1.85A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 2hyi_B* 2j0s_D* 2xb2_D* Back     alignment and structure
>2cq0_A Eukaryotic translation initiation factor 3 subunit 4; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dgu_A Heterogeneous nuclear ribonucleoprotein Q; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dk2_A Back     alignment and structure
>2dnm_A SRP46 splicing factor; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2hzc_A Splicing factor U2AF 65 kDa subunit; RNA splicing, RRM, RNA recognition, alternative conformation binding protein; HET: P6G; 1.47A {Homo sapiens} PDB: 1u2f_A Back     alignment and structure
>1x4h_A RNA-binding protein 28; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1p1t_A Cleavage stimulation factor, 64 kDa subunit; RNA recognition motif, C-terminal helix, N-terminal helix, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cpz_A CUG triplet repeat RNA-binding protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2rq4_A 2rqc_A Back     alignment and structure
>2lxi_A RNA-binding protein 10; NMR {Homo sapiens} Back     alignment and structure
>1x5p_A Negative elongation factor E; structure genomics, RRM domain, PARP14, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x5u_A Splicing factor 3B subunit 4 (spliceosome associated protein 49) (SAP 49) (SF3B50)...; structure genomics,RRM domain,splicing factor 3B; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cpd_A Apobec-1 stimulating protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x5o_A RNA binding motif, single-stranded interacting protein 1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2khc_A Testis-specific RNP-type RNA binding protein; RRM, RNA recognition motif, bruno; NMR {Drosophila melanogaster} Back     alignment and structure
>2krb_A Eukaryotic translation initiation factor 3 subunit B; EIF3, eukaryotic initiation factor, EIF3B, EIF3J; NMR {Homo sapiens} Back     alignment and structure
>3ulh_A THO complex subunit 4; nuclear protein, RNA binding, structural genomi center for structural genomics, JCSG, protein structure INI PSI-biology; 2.54A {Homo sapiens} PDB: 1no8_A Back     alignment and structure
>2ek1_A RNA-binding protein 12; RNA recognition motif, dimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.00A {Homo sapiens} PDB: 2ek6_A Back     alignment and structure
>2kt5_A RNA and export factor-binding protein 2; chaperone, mRNA processing, mRNA splicing, transport, nucleus, RNA-binding, spliceosome, transport; NMR {Mus musculus} Back     alignment and structure
>2cpi_A CCR4-NOT transcription complex subunit 4; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>3zzy_A Polypyrimidine tract-binding protein 1; protein binding, peptide binding, RNA recognition motif; 1.40A {Homo sapiens} PDB: 3zzz_A Back     alignment and structure
>2jrs_A RNA-binding protein 39; RNA binding motif of RBM39_human (caper), RRM2 domain, solution structure, structural genomics, PSI-2; NMR {Homo sapiens} Back     alignment and structure
>2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} Back     alignment and structure
>2i2y_A Fusion protein consists of immunoglobin G- binding protein G and splicing factor,...; protein-RNA complex RRM alpha-beta sandwich BETA1-alpha1- BETA2-BETA3-alpha2-BETA4; NMR {Streptococcus SP} PDB: 2i38_A Back     alignment and structure
>2dhg_A TRNA selenocysteine associated protein (SECP43); RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1sjr_A Polypyrimidine tract-binding protein 1; extended babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2adb_A Back     alignment and structure
>3ucg_A Polyadenylate-binding protein 2; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: PGE; 1.95A {Homo sapiens} PDB: 3b4d_A 3b4m_A Back     alignment and structure
>1x4c_A Splicing factor, arginine/serine-rich 1; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2kxn_B Transformer-2 protein homolog beta; SR protein, RRM, splicing factor, RNA protein complex, SMN, binding protein-RNA complex; NMR {Homo sapiens} PDB: 2rra_A 2rrb_A Back     alignment and structure
>1wi8_A EIF-4B, eukaryotic translation initiation factor 4B; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cqd_A RNA-binding region containing protein 1; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3tht_A Alkylated DNA repair protein ALKB homolog 8; structural genomics, PSI-biology, northeast structural genom consortium, NESG; HET: AKG; 3.01A {Homo sapiens} PDB: 3thp_A* Back     alignment and structure
>1wg1_A KIAA1579 protein, homolog EXC-7; RBD, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wi6_A Back     alignment and structure
>2lkz_A RNA-binding protein 5; RRM; NMR {Homo sapiens} Back     alignment and structure
>3p5t_L Cleavage and polyadenylation specificity factor S; RRM domain, poly(A) site recognition, RNA, nuclear, RNA BIND protein; 2.70A {Homo sapiens} PDB: 3p6y_C Back     alignment and structure
>2cpx_A Hypothetical protein FLJ11016; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1h2v_Z 20 kDa nuclear CAP binding protein; CAP-binding-complex, RNP domain, MIF4G domain, RNA maturation, RNA export, nuclear protein, RNA-binding; 2.0A {Homo sapiens} SCOP: d.58.7.1 PDB: 1h2u_X* 1h2t_Z 1n52_B* 1n54_B 3fex_B 3fey_B 1h6k_X Back     alignment and structure
>2jvr_A Nucleolar protein 3; RNA recognition motif, nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding; NMR {Saccharomyces cerevisiae} PDB: 2osr_A Back     alignment and structure
>2cqp_A RNA-binding protein 12; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>3ns6_A Eukaryotic translation initiation factor 3 subuni; 1.25A {Saccharomyces cerevisiae} PDB: 3ns5_A Back     alignment and structure
>2cq4_A RNA binding motif protein 23; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1s79_A Lupus LA protein; RRM, alpha/beta, RNA binding protein, translation; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2jwn_A Embryonic polyadenylate-binding protein 2-B; epabp2, poly(A) binding, structural genomics, protein structure initiative, PSI-2; NMR {Xenopus laevis} Back     alignment and structure
>2ki2_A SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA binding proteins, RNA binding protein/SS-DNA binding protein complex; NMR {Helicobacter pylori} Back     alignment and structure
>2nlw_A Eukaryotic translation initiation factor 3 subunit 9; eukaryotic initiation factor 3 complex, RNA recognition motif; NMR {Homo sapiens} Back     alignment and structure
>2dng_A Eukaryotic translation initiation factor 4H; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2m2b_A RNA-binding protein 10; T-cell, JCSG, MPP, PSI-biology; NMR {Homo sapiens} Back     alignment and structure
>2kn4_A Immunoglobulin G-binding protein G, splicing FACT arginine/serine-rich 2, S35, splicing factor SC35,; RRM domain, cell WALL; NMR {Streptococcus SP} Back     alignment and structure
>2j76_E EIF-4B, EIF4B, eukaryotic translation initiation factor 4B; protein biosynthesis, RNA recognition motif, RNA binding domain, RRM, RBD, RNP; NMR {Homo sapiens} Back     alignment and structure
>2rs2_A Musashi-1, RNA-binding protein musashi homolog 1; protein-RNA complex, RRM, RBD, RNA binding protein- complex; NMR {Mus musculus} Back     alignment and structure
>1fj7_A Nucleolin RBD1, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Back     alignment and structure
>3egn_A RNA-binding protein 40; RNA recognition motif (RRM), RNP motif, U11/U12-65K protein, DI-snRNP, U1A protein, U2B protein; 2.50A {Homo sapiens} Back     alignment and structure
>3s7r_A Heterogeneous nuclear ribonucleoprotein A/B; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 2.15A {Homo sapiens} PDB: 1hd0_A 1hd1_A Back     alignment and structure
>2fc9_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3d2w_A TAR DNA-binding protein 43; DP-43 proteinopathy, TDP-43 inclusions, RNA recognition MOTI U, ALS, RRM; HET: DNA; 1.65A {Mus musculus} Back     alignment and structure
>3n9u_C Cleavage and polyadenylation specificity factor S; protein-protein complex, coexpression, heterotetramer, mRNA maturation, mRNA cleavage; 1.92A {Homo sapiens} Back     alignment and structure
>1uaw_A Mouse-musashi-1; RNP-type structure, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2mss_A Protein (musashi1); RNA-binding domain, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2mst_A Back     alignment and structure
>3u1l_A PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 1.64A {Saccharomyces cerevisiae} PDB: 3u1m_A 3tp2_A Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Back     alignment and structure
>2lea_A Serine/arginine-rich splicing factor 2; SR protein, RNA binding protein; NMR {Homo sapiens} PDB: 2leb_A 2lec_A Back     alignment and structure
>2dh8_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3beg_B Splicing factor, arginine/serine-rich 1; kinase, SR protein kinase, SR protein, PRE-mRNA splicing, at binding, chromosome partition; HET: SEP ANP; 2.90A {Homo sapiens} SCOP: d.58.7.1 PDB: 2o3d_A 1wg4_A Back     alignment and structure
>1rk8_A CG8781-PA, CG8781-PA protein; mRNA processing, RRM, RBD, NMD, oskar mRNA localization, translation; 1.90A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 1hl6_A 2x1g_A Back     alignment and structure
>1x4b_A Heterogeneous nuclear ribonucleoproteins A2/B1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cpy_A RNA-binding protein 12; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2e5g_A U6 snRNA-specific terminal uridylyltransferase 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2e44_A Insulin-like growth factor 2 mRNA binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dnl_A Cytoplasmic polyadenylation element binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cqg_A TDP-43, TAR DNA-binding protein-43; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Back     alignment and structure
>2fc8_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1wf0_A TDP-43, TAR DNA-binding protein-43; structural genomics, RRM domain, riken structural genomics/proteomics initiative RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Back     alignment and structure
>1iqt_A AUF1, heterogeneous nuclear ribonucleoprotein D0; RNA-binding protein, hnRNP, telomere, DNA-binding protein, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wtb_A 1x0f_A Back     alignment and structure
>1wez_A HnRNP H', FTP-3, heterogeneous nuclear ribonucleoprotein H'; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dgw_A Probable RNA-binding protein 19; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2lcw_A RNA-binding protein FUS; RRM, nucleic acid binding protein; NMR {Homo sapiens} Back     alignment and structure
>2xs2_A Deleted in azoospermia-like; RNA binding protein-RNA complex; 1.35A {Mus musculus} PDB: 2xs7_A 2xs5_A 2xsf_A Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Back     alignment and structure
>2f3j_A RNA and export factor binding protein 2; RRM domain, RBD domain., transport protein; NMR {Mus musculus} Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Back     alignment and structure
>1wel_A RNA-binding protein 12; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Back     alignment and structure
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Back     alignment and structure
>3q2s_C Cleavage and polyadenylation specificity factor S; CFIM, CFIM25, CFIM68, CPSF5, CPSF6, CPSF, 3' END processing, processing, cleavage factor; 2.90A {Homo sapiens} PDB: 3q2t_C Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Back     alignment and structure
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Back     alignment and structure
>2db1_A Heterogeneous nuclear ribonucleoprotein F; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1wg5_A Heterogeneous nuclear ribonucleoprotein H; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2hgl_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative, splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kfy_A Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Back     alignment and structure
>2lmi_A GRSF-1, G-rich sequence factor 1; G-rich RNA sequence binding factor, RNA binding domain, STRU genomics, joint center for structural genomics, JCSG; NMR {Homo sapiens} Back     alignment and structure
>2pe8_A Splicing factor 45; RRM, protein binding; 2.00A {Homo sapiens} PDB: 2peh_A Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Back     alignment and structure
>3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* Back     alignment and structure
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Back     alignment and structure
>2dit_A HIV TAT specific factor 1 variant; structural genomics, RRM_1 domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Back     alignment and structure
>2diu_A KIAA0430 protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Back     alignment and structure
>2dnn_A RNA-binding protein 12; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2hgn_A Heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg1_A Back     alignment and structure
>2dha_A FLJ20171 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2voo_A Lupus LA protein; RNA-binding protein, RNA recognition motif, systemic lupus erythematosus, phosphoprotein, RNA maturation; 1.8A {Homo sapiens} SCOP: a.4.5.46 d.58.7.1 PDB: 2von_A 2vod_A 2vop_A 1zh5_A 1yty_A 1s7a_A Back     alignment and structure
>2hgm_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg0_A Back     alignment and structure
>3v4m_A Splicing factor U2AF 65 kDa subunit; canonical RNA binding protein, RNA splicing, structural GENO joint center for structural genomics, JCSG; HET: MSE; 1.80A {Mus musculus} PDB: 1o0p_A 1opi_A Back     alignment and structure
>3ue2_A Poly(U)-binding-splicing factor PUF60; RNA recognition motif, RRM, RNA binding domain, ST genomics, joint center for structural genomics, JCSG; HET: MSE; 1.23A {Homo sapiens} SCOP: d.58.7.0 PDB: 3us5_A 2dny_A Back     alignment and structure
>2d9o_A DNAJ (HSP40) homolog, subfamily C, member 17; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2j8a_A Histone-lysine N-methyltransferase, H3 lysine-4 specific; histone methyltransferase, RRM fold, telomere, nuclear protein; 3.0A {Saccharomyces cerevisiae} Back     alignment and structure
>1jmt_A Splicing factor U2AF 35 kDa subunit; RRM, RNA splicing, proline, PPII helix, peptide recognition, RNA binding protein; 2.20A {Homo sapiens} SCOP: d.58.7.3 Back     alignment and structure
>3s6e_A RNA-binding protein 39; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative, PSI-biology; HET: MSE CIT; 0.95A {Mus musculus} PDB: 2lq5_A Back     alignment and structure
>1owx_A Lupus LA protein, SS-B, LA; RRM, transcription; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2kn4_A Immunoglobulin G-binding protein G, splicing FACT arginine/serine-rich 2, S35, splicing factor SC35,; RRM domain, cell WALL; NMR {Streptococcus SP} Back     alignment and structure
>2i2y_A Fusion protein consists of immunoglobin G- binding protein G and splicing factor,...; protein-RNA complex RRM alpha-beta sandwich BETA1-alpha1- BETA2-BETA3-alpha2-BETA4; NMR {Streptococcus SP} PDB: 2i38_A Back     alignment and structure
>3dxb_A Thioredoxin N-terminally fused to PUF60(UHM); splicing, FBP interacting repressor, RRM, electron TRAN redox-active center, transport; 2.20A {Escherichia coli O157} Back     alignment and structure
>2dnr_A Synaptojanin-1; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2lea_A Serine/arginine-rich splicing factor 2; SR protein, RNA binding protein; NMR {Homo sapiens} PDB: 2leb_A 2lec_A Back     alignment and structure
>3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* Back     alignment and structure
>1ufw_A Synaptojanin 2; RNP domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1why_A Hypothetical protein riken cDNA 1810017N16; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1rk8_A CG8781-PA, CG8781-PA protein; mRNA processing, RRM, RBD, NMD, oskar mRNA localization, translation; 1.90A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 1hl6_A 2x1g_A Back     alignment and structure
>3r27_A HnRNP L, heterogeneous nuclear ribonucleoprotein L; RBD fold, protein binding, nucleus; 2.04A {Homo sapiens} Back     alignment and structure
>1wex_A Hypothetical protein (riken cDNA 2810036L13); structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1x4d_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2e5h_A Zinc finger CCHC-type and RNA-binding motif- containing protein 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ad9_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cq1_A PTB-like protein L; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cpj_A Non-POU domain-containing octamer-binding protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1x4a_A Splicing factor, arginine/serine-rich 1 (splicing factor 2, alternate splicing factor)...; structure genomics, SURP domain, splicing factor SF2; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2e5j_A Methenyltetrahydrofolate synthetase domain containing; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2do0_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RNA recognition motif, RRM, RNA binding domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2x1f_A MRNA 3'-END-processing protein RNA15; transcription-RNA complex, mRNA processing; 1.60A {Saccharomyces cerevisiae} PDB: 2x1b_A 2x1a_A 2km8_B Back     alignment and structure
>2dnq_A RNA-binding protein 4B; RRM domain,RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1sjq_A Polypyrimidine tract-binding protein 1; babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2hzc_A Splicing factor U2AF 65 kDa subunit; RNA splicing, RRM, RNA recognition, alternative conformation binding protein; HET: P6G; 1.47A {Homo sapiens} PDB: 1u2f_A Back     alignment and structure
>3mdf_A Peptidyl-prolyl CIS-trans isomerase E; RRM domain, PHD finger, CYP33, MLL, RNA binding protein, ISO mRNA processing, mRNA splicing, nucleus; 1.85A {Homo sapiens} SCOP: d.58.7.1 PDB: 2kyx_A 3lpy_A* Back     alignment and structure
>2dnz_A Probable RNA-binding protein 23; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cqh_A IGF-II mRNA-binding protein 2 isoform A; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x4e_A RNA binding motif, single-stranded interacting protein 2; structural genomics, RRM domain, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cq3_A RNA-binding protein 9; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cqc_A Arginine/serine-rich splicing factor 10; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dgu_A Heterogeneous nuclear ribonucleoprotein Q; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dk2_A Back     alignment and structure
>2la4_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNA recognition, stress granules, nucleus, RNA-binding, transcription; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1x4f_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2cqi_A Nucleolysin TIAR; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, ST genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>4a8x_A RNA-binding protein with serine-rich domain 1; transcription, splicing, RNA processing, nonsense mediated D NMD, HDAC, histone deacetylation; 1.90A {Homo sapiens} Back     alignment and structure
>2div_A TRNA selenocysteine associated protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1whw_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2dnh_A Bruno-like 5, RNA binding protein; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dnk_A 2dno_A Back     alignment and structure
>2jvo_A Nucleolar protein 3; nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding, rRNA processing; NMR {Saccharomyces cerevisiae} PDB: 2osq_A Back     alignment and structure
>3bs9_A Nucleolysin TIA-1 isoform P40; RNA recognition motif, RRM, RNA binding domain, RBD, RNA splicing, apoptosis, phosphoprotein, RNA-binding; 1.95A {Homo sapiens} Back     alignment and structure
>2hgl_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative, splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kfy_A Back     alignment and structure
>3md1_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RBD, RNP, poly(U) binding, nucleus, RNA-binding, binding protein; 1.60A {Saccharomyces cerevisiae} SCOP: d.58.7.0 Back     alignment and structure
>1p27_B RNA-binding protein 8A; nuclear protein, mRNA splicing; 2.00A {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cph_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2kvi_A Nuclear polyadenylated RNA-binding protein 3; RNA-binding motif, RRM, transcription termination, NUC phosphoprotein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2lkz_A RNA-binding protein 5; RRM; NMR {Homo sapiens} Back     alignment and structure
>1x5s_A Cold-inducible RNA-binding protein; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x5t_A Splicing factor 3B subunit 4; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dgv_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dh9_A Back     alignment and structure
>2ytc_A PRE-mRNA-splicing factor RBM22; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cqb_A Peptidyl-prolyl CIS-trans isomerase E; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dgp_A Bruno-like 4, RNA binding protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dgq_A Back     alignment and structure
>1x4c_A Splicing factor, arginine/serine-rich 1; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2cpf_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2ywk_A Putative RNA-binding protein 11; RRM-domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.54A {Homo sapiens} Back     alignment and structure
>2cpe_A RNA-binding protein EWS; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dgt_A RNA-binding protein 30; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ek1_A RNA-binding protein 12; RNA recognition motif, dimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.00A {Homo sapiens} PDB: 2ek6_A Back     alignment and structure
>1nu4_A U1A RNA binding domain; RNA recognition motif, U1 small nuclear ribonucleoprotein, R binding domain, RNA binding protein; HET: MLA; 1.80A {Homo sapiens} SCOP: d.58.7.1 PDB: 1drz_A* 1urn_A 3hhn_B* 3egz_A* 1zzn_A* 1u6b_A* 3cun_A* 3cul_A* 3g8s_A* 3g8t_A* 3g96_A* 3g9c_A* 3irw_P* 3mum_P* 3mur_P* 3mut_P* 3muv_P* 3mxh_P* 3p49_B 3r1h_A* ... Back     alignment and structure
>4f25_A Polyadenylate-binding protein 1; RRM fold, translation initiation, RNA-binding, EIF4G-binding translation; 1.90A {Homo sapiens} PDB: 4f26_A 2k8g_A Back     alignment and structure
>1x4g_A Nucleolysin TIAR; structural genomics, RRM domain, TIA-1 related protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2la6_A RNA-binding protein FUS; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, RNA recognition; NMR {Homo sapiens} Back     alignment and structure
>3lqv_A PRE-mRNA branch site protein P14; cysless mutant, PRE-mRNA splicing, adenine, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: ADE; 2.38A {Homo sapiens} SCOP: d.58.7.1 PDB: 2f9d_A 2f9j_A 2fho_B Back     alignment and structure
>2d9p_A Polyadenylate-binding protein 3; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2hvz_A Splicing factor, arginine/serine-rich 7; RRM, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>2xnq_A Nuclear polyadenylated RNA-binding protein 3; transcription termination, RNA processi recognition, RRM; HET: CAF; 1.30A {Saccharomyces cerevisiae} PDB: 2xnr_A 2l41_A Back     alignment and structure
>2dgx_A KIAA0430 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2fc9_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dnl_A Cytoplasmic polyadenylation element binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dnp_A RNA-binding protein 14; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dgo_A Cytotoxic granule-associated RNA binding protein 1; RRM domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2rne_A 2dh7_A Back     alignment and structure
>1x4h_A RNA-binding protein 28; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2cq2_A Hypothetical protein LOC91801; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cpx_A Hypothetical protein FLJ11016; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1wf1_A RNA-binding protein RALY; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wf2_A Back     alignment and structure
>2dnm_A SRP46 splicing factor; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2lxi_A RNA-binding protein 10; NMR {Homo sapiens} Back     alignment and structure
>2dis_A Unnamed protein product; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1wey_A Calcipressin 1; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2cpz_A CUG triplet repeat RNA-binding protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2rq4_A 2rqc_A Back     alignment and structure
>2dgs_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2e44_A Insulin-like growth factor 2 mRNA binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cpi_A CCR4-NOT transcription complex subunit 4; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2cpd_A Apobec-1 stimulating protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2err_A Ataxin-2-binding protein 1; protein-RNA complex, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cqp_A RNA-binding protein 12; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1p1t_A Cleavage stimulation factor, 64 kDa subunit; RNA recognition motif, C-terminal helix, N-terminal helix, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2kt5_A RNA and export factor-binding protein 2; chaperone, mRNA processing, mRNA splicing, transport, nucleus, RNA-binding, spliceosome, transport; NMR {Mus musculus} Back     alignment and structure
>3ulh_A THO complex subunit 4; nuclear protein, RNA binding, structural genomi center for structural genomics, JCSG, protein structure INI PSI-biology; 2.54A {Homo sapiens} PDB: 1no8_A Back     alignment and structure
>1whx_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2cq0_A Eukaryotic translation initiation factor 3 subunit 4; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3s8s_A Histone-lysine N-methyltransferase SETD1A; chromatin modification, transcription regulation, structural genomics, structural genomics consortium; 1.30A {Homo sapiens} Back     alignment and structure
>2do4_A Squamous cell carcinoma antigen recognized by T- cells 3; RRM domaim, RDB, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cqg_A TDP-43, TAR DNA-binding protein-43; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} Back     alignment and structure
>1u6f_A Tcubp1, RNA-binding protein UBP1; trypanosome, mRNA-binding protein, GU-rich RNA, structure; NMR {Trypanosoma cruzi} SCOP: d.58.7.1 Back     alignment and structure
>1x5u_A Splicing factor 3B subunit 4 (spliceosome associated protein 49) (SAP 49) (SF3B50)...; structure genomics,RRM domain,splicing factor 3B; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2z73_A Rhodopsin; visual pigment, GQ-type, G-protein coupled receptor, chromophore, glycoprotein, lipoprotein, membrane, palmitate phosphorylation; HET: BOG RET PLM TWT PC1; 2.50A {Todarodes pacificus} PDB: 3aym_A* 3ayn_A* 2ziy_A* Back     alignment and structure
>4fxv_A ELAV-like protein 1; RNA recognition motif, putative RNA-binding domain, transcri structural genomics, joint center for structural genomics; 1.90A {Homo sapiens} Back     alignment and structure
>1oo0_B CG8781-PA, drosophila Y14; RNA recognition motif, splicing, protein complex, EXON junct complex, signaling protein; 1.85A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 2hyi_B* 2j0s_D* 2xb2_D* Back     alignment and structure
>3ex7_B RNA-binding protein 8A; protein-RNA complex, mRNA processing, mRNA splicing, mRNA transport, nonsense-mediated mRNA decay, nucleus; HET: ADP; 2.30A {Homo sapiens} PDB: 2j0q_D* Back     alignment and structure
>2cqd_A RNA-binding region containing protein 1; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1wf0_A TDP-43, TAR DNA-binding protein-43; structural genomics, RRM domain, riken structural genomics/proteomics initiative RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2fy1_A RNA-binding motif protein, Y chromosome, family 1 member A1; RNA binding protein, structure, protein-RNA complex, RNA stem-loop, structural protein/RNA complex; NMR {Homo sapiens} Back     alignment and structure
>2dh8_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3beg_B Splicing factor, arginine/serine-rich 1; kinase, SR protein kinase, SR protein, PRE-mRNA splicing, at binding, chromosome partition; HET: SEP ANP; 2.90A {Homo sapiens} SCOP: d.58.7.1 PDB: 2o3d_A 1wg4_A Back     alignment and structure
>2kxn_B Transformer-2 protein homolog beta; SR protein, RRM, splicing factor, RNA protein complex, SMN, binding protein-RNA complex; NMR {Homo sapiens} PDB: 2rra_A 2rrb_A Back     alignment and structure
>2jrs_A RNA-binding protein 39; RNA binding motif of RBM39_human (caper), RRM2 domain, solution structure, structural genomics, PSI-2; NMR {Homo sapiens} Back     alignment and structure
>3s7r_A Heterogeneous nuclear ribonucleoprotein A/B; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 2.15A {Homo sapiens} PDB: 1hd0_A 1hd1_A Back     alignment and structure
>2a3j_A U1 small nuclear ribonucleoprotein A; computationally designed protein, RRM, U1A, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>1fjc_A Nucleolin RBD2, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Back     alignment and structure
>2dhg_A TRNA selenocysteine associated protein (SECP43); RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2khc_A Testis-specific RNP-type RNA binding protein; RRM, RNA recognition motif, bruno; NMR {Drosophila melanogaster} Back     alignment and structure
>1wg1_A KIAA1579 protein, homolog EXC-7; RBD, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wi6_A Back     alignment and structure
>1uaw_A Mouse-musashi-1; RNP-type structure, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2e5g_A U6 snRNA-specific terminal uridylyltransferase 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1fj7_A Nucleolin RBD1, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Back     alignment and structure
>2krb_A Eukaryotic translation initiation factor 3 subunit B; EIF3, eukaryotic initiation factor, EIF3B, EIF3J; NMR {Homo sapiens} Back     alignment and structure
>3ns6_A Eukaryotic translation initiation factor 3 subuni; 1.25A {Saccharomyces cerevisiae} PDB: 3ns5_A Back     alignment and structure
>1wi8_A EIF-4B, eukaryotic translation initiation factor 4B; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1h2v_Z 20 kDa nuclear CAP binding protein; CAP-binding-complex, RNP domain, MIF4G domain, RNA maturation, RNA export, nuclear protein, RNA-binding; 2.0A {Homo sapiens} SCOP: d.58.7.1 PDB: 1h2u_X* 1h2t_Z 1n52_B* 1n54_B 3fex_B 3fey_B 1h6k_X Back     alignment and structure
>2jvr_A Nucleolar protein 3; RNA recognition motif, nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding; NMR {Saccharomyces cerevisiae} PDB: 2osr_A Back     alignment and structure
>3ucg_A Polyadenylate-binding protein 2; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: PGE; 1.95A {Homo sapiens} PDB: 3b4d_A 3b4m_A Back     alignment and structure
>2hgn_A Heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg1_A Back     alignment and structure
>3d2w_A TAR DNA-binding protein 43; DP-43 proteinopathy, TDP-43 inclusions, RNA recognition MOTI U, ALS, RRM; HET: DNA; 1.65A {Mus musculus} Back     alignment and structure
>2cq4_A RNA binding motif protein 23; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2rs2_A Musashi-1, RNA-binding protein musashi homolog 1; protein-RNA complex, RRM, RBD, RNA binding protein- complex; NMR {Mus musculus} Back     alignment and structure
>2fc8_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x5o_A RNA binding motif, single-stranded interacting protein 1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3egn_A RNA-binding protein 40; RNA recognition motif (RRM), RNP motif, U11/U12-65K protein, DI-snRNP, U1A protein, U2B protein; 2.50A {Homo sapiens} Back     alignment and structure
>3p5t_L Cleavage and polyadenylation specificity factor S; RRM domain, poly(A) site recognition, RNA, nuclear, RNA BIND protein; 2.70A {Homo sapiens} PDB: 3p6y_C Back     alignment and structure
>1x4b_A Heterogeneous nuclear ribonucleoproteins A2/B1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2m2b_A RNA-binding protein 10; T-cell, JCSG, MPP, PSI-biology; NMR {Homo sapiens} Back     alignment and structure
>1s79_A Lupus LA protein; RRM, alpha/beta, RNA binding protein, translation; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dng_A Eukaryotic translation initiation factor 4H; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2wbr_A GW182, gawky, LD47780P; DNA-binding protein, RRM, RBD, TNRC6A, mirnas, P-bodies, argonaute, mRNA decay; NMR {Drosophila melanogaster} Back     alignment and structure
>2db1_A Heterogeneous nuclear ribonucleoprotein F; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>3u1l_A PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 1.64A {Saccharomyces cerevisiae} PDB: 3u1m_A 3tp2_A Back     alignment and structure
>2mss_A Protein (musashi1); RNA-binding domain, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2mst_A Back     alignment and structure
>2j76_E EIF-4B, EIF4B, eukaryotic translation initiation factor 4B; protein biosynthesis, RNA recognition motif, RNA binding domain, RRM, RBD, RNP; NMR {Homo sapiens} Back     alignment and structure
>2cpy_A RNA-binding protein 12; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1uw4_A UPF3X; nonsense mediated mRNA decay protein, RNA-binding protein, N domain, MIF4G domain; 1.95A {Homo sapiens} SCOP: d.58.7.4 Back     alignment and structure
>1sjr_A Polypyrimidine tract-binding protein 1; extended babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2adb_A Back     alignment and structure
>3tht_A Alkylated DNA repair protein ALKB homolog 8; structural genomics, PSI-biology, northeast structural genom consortium, NESG; HET: AKG; 3.01A {Homo sapiens} PDB: 3thp_A* Back     alignment and structure
>3n9u_C Cleavage and polyadenylation specificity factor S; protein-protein complex, coexpression, heterotetramer, mRNA maturation, mRNA cleavage; 1.92A {Homo sapiens} Back     alignment and structure
>2f3j_A RNA and export factor binding protein 2; RRM domain, RBD domain., transport protein; NMR {Mus musculus} Back     alignment and structure
>2dgw_A Probable RNA-binding protein 19; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2jwn_A Embryonic polyadenylate-binding protein 2-B; epabp2, poly(A) binding, structural genomics, protein structure initiative, PSI-2; NMR {Xenopus laevis} Back     alignment and structure
>1iqt_A AUF1, heterogeneous nuclear ribonucleoprotein D0; RNA-binding protein, hnRNP, telomere, DNA-binding protein, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wtb_A 1x0f_A Back     alignment and structure
>1x5p_A Negative elongation factor E; structure genomics, RRM domain, PARP14, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2nlw_A Eukaryotic translation initiation factor 3 subunit 9; eukaryotic initiation factor 3 complex, RNA recognition motif; NMR {Homo sapiens} Back     alignment and structure
>3zzy_A Polypyrimidine tract-binding protein 1; protein binding, peptide binding, RNA recognition motif; 1.40A {Homo sapiens} PDB: 3zzz_A Back     alignment and structure
>1wel_A RNA-binding protein 12; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2lmi_A GRSF-1, G-rich sequence factor 1; G-rich RNA sequence binding factor, RNA binding domain, STRU genomics, joint center for structural genomics, JCSG; NMR {Homo sapiens} Back     alignment and structure
>2ki2_A SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA binding proteins, RNA binding protein/SS-DNA binding protein complex; NMR {Helicobacter pylori} Back     alignment and structure
>2xs2_A Deleted in azoospermia-like; RNA binding protein-RNA complex; 1.35A {Mus musculus} PDB: 2xs7_A 2xs5_A 2xsf_A Back     alignment and structure
>2lcw_A RNA-binding protein FUS; RRM, nucleic acid binding protein; NMR {Homo sapiens} Back     alignment and structure
>1wg5_A Heterogeneous nuclear ribonucleoprotein H; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1wez_A HnRNP H', FTP-3, heterogeneous nuclear ribonucleoprotein H'; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2l9w_A U4/U6 snRNA-associated-splicing factor PRP24; RRM, U6 snRNP, RNA binding protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1mke_A WIP - N-WAsp, fusion protein consisting of wiskott-aldrich syndrome protein interacting protein...; polyproline, protein-protein complex; NMR {Rattus norvegicus} SCOP: b.55.1.4 Back     alignment and structure
>2diu_A KIAA0430 protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2e5i_A Heterogeneous nuclear ribonucleoprotein L-like; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>3q2s_C Cleavage and polyadenylation specificity factor S; CFIM, CFIM25, CFIM68, CPSF5, CPSF6, CPSF, 3' END processing, processing, cleavage factor; 2.90A {Homo sapiens} PDB: 3q2t_C Back     alignment and structure
>2hgm_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg0_A Back     alignment and structure
>2ifs_A N-WAsp, wiskott-aldrich syndrome protien ineracting protein and neural wiskott-aldrich syndrome...; verprolin, polyproline, protein- protein complex; NMR {Homo sapiens} Back     alignment and structure
>3pq1_A Poly(A) RNA polymerase; nucleotidyl transferase, RNP-type RNA binding domain, poly(A polymerase, mitochondria, transferase; 3.10A {Homo sapiens} Back     alignment and structure
>2dha_A FLJ20171 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dit_A HIV TAT specific factor 1 variant; structural genomics, RRM_1 domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2voo_A Lupus LA protein; RNA-binding protein, RNA recognition motif, systemic lupus erythematosus, phosphoprotein, RNA maturation; 1.8A {Homo sapiens} SCOP: a.4.5.46 d.58.7.1 PDB: 2von_A 2vod_A 2vop_A 1zh5_A 1yty_A 1s7a_A Back     alignment and structure
>2pe8_A Splicing factor 45; RRM, protein binding; 2.00A {Homo sapiens} PDB: 2peh_A Back     alignment and structure
>2dnn_A RNA-binding protein 12; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3u0r_A Apoptosis inhibitor 5; heat repeat, armadillo repeat, lysine acetylation; 2.50A {Homo sapiens} PDB: 3v6a_A Back     alignment and structure
>2l08_A Regulator of nonsense transcripts 3A; NESG, nonsense regulator, structural genomics, PSI-2, protei structure initiative; NMR {Homo sapiens} Back     alignment and structure
>1whv_A Poly(A)-specific ribonuclease; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, PARN, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2rok_A* Back     alignment and structure
>2dhx_A Poly (ADP-ribose) polymerase family, member 10 variant; RRM domain, RNA- binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wwh_A Nucleoporin 35, nucleoporin; structural genomics, MPPN, riken structural genomics/proteomics initiative, RSGI, protein transport; 2.70A {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>3ctr_A Poly(A)-specific ribonuclease PARN; protein-RNA-complex, M7G-CAP, M7GTP, RNA recognition motif, RRM, cytoplasm, exonuclease, hydrolase, magnesium; HET: MGP; 2.10A {Homo sapiens} Back     alignment and structure
>1qc6_A EVH1 domain from ENA/VAsp-like protein; AN incomplete seven stranded anti-parallel beta barrel closed by AN alpha helix, EVH1 domain; 2.60A {Mus musculus} SCOP: b.55.1.4 Back     alignment and structure
>3s6e_A RNA-binding protein 39; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative, PSI-biology; HET: MSE CIT; 0.95A {Mus musculus} PDB: 2lq5_A Back     alignment and structure
>1owx_A Lupus LA protein, SS-B, LA; RRM, transcription; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3v4m_A Splicing factor U2AF 65 kDa subunit; canonical RNA binding protein, RNA splicing, structural GENO joint center for structural genomics, JCSG; HET: MSE; 1.80A {Mus musculus} PDB: 1o0p_A 1opi_A Back     alignment and structure
>3ue2_A Poly(U)-binding-splicing factor PUF60; RNA recognition motif, RRM, RNA binding domain, ST genomics, joint center for structural genomics, JCSG; HET: MSE; 1.23A {Homo sapiens} SCOP: d.58.7.0 PDB: 3us5_A 2dny_A Back     alignment and structure
>3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Back     alignment and structure
>1evh_A WH1 domain, protein (MENA EVH1 domain); molecular recognition, actin dynamics, contractIle protein; 1.80A {Mus musculus} SCOP: b.55.1.4 PDB: 2xqn_M 2iyb_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 1134
d2f9da1114 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p 3e-04
d1x4aa195 d.58.7.1 (A:9-103) Splicing factor, arginine/serin 3e-04
d2disa196 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 { 4e-04
d2cpja186 d.58.7.1 (A:65-150) Non-POU domain-containing octa 9e-04
d2cpja186 d.58.7.1 (A:65-150) Non-POU domain-containing octa 0.004
d1p1ta_104 d.58.7.1 (A:) Cleavage stimulation factor, 64 kda 0.003
d2adba1108 d.58.7.1 (A:177-284) Polypyrimidine tract-binding 0.003
>d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]} Length = 114 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Ferredoxin-like
superfamily: RNA-binding domain, RBD
family: Canonical RBD
domain: Pre-mRNA branch site protein p14
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 39.2 bits (91), Expect = 3e-04
 Identities = 11/64 (17%), Positives = 27/64 (42%), Gaps = 3/64 (4%)

Query: 569 ASKQLWLGSFGPEASEAHIRFQIDRFGPLEHFFFFPI---KGFALVEYINIIDAIRAREY 625
            ++ L++ +   + +   +     ++GP+           +G A V Y +I DA  A ++
Sbjct: 6   VNRILYIRNLPYKITAEEMYDIFGKYGPIRQIRVGNTPETRGTAYVVYEDIFDAKNACDH 65

Query: 626 IRNH 629
           +   
Sbjct: 66  LSGF 69


>d1x4aa1 d.58.7.1 (A:9-103) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 Back     information, alignment and structure
>d2disa1 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d2cpja1 d.58.7.1 (A:65-150) Non-POU domain-containing octamer-binding protein, NonO {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure
>d2cpja1 d.58.7.1 (A:65-150) Non-POU domain-containing octamer-binding protein, NonO {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure
>d1p1ta_ d.58.7.1 (A:) Cleavage stimulation factor, 64 kda subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d2adba1 d.58.7.1 (A:177-284) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 108 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query1134
d1u1qa_183 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.65
d2adca288 Polypyrimidine tract-binding protein {Human (Homo 99.57
d1whya_97 Putative RNA-binding protein 15B, Rbm15b {Mouse (M 99.54
d2cpda186 APOBEC1 stimulating protein {Human (Homo sapiens) 99.54
d2b0ga183 Splicesomal U1A protein {Drosophila melanogaster [ 99.5
d1b7fa182 Sex-lethal protein {Drosophila melanogaster [TaxId 99.5
d1x4ga196 Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 99.48
d2cpja186 Non-POU domain-containing octamer-binding protein, 99.48
d1wexa_104 Heterogeneous nuclear ribonucleoprotein L-like {Mo 99.47
d1h2vz_93 CBP20, 20KDa nuclear cap-binding protein {Human (H 99.46
d1fxla182 Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 99.45
d2cq1a188 Polypyrimidine tract-binding protein 2, PTBP2 {Hum 99.44
d1whxa_111 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.44
d2f9da1114 Pre-mRNA branch site protein p14 {Human (Homo sapi 99.44
d2bz2a179 Negative elongation factor E, NELF-E {Human (Homo 99.44
d2cqha180 IGF-II mRNA-binding protein 2 isoform A {Human (Ho 99.43
d2cqia190 Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 99.43
d1fjca_96 Nucleolin {Golden hamster (Mesocricetus auratus) [ 99.42
d2cqba189 Peptidyl-prolyl cis-trans isomerase E, N-terminal 99.42
d2adca1109 Polypyrimidine tract-binding protein {Human (Homo 99.41
d1x4aa195 Splicing factor, arginine/serine-rich 1, SFRS1 {Hu 99.41
d2ghpa181 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.41
d1wg1a_88 Probable RNA-binding protein KIAA1579 {Human (Homo 99.41
d1fxla285 Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 99.4
d2adba1108 Polypyrimidine tract-binding protein {Human (Homo 99.39
d1no8a_78 Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 1 99.39
d1cvja180 Poly(A)-binding protein {Human (Homo sapiens) [Tax 99.38
d2cq0a190 Eukaryotic translation initiation factor 3 subunit 99.38
d1x5sa190 Cold-inducible RNA-binding protein {Human (Homo sa 99.38
d1u6fa1139 RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId 99.38
d1cvja289 Poly(A)-binding protein {Human (Homo sapiens) [Tax 99.38
d2cq2a1101 Alkylation repair AlkB homolog 8, ALKBH8 {Human (H 99.38
d2cpfa185 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.38
d2u2fa_85 Splicing factor U2AF 65 KDa subunit {Human (Homo s 99.38
d1wf2a_98 Heterogeneous nuclear ribonucleoproteins C1/C2 {Hu 99.38
d2cpza1102 CUG triplet repeat RNA-binding protein 1 {Human (H 99.37
d2cpha194 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.37
d1rk8a_88 RNA-binding protein 8 {Fruit fly (Drosophila melan 99.37
d2cq3a193 RNA-binding protein 9 {Human (Homo sapiens) [TaxId 99.36
d1x5ua193 Splicing factor 3B subunit 4 {Human (Homo sapiens) 99.36
d1nu4a_91 Splicesomal U1A protein {Human (Homo sapiens) [Tax 99.35
d2cqca183 Arginine/serine-rich splicing factor 10 {Human (Ho 99.34
d1whwa_99 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.34
d1x4da189 Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} 99.33
d3begb187 Splicing factor, arginine/serine-rich 1, SFRS1 {Hu 99.33
d1b7fa285 Sex-lethal protein {Drosophila melanogaster [TaxId 99.32
d1weya_104 Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090 99.32
d1wi6a175 Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (M 99.31
d1x4fa199 Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} 99.29
d1wf0a_88 TAR DNA-binding protein 43, TDP-43 {Human (Homo sa 99.29
d2cpxa1102 RNA-binding protein 41, RBM41 {Human (Homo sapiens 99.28
d1wg4a_98 Splicing factor, arginine/serine-rich 9 (SFRS9) {M 99.28
d1x5oa1101 RNA-binding motif, single-stranded-interacting pro 99.28
d2disa196 Hypothetical protein FLJ20273 {Human (Homo sapiens 99.27
d1x5ta183 Splicing factor 3B subunit 4 {Human (Homo sapiens) 99.26
d1p1ta_104 Cleavage stimulation factor, 64 kda subunit {Human 99.26
d1x4ha198 RNA-binding protein 28 {Mouse (Mus musculus) [TaxI 99.25
d1uawa_77 Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} 99.25
d2ghpa386 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.25
d1x4ea172 RNA-binding motif, single-stranded-interacting pro 99.24
d2msta_75 Neural RNA-binding protein Musashi-1 {Mouse (Mus m 99.24
d2cpia189 E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musc 99.24
d2cqda1103 RNA-binding region containing protein 1 {Human (Ho 99.23
d1l3ka279 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.22
d1fjeb191 Nucleolin {Golden hamster (Mesocricetus auratus) [ 99.2
d2cq4a1101 RNA binding protein 23 {Human (Homo sapiens) [TaxI 99.2
d1x4ba1103 Heterogeneous nuclear ribonucleoproteins A2/B1 {Hu 99.19
d1hd0a_75 Heterogeneous nuclear ribonucleoprotein d0 {Human 99.19
d2cpea1101 RNA-binding protein EWS {Human (Homo sapiens) [Tax 99.18
d2cqga190 TAR DNA-binding protein 43, TDP-43 {Human (Homo sa 99.17
d1l3ka184 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.17
d1zh5a285 Lupus LA protein {Human (Homo sapiens) [TaxId: 960 99.16
d1x0fa175 Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo s 99.14
d1wi8a_104 Eukaryotic translation initiation factor 4B {Human 99.12
d1owxa_113 Lupus LA protein {Human (Homo sapiens) [TaxId: 960 99.08
d2ghpa275 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.07
d1u2fa_90 Splicing factor U2AF 65 KDa subunit {Human (Homo s 99.05
d2cqpa186 RNA-binding protein 12 {Mouse (Mus musculus) [TaxI 99.04
d1weza_102 Heterogeneous nuclear ribonucleoprotein H' {Human 98.97
d2cpya1103 RNA-binding protein 12 {Human (Homo sapiens) [TaxI 98.97
d1wg5a_104 Heterogeneous nuclear ribonucleoprotein H' {Human 98.91
d1u1qa_183 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 98.83
U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]}" target="_blank" href="http://scop.mrc-lmb.cam.ac.uk/scop/search.cgi?sid=d1jmta_">d1jmta_104 U2 98.81
d1wela1112 RNA-binding protein 12 {Human (Homo sapiens) [TaxI 98.75
d1o0pa_104 Splicing factor U2AF 65 KDa subunit {Human (Homo s 98.75
d2dita199 HIV Tat-specific factor 1 {Human (Homo sapiens) [T 98.74
d1wwha181 Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090 98.74
d2adca288 Polypyrimidine tract-binding protein {Human (Homo 97.64
d1whya_97 Putative RNA-binding protein 15B, Rbm15b {Mouse (M 97.57
d1x4aa195 Splicing factor, arginine/serine-rich 1, SFRS1 {Hu 97.55
d2cq1a188 Polypyrimidine tract-binding protein 2, PTBP2 {Hum 97.46
d1wexa_104 Heterogeneous nuclear ribonucleoprotein L-like {Mo 97.42
d2b0ga183 Splicesomal U1A protein {Drosophila melanogaster [ 97.18
d1x4da189 Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} 97.13
d1nu4a_91 Splicesomal U1A protein {Human (Homo sapiens) [Tax 97.1
d2cpda186 APOBEC1 stimulating protein {Human (Homo sapiens) 97.07
d1b7fa182 Sex-lethal protein {Drosophila melanogaster [TaxId 97.05
d2adba1108 Polypyrimidine tract-binding protein {Human (Homo 97.04
d2cqia190 Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 97.01
d1x4ga196 Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 96.96
d2disa196 Hypothetical protein FLJ20273 {Human (Homo sapiens 96.94
d2cpja186 Non-POU domain-containing octamer-binding protein, 96.92
d2cqha180 IGF-II mRNA-binding protein 2 isoform A {Human (Ho 96.9
d2f9da1114 Pre-mRNA branch site protein p14 {Human (Homo sapi 96.86
d2cqca183 Arginine/serine-rich splicing factor 10 {Human (Ho 96.83
d1whxa_111 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 96.8
d1wg1a_88 Probable RNA-binding protein KIAA1579 {Human (Homo 96.8
d1h2vz_93 CBP20, 20KDa nuclear cap-binding protein {Human (H 96.78
d1wg4a_98 Splicing factor, arginine/serine-rich 9 (SFRS9) {M 96.77
d2ghpa181 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 96.77
d2cqba189 Peptidyl-prolyl cis-trans isomerase E, N-terminal 96.76
d1fxla182 Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 96.76
d1x4fa199 Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} 96.74
d1fjca_96 Nucleolin {Golden hamster (Mesocricetus auratus) [ 96.73
d1x5sa190 Cold-inducible RNA-binding protein {Human (Homo sa 96.71
d2adca1109 Polypyrimidine tract-binding protein {Human (Homo 96.65
d1whwa_99 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 96.63
d2cpza1102 CUG triplet repeat RNA-binding protein 1 {Human (H 96.63
d1rk8a_88 RNA-binding protein 8 {Fruit fly (Drosophila melan 96.61
d1fxla285 Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 96.59
d1weya_104 Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090 96.57
d1wi8a_104 Eukaryotic translation initiation factor 4B {Human 96.56
d1x4ha198 RNA-binding protein 28 {Mouse (Mus musculus) [TaxI 96.56
d1x4ea172 RNA-binding motif, single-stranded-interacting pro 96.54
d3begb187 Splicing factor, arginine/serine-rich 1, SFRS1 {Hu 96.53
d2msta_75 Neural RNA-binding protein Musashi-1 {Mouse (Mus m 96.49
d1p1ta_104 Cleavage stimulation factor, 64 kda subunit {Human 96.48
d1fjeb191 Nucleolin {Golden hamster (Mesocricetus auratus) [ 96.47
d1cvja289 Poly(A)-binding protein {Human (Homo sapiens) [Tax 96.43
d2cpxa1102 RNA-binding protein 41, RBM41 {Human (Homo sapiens 96.4
d2cpha194 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 96.39
d1b7fa285 Sex-lethal protein {Drosophila melanogaster [TaxId 96.38
d2bz2a179 Negative elongation factor E, NELF-E {Human (Homo 96.36
d2cq2a1101 Alkylation repair AlkB homolog 8, ALKBH8 {Human (H 96.33
d2cq3a193 RNA-binding protein 9 {Human (Homo sapiens) [TaxId 96.3
d1no8a_78 Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 1 96.26
d1zh5a285 Lupus LA protein {Human (Homo sapiens) [TaxId: 960 96.22
d1cvja180 Poly(A)-binding protein {Human (Homo sapiens) [Tax 96.22
d2cqpa186 RNA-binding protein 12 {Mouse (Mus musculus) [TaxI 96.19
d1l3ka279 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 96.18
d1l3ka184 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 96.18
d2u2fa_85 Splicing factor U2AF 65 KDa subunit {Human (Homo s 96.18
d2cpfa185 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 96.17
d1x5ua193 Splicing factor 3B subunit 4 {Human (Homo sapiens) 96.15
d2cpea1101 RNA-binding protein EWS {Human (Homo sapiens) [Tax 96.11
d1wf0a_88 TAR DNA-binding protein 43, TDP-43 {Human (Homo sa 96.11
d1x5oa1101 RNA-binding motif, single-stranded-interacting pro 96.07
d1wi6a175 Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (M 96.06
d1u6fa1139 RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId 96.03
d2cq0a190 Eukaryotic translation initiation factor 3 subunit 96.02
d1uawa_77 Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} 96.01
d2cpia189 E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musc 95.96
d2cqga190 TAR DNA-binding protein 43, TDP-43 {Human (Homo sa 95.81
d1hd0a_75 Heterogeneous nuclear ribonucleoprotein d0 {Human 95.78
d1x5ta183 Splicing factor 3B subunit 4 {Human (Homo sapiens) 95.61
d1wf2a_98 Heterogeneous nuclear ribonucleoproteins C1/C2 {Hu 95.53
d1x4ba1103 Heterogeneous nuclear ribonucleoproteins A2/B1 {Hu 95.46
d1x0fa175 Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo s 95.4
d2cq4a1101 RNA binding protein 23 {Human (Homo sapiens) [TaxI 95.33
d2cqda1103 RNA-binding region containing protein 1 {Human (Ho 95.28
d2ghpa386 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 95.27
d1u2fa_90 Splicing factor U2AF 65 KDa subunit {Human (Homo s 95.17
d1uw4a_91 RNA processing protein UPF3x, RRM domain {Human (H 95.09
d2ghpa275 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 94.94
d1wwha181 Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090 93.4
d1wg5a_104 Heterogeneous nuclear ribonucleoprotein H' {Human 92.98
d2cpya1103 RNA-binding protein 12 {Human (Homo sapiens) [TaxI 92.42
d1weza_102 Heterogeneous nuclear ribonucleoprotein H' {Human 92.4
d1wela1112 RNA-binding protein 12 {Human (Homo sapiens) [TaxI 92.38
d1owxa_113 Lupus LA protein {Human (Homo sapiens) [TaxId: 960 90.59
d1o0pa_104 Splicing factor U2AF 65 KDa subunit {Human (Homo s 89.13
d1mkea1114 Actin regulatory protein WASP {Rat (Rattus norvegi 88.24
d2dita199 HIV Tat-specific factor 1 {Human (Homo sapiens) [T 86.57
d1xoda1114 Sprouty-related, EVH1 domain-containing protein 1, 82.46
>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Ferredoxin-like
superfamily: RNA-binding domain, RBD
family: Canonical RBD
domain: Nuclear ribonucleoprotein A1 (RNP A1, UP1)
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.65  E-value=4.9e-16  Score=151.46  Aligned_cols=141  Identities=15%  Similarity=0.219  Sum_probs=105.3

Q ss_pred             CceEEeccCCCccCHHHHHHHhhccCCcceEEEe------ccCceEEEEecCHHHHHHHHHhhccCcceE-EEEeeccCC
Q 001164          570 SKQLWLGSFGPEASEAHIRFQIDRFGPLEHFFFF------PIKGFALVEYINIIDAIRAREYIRNHFSWR-VKFMDVGLG  642 (1134)
Q Consensus       570 s~~LWVGnL~~~vte~dL~~~F~~yGpLe~v~~~------~~rgfAFVeFr~i~DAi~A~~~L~G~~~~R-I~f~r~~lG  642 (1134)
                      .++||||||++++||+||+++|++||.|+++++.      ..+|||||+|.+.++|.+|++.+.+....+ +...+. ..
T Consensus         6 ~r~lfV~nLp~~~te~~L~~~F~~~G~v~~~~~~~~~~~~~~~g~afv~f~~~~~a~~a~~~~~~~~~~~~~~~~~~-~~   84 (183)
T d1u1qa_           6 LRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAAMNARPHKVDGRVVEPKRA-VS   84 (183)
T ss_dssp             HHEEEEESCCTTCCHHHHHHHHGGGSCEEEEEEEECTTTCCEEEEEEEEESSHHHHHHHHHTCSCEETTEECEEEEC-CC
T ss_pred             CCEEEEECCCCCCCHHHHHHHHHHcCCEEEEEeeecccCCCccCceecccCCHHHHHHHHHhcCCcccccchhhhhh-hh
Confidence            4799999999999999999999999999999975      368999999999999999998877654332 221111 11


Q ss_pred             CCcccccccccccceEEEccCCChhhHHHHHHHHhhccccCCcee-EecC---CCceeeEeecCHHHHHHHHH
Q 001164          643 TKGVINGVAVGSCFHVYVGNIPNQWAKDEILHESYKVVYKGPYMV-TDLS---CEGALLMEFRTPEEATTAMA  711 (1134)
Q Consensus       643 a~G~~~Gva~~~s~~LwVG~iss~~~keeilhELykfglk~p~~f-tfls---de~~a~LEFeSeEEAa~ak~  711 (1134)
                      ............++.||||+|+..+++++|...|..+|....+.+ ++..   ..+.++++|.+.++|.+|+.
T Consensus        85 ~~~~~~~~~~~~~~~i~V~~lp~~~te~~L~~~f~~~G~v~~~~i~~~~~~~~~~g~~fV~f~~~e~A~~Al~  157 (183)
T d1u1qa_          85 REDSQRPGAHLTVKKIFVGGIKEDTEEHHLRDYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVI  157 (183)
T ss_dssp             TTGGGSTTTTCCCSEEEEECCCTTCCHHHHHHHHGGGSCEEEEEEEECTTTCCEEEEEEEEESCHHHHHHHHT
T ss_pred             cccccccccccccceeEEccCCCcCCHHHHhhhhccCCceeeeeeecccccCccceeEEEEECCHHHHHHHHH
Confidence            111111122346889999999999999999999988775554433 3222   23478999999999998854



>d2adca2 d.58.7.1 (A:444-531) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whya_ d.58.7.1 (A:) Putative RNA-binding protein 15B, Rbm15b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cpda1 d.58.7.1 (A:223-308) APOBEC1 stimulating protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b0ga1 d.58.7.1 (A:1-83) Splicesomal U1A protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1b7fa1 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1x4ga1 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpja1 d.58.7.1 (A:65-150) Non-POU domain-containing octamer-binding protein, NonO {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wexa_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein L-like {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1h2vz_ d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fxla1 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq1a1 d.58.7.1 (A:51-138) Polypyrimidine tract-binding protein 2, PTBP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whxa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bz2a1 d.58.7.1 (A:35-113) Negative elongation factor E, NELF-E {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqha1 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 isoform A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqia1 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fjca_ d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Back     information, alignment and structure
>d2cqba1 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomerase E, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adca1 d.58.7.1 (A:335-443) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4aa1 d.58.7.1 (A:9-103) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghpa1 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wg1a_ d.58.7.1 (A:) Probable RNA-binding protein KIAA1579 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fxla2 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adba1 d.58.7.1 (A:177-284) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1no8a_ d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1cvja1 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq0a1 d.58.7.1 (A:231-320) Eukaryotic translation initiation factor 3 subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5sa1 d.58.7.1 (A:8-97) Cold-inducible RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u6fa1 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1cvja2 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq2a1 d.58.7.1 (A:25-125) Alkylation repair AlkB homolog 8, ALKBH8 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpfa1 d.58.7.1 (A:362-446) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf2a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoproteins C1/C2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpza1 d.58.7.1 (A:383-484) CUG triplet repeat RNA-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpha1 d.58.7.1 (A:454-547) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1rk8a_ d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2cq3a1 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ua1 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nu4a_ d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqca1 d.58.7.1 (A:109-191) Arginine/serine-rich splicing factor 10 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whwa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x4da1 d.58.7.1 (A:8-96) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d3begb1 d.58.7.1 (B:121-207) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b7fa2 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1weya_ d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wi6a1 d.58.7.1 (A:69-143) Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x4fa1 d.58.7.1 (A:8-106) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wf0a_ d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpxa1 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg4a_ d.58.7.1 (A:) Splicing factor, arginine/serine-rich 9 (SFRS9) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x5oa1 d.58.7.1 (A:8-108) RNA-binding motif, single-stranded-interacting protein 1, RBMS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2disa1 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ta1 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p1ta_ d.58.7.1 (A:) Cleavage stimulation factor, 64 kda subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ha1 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uawa_ d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ghpa3 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1x4ea1 d.58.7.1 (A:8-79) RNA-binding motif, single-stranded-interacting protein 2, RBMS2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2msta_ d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cpia1 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqda1 d.58.7.1 (A:1-103) RNA-binding region containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l3ka2 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fjeb1 d.58.7.1 (B:1-91) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Back     information, alignment and structure
>d2cq4a1 d.58.7.1 (A:132-232) RNA binding protein 23 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ba1 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucleoproteins A2/B1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hd0a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein d0 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpea1 d.58.7.1 (A:353-453) RNA-binding protein EWS {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqga1 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l3ka1 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zh5a2 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x0fa1 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wi8a_ d.58.7.1 (A:) Eukaryotic translation initiation factor 4B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1owxa_ d.58.7.1 (A:) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghpa2 d.58.7.1 (A:41-115) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqpa1 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1weza_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpya1 d.58.7.1 (A:536-638) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg5a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jmta_ d.58.7.3 (A:) U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wela1 d.58.7.1 (A:412-523) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o0pa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dita1 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wwha1 d.58.7.1 (A:169-249) Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2adca2 d.58.7.1 (A:444-531) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whya_ d.58.7.1 (A:) Putative RNA-binding protein 15B, Rbm15b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x4aa1 d.58.7.1 (A:9-103) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq1a1 d.58.7.1 (A:51-138) Polypyrimidine tract-binding protein 2, PTBP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wexa_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein L-like {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2b0ga1 d.58.7.1 (A:1-83) Splicesomal U1A protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1x4da1 d.58.7.1 (A:8-96) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nu4a_ d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpda1 d.58.7.1 (A:223-308) APOBEC1 stimulating protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b7fa1 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2adba1 d.58.7.1 (A:177-284) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqia1 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ga1 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2disa1 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpja1 d.58.7.1 (A:65-150) Non-POU domain-containing octamer-binding protein, NonO {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqha1 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 isoform A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqca1 d.58.7.1 (A:109-191) Arginine/serine-rich splicing factor 10 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whxa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wg1a_ d.58.7.1 (A:) Probable RNA-binding protein KIAA1579 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h2vz_ d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg4a_ d.58.7.1 (A:) Splicing factor, arginine/serine-rich 9 (SFRS9) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ghpa1 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2cqba1 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomerase E, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fxla1 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4fa1 d.58.7.1 (A:8-106) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fjca_ d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Back     information, alignment and structure
>d1x5sa1 d.58.7.1 (A:8-97) Cold-inducible RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adca1 d.58.7.1 (A:335-443) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whwa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cpza1 d.58.7.1 (A:383-484) CUG triplet repeat RNA-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rk8a_ d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1fxla2 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1weya_ d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wi8a_ d.58.7.1 (A:) Eukaryotic translation initiation factor 4B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ha1 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x4ea1 d.58.7.1 (A:8-79) RNA-binding motif, single-stranded-interacting protein 2, RBMS2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3begb1 d.58.7.1 (B:121-207) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2msta_ d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1p1ta_ d.58.7.1 (A:) Cleavage stimulation factor, 64 kda subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fjeb1 d.58.7.1 (B:1-91) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Back     information, alignment and structure
>d1cvja2 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpxa1 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpha1 d.58.7.1 (A:454-547) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1b7fa2 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2bz2a1 d.58.7.1 (A:35-113) Negative elongation factor E, NELF-E {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq2a1 d.58.7.1 (A:25-125) Alkylation repair AlkB homolog 8, ALKBH8 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq3a1 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1no8a_ d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zh5a2 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cvja1 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqpa1 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1l3ka2 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l3ka1 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpfa1 d.58.7.1 (A:362-446) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x5ua1 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpea1 d.58.7.1 (A:353-453) RNA-binding protein EWS {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf0a_ d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5oa1 d.58.7.1 (A:8-108) RNA-binding motif, single-stranded-interacting protein 1, RBMS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wi6a1 d.58.7.1 (A:69-143) Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1u6fa1 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d2cq0a1 d.58.7.1 (A:231-320) Eukaryotic translation initiation factor 3 subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uawa_ d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cpia1 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqga1 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hd0a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein d0 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ta1 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf2a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoproteins C1/C2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ba1 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucleoproteins A2/B1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x0fa1 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq4a1 d.58.7.1 (A:132-232) RNA binding protein 23 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqda1 d.58.7.1 (A:1-103) RNA-binding region containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghpa3 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uw4a_ d.58.7.4 (A:) RNA processing protein UPF3x, RRM domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghpa2 d.58.7.1 (A:41-115) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wwha1 d.58.7.1 (A:169-249) Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wg5a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpya1 d.58.7.1 (A:536-638) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1weza_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wela1 d.58.7.1 (A:412-523) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1owxa_ d.58.7.1 (A:) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o0pa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mkea1 b.55.1.4 (A:31-144) Actin regulatory protein WASP {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2dita1 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xoda1 b.55.1.4 (A:10-123) Sprouty-related, EVH1 domain-containing protein 1, Spred-1 {Western clawed frog (Xenopus tropicalis) [TaxId: 8364]} Back     information, alignment and structure