Citrus Sinensis ID: 001187


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------1000------1010------1020------1030------1040------1050------1060------1070------1080------1090------1100------1110------1120------113
MAPGKRQNNGRSPLVNPQRQITSFFSKSNSPSPSPTISKLNPNKSNSNPNPNPNSNSNRTPSPSPSPTTPSPLQSNPKKSRLVIGQTPSPPPSTPAAAKSYGEDVLRKRIRVYWPLDKAWYEGCVKSFDKECNKHLVQYDDGEDELLDLGKEKIEWVQESVSLLKRLRRDSFKKVVVEDDEEMENVEDEISDDRSDSSDDDWNKNVGKEDVSEDEEVDLVDEQENKVLRGRKRKSSGVKKSKSDGNAVNADFKSPIIKPVKIFGSDKLSNGFDNPVMGDVSERFSAREADKFHFLGPDRRDAKRRRPGDVYYDPRTLYLPPDFLRNLSEGQKQWWEFKSKHMDKVIFFKMGKFYELFEMDAHVGAKELDLQYMKGEQPHCGFPERNFSMNVEKLARKGYRVLVVEQTETPEQLELRRKEKGSKDKVVKREICAVVTKGTLTEGELLSANPDASYLMALTESNQSPASQSTDRCFGICVVDVATSRIILGQVMDDLDCSVLCCLLSELRPVEIIKPANMLSPETERAILRHTRNPLVNDLVPLSEFWDAETTVLEIKNIYNRITAESLNKADSNVANSQAEGDGLTCLPGILSELISTGDSGSQVLSALGGTLFYLKKSFLDETLLRFAKFELLPCSGFGDMAKKPYMVLDAPALENLEVFENSRSGDSSGTLYAQLNHCVTAFGKRLLRTWLARPLYNSGLIRERQDAVAGLRGVNQPFALEFRKALSRLPDMERLLARLFASSEANGRNSNKVVLYEDAAKKQLQEFISALHGCELMDQACSSLGAILENTESRQLHHILTPGKGLPAIVSILKHFKDAFDWVEANNSGRIIPHGGVDMDYDSACKKVKEIEASLTKHLKEQRKLLGDTSITYVTIGKDLYLLEVPESLRGSVPRDYELRSSKKGFFRYWTPNIKKLLGELSQAESEKESALKSILQRLIGQFCEHHNKWRQMVAATAELDALISLAIASDFYEGPTCRPVILDSCSNEEPYISAKSLGHPVLRSDSLGKGEFVPNDITIGGHGNASFILLTGPNMGGKSTLLRQVCLAVILAQVGADVPAEIFEISPVDRIFVRMGAKDHIMAGQSTFLTELSETALMLSSATRNSLVVLDELGRGTSTSDGQAIAS
ccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHccccccccccccccccccccccccccccccccccccHHHHHccccHHHHHHHHHHHHHHHcccccccccccccHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHcccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHcccEEEEEEcccccccHHHHHHHHHHHccEEEccccccccccccccHHHHHHHHHHccccEEEEEccccHHHHHHHHHccccccccEEEcEEEEEccccccccccccccccccEEEEEEEccccccccccccEEEEEEEEcccccEEEEEEcccccHHHHHHHHHcccccEEEEccccccHHHHHHHHHccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccHHHHHHHHccccHHHHHHHHHHHHHHHHHccHHHHHHHccccccccccccccccccccEEEEHHHHHccccccccccccccccHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHcccHHHHHHHHHHccccccHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHccccccHHHHHHHHHHHHcccccccccccEEEccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEccEEEEEEEEEcccccccccccEEEcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccEEEcccccccccEEEEcccccEEEcccccccccccccccccccccccEEEEEcccccHHHHHHHHHHHHHHHHHHcccccccccccccccEEccccccccccccccccHHHHHHHHHHHHHcccccccHHHHccccccccHHHHHccc
cccccccccccccccccccHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHcccEEEEEccccccHHcccEEccccccccEEEEEccccccEEcccccHHHHHcccHHHHHHHcccccEEEEEcccHHcccccccccccccccccHHHcccccHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHccccccccccccccHHHHHHHHHHccccccccccccccccccccEEEccHHHHHHccHHHHHHHHHHHHcccEEEEEEccHHHHHHHHHHHHHHHHHccEEcccccccccccHHHHHHHHHHHHHcccEEEEEEEcccHHHHHHHHHHcccccccEEEEEEEEEccccccHHHHHcccccccEEEEEEEEcccccccccccEEEEEEEEEcccEEEEEEcccccHHHHHHHHHHHccccEEEcccccccHHHHHHHHcccccccHcccccccccccHHHHHHHHHHHHcccHHHHHHHHHHHccccccccccHHHcHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccEEEccccEEEEEHHHHHHHHHHHccccccccccHHHHHHccccHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHccHHHHHHHHHHHHccccHHHHHHHHHHccccccccccEEEEEEcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHccccHHHHHHHHHHHHccccEEEccccEEEccccccHHHHHHHHHHHcHHHHHHHHHHHHHHHHcccEEEEEEccccEEEEEEcccccccccHHHHHHHHHHHHHHHHcHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccEEcccccccccEEEEEcccccEEEEEEccccccccccEEEccccccEEEEEEccccccHHHHHHHHHHHHHHHHHcccccHcccEEccccEEEEEccccHHcccccccEEEEHHHHHHHHHHHccccEEEEEcccccccccccHHHcc
mapgkrqnngrsplvnpqrqitsffsksnspspsptisklnpnksnsnpnpnpnsnsnrtpspspspttpsplqsnpkksrlvigqtpspppstpaaakSYGEDVLRKRIRVywpldkawyeGCVKSFDKECNKhlvqyddgeDELLDLGKEKIEWVQESVSLLKRLRrdsfkkvvveddeemenvedeisddrsdssdddwnknvgkedvsedeevdlVDEQENKVLrgrkrkssgvkksksdgnavnadfkspiikpvkifgsdklsngfdnpvmgdvserfsareadkfhflgpdrrdakrrrpgdvyydprtlylppdflrNLSEGQKQWWEFKSKHMDKVIFFKMGKFYELFEMDahvgakeldlqymkgeqphcgfpernfSMNVEKLARKGYRVLVVEQTETPEQLELRRKEKGSKDKVVKREICAVvtkgtltegellsanpdASYLMALtesnqspasqstdrcfgICVVDVATSRIILGQVMDDLDCSVLCCllselrpveiikpanmlspETERAILRHtrnplvndlvplsefwdaeTTVLEIKNIYNRITAeslnkadsnvansqaegdgltclpGILSELISTGDSGSQVLSALGGTLFYLKKSFLDETLLRFAkfellpcsgfgdmakkpymvldapalenlevfensrsgdssgtLYAQLNHCVTAFGKRLLRTWLARplynsglireRQDAVaglrgvnqPFALEFRKALSRLPDMERLLARLFASseangrnsnkvVLYEDAAKKQLQEFISALHGCELMDQACSSLGAILEntesrqlhhiltpgkgLPAIVSILKHFKDAFDWveannsgriiphggvdmdyDSACKKVKEIEASLTKHLKEQRKLLGDTSITYVTIGKDlyllevpeslrgsvprdyelrsskkgffrywTPNIKKLLGELSQAESEKESALKSILQRLIGQFCEHHNKWRQMVAATAELDALISLAIasdfyegptcrpvildscsneepyisakslghpvlrsdslgkgefvpnditigghgnasfilltgpnmggkstLLRQVCLAVILAQvgadvpaeifeispvdrifVRMGAKDHIMAGQSTFLTELSETALMLSSATRNSLVVLdelgrgtstsdgqaias
mapgkrqnngrsplvnpQRQITSFfsksnspspsptISKLNPNKSNSNPNPNPNSNSNRTPSPSPSPTTPSPLQSNPKKSRLVIGqtpspppstpaaaksygedvLRKRIRVYWPLDKAWYEGCVKSFDKECNKHLVQYDDGEDELLDLGKEKIEWVQESVsllkrlrrdsfkkvvveddeemenvedeisddrsdssdddwnknvgkedvsedeevdlvdeqenkvlrgrkrkssgvkksksdgnavnadfkspiikpVKIFGSDKLSNGFDNPVMGDVSERfsareadkfhflgpdrrdakrrrpgdvyydprtlylppDFLRNLSEGQKQWWEFKSKHMDKVIFFKMGKFYELFEMDAHVGAKELDLQYMKGEQPHCGFPERNFSMNVEKLARKGYRVLvveqtetpeqlelrrkekgskdkvvkreicavvtkgtltegellsANPDASYLMALTESNqspasqstdRCFGICVVDVATSRIILGQVMDDLDCSVLCCLLSElrpveiikpanmlSPETERAILRHTRNPLVNDLVPLSEFWDAETTVLEIKNIYNRITAESLNKADSNVANSQAEGDGLTCLPGILSELISTGDSGSQVLSALGGTLFYLKKSFLDETLLRFAKFELLPCSGFGDMAKKPYMVLDAPALENLEVFENSRSGDSSGTLYAQLNHCVTAFGKRLLRTWLARPLYNSGLIRERQDAvaglrgvnqPFALEFRKALSRLPDMERLLARLFasseangrnsnKVVLYEDAAKKQLQEFISALHGCELMDQACSSLGAILENTESRQLHHILTPGKGLPAIVSILKHFKDAFDWVEANNsgriiphggvDMDYDSACKKVKEIEASLTKHLKeqrkllgdtsityvtigkdlyllevpeslrgsvprdyelrsskkgffryWTPNIKKLLGELSQAESEKESALKSILQRLIGQFCEHHNKWRQMVAATAELDALISLAIASDFYEGPTCRPVILDSCSNEEPYISAKSLGHPVLRSDSLGKGEFVPNDITIGGHGNASFILLTGPNMGGKSTLLRQVCLAVILAQVGADVPAEIFEISPVDRIFVRMGAKDHIMAGQSTFLTELSETALMLSSATRNSLVVLDElgrgtstsdgqaias
MAPGKRQNNGRSPLVNPQRQitsffsksnspspsptisklnpnksnsnpnpnpnsnsnrtpspspspttpsplqsnpKKSRLVIGQtpspppstpaaaKSYGEDVLRKRIRVYWPLDKAWYEGCVKSFDKECNKHLVQYddgedelldlgkekIEWVQESVSLLKRLRRDSFKKvvveddeemenvedeIsddrsdssdddWNKNvgkedvsedeevdlvdeqeNKVLrgrkrkssgvkksksdgNAVNADFKSPIIKPVKIFGSDKLSNGFDNPVMGDVSERFSAREADKFHFLGPDRRDAKRRRPGDVYYDPRTLYLPPDFLRNLSEGQKQWWEFKSKHMDKVIFFKMGKFYELFEMDAHVGAKELDLQYMKGEQPHCGFPERNFSMNVEKLARKGYRVLVVEQTETPEQLELRRKEKGSKDKVVKREICAVVTKGTLTEGELLSANPDASYLMALTESNQSPASQSTDRCFGICVVDVATSRIILGQVMddldcsvlccllselRPVEIIKPANMLSPETERAILRHTRNPLVNDLVPLSEFWDAETTVLEIKNIYNRITAESLNKADSNVANSQAEGDGLTCLPGILSELISTGDSGSQVLSALGGTLFYLKKSFLDETLLRFAKFELLPCSGFGDMAKKPYMVLDAPALENLEVFENSRSGDSSGTLYAQLNHCVTAFGKRLLRTWLARPLYNSGLIRERQDAVAGLRGVNQPFALEFRKALSRLPDMERLLARLFASSEANGRNSNKVVLYEDAAKKQLQEFISALHGCELMDQACSSLGAILENTESRQLHHILTPGKGLPAIVSILKHFKDAFDWVEANNSGRIIPHGGVDMDYDSACKKVKEIEASLTKHLKEQRKLLGDTSITYVTIGKDLYLLEVPESLRGSVPRDYELRSSKKGFFRYWTPNIKKLLGELSQAESEKESALKSILQRLIGQFCEHHNKWRQMVAATAELDALISLAIASDFYEGPTCRPVILDSCSNEEPYISAKSLGHPVLRSDSLGKGEFVPNDITIGGHGNASFILLTGPNMGGKSTLLRQVCLAVILAQVGADVPAEIFEISPVDRIFVRMGAKDHIMAGQSTFLTELSETALMLSSATRNSLVVLDELGRGTSTSDGQAIAS
******************************************************************************************************EDVLRKRIRVYWPLDKAWYEGCVKSFDKECNKHLVQYDDGEDELLDLGKEKIEWVQESVSLLKRLRRDSFKKV********************************************************************************IIKPVKIFGS*******************************************DVYYDPRTLYLPPDFLRNLSEGQKQWWEFKSKHMDKVIFFKMGKFYELFEMDAHVGAKELDLQYMKGEQPHCGFPERNFSMNVEKLARKGYRVLVVE********************VVKREICAVVTKGTLTEGELL*************************RCFGICVVDVATSRIILGQVMDDLDCSVLCCLLSELRPVEIIKPANMLSPETERAILRHTRNPLVNDLVPLSEFWDAETTVLEIKNIYNRITAES***************DGLTCLPGILSELISTGDSGSQVLSALGGTLFYLKKSFLDETLLRFAKFELLPCSGFGDMAKKPYMVLDAPALENLEVFE********GTLYAQLNHCVTAFGKRLLRTWLARPLYNSGLIRERQDAVAGLRGVNQPFALEFRKALSRLPDMERLLARLFA*********NKVVLYEDAAKKQLQEFISALHGCELMDQACSSLGAILENTESRQLHHILTPGKGLPAIVSILKHFKDAFDWVEANNSGRIIPHGGVDMDYDSACKKVKEIEASLTKHLKEQRKLLGDTSITYVTIGKDLYLLEVPESLRGSVPRDYELRSSKKGFFRYWTPNIKKLLGE***********LKSILQRLIGQFCEHHNKWRQMVAATAELDALISLAIASDFYEGPTCRPVILDSCSNEEPYISAKSLGHPVLRSDSLGKGEFVPNDITIGGHGNASFILLTGPNMGGKSTLLRQVCLAVILAQVGADVPAEIFEISPVDRIFVRMGAKDHIMAGQSTFLTELSETALMLSSATRNSLVVL*****************
**************************************************************************************************************************************************************************************************************************************************************************************************************************RTLYLPPDFLRNLSEGQKQWWEFKSKHMDKVIFFKMGKFYELFEMDAHVGAKELDLQYMKGEQPHCGFPERNFSMNVEKLARKGYRVLVVEQTETPEQL***********KVVKREICAVVTKGTLTEGELLSANPDASYLMALTESNQSPASQSTDRCFGICVVDVATSRIILGQVMDDLDCSVLCCLLSELRPVEIIKPANMLSPETERAILRHTRNPLVNDLVPLSEFWDAETTVLEIKNIYNRITAESLNKADSNVANSQAEGDGLTCLPGILSELISTGDSGSQVLSALGGTLFYLKKSFLDETLLRFAKFELLPCSGFGDMAKKPYMVLDAPALENLEVFENSRSGDSSGTLYAQLNHCVTAFGKRLLRTWLARPLYNSGLIRERQDAVAGLRGVNQPFALEFRKALSRLPDMERLLARLFASSEANGRNSNKVVLYEDAAKKQLQEFISALHGCELMDQACSSL********SRQLHHILTPGKGLPAIVSILKHFKDAFDWVEANNSGRIIPHGGVDMDYDSACKKVKEIEASLTKHLKEQRKLLGDTSITYVTIGKDLYLLEVPESLRGSVPRDYELRSSKKGFFRYWTPNIKKLLGELSQAESEKESALKSILQRLIGQFCEHHNKWRQMVAATAELDALISLAIASDFYEGPTCRPVILDSCSNEEPYISAKSLGHPVLRSDSLGKGEFVPNDITIGGHGNASFILLTGPNMGGKSTLLRQVCLAVILAQVGADVPAEIFEISPVDRIFVRMGAKDHIMAGQSTFLTELSETALMLSSATRNSLVVLDELGRGTSTSDGQAIAS
************PLVNPQRQITSFF*************KLNPNKSN******************************************************YGEDVLRKRIRVYWPLDKAWYEGCVKSFDKECNKHLVQYDDGEDELLDLGKEKIEWVQESVSLLKRLRRDSFKKVVVED***************************************LVDEQENKV******************NAVNADFKSPIIKPVKIFGSDKLSNGFDNPVMGDVSERFSAREADKFHFLGPDRRDAKRRRPGDVYYDPRTLYLPPDFLRNLSEGQKQWWEFKSKHMDKVIFFKMGKFYELFEMDAHVGAKELDLQYMKGEQPHCGFPERNFSMNVEKLARKGYRVLVVEQTETPEQLE***********VVKREICAVVTKGTLTEGELLSANPDASYLMALT***********DRCFGICVVDVATSRIILGQVMDDLDCSVLCCLLSELRPVEIIKPANMLSPETERAILRHTRNPLVNDLVPLSEFWDAETTVLEIKNIYNRITAESLNKADSNVANSQAEGDGLTCLPGILSELISTGDSGSQVLSALGGTLFYLKKSFLDETLLRFAKFELLPCSGFGDMAKKPYMVLDAPALENLEVFENSRSGDSSGTLYAQLNHCVTAFGKRLLRTWLARPLYNSGLIRERQDAVAGLRGVNQPFALEFRKALSRLPDMERLLARLFASSEANGRNSNKVVLYEDAAKKQLQEFISALHGCELMDQACSSLGAILENTESRQLHHILTPGKGLPAIVSILKHFKDAFDWVEANNSGRIIPHGGVDMDYDSACKKVKEIEASLTKHLKEQRKLLGDTSITYVTIGKDLYLLEVPESLRGSVPRDYELRSSKKGFFRYWTPNIKKLLGE***********LKSILQRLIGQFCEHHNKWRQMVAATAELDALISLAIASDFYEGPTCRPVILDSCSNEEPYISAKSLGHPVLRSDSLGKGEFVPNDITIGGHGNASFILLTGPNMGGKSTLLRQVCLAVILAQVGADVPAEIFEISPVDRIFVRMGAKDHIMAGQSTFLTELSETALMLSSATRNSLVVLDELGRG***********
***************************************************************************************************SYGEDVLRKRIRVYWPLDKAWYEGCVKSFDKECNKHLVQYDDGEDELLDLGKEKIEWVQESVSLLKRLRRDSFKK**VE*********************************************************************************************************FSAREAD**HFLGPD*****RRRPGDVYYDPRTLYLPPDFLRNLSEGQKQWWEFKSKHMDKVIFFKMGKFYELFEMDAHVGAKELDLQYMKGEQPHCGFPERNFSMNVEKLARKGYRVLVVEQTETPEQLELRRKEKGSKDKVVKREICAVVTKGTLTEGELLSANPDASYLMALTESNQSPASQSTDRCFGICVVDVATSRIILGQVMDDLDCSVLCCLLSELRPVEIIKPANMLSPETERAILRHTRNPLVNDLVPLSEFWDAETTVLEIKNIYNRITAESLNKADSNVANSQAEGDGLTCLPGILSELISTGDSGSQVLSALGGTLFYLKKSFLDETLLRFAKFELLPCSGFGDMAKKPYMVLDAPALENLEVFENSRSGDSSGTLYAQLNHCVTAFGKRLLRTWLARPLYNSGLIRERQDAVAGLRGVNQPFALEFRKALSRLPDMERLLARLFASSEANGRNSNKVVLYEDAAKKQLQEFISALHGCELMDQACSSLGAILENTESRQLHHILTPGKGLPAIVSILKHFKDAFDWVEANNSGRIIPHGGVDMDYDSACKKVKEIEASLTKHLKEQRKLLGDTSITYVTIGKDLYLLEVPESLRGSVPRDYELRSSKKGFFRYWTPNIKKLLGELSQAESEKESALKSILQRLIGQFCEHHNKWRQMVAATAELDALISLAIASDFYEGPTCRPVILDSCSNEEPYISAKSLGHPVLRSDSLGKGEFVPNDITIGGHGNASFILLTGPNMGGKSTLLRQVCLAVILAQVGADVPAEIFEISPVDRIFVRMGAKDHIMAGQSTFLTELSETALMLSSATRNSLVVLDELGRGTS*********
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAPGKRQNNGRSPLVNPQRQITSFFSKSNSPSPSPTISKLNPNKSNSNPNPNPNSNSNRTPSPSPSPTTPSPLQSNPKKSRLVIGQTPSPPPSTPAAAKSYGEDVLRKRIRVYWPLDKAWYEGCVKSFDKECNKHLVQYDDGEDELLDLGKEKIEWVQESVSLLKRLRRDSFKKVVVEDDEEMENVEDEISDDRSDSSDDDWNKNVGKEDVSEDEEVDLVDEQENKVLRGRKRKSSGVKKSKSDGNAVNADFKSPIIKPVKIFGSDKLSNGFDNPVMGDVSERFSAREADKFHFLGPDRRDAKRRRPGDVYYDPRTLYLPPDFLRNLSEGQKQWWEFKSKHMDKVIFFKMGKFYELFEMDAHVGAKELDLQYMKGEQPHCGFPERNFSMNVEKLARKGYRVLVVEQTETPEQLELRRKEKGSKDKVVKREICAVVTKGTLTEGELLSANPDASYLMALTESNQSPASQSTDRCFGICVVDVATSRIILGQVMDDLDCSVLCCLLSELRPVEIIKPANMLSPETERAILRHTRNPLVNDLVPLSEFWDAETTVLEIKNIYNRITAESLNKADSNVANSQAEGDGLTCLPGILSELISTGDSGSQVLSALGGTLFYLKKSFLDETLLRFAKFELLPCSGFGDMAKKPYMVLDAPALENLEVFENSRSGDSSGTLYAQLNHCVTAFGKRLLRTWLARPLYNSGLIRERQDAVAGLRGVNQPFALEFRKALSRLPDMERLLARLFASSEANGRNSNKVVLYEDAAKKQLQEFISALHGCELMDQACSSLGAILENTESRQLHHILTPGKGLPAIVSILKHFKDAFDWVEANNSGRIIPHGGVDMDYDSACKKVKEIEASLTKHLKEQRKLLGDTSITYVTIGKDLYLLEVPESLRGSVPRDYELRSSKKGFFRYWTPNxxxxxxxxxxxxxxxxxxxxxILQRLIGQFCEHHNKWRQMVAATAELDALISLAIASDFYEGPTCRPVILDSCSNEEPYISAKSLGHPVLRSDSLGKGEFVPNDITIGGHGNASFILLTGPNMGGKSTLLRQVCLAVILAQVGADVPAEIFEISPVDRIFVRMGAKDHIMAGQSTFLTELSETALMLSSATRNSLVVLDELGRGTSTSDGQAIAS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query1129 2.2.26 [Sep-21-2011]
O04716 1324 DNA mismatch repair prote yes no 0.992 0.845 0.650 0.0
P54276 1358 DNA mismatch repair prote yes no 0.836 0.695 0.374 1e-169
P52701 1360 DNA mismatch repair prote yes no 0.818 0.679 0.373 1e-165
Q9VUM0 1190 Probable DNA mismatch rep yes no 0.706 0.670 0.363 1e-134
O74502 1254 DNA mismatch repair prote yes no 0.787 0.708 0.326 1e-122
Q55GU9 1260 DNA mismatch repair prote yes no 0.674 0.604 0.331 1e-121
Q03834 1242 DNA mismatch repair prote yes no 0.701 0.637 0.321 1e-118
P20585 1137 DNA mismatch repair prote no no 0.652 0.648 0.277 9e-74
Q4P6I8 1154 DNA mismatch repair prote N/A no 0.664 0.649 0.282 1e-70
Q8RA71 869 DNA mismatch repair prote yes no 0.608 0.790 0.298 5e-69
>sp|O04716|MSH6_ARATH DNA mismatch repair protein MSH6 OS=Arabidopsis thaliana GN=MSH6 PE=1 SV=2 Back     alignment and function desciption
 Score = 1484 bits (3841), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 771/1185 (65%), Positives = 910/1185 (76%), Gaps = 65/1185 (5%)

Query: 1    MAPGKRQNNGRSPLVNPQRQITSFFSKSNSPSPSPTISKLNPNKSNSNP----------- 49
            MAP +RQ +GRSPLVN QRQITSFF KS S S SP+ S      +   P           
Sbjct: 1    MAPSRRQISGRSPLVNQQRQITSFFGKSASSSSSPSPSPSPSLSNKKTPKSNNPNPKSPS 60

Query: 50   ------------NPNPNSNSNRTPSPSPSPTTPSPLQSNPKKSRLVIGQTPSPPPSTPAA 97
                        NPNP+SN     SPSP P TPSP+QS  KK  LVIGQTPSPP S    
Sbjct: 61   PSPSPPKKTPKLNPNPSSNLP-ARSPSPGPDTPSPVQSKFKKPLLVIGQTPSPPQSV--- 116

Query: 98   AKSYGEDVLRKRIRVYWPLDKAWYEGCVKSFDKECNKHLVQYDDGEDELLDLGKEKIEWV 157
              +YG++V+ K++RVYWPLDK WY+G V  +DK   KH+V+Y+DGE+E LDLGKEK EWV
Sbjct: 117  VITYGDEVVGKQVRVYWPLDKKWYDGSVTFYDKGEGKHVVEYEDGEEESLDLGKEKTEWV 176

Query: 158  --QESVSLLKRLRR--DSFKKVVVE--DDEEMENVEDEISDDRSDSSDDDWNKNVGKEDV 211
              ++S     RL+R   + +KVV +  DD EM NVE++ SD    S +D W KNVGKE  
Sbjct: 177  VGEKSGDRFNRLKRGASALRKVVTDSDDDVEMGNVEEDKSDGDDSSDED-WGKNVGKEVC 235

Query: 212  -SEDEEVDLVDEQE-----------------NKVLR--GRKRKSS------GVKKSKSDG 245
             SE+++V+LVDE E                 N+V +   RKRK+S      G KKSK+D 
Sbjct: 236  ESEEDDVELVDENEMDEEELVEEKDEETSKVNRVSKTDSRKRKTSEVTKSGGEKKSKTDT 295

Query: 246  NAVNADFKSPIIKPVKIFG-SDKLSNGF-DNPVMGDVSERFSAREADKFHFLGPDRRDAK 303
              +   FK+ +++P K  G +D++  G  DN + GD   RF AR+++KF FLG DRRDAK
Sbjct: 296  GTILKGFKASVVEPAKKIGQADRVVKGLEDNVLDGDALARFGARDSEKFRFLGVDRRDAK 355

Query: 304  RRRPGDVYYDPRTLYLPPDFLRNLSEGQKQWWEFKSKHMDKVIFFKMGKFYELFEMDAHV 363
            RRRP D  YDPRTLYLPPDF++ L+ GQ+QWWEFK+KHMDKV+FFKMGKFYELFEMDAHV
Sbjct: 356  RRRPTDENYDPRTLYLPPDFVKKLTGGQRQWWEFKAKHMDKVVFFKMGKFYELFEMDAHV 415

Query: 364  GAKELDLQYMKGEQPHCGFPERNFSMNVEKLARKGYRVLVVEQTETPEQLELRRKEKGSK 423
            GAKELD+QYMKGEQPHCGFPE+NFS+N+EKL RKGYRVLVVEQTETP+QLE RRKE GSK
Sbjct: 416  GAKELDIQYMKGEQPHCGFPEKNFSVNIEKLVRKGYRVLVVEQTETPDQLEQRRKETGSK 475

Query: 424  DKVVKREICAVVTKGTLTEGELLSANPDASYLMALTESNQSPASQSTDRCFGICVVDVAT 483
            DKVVKRE+CAVVTKGTLT+GE+L  NPDASYLMALTE  +S  + + +  FG+C+VDVAT
Sbjct: 476  DKVVKREVCAVVTKGTLTDGEMLLTNPDASYLMALTEGGESLTNPTAEHNFGVCLVDVAT 535

Query: 484  SRIILGQVMDDLDCSVLCCLLSELRPVEIIKPANMLSPETERAILRHTRNPLVNDLVPLS 543
             +IILGQ  DD DCS L CLLSE+RPVEIIKPA +LS  TER I+R TRNPLVN+LVPLS
Sbjct: 536  QKIILGQFKDDQDCSALSCLLSEMRPVEIIKPAKVLSYATERTIVRQTRNPLVNNLVPLS 595

Query: 544  EFWDAETTVLEIKNIYNRITAESLNKADSNVANSQAEGDGLTCLPGILSELISTGDSGSQ 603
            EFWD+E T+ E+  IY RI  +    + +  +  +  GDG + LP +LSEL +   +GS 
Sbjct: 596  EFWDSEKTIYEVGIIYKRINCQP---SSAYSSEGKILGDGSSFLPKMLSELATEDKNGSL 652

Query: 604  VLSALGGTLFYLKKSFLDETLLRFAKFELLPCSGFGDMAKKPYMVLDAPALENLEVFENS 663
             LSALGG ++YL+++FLDE+LLRFAKFE LP   F ++ +K +MVLDA ALENLE+FENS
Sbjct: 653  ALSALGGAIYYLRQAFLDESLLRFAKFESLPYCDFSNVNEKQHMVLDAAALENLEIFENS 712

Query: 664  RSGDSSGTLYAQLNHCVTAFGKRLLRTWLARPLYNSGLIRERQDAVAGLRGVNQPFALEF 723
            R+G  SGTLYAQLN C+TA GKRLL+TWLARPLYN+ LI+ERQDAVA LRG N P++LEF
Sbjct: 713  RNGGYSGTLYAQLNQCITASGKRLLKTWLARPLYNTELIKERQDAVAILRGENLPYSLEF 772

Query: 724  RKALSRLPDMERLLARLFASSEANGRNSNKVVLYEDAAKKQLQEFISALHGCELMDQACS 783
            RK+LSRLPDMERL+AR+F+S EA+GRN +KVVLYED AKKQ+QEFIS L GCE M +ACS
Sbjct: 773  RKSLSRLPDMERLIARMFSSIEASGRNGDKVVLYEDTAKKQVQEFISTLRGCETMAEACS 832

Query: 784  SLGAILENTESRQLHHILTPGKGLPAIVSILKHFKDAFDWVEANNSGRIIPHGGVDMDYD 843
            SL AIL++  SR+L H+LTPG+ LP I S +K+FKDAFDWVEA+NSGR+IPH G D +YD
Sbjct: 833  SLRAILKHDTSRRLLHLLTPGQSLPNISSSIKYFKDAFDWVEAHNSGRVIPHEGADEEYD 892

Query: 844  SACKKVKEIEASLTKHLKEQRKLLGDTSITYVTIGKDLYLLEVPESLRGSVPRDYELRSS 903
             ACK V+E E+SL KHLKEQRKLLGD SI YVT+GKD YLLEVPESL GSVP DYEL SS
Sbjct: 893  CACKTVEEFESSLKKHLKEQRKLLGDASINYVTVGKDEYLLEVPESLSGSVPHDYELCSS 952

Query: 904  KKGFFRYWTPNIKKLLGELSQAESEKESALKSILQRLIGQFCEHHNKWRQMVAATAELDA 963
            KKG  RYWTP IKKLL ELSQA+SEKESALKSI QRLIG+FCEH  KWRQ+V+ATAELD 
Sbjct: 953  KKGVSRYWTPTIKKLLKELSQAKSEKESALKSISQRLIGRFCEHQEKWRQLVSATAELDV 1012

Query: 964  LISLAIASDFYEGPTCRPVILDSCSNEEPYISAKSLGHPVLRSDSLGKGEFVPNDITIGG 1023
            LISLA ASD YEG  CRPVI  S S+  P++SA  LGHPVLR DSLG+G FVPN++ IGG
Sbjct: 1013 LISLAFASDSYEGVRCRPVISGSTSDGVPHLSATGLGHPVLRGDSLGRGSFVPNNVKIGG 1072

Query: 1024 HGNASFILLTGPNMGGKSTLLRQVCLAVILAQVGADVPAEIFEISPVDRIFVRMGAKDHI 1083
               ASFILLTGPNMGGKSTLLRQVCLAVILAQ+GADVPAE FE+SPVD+I VRMGAKDHI
Sbjct: 1073 AEKASFILLTGPNMGGKSTLLRQVCLAVILAQIGADVPAETFEVSPVDKICVRMGAKDHI 1132

Query: 1084 MAGQSTFLTELSETALMLSSATRNSLVVLDELGRGTSTSDGQAIA 1128
            MAGQSTFLTELSETA+ML+SATRNSLVVLDELGRGT+TSDGQAIA
Sbjct: 1133 MAGQSTFLTELSETAVMLTSATRNSLVVLDELGRGTATSDGQAIA 1177




Involved in post-replicative DNA-mismatch repair.
Arabidopsis thaliana (taxid: 3702)
>sp|P54276|MSH6_MOUSE DNA mismatch repair protein Msh6 OS=Mus musculus GN=Msh6 PE=1 SV=3 Back     alignment and function description
>sp|P52701|MSH6_HUMAN DNA mismatch repair protein Msh6 OS=Homo sapiens GN=MSH6 PE=1 SV=2 Back     alignment and function description
>sp|Q9VUM0|MSH6_DROME Probable DNA mismatch repair protein Msh6 OS=Drosophila melanogaster GN=Msh6 PE=1 SV=2 Back     alignment and function description
>sp|O74502|MSH6_SCHPO DNA mismatch repair protein msh6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=msh6 PE=1 SV=1 Back     alignment and function description
>sp|Q55GU9|MSH6_DICDI DNA mismatch repair protein Msh6 OS=Dictyostelium discoideum GN=msh6 PE=3 SV=1 Back     alignment and function description
>sp|Q03834|MSH6_YEAST DNA mismatch repair protein MSH6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MSH6 PE=1 SV=1 Back     alignment and function description
>sp|P20585|MSH3_HUMAN DNA mismatch repair protein Msh3 OS=Homo sapiens GN=MSH3 PE=1 SV=4 Back     alignment and function description
>sp|Q4P6I8|MSH3_USTMA DNA mismatch repair protein MSH3 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=MSH3 PE=3 SV=1 Back     alignment and function description
>sp|Q8RA71|MUTS_THETN DNA mismatch repair protein MutS OS=Thermoanaerobacter tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=mutS PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1129
255548475 1306 ATP binding protein, putative [Ricinus c 0.995 0.860 0.729 0.0
224128348 1288 predicted protein [Populus trichocarpa] 0.964 0.845 0.692 0.0
225437545 1297 PREDICTED: DNA mismatch repair protein M 0.981 0.854 0.713 0.0
297743972 1237 unnamed protein product [Vitis vinifera] 0.931 0.850 0.692 0.0
356572787 1269 PREDICTED: DNA mismatch repair protein M 0.968 0.862 0.673 0.0
15235223 1324 DNA mismatch repair protein Msh6-1 [Arab 0.992 0.845 0.650 0.0
147861780 1349 hypothetical protein VITISV_032225 [Viti 0.988 0.827 0.663 0.0
297814117 1326 hypothetical protein ARALYDRAFT_912022 [ 0.992 0.844 0.647 0.0
334186287 1321 DNA mismatch repair protein Msh6-1 [Arab 0.989 0.845 0.648 0.0
2104549 1362 AGAA.3 [Arabidopsis thaliana] 0.992 0.822 0.632 0.0
>gi|255548475|ref|XP_002515294.1| ATP binding protein, putative [Ricinus communis] gi|223545774|gb|EEF47278.1| ATP binding protein, putative [Ricinus communis] Back     alignment and taxonomy information
 Score = 1616 bits (4185), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 840/1152 (72%), Positives = 946/1152 (82%), Gaps = 28/1152 (2%)

Query: 1    MAPGKRQNNGRSPLVNPQRQITSFFSKSNSPSPSPTISKLNPNKSNSNPNPNPNSNSNRT 60
            MAP ++ +NGRSPLVNPQRQITSFF K+ SPSPSP+ S    + + S      ++ +   
Sbjct: 1    MAPSRKPSNGRSPLVNPQRQITSFFCKTTSPSPSPSPSPSPAS-TLSKGQTPKSNPNPNP 59

Query: 61   PSPSPSPTTPSPLQSNPKKSRLVIGQTPSPPPSTP---AAAKSYGEDVLRKRIRVYWPLD 117
               SP PTTPSP+QS  KK  LVIG+TP+P PS       A S+G++V+ KR++VYWPLD
Sbjct: 60   KPSSPGPTTPSPVQSKTKKPLLVIGKTPTPSPSPSMPRVMANSFGKEVVEKRVKVYWPLD 119

Query: 118  KAWYEGCVKSFDKECNKHLVQYDDGEDELLDLGKEKIEWVQESVSLLKRLRRDS--FKKV 175
            K WYEGCVKS+D++  KHLVQYDD E+E+LDLG EKIEWV+ESV+  KRLRR S  FK  
Sbjct: 120  KTWYEGCVKSYDEDSGKHLVQYDDFEEEVLDLGNEKIEWVEESVTKFKRLRRGSLAFKNT 179

Query: 176  VVEDDEEMENV----EDEISDDRSDSSDDDWNKNVGKEDVSEDEEVDLVDEQENKVLRG- 230
            V+ED EEM++V    E+    D  DSSD+DW KNV K D+SEDE+ DL DE E    +G 
Sbjct: 180  VIED-EEMKDVADIEEENACVDGDDSSDEDWAKNVDK-DISEDEDADLEDEVEEDSYKGA 237

Query: 231  ----RKRKSSGVKKSKSD----GNAVNADFKSPIIKPVKIFGSDKLSNGFDN--PVMGDV 280
                RKRK  G K S       G+      K   I+PVK  G +   NG  N    + D 
Sbjct: 238  KSDSRKRKVYGAKASVKKKKSCGDVSEGAVKVSFIEPVKD-GGNGFCNGLGNGNASINDA 296

Query: 281  SERFSAREADKFHFLGPDRRDAKRRRPGDVYYDPRTLYLPPDFLRNLSEGQKQWWEFKSK 340
            SERFS REA+K  FLG +RRDAKR+RPGD  YDPRTLYLPP F+++LS GQ+QWWEFKSK
Sbjct: 297  SERFSMREAEKMWFLGAERRDAKRKRPGDADYDPRTLYLPPSFVKSLSGGQRQWWEFKSK 356

Query: 341  HMDKVIFFKMGKFYELFEMDAHVGAKELDLQYMKGEQPHCGFPERNFSMNVEKLARKGYR 400
            HMDKV+FFKMGKFYELFEMDAHVGAKELDLQYMKGEQPHCGFPER FSMNVEKL RKGYR
Sbjct: 357  HMDKVLFFKMGKFYELFEMDAHVGAKELDLQYMKGEQPHCGFPERIFSMNVEKLTRKGYR 416

Query: 401  VLVVEQTETPEQLELRRKEKGSKDKVVKREICAVVTKGTLTEGELLSANPDASYLMALTE 460
            VLV+EQTETPEQLELRRKEKGSKDKVVKREICAVVTKGTLTEGELL+ANPDASYLMA+TE
Sbjct: 417  VLVIEQTETPEQLELRRKEKGSKDKVVKREICAVVTKGTLTEGELLTANPDASYLMAVTE 476

Query: 461  SNQSPASQSTDRCFGICVVDVATSRIILGQVMDDLDCSVLCCLLSELRPVEIIKPANMLS 520
            S Q+   Q+ +  FGICV DVATSRIILGQ +DD +CS LC LLSELRPVEIIKPA  LS
Sbjct: 477  SQQNLEGQNFEPTFGICVADVATSRIILGQFVDDSECSSLCRLLSELRPVEIIKPAKSLS 536

Query: 521  PETERAILRHTRNPLVNDLVPLSEFWDAETTVLEIKNIYNRIT----AESLNKADSNVAN 576
             ETER +LRHTRNPLVNDLVPLSEFWDAE TV E+K IY  I+    + SLNK D + AN
Sbjct: 537  SETERLLLRHTRNPLVNDLVPLSEFWDAEKTVHEVKIIYKHISDQSASRSLNKEDKDTAN 596

Query: 577  SQAEGDGLTCLPGILSELISTGDSGSQVLSALGGTLFYLKKSFLDETLLRFAKFELLPCS 636
             Q   +G +CLP IL EL++ GD+G   LSALGGTL+YLK++FLDETLLRFAKFE LPCS
Sbjct: 597  LQFTEEGPSCLPEILLELVNKGDNGRLALSALGGTLYYLKQAFLDETLLRFAKFESLPCS 656

Query: 637  GFGDMAKKPYMVLDAPALENLEVFENSRSGDSSGTLYAQLNHCVTAFGKRLLRTWLARPL 696
             F D+A+KPYM+LDA ALENLE+FENSR+G  SGTLYAQLNHCVTAFGKRLL+TWLARPL
Sbjct: 657  DFCDVAQKPYMILDAAALENLEIFENSRNGGLSGTLYAQLNHCVTAFGKRLLKTWLARPL 716

Query: 697  YNSGLIRERQDAVAGLRGVNQPFALEFRKALSRLPDMERLLARLFASSEANGRNSNKVVL 756
            Y+   I +RQDAVAGLRGVNQP  LEFRKALSRLPDMERL+AR+FASSEANGRN+NKV+L
Sbjct: 717  YHLRSIVDRQDAVAGLRGVNQPATLEFRKALSRLPDMERLIARIFASSEANGRNANKVIL 776

Query: 757  YEDAAKKQLQEFISALHGCELMDQACSSLGAILENTESRQLHHILTPGKGLPAIVSILKH 816
            YEDAAKK LQEFISAL GCELM+QACSSL  ILEN ESRQLHH+LTPGK  P I SILKH
Sbjct: 777  YEDAAKKLLQEFISALRGCELMEQACSSLAVILENVESRQLHHLLTPGKSRPHIHSILKH 836

Query: 817  FKDAFDWVEANNSGRIIPHGGVDMDYDSACKKVKEIEASLTKHLKEQRKLLGDTSITYVT 876
            FK+AFDWVEANNSGR+IPH GVD++YDSAC+K++ IE+SLTKHLKEQ+K+LGD SI YVT
Sbjct: 837  FKEAFDWVEANNSGRVIPHEGVDIEYDSACEKLRVIESSLTKHLKEQQKILGDKSIMYVT 896

Query: 877  IGKDLYLLEVPESLRGSVPRDYELRSSKKGFFRYWTPNIKKLLGELSQAESEKESALKSI 936
            +GK+ YLLEVPE  RGS+PRDYELRSSKKGF+RYWTP+IKKLLGELSQAESEKE ALK+I
Sbjct: 897  VGKEAYLLEVPEHFRGSIPRDYELRSSKKGFYRYWTPSIKKLLGELSQAESEKELALKNI 956

Query: 937  LQRLIGQFCEHHNKWRQMVAATAELDALISLAIASDFYEGPTCRPVILDSCSNEEPYISA 996
            LQRLI QFCEHH+KWRQ+ +ATAELD LISLAIASDFYEG  CRPVIL S S+E P  SA
Sbjct: 957  LQRLIVQFCEHHDKWRQLNSATAELDVLISLAIASDFYEGQACRPVILGSSSSEMPCFSA 1016

Query: 997  KSLGHPVLRSDSLGKGEFVPNDITIGGHGNASFILLTGPNMGGKSTLLRQVCLAVILAQV 1056
            KSLGHP+L+SDSLGKG FVPND++IGG   ASFILLTGPNMGGKSTLLRQVCLAVILAQV
Sbjct: 1017 KSLGHPILKSDSLGKGAFVPNDVSIGGSDGASFILLTGPNMGGKSTLLRQVCLAVILAQV 1076

Query: 1057 GADVPAEIFEISPVDRIFVRMGAKDHIMAGQSTFLTELSETALMLSSATRNSLVVLDELG 1116
            GADVPAE FE+SPVDRIFVRMGAKDHIMAGQSTFLTELSETALMLSSATRNSLV LDELG
Sbjct: 1077 GADVPAESFELSPVDRIFVRMGAKDHIMAGQSTFLTELSETALMLSSATRNSLVTLDELG 1136

Query: 1117 RGTSTSDGQAIA 1128
            RGTSTSDGQAIA
Sbjct: 1137 RGTSTSDGQAIA 1148




Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|224128348|ref|XP_002320307.1| predicted protein [Populus trichocarpa] gi|222861080|gb|EEE98622.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|225437545|ref|XP_002275930.1| PREDICTED: DNA mismatch repair protein Msh6-1-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|297743972|emb|CBI36942.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|356572787|ref|XP_003554547.1| PREDICTED: DNA mismatch repair protein Msh6-1-like [Glycine max] Back     alignment and taxonomy information
>gi|15235223|ref|NP_192116.1| DNA mismatch repair protein Msh6-1 [Arabidopsis thaliana] gi|6226648|sp|O04716.2|MSH6_ARATH RecName: Full=DNA mismatch repair protein MSH6; Short=AtMSH6; AltName: Full=MutS protein homolog 6 gi|3912921|gb|AAC78699.1| G/T DNA mismatch repair enzyme [Arabidopsis thaliana] gi|5763966|emb|CAB53337.1| mismatch repair protein msh6-1 [Arabidopsis thaliana] gi|7268591|emb|CAB80700.1| G/T DNA mismatch repair enzyme [Arabidopsis thaliana] gi|332656719|gb|AEE82119.1| DNA mismatch repair protein Msh6-1 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|147861780|emb|CAN78918.1| hypothetical protein VITISV_032225 [Vitis vinifera] Back     alignment and taxonomy information
>gi|297814117|ref|XP_002874942.1| hypothetical protein ARALYDRAFT_912022 [Arabidopsis lyrata subsp. lyrata] gi|297320779|gb|EFH51201.1| hypothetical protein ARALYDRAFT_912022 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|334186287|ref|NP_001190656.1| DNA mismatch repair protein Msh6-1 [Arabidopsis thaliana] gi|332656720|gb|AEE82120.1| DNA mismatch repair protein Msh6-1 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|2104549|gb|AAB57798.1| AGAA.3 [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1129
TAIR|locus:2132233 1324 MSH6 "AT4G02070" [Arabidopsis 0.774 0.660 0.706 0.0
ZFIN|ZDB-GENE-020905-3 1369 msh6 "mutS homolog 6 (E. coli) 0.437 0.360 0.348 1.2e-140
RGD|2322311 1361 Msh6 "mutS homolog 6 (E. coli) 0.632 0.524 0.376 2.5e-120
FB|FBgn0036486 1190 Msh6 "Msh6" [Drosophila melano 0.709 0.673 0.354 6.7e-120
MGI|MGI:1343961 1358 Msh6 "mutS homolog 6 (E. coli) 0.636 0.529 0.370 1.1e-119
UNIPROTKB|E1BWV7 1357 MSH6 "Uncharacterized protein" 0.639 0.532 0.367 2.3e-119
UNIPROTKB|E1BYJ2 1341 MSH6 "Uncharacterized protein" 0.639 0.538 0.367 2.3e-119
WB|WBGene00003422 1186 msh-6 [Caenorhabditis elegans 0.740 0.704 0.331 7.9e-117
UNIPROTKB|Q9N3T8 1186 msh-6 "Protein MSH-6" [Caenorh 0.740 0.704 0.331 7.9e-117
ASPGD|ASPL0000041666 1186 mshA [Emericella nidulans (tax 0.330 0.314 0.379 6.1e-114
TAIR|locus:2132233 MSH6 "AT4G02070" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 3177 (1123.4 bits), Expect = 0., Sum P(3) = 0.
 Identities = 621/879 (70%), Positives = 721/879 (82%)

Query:   252 FKSPIIKPVKIFG-SDKLSNGF-DNPVMGDVSERFSAREADKFHFLGPDRRDAKRRRPGD 309
             FK+ +++P K  G +D++  G  DN + GD   RF AR+++KF FLG DRRDAKRRRP D
Sbjct:   302 FKASVVEPAKKIGQADRVVKGLEDNVLDGDALARFGARDSEKFRFLGVDRRDAKRRRPTD 361

Query:   310 VYYDPRTLYLPPDFLRNLSEGQKQWWEFKSKHMDKVIFFKMGKFYELFEMDAHVGAKELD 369
               YDPRTLYLPPDF++ L+ GQ+QWWEFK+KHMDKV+FFKMGKFYELFEMDAHVGAKELD
Sbjct:   362 ENYDPRTLYLPPDFVKKLTGGQRQWWEFKAKHMDKVVFFKMGKFYELFEMDAHVGAKELD 421

Query:   370 LQYMKGEQPHCGFPERNFSMNVEKLARKGYRVLVVEQTETPEQLELRRKEKGSKDKVVKR 429
             +QYMKGEQPHCGFPE+NFS+N+EKL RKGYRVLVVEQTETP+QLE RRKE GSKDKVVKR
Sbjct:   422 IQYMKGEQPHCGFPEKNFSVNIEKLVRKGYRVLVVEQTETPDQLEQRRKETGSKDKVVKR 481

Query:   430 EICAVVTKGTLTEGELLSANPDASYLMALTESNQSPASQSTDRCFGICVVDVATSRIILG 489
             E+CAVVTKGTLT+GE+L  NPDASYLMALTE  +S  + + +  FG+C+VDVAT +IILG
Sbjct:   482 EVCAVVTKGTLTDGEMLLTNPDASYLMALTEGGESLTNPTAEHNFGVCLVDVATQKIILG 541

Query:   490 QVMXXXXXXXXXXXXXXXRPVEIIKPANMLSPETERAILRHTRNPLVNDLVPLSEFWDAE 549
             Q                 RPVEIIKPA +LS  TER I+R TRNPLVN+LVPLSEFWD+E
Sbjct:   542 QFKDDQDCSALSCLLSEMRPVEIIKPAKVLSYATERTIVRQTRNPLVNNLVPLSEFWDSE 601

Query:   550 TTVLEIKNIYNRITAESLNKADSNVANSQAEGDGLTCLPGILSELISTGDSGSQVLSALG 609
              T+ E+  IY RI  +  +   S     +  GDG + LP +LSEL +   +GS  LSALG
Sbjct:   602 KTIYEVGIIYKRINCQPSSAYSSE---GKILGDGSSFLPKMLSELATEDKNGSLALSALG 658

Query:   610 GTLFYLKKSFLDETLLRFAKFELLPCSGFGDMAKKPYMVLDAPALENLEVFENSRSGDSS 669
             G ++YL+++FLDE+LLRFAKFE LP   F ++ +K +MVLDA ALENLE+FENSR+G  S
Sbjct:   659 GAIYYLRQAFLDESLLRFAKFESLPYCDFSNVNEKQHMVLDAAALENLEIFENSRNGGYS 718

Query:   670 GTLYAQLNHCVTAFGKRLLRTWLARPLYNSGLIRERQDAVAGLRGVNQPFALEFRKALSR 729
             GTLYAQLN C+TA GKRLL+TWLARPLYN+ LI+ERQDAVA LRG N P++LEFRK+LSR
Sbjct:   719 GTLYAQLNQCITASGKRLLKTWLARPLYNTELIKERQDAVAILRGENLPYSLEFRKSLSR 778

Query:   730 LPDMERLLARLFASSEANGRNSNKVVLYEDAAKKQLQEFISALHGCELMDQACSSLGAIL 789
             LPDMERL+AR+F+S EA+GRN +KVVLYED AKKQ+QEFIS L GCE M +ACSSL AIL
Sbjct:   779 LPDMERLIARMFSSIEASGRNGDKVVLYEDTAKKQVQEFISTLRGCETMAEACSSLRAIL 838

Query:   790 ENTESRQLHHILTPGKGLPAIVSILKHFKDAFDWVEANNSGRIIPHGGVDMDYDSACKKV 849
             ++  SR+L H+LTPG+ LP I S +K+FKDAFDWVEA+NSGR+IPH G D +YD ACK V
Sbjct:   839 KHDTSRRLLHLLTPGQSLPNISSSIKYFKDAFDWVEAHNSGRVIPHEGADEEYDCACKTV 898

Query:   850 KEIEASLTKHLKEQRKLLGDTSITYVTIGKDLYLLEVPESLRGSVPRDYELRSSKKGFFR 909
             +E E+SL KHLKEQRKLLGD SI YVT+GKD YLLEVPESL GSVP DYEL SSKKG  R
Sbjct:   899 EEFESSLKKHLKEQRKLLGDASINYVTVGKDEYLLEVPESLSGSVPHDYELCSSKKGVSR 958

Query:   910 YWTPNIKKLLGELSQAESEKESALKSILQRLIGQFCEHHNKWRQMVAATAELDALISLAI 969
             YWTP IKKLL ELSQA+SEKESALKSI QRLIG+FCEH  KWRQ+V+ATAELD LISLA 
Sbjct:   959 YWTPTIKKLLKELSQAKSEKESALKSISQRLIGRFCEHQEKWRQLVSATAELDVLISLAF 1018

Query:   970 ASDFYEGPTCRPVILDSCSNEEPYISAKSLGHPVLRSDSLGKGEFVPNDITIGGHGNASF 1029
             ASD YEG  CRPVI  S S+  P++SA  LGHPVLR DSLG+G FVPN++ IGG   ASF
Sbjct:  1019 ASDSYEGVRCRPVISGSTSDGVPHLSATGLGHPVLRGDSLGRGSFVPNNVKIGGAEKASF 1078

Query:  1030 ILLTGPNMGGKSTLLRQVCLAVILAQVGADVPAEIFEISPVDRIFVRMGAKDHIMAGQST 1089
             ILLTGPNMGGKSTLLRQVCLAVILAQ+GADVPAE FE+SPVD+I VRMGAKDHIMAGQST
Sbjct:  1079 ILLTGPNMGGKSTLLRQVCLAVILAQIGADVPAETFEVSPVDKICVRMGAKDHIMAGQST 1138

Query:  1090 FLTELSETALMLSSATRNSLVVLDELGRGTSTSDGQAIA 1128
             FLTELSETA+ML+SATRNSLVVLDELGRGT+TSDGQAIA
Sbjct:  1139 FLTELSETAVMLTSATRNSLVVLDELGRGTATSDGQAIA 1177


GO:0000228 "nuclear chromosome" evidence=IBA
GO:0000400 "four-way junction DNA binding" evidence=IBA
GO:0000710 "meiotic mismatch repair" evidence=IBA
GO:0005634 "nucleus" evidence=ISM
GO:0006200 "ATP catabolic process" evidence=IBA
GO:0006298 "mismatch repair" evidence=IEA;ISS
GO:0007131 "reciprocal meiotic recombination" evidence=IBA
GO:0008094 "DNA-dependent ATPase activity" evidence=IBA
GO:0009411 "response to UV" evidence=IBA
GO:0032137 "guanine/thymine mispair binding" evidence=IBA
GO:0032138 "single base insertion or deletion binding" evidence=IBA
GO:0032301 "MutSalpha complex" evidence=IBA
GO:0043570 "maintenance of DNA repeat elements" evidence=IBA
GO:0045910 "negative regulation of DNA recombination" evidence=IBA
GO:0003684 "damaged DNA binding" evidence=IDA
GO:0005515 "protein binding" evidence=IPI
GO:0006290 "pyrimidine dimer repair" evidence=IMP
GO:0006261 "DNA-dependent DNA replication" evidence=RCA
GO:0006270 "DNA replication initiation" evidence=RCA
GO:0006275 "regulation of DNA replication" evidence=RCA
GO:0048451 "petal formation" evidence=RCA
GO:0048453 "sepal formation" evidence=RCA
GO:0051726 "regulation of cell cycle" evidence=RCA
ZFIN|ZDB-GENE-020905-3 msh6 "mutS homolog 6 (E. coli)" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
RGD|2322311 Msh6 "mutS homolog 6 (E. coli)" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
FB|FBgn0036486 Msh6 "Msh6" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
MGI|MGI:1343961 Msh6 "mutS homolog 6 (E. coli)" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|E1BWV7 MSH6 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|E1BYJ2 MSH6 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
WB|WBGene00003422 msh-6 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
UNIPROTKB|Q9N3T8 msh-6 "Protein MSH-6" [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
ASPGD|ASPL0000041666 mshA [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
O04716MSH6_ARATHNo assigned EC number0.65060.99200.8459yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
eugene3.00140670
hypothetical protein (1288 aa)
(Populus trichocarpa)
Predicted Functional Partners:
eugene3.00120511
hypothetical protein (944 aa)
   0.798
gw1.XIX.1944.1
annotation not avaliable (727 aa)
    0.688
gw1.V.2541.1
hypothetical protein (1081 aa)
     0.597
estExt_Genewise1_v1.C_LG_I1046
proliferating cell nuclear antigen (PCNA); This protein is an auxiliary protein of DNA polymera [...] (268 aa)
     0.527
estExt_Genewise1_v1.C_LG_IX3930
proliferating cell nuclear antigen (PCNA); This protein is an auxiliary protein of DNA polymera [...] (265 aa)
     0.519
fgenesh4_pg.C_scaffold_15300000001
Predicted protein (342 aa)
       0.502
eugene3.00660007
hypothetical protein (2222 aa)
     0.436
eugene3.07100002
annotation not avaliable (68 aa)
       0.431
eugene3.00140751
SubName- Full=Putative uncharacterized protein; (915 aa)
     0.423

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1129
COG0249 843 COG0249, MutS, Mismatch repair ATPase (MutS family 1e-150
PRK05399 854 PRK05399, PRK05399, DNA mismatch repair protein Mu 1e-126
TIGR01070 840 TIGR01070, mutS1, DNA mismatch repair protein MutS 7e-95
smart00533308 smart00533, MUTSd, DNA-binding domain of DNA misma 3e-61
pfam00488235 pfam00488, MutS_V, MutS domain V 5e-59
cd03286218 cd03286, ABC_MSH6_euk, ATP-binding cassette domain 4e-58
pfam05192290 pfam05192, MutS_III, MutS domain III 8e-55
smart00534185 smart00534, MUTSac, ATPase domain of DNA mismatch 2e-52
cd03284216 cd03284, ABC_MutS1, ATP-binding cassette domain of 5e-51
cd03243202 cd03243, ABC_MutS_homologs, ATP-binding cassette d 1e-50
cd03285222 cd03285, ABC_MSH2_euk, ATP-binding cassette domain 4e-41
cd03287222 cd03287, ABC_MSH3_euk, ATP-binding cassette domain 2e-40
pfam01624113 pfam01624, MutS_I, MutS domain I 1e-39
cd03281213 cd03281, ABC_MSH5_euk, ATP-binding cassette domain 1e-37
cd03282204 cd03282, ABC_MSH4_euk, ATP-binding cassette domain 7e-34
cd03283199 cd03283, ABC_MutS-like, ATP-binding cassette domai 2e-25
cd03280200 cd03280, ABC_MutS2, ATP-binding cassette domain of 1e-22
TIGR01069 771 TIGR01069, mutS2, MutS2 family protein 1e-21
cd03227162 cd03227, ABC_Class2, ATP-binding cassette domain o 1e-21
pfam0519092 pfam05190, MutS_IV, MutS family domain IV 3e-19
PRK00409 782 PRK00409, PRK00409, recombination and DNA strand e 4e-18
COG1193 753 COG1193, COG1193, Mismatch repair ATPase (MutS fam 5e-15
cd00267157 cd00267, ABC_ATPase, ATP-binding cassette transpor 5e-07
pfam05188133 pfam05188, MutS_II, MutS domain II 3e-04
>gnl|CDD|223327 COG0249, MutS, Mismatch repair ATPase (MutS family) [DNA replication, recombination, and repair] Back     alignment and domain information
 Score =  470 bits (1211), Expect = e-150
 Identities = 248/803 (30%), Positives = 365/803 (45%), Gaps = 111/803 (13%)

Query: 332  KQWWEFKSKHMDKVIFFKMGKFYELFEMDAHVGAKELDL-QYMKGEQPHCGFPERNFSMN 390
            +Q+ E K+++ D ++FF+MG FYELF  DA + A+ LD+    +G  P  G P       
Sbjct: 11   QQYLEIKAQYPDTLLFFRMGDFYELFFEDAKIAARLLDITLTKRGNIPMAGVPYHALDYY 70

Query: 391  VEKLARKGYRVLVVEQTETPEQLELRRKEKGSKDKVVKREICAVVTKGTLTEGELLSANP 450
            + KL   GY+V + EQ E P               VV+R++  VVT GTLT+  LLS   
Sbjct: 71   LAKLIELGYKVAICEQLEDP----------AEAKGVVERKVVRVVTPGTLTDEALLSDR- 119

Query: 451  DASYLMALTESNQSPASQSTDRCFGICVVDVATSRIILGQVMDDLDCSVLCCLLSEL--- 507
            + +YL AL        +   D   G+  +D++T    + +   +        LLSEL   
Sbjct: 120  ENNYLAAL--------AIDRDGKVGLAFIDLSTGEFFVSEFEREK-------LLSELKRL 164

Query: 508  RPVEIIKPANMLSPETERAILRHTRNPLVNDLVPLSEFWDAETTVLEIKNIYNRITAESL 567
            +P E++   ++LS              L     P S F D +     +   +        
Sbjct: 165  QPKELLLSESLLSSTLAEIQKGLFVVRL-----PASFF-DEDDAEEILSEYF-------- 210

Query: 568  NKADSNVANSQAEGDGLTCLPGILSELISTGDSGSQVLSALGGTLFYLKKSFLDETL-LR 626
                                 G+         S    LSA G  L YLK +       ++
Sbjct: 211  ---------------------GVRDLDGFGLISTPLALSAAGALLSYLKDTQKTFLPHIQ 249

Query: 627  FAKFELLPCSGFGDMAKKPYMVLDAPALENLEVFENSRSGDSSGTLYAQLNHCVTAFGKR 686
              +   L          + YMVLDA    NLE+F N R     G+L+  L+  VT  G R
Sbjct: 250  IIQRYDL----------EDYMVLDAATRRNLELFSNLRGNGKKGSLFWLLDRTVTPMGSR 299

Query: 687  LLRTWLARPLYNSGLIRERQDAVAGLRGVNQPFALE-FRKALSRLPDMERLLARLFASSE 745
            LL+ WL +PL +   I ER DAV  L   + P   E  R+ L ++PD+ERLL+RL     
Sbjct: 300  LLKRWLLQPLLDKEEIEERLDAVEEL--KDNPELREKLREMLKKVPDLERLLSRL----- 352

Query: 746  ANGRNSNKVVLYEDAAKKQLQEFISALHGCELMDQACSSLGAILENTESRQLHHILTPGK 805
            + GR S + +L       +L++ +  +   E+                   L  +L   +
Sbjct: 353  SLGRASPRDLL-------RLRDSLEKIP--EIFKLL-------SSLKSESDLLLLLEDIE 396

Query: 806  GLPAIVSILKHFKDAFDWVEANNSGRIIPHGGVDMDYDSACKKVKEIEASLTKHLKEQRK 865
             L  +  +L+  + A +          I   G +++ D     +   +  + K   E+R+
Sbjct: 397  SLDYLAELLELLETAINEDPPLAVRDGIIKEGYNIELDELRDLLNNAKEWIAKLELEERE 456

Query: 866  LLGDTSITYVTIGKDLYLLEVPESLRGSVPRDYELRSSKKGFFRYWTPNIKKLLGELSQA 925
              G  S+         Y +EV +S    VP DY  R + K   R+ TP +K+L  +L  A
Sbjct: 457  RTGIKSLKIKYNKVYGYYIEVTKSNAKLVPDDYIRRQTLKNAERFTTPELKELEEKLLDA 516

Query: 926  ESEKESALKSILQRLIGQFCEHHNKWRQMVAATAELDALISLAIASDFYEGPTCRPVILD 985
            E +  +    +   L  +   H N+ + +  A AELD L SLA  +        RP    
Sbjct: 517  EEKILALEYELFDELREKILAHINELQALAKALAELDVLSSLAEIAAEQ--NYVRPEF-- 572

Query: 986  SCSNEEPYISAKSLGHPVLRSDSLGKGEFVPNDITIGGHGNASFILLTGPNMGGKSTLLR 1045
                +   +  K   HPV+  +++    FVPNDI + G+     IL+TGPNMGGKST LR
Sbjct: 573  ---VDSNDLEIKEGRHPVV--EAVLDNGFVPNDIDLSGNRR--IILITGPNMGGKSTYLR 625

Query: 1046 QVCLAVILAQVGADVPAEIFEISPVDRIFVRMGAKDHIMAGQSTFLTELSETALMLSSAT 1105
            QV L VILAQ+G+ VPAE   I  VDRIF R+GA D + +G+STF+ E+ ETA +L +AT
Sbjct: 626  QVALIVILAQIGSFVPAEKARIGIVDRIFTRIGAADDLASGRSTFMVEMLETANILDNAT 685

Query: 1106 RNSLVVLDELGRGTSTSDGQAIA 1128
              SLV+LDE+GRGTST DG AIA
Sbjct: 686  ERSLVILDEIGRGTSTYDGLAIA 708


Length = 843

>gnl|CDD|235444 PRK05399, PRK05399, DNA mismatch repair protein MutS; Provisional Back     alignment and domain information
>gnl|CDD|233259 TIGR01070, mutS1, DNA mismatch repair protein MutS Back     alignment and domain information
>gnl|CDD|214710 smart00533, MUTSd, DNA-binding domain of DNA mismatch repair MUTS family Back     alignment and domain information
>gnl|CDD|215944 pfam00488, MutS_V, MutS domain V Back     alignment and domain information
>gnl|CDD|213253 cd03286, ABC_MSH6_euk, ATP-binding cassette domain of eukaryotic MutS6 homolog Back     alignment and domain information
>gnl|CDD|218489 pfam05192, MutS_III, MutS domain III Back     alignment and domain information
>gnl|CDD|197777 smart00534, MUTSac, ATPase domain of DNA mismatch repair MUTS family Back     alignment and domain information
>gnl|CDD|213251 cd03284, ABC_MutS1, ATP-binding cassette domain of MutS1 homolog Back     alignment and domain information
>gnl|CDD|213210 cd03243, ABC_MutS_homologs, ATP-binding cassette domain of MutS homologs Back     alignment and domain information
>gnl|CDD|213252 cd03285, ABC_MSH2_euk, ATP-binding cassette domain of eukaryotic MutS2 homolog Back     alignment and domain information
>gnl|CDD|213254 cd03287, ABC_MSH3_euk, ATP-binding cassette domain of eukaryotic MutS3 homolog Back     alignment and domain information
>gnl|CDD|216613 pfam01624, MutS_I, MutS domain I Back     alignment and domain information
>gnl|CDD|213248 cd03281, ABC_MSH5_euk, ATP-binding cassette domain of eukaryotic MutS5 homolog Back     alignment and domain information
>gnl|CDD|213249 cd03282, ABC_MSH4_euk, ATP-binding cassette domain of eukaryotic MutS4 homolog Back     alignment and domain information
>gnl|CDD|213250 cd03283, ABC_MutS-like, ATP-binding cassette domain of MutS-like homolog Back     alignment and domain information
>gnl|CDD|213247 cd03280, ABC_MutS2, ATP-binding cassette domain of MutS2 Back     alignment and domain information
>gnl|CDD|130141 TIGR01069, mutS2, MutS2 family protein Back     alignment and domain information
>gnl|CDD|213194 cd03227, ABC_Class2, ATP-binding cassette domain of non-transporter proteins Back     alignment and domain information
>gnl|CDD|218487 pfam05190, MutS_IV, MutS family domain IV Back     alignment and domain information
>gnl|CDD|234750 PRK00409, PRK00409, recombination and DNA strand exchange inhibitor protein; Reviewed Back     alignment and domain information
>gnl|CDD|224114 COG1193, COG1193, Mismatch repair ATPase (MutS family) [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|213179 cd00267, ABC_ATPase, ATP-binding cassette transporter nucleotide-binding domain Back     alignment and domain information
>gnl|CDD|218486 pfam05188, MutS_II, MutS domain II Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 1129
KOG0217 1125 consensus Mismatch repair ATPase MSH6 (MutS family 100.0
TIGR01070 840 mutS1 DNA mismatch repair protein MutS. 100.0
PRK05399 854 DNA mismatch repair protein MutS; Provisional 100.0
COG0249 843 MutS Mismatch repair ATPase (MutS family) [DNA rep 100.0
KOG0218 1070 consensus Mismatch repair MSH3 [Replication, recom 100.0
KOG0219 902 consensus Mismatch repair ATPase MSH2 (MutS family 100.0
KOG0220 867 consensus Mismatch repair ATPase MSH4 (MutS family 100.0
KOG0221 849 consensus Mismatch repair ATPase MSH5 (MutS family 100.0
PRK00409 782 recombination and DNA strand exchange inhibitor pr 100.0
TIGR01069 771 mutS2 MutS2 family protein. Function of MutS2 is u 100.0
PF00488235 MutS_V: MutS domain V C-terminus.; InterPro: IPR00 100.0
smart00533308 MUTSd DNA-binding domain of DNA mismatch repair MU 100.0
COG1193 753 Mismatch repair ATPase (MutS family) [DNA replicat 100.0
cd03286218 ABC_MSH6_euk MutS6 homolog in eukaryotes. The MutS 100.0
cd03287222 ABC_MSH3_euk MutS3 homolog in eukaryotes. The MutS 99.97
PF01624113 MutS_I: MutS domain I C-terminus.; InterPro: IPR00 99.97
cd03285222 ABC_MSH2_euk MutS2 homolog in eukaryotes. The MutS 99.96
cd03281213 ABC_MSH5_euk MutS5 homolog in eukaryotes. The MutS 99.96
cd03282204 ABC_MSH4_euk MutS4 homolog in eukaryotes. The MutS 99.96
cd03284216 ABC_MutS1 MutS1 homolog in eukaryotes. The MutS pr 99.95
cd03280200 ABC_MutS2 MutS2 homologs in bacteria and eukaryote 99.92
PF05192204 MutS_III: MutS domain III C-terminus.; InterPro: I 99.91
cd03243202 ABC_MutS_homologs The MutS protein initiates DNA m 99.91
cd03283199 ABC_MutS-like MutS-like homolog in eukaryotes. The 99.9
smart00534185 MUTSac ATPase domain of DNA mismatch repair MUTS f 99.89
cd03227162 ABC_Class2 ABC-type Class 2 contains systems invol 99.74
PF05188137 MutS_II: MutS domain II; InterPro: IPR007860 Misma 99.37
PF0519092 MutS_IV: MutS family domain IV C-terminus.; InterP 99.3
PF0946555 LBR_tudor: Lamin-B receptor of TUDOR domain; Inter 99.12
COG1121254 ZnuC ABC-type Mn/Zn transport systems, ATPase comp 98.67
COG1131 293 CcmA ABC-type multidrug transport system, ATPase c 98.61
COG1120258 FepC ABC-type cobalamin/Fe3+-siderophores transpor 98.55
COG0411250 LivG ABC-type branched-chain amino acid transport 98.46
cd03214180 ABC_Iron-Siderophores_B12_Hemin ABC transporters, 98.42
TIGR01188 302 drrA daunorubicin resistance ABC transporter ATP-b 98.34
COG0410237 LivF ABC-type branched-chain amino acid transport 98.33
COG4152 300 ABC-type uncharacterized transport system, ATPase 98.31
PRK13537 306 nodulation ABC transporter NodI; Provisional 98.3
cd03216163 ABC_Carb_Monos_I This family represents the domain 98.3
PRK13536 340 nodulation factor exporter subunit NodI; Provision 98.29
COG4555245 NatA ABC-type Na+ transport system, ATPase compone 98.27
cd03230173 ABC_DR_subfamily_A This family of ATP-binding prot 98.26
cd03215182 ABC_Carb_Monos_II This family represents domain II 98.26
cd03238176 ABC_UvrA The excision repair protein UvrA; Nucleot 98.25
cd03221144 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is 98.24
cd03228171 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein 98.22
TIGR01166190 cbiO cobalt transport protein ATP-binding subunit. 98.22
cd03263220 ABC_subfamily_A The ABCA subfamily mediates the tr 98.21
TIGR03522 301 GldA_ABC_ATP gliding motility-associated ABC trans 98.2
cd03255218 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of 98.2
TIGR02673214 FtsE cell division ATP-binding protein FtsE. This 98.2
TIGR01288 303 nodI ATP-binding ABC transporter family nodulation 98.19
cd03265220 ABC_DrrA DrrA is the ATP-binding protein component 98.18
cd00267157 ABC_ATPase ABC (ATP-binding cassette) transporter 98.18
cd03269210 ABC_putative_ATPase This subfamily is involved in 98.17
cd03292214 ABC_FtsE_transporter FtsE is a hydrophilic nucleot 98.16
cd03213194 ABCG_EPDR ABCG transporters are involved in eye pi 98.16
cd03225211 ABC_cobalt_CbiO_domain1 Domain I of the ABC compon 98.16
cd03268208 ABC_BcrA_bacitracin_resist The BcrA subfamily repr 98.16
TIGR03608206 L_ocin_972_ABC putative bacteriocin export ABC tra 98.15
cd03226205 ABC_cobalt_CbiO_domain2 Domain II of the ABC compo 98.15
COG4619223 ABC-type uncharacterized transport system, ATPase 98.15
cd03247178 ABCC_cytochrome_bd The CYD subfamily implicated in 98.14
cd03259213 ABC_Carb_Solutes_like ABC Carbohydrate and Solute 98.14
PRK10584228 putative ABC transporter ATP-binding protein YbbA; 98.14
cd03223166 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cass 98.14
cd03293220 ABC_NrtD_SsuB_transporters NrtD and SsuB are the A 98.14
cd03244221 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C. 98.14
TIGR02315243 ABC_phnC phosphonate ABC transporter, ATP-binding 98.13
cd03261235 ABC_Org_Solvent_Resistant ABC (ATP-binding cassett 98.13
cd03258233 ABC_MetN_methionine_transporter MetN (also known a 98.13
PRK09544251 znuC high-affinity zinc transporter ATPase; Review 98.13
cd03229178 ABC_Class3 This class is comprised of all BPD (Bin 98.13
PRK13540200 cytochrome c biogenesis protein CcmA; Provisional 98.12
PRK11264 250 putative amino-acid ABC transporter ATP-binding pr 98.12
cd03262213 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP- 98.12
cd03222177 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibi 98.12
TIGR00960216 3a0501s02 Type II (General) Secretory Pathway (IIS 98.12
cd03232192 ABC_PDR_domain2 The pleiotropic drug resistance-li 98.11
cd03235213 ABC_Metallic_Cations ABC component of the metal-ty 98.1
PRK11247257 ssuB aliphatic sulfonates transport ATP-binding su 98.1
cd03294269 ABC_Pro_Gly_Bertaine This family comprises the gly 98.1
cd03218232 ABC_YhbG The ABC transporters belonging to the Yhb 98.1
PRK11300 255 livG leucine/isoleucine/valine transporter ATP-bin 98.1
PRK10247225 putative ABC transporter ATP-binding protein YbbL; 98.1
cd03246173 ABCC_Protease_Secretion This family represents the 98.09
cd03266218 ABC_NatA_sodium_exporter NatA is the ATPase compon 98.09
cd03219 236 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC trans 98.08
TIGR02211221 LolD_lipo_ex lipoprotein releasing system, ATP-bin 98.08
cd03301213 ABC_MalK_N The N-terminal ATPase domain of the mal 98.08
COG1119257 ModF ABC-type molybdenum transport system, ATPase 98.07
cd03256 241 ABC_PhnC_transporter ABC-type phosphate/phosphonat 98.07
PF00005137 ABC_tran: ABC transporter This structure is on hol 98.06
PRK11248255 tauB taurine transporter ATP-binding subunit; Prov 98.06
cd03264211 ABC_drug_resistance_like ABC-type multidrug transp 98.05
TIGR01189198 ccmA heme ABC exporter, ATP-binding protein CcmA. 98.05
PRK11629233 lolD lipoprotein transporter ATP-binding subunit; 98.04
TIGR01978 243 sufC FeS assembly ATPase SufC. SufC is part of the 98.04
cd03267236 ABC_NatA_like Similar in sequence to NatA, this is 98.04
TIGR03864236 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, 98.04
cd03250204 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C. 98.04
PRK10908222 cell division protein FtsE; Provisional 98.03
TIGR01184230 ntrCD nitrate transport ATP-binding subunits C and 98.03
PRK13539207 cytochrome c biogenesis protein CcmA; Provisional 98.03
TIGR02314 343 ABC_MetN D-methionine ABC transporter, ATP-binding 98.03
PRK13538204 cytochrome c biogenesis protein CcmA; Provisional 98.03
COG3839 338 MalK ABC-type sugar transport systems, ATPase comp 98.02
PRK13647274 cbiO cobalt transporter ATP-binding subunit; Provi 98.02
PRK13632271 cbiO cobalt transporter ATP-binding subunit; Provi 98.02
cd03231201 ABC_CcmA_heme_exporter CcmA, the ATP-binding compo 98.01
cd03278197 ABC_SMC_barmotin Barmotin is a tight junction-asso 98.01
cd03220224 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transpo 98.01
cd03296239 ABC_CysA_sulfate_importer Part of the ABC transpor 98.01
TIGR03005 252 ectoine_ehuA ectoine/hydroxyectoine ABC transporte 98.01
TIGR01277213 thiQ thiamine ABC transporter, ATP-binding protein 98.01
PRK10895241 lipopolysaccharide ABC transporter ATP-binding pro 98.01
COG1137243 YhbG ABC-type (unclassified) transport system, ATP 98.0
cd03260227 ABC_PstB_phosphate_transporter Phosphate uptake is 98.0
cd03237246 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 o 97.99
PRK09984 262 phosphonate/organophosphate ester transporter subu 97.99
TIGR00968237 3a0106s01 sulfate ABC transporter, ATP-binding pro 97.99
TIGR03410 230 urea_trans_UrtE urea ABC transporter, ATP-binding 97.99
PRK11650 356 ugpC glycerol-3-phosphate transporter ATP-binding 97.99
COG1116248 TauB ABC-type nitrate/sulfonate/bicarbonate transp 97.99
PRK11000 369 maltose/maltodextrin transporter ATP-binding prote 97.99
PRK13635279 cbiO cobalt transporter ATP-binding subunit; Provi 97.98
PRK13638 271 cbiO cobalt transporter ATP-binding subunit; Provi 97.98
cd03217200 ABC_FeS_Assembly ABC-type transport system involve 97.98
PRK11831269 putative ABC transporter ATP-binding protein YrbF; 97.98
cd03295242 ABC_OpuCA_Osmoprotection OpuCA is a the ATP bindin 97.98
PRK14275 286 phosphate ABC transporter ATP-binding protein; Pro 97.98
PRK13541195 cytochrome c biogenesis protein CcmA; Provisional 97.97
PRK09493240 glnQ glutamine ABC transporter ATP-binding protein 97.97
cd03298211 ABC_ThiQ_thiamine_transporter ABC-type thiamine tr 97.97
PRK13546264 teichoic acids export protein ATP-binding subunit; 97.97
cd03245220 ABCC_bacteriocin_exporters ABC-type bacteriocin ex 97.97
PRK10253265 iron-enterobactin transporter ATP-binding protein; 97.96
COG3842 352 PotA ABC-type spermidine/putrescine transport syst 97.96
PRK13637 287 cbiO cobalt transporter ATP-binding subunit; Provi 97.96
PRK13641 287 cbiO cobalt transporter ATP-binding subunit; Provi 97.96
TIGR03411 242 urea_trans_UrtD urea ABC transporter, ATP-binding 97.95
PRK14250241 phosphate ABC transporter ATP-binding protein; Pro 97.95
cd03224222 ABC_TM1139_LivF_branched LivF (TM1139) is part of 97.95
PRK13548 258 hmuV hemin importer ATP-binding subunit; Provision 97.95
TIGR03740223 galliderm_ABC gallidermin-class lantibiotic protec 97.95
PRK11153 343 metN DL-methionine transporter ATP-binding subunit 97.94
PRK14245 250 phosphate ABC transporter ATP-binding protein; Pro 97.94
PRK13644274 cbiO cobalt transporter ATP-binding subunit; Provi 97.94
PRK13633280 cobalt transporter ATP-binding subunit; Provisiona 97.94
PRK03695248 vitamin B12-transporter ATPase; Provisional 97.93
cd03233202 ABC_PDR_domain1 The pleiotropic drug resistance (P 97.93
KOG4675273 consensus Uncharacterized conserved protein, conta 97.93
PRK13648269 cbiO cobalt transporter ATP-binding subunit; Provi 97.93
COG4133209 CcmA ABC-type transport system involved in cytochr 97.93
PRK13547 272 hmuV hemin importer ATP-binding subunit; Provision 97.93
COG1118 345 CysA ABC-type sulfate/molybdate transport systems, 97.93
PRK15439 510 autoinducer 2 ABC transporter ATP-binding protein 97.92
TIGR03265 353 PhnT2 putative 2-aminoethylphosphonate ABC transpo 97.92
PRK13646286 cbiO cobalt transporter ATP-binding subunit; Provi 97.92
PRK10575265 iron-hydroxamate transporter ATP-binding subunit; 97.92
PRK15177213 Vi polysaccharide export ATP-binding protein VexC; 97.92
PRK14264 305 phosphate ABC transporter ATP-binding protein; Pro 97.91
TIGR02770 230 nickel_nikD nickel import ATP-binding protein NikD 97.91
TIGR01186 363 proV glycine betaine/L-proline transport ATP bindi 97.91
PRK11124242 artP arginine transporter ATP-binding subunit; Pro 97.91
PRK09536 402 btuD corrinoid ABC transporter ATPase; Reviewed 97.9
PRK13652277 cbiO cobalt transporter ATP-binding subunit; Provi 97.9
TIGR02982220 heterocyst_DevA ABC exporter ATP-binding subunit, 97.9
TIGR00972 247 3a0107s01c2 phosphate ABC transporter, ATP-binding 97.9
PRK11614 237 livF leucine/isoleucine/valine transporter ATP-bin 97.89
PRK10419268 nikE nickel transporter ATP-binding protein NikE; 97.89
cd03257228 ABC_NikE_OppD_transporters The ABC transporter sub 97.89
PRK13543214 cytochrome c biogenesis protein CcmA; Provisional 97.89
TIGR03873 256 F420-0_ABC_ATP proposed F420-0 ABC transporter, AT 97.89
PRK13640282 cbiO cobalt transporter ATP-binding subunit; Provi 97.88
PRK10771232 thiQ thiamine transporter ATP-binding subunit; Pro 97.88
TIGR02142 354 modC_ABC molybdenum ABC transporter, ATP-binding p 97.88
TIGR03258 362 PhnT 2-aminoethylphosphonate ABC transport system, 97.87
cd03252 237 ABCC_Hemolysin The ABC-transporter hemolysin B is 97.87
PRK11432 351 fbpC ferric transporter ATP-binding subunit; Provi 97.87
PRK15056272 manganese/iron transporter ATP-binding protein; Pr 97.87
PRK10744 260 pstB phosphate transporter ATP-binding protein; Pr 97.87
TIGR02323 253 CP_lyasePhnK phosphonate C-P lyase system protein 97.87
PRK11144 352 modC molybdate transporter ATP-binding protein; Pr 97.87
PRK11231255 fecE iron-dicitrate transporter ATP-binding subuni 97.87
TIGR02769 265 nickel_nikE nickel import ATP-binding protein NikE 97.87
cd03297214 ABC_ModC_molybdenum_transporter ModC is an ABC-typ 97.86
PRK14237 267 phosphate transporter ATP-binding protein; Provisi 97.86
PRK13649280 cbiO cobalt transporter ATP-binding subunit; Provi 97.86
cd03300232 ABC_PotA_N PotA is an ABC-type transporter and the 97.86
PRK10938 490 putative molybdenum transport ATP-binding protein 97.86
COG1134249 TagH ABC-type polysaccharide/polyol phosphate tran 97.86
PRK14242 253 phosphate transporter ATP-binding protein; Provisi 97.86
PRK10619 257 histidine/lysine/arginine/ornithine transporter su 97.86
PRK10851 353 sulfate/thiosulfate transporter subunit; Provision 97.86
PRK15112 267 antimicrobial peptide ABC system ATP-binding prote 97.85
PRK14268 258 phosphate ABC transporter ATP-binding protein; Pro 97.85
PRK09452 375 potA putrescine/spermidine ABC transporter ATPase 97.85
COG0396 251 sufC Cysteine desulfurase activator ATPase [Posttr 97.85
PRK13636 283 cbiO cobalt transporter ATP-binding subunit; Provi 97.85
cd03251 234 ABCC_MsbA MsbA is an essential ABC transporter, cl 97.85
PRK13545 549 tagH teichoic acids export protein ATP-binding sub 97.85
cd03254229 ABCC_Glucan_exporter_like Glucan exporter ATP-bind 97.85
PRK10070 400 glycine betaine transporter ATP-binding subunit; P 97.84
PRK14269 246 phosphate ABC transporter ATP-binding protein; Pro 97.83
cd03249 238 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) 97.82
cd03236 255 ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 o 97.82
PRK10418 254 nikD nickel transporter ATP-binding protein NikD; 97.82
COG1127263 Ttg2A ABC-type transport system involved in resist 97.82
PRK11607 377 potG putrescine transporter ATP-binding subunit; P 97.81
PRK14235 267 phosphate transporter ATP-binding protein; Provisi 97.81
PRK13650279 cbiO cobalt transporter ATP-binding subunit; Provi 97.81
cd03248226 ABCC_TAP TAP, the Transporter Associated with Anti 97.81
cd03253 236 ABCC_ATM1_transporter ATM1 is an ABC transporter t 97.81
cd03234226 ABCG_White The White subfamily represents ABC tran 97.81
PRK14241 258 phosphate transporter ATP-binding protein; Provisi 97.8
PRK13639 275 cbiO cobalt transporter ATP-binding subunit; Provi 97.8
COG0488530 Uup ATPase components of ABC transporters with dup 97.8
PRK14273 254 phosphate ABC transporter ATP-binding protein; Pro 97.8
PRK14254 285 phosphate ABC transporter ATP-binding protein; Pro 97.79
PRK11701258 phnK phosphonate C-P lyase system protein PhnK; Pr 97.78
PRK13651 305 cobalt transporter ATP-binding subunit; Provisiona 97.78
COG4674249 Uncharacterized ABC-type transport system, ATPase 97.78
PRK14244 251 phosphate ABC transporter ATP-binding protein; Pro 97.78
COG1126240 GlnQ ABC-type polar amino acid transport system, A 97.77
PRK10938 490 putative molybdenum transport ATP-binding protein 97.77
PRK14261 253 phosphate ABC transporter ATP-binding protein; Pro 97.77
PRK13549 506 xylose transporter ATP-binding subunit; Provisiona 97.75
TIGR02324224 CP_lyasePhnL phosphonate C-P lyase system protein 97.75
PRK10762 501 D-ribose transporter ATP binding protein; Provisio 97.75
PRK14274 259 phosphate ABC transporter ATP-binding protein; Pro 97.75
PRK09700 510 D-allose transporter ATP-binding protein; Provisio 97.74
PRK14265 274 phosphate ABC transporter ATP-binding protein; Pro 97.74
PRK10636 638 putative ABC transporter ATP-binding protein; Prov 97.74
PRK14251 251 phosphate ABC transporter ATP-binding protein; Pro 97.74
PRK14248 268 phosphate ABC transporter ATP-binding protein; Pro 97.74
PRK13642277 cbiO cobalt transporter ATP-binding subunit; Provi 97.74
PRK14256 252 phosphate ABC transporter ATP-binding protein; Pro 97.73
TIGR03269 520 met_CoM_red_A2 methyl coenzyme M reductase system, 97.73
PRK14262 250 phosphate ABC transporter ATP-binding protein; Pro 97.73
PRK14247 250 phosphate ABC transporter ATP-binding protein; Pro 97.73
PRK14239 252 phosphate transporter ATP-binding protein; Provisi 97.73
PRK13645 289 cbiO cobalt transporter ATP-binding subunit; Provi 97.72
TIGR03771223 anch_rpt_ABC anchored repeat-type ABC transporter, 97.72
PRK14267 253 phosphate ABC transporter ATP-binding protein; Pro 97.72
TIGR01257 2272 rim_protein retinal-specific rim ABC transporter. 97.72
COG1129 500 MglA ABC-type sugar transport system, ATPase compo 97.71
PRK14259 269 phosphate ABC transporter ATP-binding protein; Pro 97.71
PRK15064 530 ABC transporter ATP-binding protein; Provisional 97.71
PRK13631 320 cbiO cobalt transporter ATP-binding subunit; Provi 97.7
PRK14260 259 phosphate ABC transporter ATP-binding protein; Pro 97.69
PRK13634 290 cbiO cobalt transporter ATP-binding subunit; Provi 97.69
PRK15079 331 oligopeptide ABC transporter ATP-binding protein O 97.69
cd03289275 ABCC_CFTR2 The CFTR subfamily domain 2. The cystic 97.69
COG3638258 ABC-type phosphate/phosphonate transport system, A 97.68
KOG0219 902 consensus Mismatch repair ATPase MSH2 (MutS family 97.68
PRK14253 249 phosphate ABC transporter ATP-binding protein; Pro 97.68
PRK13409 590 putative ATPase RIL; Provisional 97.67
PRK14271 276 phosphate ABC transporter ATP-binding protein; Pro 97.67
PRK10636 638 putative ABC transporter ATP-binding protein; Prov 97.67
CHL00131 252 ycf16 sulfate ABC transporter protein; Validated 97.67
TIGR03719552 ABC_ABC_ChvD ATP-binding cassette protein, ChvD fa 97.67
PRK11819556 putative ABC transporter ATP-binding protein; Revi 97.66
COG1136226 SalX ABC-type antimicrobial peptide transport syst 97.66
PRK10982 491 galactose/methyl galaxtoside transporter ATP-bindi 97.66
PRK11819 556 putative ABC transporter ATP-binding protein; Revi 97.66
PRK14240 250 phosphate transporter ATP-binding protein; Provisi 97.65
TIGR03415 382 ABC_choXWV_ATP choline ABC transporter, ATP-bindin 97.65
PRK14270 251 phosphate ABC transporter ATP-binding protein; Pro 97.65
PRK14263 261 phosphate ABC transporter ATP-binding protein; Pro 97.65
PRK14246 257 phosphate ABC transporter ATP-binding protein; Pro 97.63
cd03369207 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-ty 97.62
cd03299235 ABC_ModC_like Archeal protein closely related to M 97.62
PRK13409590 putative ATPase RIL; Provisional 97.62
TIGR03269520 met_CoM_red_A2 methyl coenzyme M reductase system, 97.62
COG1122 235 CbiO ABC-type cobalt transport system, ATPase comp 97.62
COG4604 252 CeuD ABC-type enterochelin transport system, ATPas 97.62
PRK15064530 ABC transporter ATP-binding protein; Provisional 97.62
PRK14255 252 phosphate ABC transporter ATP-binding protein; Pro 97.61
TIGR01257 2272 rim_protein retinal-specific rim ABC transporter. 97.6
cd03291282 ABCC_CFTR1 The CFTR subfamily domain 1. The cystic 97.6
PRK14249 251 phosphate ABC transporter ATP-binding protein; Pro 97.6
PRK15439510 autoinducer 2 ABC transporter ATP-binding protein 97.59
KOG0062 582 consensus ATPase component of ABC transporters wit 97.59
PRK14243 264 phosphate transporter ATP-binding protein; Provisi 97.58
PRK09580 248 sufC cysteine desulfurase ATPase component; Review 97.58
cd03290218 ABCC_SUR1_N The SUR domain 1. The sulfonylurea rec 97.58
PRK15134 529 microcin C ABC transporter ATP-binding protein Yej 97.57
cd03288 257 ABCC_SUR2 The SUR domain 2. The sulfonylurea recep 97.57
PRK11288 501 araG L-arabinose transporter ATP-binding protein; 97.57
PRK14252 265 phosphate ABC transporter ATP-binding protein; Pro 97.57
PRK14266 250 phosphate ABC transporter ATP-binding protein; Pro 97.56
PRK13643 288 cbiO cobalt transporter ATP-binding subunit; Provi 97.56
PRK14238 271 phosphate transporter ATP-binding protein; Provisi 97.54
cd03239178 ABC_SMC_head The structural maintenance of chromos 97.54
PRK14272 252 phosphate ABC transporter ATP-binding protein; Pro 97.54
TIGR02633 500 xylG D-xylose ABC transporter, ATP-binding protein 97.53
PRK09700510 D-allose transporter ATP-binding protein; Provisio 97.53
PRK14236 272 phosphate transporter ATP-binding protein; Provisi 97.52
TIGR02633 500 xylG D-xylose ABC transporter, ATP-binding protein 97.5
PRK15134529 microcin C ABC transporter ATP-binding protein Yej 97.49
TIGR03719 552 ABC_ABC_ChvD ATP-binding cassette protein, ChvD fa 97.49
PRK11147 635 ABC transporter ATPase component; Reviewed 97.49
COG2274 709 SunT ABC-type bacteriocin/lantibiotic exporters, c 97.49
PRK13549 506 xylose transporter ATP-binding subunit; Provisiona 97.49
COG3840231 ThiQ ABC-type thiamine transport system, ATPase co 97.49
PRK14257329 phosphate ABC transporter ATP-binding protein; Pro 97.48
PRK10261 623 glutathione transporter ATP-binding protein; Provi 97.48
PRK11288 501 araG L-arabinose transporter ATP-binding protein; 97.47
PLN03073718 ABC transporter F family; Provisional 97.46
cd03274212 ABC_SMC4_euk Eukaryotic SMC4 proteins; SMC protein 97.46
cd03279213 ABC_sbcCD SbcCD and other Mre11/Rad50 (MR) complex 97.45
PRK14258 261 phosphate ABC transporter ATP-binding protein; Pro 97.45
PLN03211 659 ABC transporter G-25; Provisional 97.44
PRK10762 501 D-ribose transporter ATP binding protein; Provisio 97.44
PRK11022 326 dppD dipeptide transporter ATP-binding subunit; Pr 97.43
PRK11147 635 ABC transporter ATPase component; Reviewed 97.43
COG4586 325 ABC-type uncharacterized transport system, ATPase 97.42
cd03272 243 ABC_SMC3_euk Eukaryotic SMC3 proteins; SMC protein 97.42
PRK10982 491 galactose/methyl galaxtoside transporter ATP-bindi 97.42
PRK15093 330 antimicrobial peptide ABC transporter ATP-binding 97.41
cd03270 226 ABC_UvrA_I The excision repair protein UvrA domain 97.39
COG1125 309 OpuBA ABC-type proline/glycine betaine transport s 97.39
TIGR01842544 type_I_sec_PrtD type I secretion system ABC transp 97.38
TIGR00954659 3a01203 Peroxysomal Fatty Acyl CoA Transporter (FA 97.37
PRK11308 327 dppF dipeptide transporter ATP-binding subunit; Pr 97.35
PRK10261 623 glutathione transporter ATP-binding protein; Provi 97.33
KOG0927614 consensus Predicted transporter (ABC superfamily) 97.3
TIGR02204576 MsbA_rel ABC transporter, permease/ATP-binding pro 97.3
COG3845 501 ABC-type uncharacterized transport systems, ATPase 97.29
PRK13657588 cyclic beta-1,2-glucan ABC transporter; Provisiona 97.28
PRK10522547 multidrug transporter membrane component/ATP-bindi 97.28
PRK10535 648 macrolide transporter ATP-binding /permease protei 97.28
COG1117 253 PstB ABC-type phosphate transport system, ATPase c 97.27
TIGR03797 686 NHPM_micro_ABC2 NHPM bacteriocin system ABC transp 97.26
COG0488 530 Uup ATPase components of ABC transporters with dup 97.26
COG4778235 PhnL ABC-type phosphonate transport system, ATPase 97.25
PRK10789 569 putative multidrug transporter membrane\ATP-bindin 97.24
TIGR01192 585 chvA glucan exporter ATP-binding protein. This mod 97.23
COG4559 259 ABC-type hemin transport system, ATPase component 97.22
smart00382148 AAA ATPases associated with a variety of cellular 97.21
TIGR01187 325 potA spermidine/putrescine ABC transporter ATP-bin 97.21
PLN03073 718 ABC transporter F family; Provisional 97.21
TIGR03375 694 type_I_sec_LssB type I secretion system ATPase, Ls 97.17
PRK10790 592 putative multidrug transporter membrane\ATP-bindin 97.16
COG1101 263 PhnK ABC-type uncharacterized transport system, AT 97.16
cd03275 247 ABC_SMC1_euk Eukaryotic SMC1 proteins; SMC protein 97.14
cd03277213 ABC_SMC5_euk Eukaryotic SMC5 proteins; SMC protein 97.14
TIGR00955 617 3a01204 The Eye Pigment Precursor Transporter (EPP 97.14
PRK11174 588 cysteine/glutathione ABC transporter membrane/ATP- 97.14
cd03276198 ABC_SMC6_euk Eukaryotic SMC6 proteins; SMC protein 97.13
COG4988 559 CydD ABC-type transport system involved in cytochr 97.12
smart0033357 TUDOR Tudor domain. Domain of unknown function pre 97.11
PRK09473 330 oppD oligopeptide transporter ATP-binding componen 97.11
cd03271 261 ABC_UvrA_II The excision repair protein UvrA domai 97.11
TIGR03796710 NHPM_micro_ABC1 NHPM bacteriocin system ABC transp 97.08
cd03240204 ABC_Rad50 The catalytic domains of Rad50 are simil 97.07
COG2884223 FtsE Predicted ATPase involved in cell division [C 97.07
PRK11160574 cysteine/glutathione ABC transporter membrane/ATP- 97.06
TIGR02203571 MsbA_lipidA lipid A export permease/ATP-binding pr 97.06
TIGR01194555 cyc_pep_trnsptr cyclic peptide transporter. This m 97.05
PF1355562 AAA_29: P-loop containing region of AAA domain 97.01
PTZ00243 1560 ABC transporter; Provisional 97.01
TIGR02857529 CydD thiol reductant ABC exporter, CydD subunit. U 97.0
KOG0059 885 consensus Lipid exporter ABCA1 and related protein 96.99
TIGR01193 708 bacteriocin_ABC ABC-type bacteriocin transporter. 96.98
COG4615546 PvdE ABC-type siderophore export system, fused ATP 96.95
KOG0927 614 consensus Predicted transporter (ABC superfamily) 96.94
PRK14722 374 flhF flagellar biosynthesis regulator FlhF; Provis 96.93
TIGR00958 711 3a01208 Conjugate Transporter-2 (CT2) Family prote 96.93
TIGR01846 694 type_I_sec_HlyB type I secretion system ABC transp 96.93
TIGR02868529 CydC thiol reductant ABC exporter, CydC subunit. T 96.92
PLN03140 1470 ABC transporter G family member; Provisional 96.91
COG4148 352 ModC ABC-type molybdate transport system, ATPase c 96.9
cd0450848 TUDOR Tudor domains are found in many eukaryotic o 96.9
TIGR01271 1490 CFTR_protein cystic fibrosis transmembrane conduct 96.89
COG4525 259 TauB ABC-type taurine transport system, ATPase com 96.85
smart0074361 Agenet Tudor-like domain present in plant sequence 96.84
COG4178604 ABC-type uncharacterized transport system, permeas 96.84
PRK06995 484 flhF flagellar biosynthesis regulator FlhF; Valida 96.79
PTZ00265 1466 multidrug resistance protein (mdr1); Provisional 96.79
TIGR00956 1394 3a01205 Pleiotropic Drug Resistance (PDR) Family p 96.76
PRK14721 420 flhF flagellar biosynthesis regulator FlhF; Provis 96.76
PRK11176 582 lipid transporter ATP-binding/permease protein; Pr 96.75
COG1124 252 DppF ABC-type dipeptide/oligopeptide/nickel transp 96.74
KOG0064 728 consensus Peroxisomal long-chain acyl-CoA transpor 96.73
PLN03140 1470 ABC transporter G family member; Provisional 96.71
COG3910233 Predicted ATPase [General function prediction only 96.7
cd03273 251 ABC_SMC2_euk Eukaryotic SMC2 proteins; SMC protein 96.68
COG4107258 PhnK ABC-type phosphonate transport system, ATPase 96.68
KOG0061 613 consensus Transporter, ABC superfamily (Breast can 96.67
TIGR00956 1394 3a01205 Pleiotropic Drug Resistance (PDR) Family p 96.66
COG2401593 ABC-type ATPase fused to a predicted acetyltransfe 96.65
PRK12727 559 flagellar biosynthesis regulator FlhF; Provisional 96.63
KOG0057591 consensus Mitochondrial Fe/S cluster exporter, ABC 96.61
COG4138 248 BtuD ABC-type cobalamin transport system, ATPase c 96.51
TIGR00957 1522 MRP_assoc_pro multi drug resistance-associated pro 96.5
PRK14723 767 flhF flagellar biosynthesis regulator FlhF; Provis 96.5
COG4598 256 HisP ABC-type histidine transport system, ATPase c 96.46
PRK13695174 putative NTPase; Provisional 96.46
COG1132567 MdlB ABC-type multidrug transport system, ATPase a 96.42
KOG0060659 consensus Long-chain acyl-CoA transporter, ABC sup 96.41
PF09038122 53-BP1_Tudor: Tumour suppressor p53-binding protei 96.37
COG4608 268 AppF ABC-type oligopeptide transport system, ATPas 96.31
TIGR03499282 FlhF flagellar biosynthetic protein FlhF. 96.31
TIGR02858270 spore_III_AA stage III sporulation protein AA. Mem 96.26
COG4618 580 ArpD ABC-type protease/lipase transport system, AT 96.25
PF00004132 AAA: ATPase family associated with various cellula 96.24
PRK12723 388 flagellar biosynthesis regulator FlhF; Provisional 96.2
COG1135 339 AbcC ABC-type metal ion transport system, ATPase c 96.08
cd00009151 AAA The AAA+ (ATPases Associated with a wide varie 96.08
PRK09183259 transposase/IS protein; Provisional 96.05
KOG0056790 consensus Heavy metal exporter HMT1, ABC superfami 96.01
TIGR03015 269 pepcterm_ATPase putative secretion ATPase, PEP-CTE 96.0
COG4175 386 ProV ABC-type proline/glycine betaine transport sy 95.98
COG1618179 Predicted nucleotide kinase [Nucleotide transport 95.97
PRK11889436 flhF flagellar biosynthesis regulator FlhF; Provis 95.96
PRK04296190 thymidine kinase; Provisional 95.95
cd01130186 VirB11-like_ATPase Type IV secretory pathway compo 95.92
COG1245591 Predicted ATPase, RNase L inhibitor (RLI) homolog 95.9
PLN03232 1495 ABC transporter C family member; Provisional 95.86
COG4987 573 CydC ABC-type transport system involved in cytochr 95.83
PRK14974336 cell division protein FtsY; Provisional 95.8
cd00820107 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPC 95.75
PF03266168 NTPase_1: NTPase; InterPro: IPR004948 This entry r 95.73
PRK08533 230 flagellar accessory protein FlaH; Reviewed 95.71
cd01120165 RecA-like_NTPases RecA-like NTPases. This family i 95.65
PF13401131 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S 95.61
PF13173128 AAA_14: AAA domain 95.61
COG4181228 Predicted ABC-type transport system involved in ly 95.57
PF13476202 AAA_23: AAA domain; PDB: 3AV0_B 3AUY_B 3AUX_A 2O5V 95.54
PRK06731270 flhF flagellar biosynthesis regulator FlhF; Valida 95.53
PRK05703 424 flhF flagellar biosynthesis regulator FlhF; Valida 95.52
PRK06067 234 flagellar accessory protein FlaH; Validated 95.49
PRK10416 318 signal recognition particle-docking protein FtsY; 95.39
PLN03130 1622 ABC transporter C family member; Provisional 95.39
PRK10078186 ribose 1,5-bisphosphokinase; Provisional 95.34
COG1123 539 ATPase components of various ABC-type transport sy 95.34
TIGR00602 637 rad24 checkpoint protein rad24. This family is bas 95.28
PHA00729 226 NTP-binding motif containing protein 95.28
PRK06526254 transposase; Provisional 95.26
TIGR02322179 phosphon_PhnN phosphonate metabolism protein/1,5-b 95.21
TIGR00750 300 lao LAO/AO transport system ATPase. Mutations have 95.2
KOG0055 1228 consensus Multidrug/pheromone exporter, ABC superf 95.17
PRK12726407 flagellar biosynthesis regulator FlhF; Provisional 95.15
PRK06921266 hypothetical protein; Provisional 95.13
PF05729166 NACHT: NACHT domain 95.01
PLN03232 1495 ABC transporter C family member; Provisional 94.97
KOG1970 634 consensus Checkpoint RAD17-RFC complex, RAD17/RAD2 94.95
TIGR01271 1490 CFTR_protein cystic fibrosis transmembrane conduct 94.94
TIGR00235207 udk uridine kinase. Model contains a number of lon 94.92
PRK09825176 idnK D-gluconate kinase; Provisional 94.89
COG3950 440 Predicted ATP-binding protein involved in virulenc 94.87
PRK00349 943 uvrA excinuclease ABC subunit A; Reviewed 94.86
TIGR03263180 guanyl_kin guanylate kinase. Members of this famil 94.81
cd01131198 PilT Pilus retraction ATPase PilT. PilT is a nucle 94.79
COG4161 242 ArtP ABC-type arginine transport system, ATPase co 94.72
cd01128 249 rho_factor Transcription termination factor rho is 94.71
PTZ00243 1560 ABC transporter; Provisional 94.69
TIGR02788308 VirB11 P-type DNA transfer ATPase VirB11. The VirB 94.68
PF00448196 SRP54: SRP54-type protein, GTPase domain; InterPro 94.68
PTZ00265 1466 multidrug resistance protein (mdr1); Provisional 94.67
PLN03130 1622 ABC transporter C family member; Provisional 94.64
PF03215 519 Rad17: Rad17 cell cycle checkpoint protein 94.62
cd03115173 SRP The signal recognition particle (SRP) mediates 94.58
KOG0066807 consensus eIF2-interacting protein ABC50 (ABC supe 94.56
KOG0058 716 consensus Peptide exporter, ABC superfamily [Intra 94.55
cd01121 372 Sms Sms (bacterial radA) DNA repair protein. This 94.5
cd02025 220 PanK Pantothenate kinase (PanK) catalyzes the phos 94.49
COG4136213 ABC-type uncharacterized transport system, ATPase 94.46
PRK09270229 nucleoside triphosphate hydrolase domain-containin 94.36
PRK00771 437 signal recognition particle protein Srp54; Provisi 94.35
PRK12377248 putative replication protein; Provisional 94.27
PRK09435 332 membrane ATPase/protein kinase; Provisional 94.25
TIGR02237209 recomb_radB DNA repair and recombination protein R 94.23
PRK07952244 DNA replication protein DnaC; Validated 94.09
cd02023198 UMPK Uridine monophosphate kinase (UMPK, EC 2.7.1. 94.06
PRK06893229 DNA replication initiation factor; Validated 94.05
PF02463220 SMC_N: RecF/RecN/SMC N terminal domain; InterPro: 94.01
TIGR03238 504 dnd_assoc_3 dnd system-associated protein 3. cereu 93.97
PLN00104450 MYST -like histone acetyltransferase; Provisional 93.96
TIGR00554 290 panK_bact pantothenate kinase, bacterial type. Sho 93.94
cd01123 235 Rad51_DMC1_radA Rad51_DMC1_radA,B. This group of r 93.91
KOG2355 291 consensus Predicted ABC-type transport, ATPase com 93.91
cd03241 276 ABC_RecN RecN ATPase involved in DNA repair; ABC ( 93.83
cd03242 270 ABC_RecF RecF is a recombinational DNA repair ATPa 93.81
COG1245 591 Predicted ATPase, RNase L inhibitor (RLI) homolog 93.76
PF13304 303 AAA_21: AAA domain; PDB: 3QKS_B 1US8_B 1F2U_B 1F2T 93.75
TIGR00957 1522 MRP_assoc_pro multi drug resistance-associated pro 93.7
COG4167 267 SapF ABC-type antimicrobial peptide transport syst 93.68
PRK00300205 gmk guanylate kinase; Provisional 93.63
PRK05416 288 glmZ(sRNA)-inactivating NTPase; Provisional 93.56
PRK08181269 transposase; Validated 93.55
cd01124187 KaiC KaiC is a circadian clock protein primarily f 93.53
PRK00411 394 cdc6 cell division control protein 6; Reviewed 93.45
PRK05480 209 uridine/cytidine kinase; Provisional 93.39
PF13207121 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6 93.38
TIGR00064272 ftsY signal recognition particle-docking protein F 93.28
TIGR01360188 aden_kin_iso1 adenylate kinase, isozyme 1 subfamil 93.27
TIGR02524 358 dot_icm_DotB Dot/Icm secretion system ATPase DotB. 93.26
>KOG0217 consensus Mismatch repair ATPase MSH6 (MutS family) [Replication, recombination and repair] Back     alignment and domain information
Probab=100.00  E-value=8.2e-174  Score=1532.74  Aligned_cols=964  Identities=42%  Similarity=0.673  Sum_probs=794.3

Q ss_pred             ccccCcccccceEEEecCCCCceEeEEEEeeeCCCCeEEEEccCCchhhhccCcceEEEEecchhhhhhccccccccccC
Q 001187           98 AKSYGEDVLRKRIRVYWPLDKAWYEGCVKSFDKECNKHLVQYDDGEDELLDLGKEKIEWVQESVSLLKRLRRDSFKKVVV  177 (1129)
Q Consensus        98 ~~~~~~~~vg~rv~v~Wp~d~~~y~g~v~~~~~~~~~h~v~Yddgd~e~l~l~~e~~~~~~~~~~~~~~~~~~~~~~~~~  177 (1129)
                      .-..+++.+|           .||.+.|..++.+..+    |-++....+..-+|+-+|......+....|.+ ...++.
T Consensus         8 ~~t~~~e~~~-----------~~~~~~v~~~~~~e~k----~l~~~t~k~~~~~e~~~~~~~~~r~~~~~rv~-~~e~~~   71 (1125)
T KOG0217|consen    8 HMTFFEETPG-----------KLYRNSVGLKPKEEPK----SLRNGTLKIKNLKEKEEFKSGQPREVVSSRVK-EYEAVG   71 (1125)
T ss_pred             ceeecccCcc-----------hhcccccccCCccchh----hhcCCCcCcCccchhhHhhccCcccccccccc-chhhcC
Confidence            3445677777           7999999998877665    65555544444456666663211111111110 122222


Q ss_pred             CChhhhhccc-CccCCCCCCCcchhhc-cccCC-CCCCcchh-------hchhhhhh--------hccccccccccCC--
Q 001187          178 EDDEEMENVE-DEISDDRSDSSDDDWN-KNVGK-EDVSEDEE-------VDLVDEQE--------NKVLRGRKRKSSG--  237 (1129)
Q Consensus       178 ~~~~~~~~~~-~~~~~~~~~~~d~~~~-~~~~~-~~~~~~e~-------~~~~~e~e--------~~~~~~~~~k~~~--  237 (1129)
                      .+.+.-.+.. ...-++.+++||+||+ |++.. +++++++|       ++..+|+.        ...+++|.+++..  
T Consensus        72 ~d~~~~~~~~~~~~k~~~~sDsd~d~g~k~~~~~~~~d~~~~D~~~~d~~~~~~ee~~~~~~~~~~~~~~~r~~~a~~v~  151 (1125)
T KOG0217|consen   72 DDADIVVESSSEKPKSGLDSDSDEDFGGKEVEEKEDSDEELDDETASDYEVVISEESEGGEPVCRVSDTDSRSRKAESVS  151 (1125)
T ss_pred             CCccceeeecccCCccccCCCcccccCcccccccccccccccccccCCcceeccccccCCCcccccCCCcccchhccccc
Confidence            2222222222 2233456788888887 22222 22222111       01111111        1244566666644  


Q ss_pred             ---CcCCCCCCCCCCCCccccccCCccc-cCC-CCCCCCC-CCCccccccccccccccccccccCC-CCcccCCCCCCCC
Q 001187          238 ---VKKSKSDGNAVNADFKSPIIKPVKI-FGS-DKLSNGF-DNPVMGDVSERFSAREADKFHFLGP-DRRDAKRRRPGDV  310 (1129)
Q Consensus       238 ---~kk~~~~~~~~~~~~~~~~~~p~~~-~~~-~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~l~~-~~rD~~~r~p~~p  310 (1129)
                         +||..+...++..+.......|.+- .+. ++.+.+. ....-++..+|+.++.++++.||.+ ++||+++|||+||
T Consensus       152 k~~~kk~~~~~~~~~~~~~~~~~~p~~~~~~~a~r~~~~~~~i~~~~~~~~~~~a~~~E~~r~l~~e~~RD~~rrr~~dp  231 (1125)
T KOG0217|consen  152 KGKSKKSPSDSGAVSMGHDLDFNDPMPLREGQASRSASGYCGISNGETELSRMEAFDHEKERYLKLEDVRDALRRRRGDP  231 (1125)
T ss_pred             ccccCCCCCCccccccccccccCCCCccccCccccccccccccccccccccchhhhcccchhhccHHHhhhhhcCCCCCC
Confidence               2222223335555555566777662 122 2222232 2222344467788888888777765 5799999999999


Q ss_pred             CCCCCCCCCCchhhcCCCHHHHHHHHHHHhCCCeEEEEeeCceEEEehhhHHHHhhhcceeeecCCCCcCCcCcccHhHH
Q 001187          311 YYDPRTLYLPPDFLRNLSEGQKQWWEFKSKHMDKVIFFKMGKFYELFEMDAHVGAKELDLQYMKGEQPHCGFPERNFSMN  390 (1129)
Q Consensus       311 ~ydp~Tl~ip~~~~~~~TP~~~Qyw~iK~~~~D~vlffkvGkFYEly~~DA~i~a~~L~L~~t~g~~p~~GfPe~sl~~y  390 (1129)
                      +|||+|||||+++|++|||+++|||+||++|||+|||||+|||||||++||.+++++|+|+||++++|||||||++|+.|
T Consensus       232 ~yDp~TLyiP~s~~~kftpg~kqwWeiKs~~fD~ivfFk~GKFyELye~DA~vg~~~~dl~f~~vN~~~~GfPE~sf~~~  311 (1125)
T KOG0217|consen  232 EYDPRTLYIPPSFWKKFTPGEKQWWEIKSDNFDTIVFFKKGKFYELYEMDALVGARLFDLKFMDVNMPHSGFPEGSFDYW  311 (1125)
T ss_pred             CCCccceecCHHHHhcCCchhhhhhhhhhhcccEEEEEecchHHHHHhhhhhhhhhhcceeecccccccCCCCccchhhH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHcCCeEEEEecCCChhHHHHHhhhcCCCCceeeeeEEEEeeCcceeeccccCCCCCCcEEEEEEecCCCCCCCCC
Q 001187          391 VEKLARKGYRVLVVEQTETPEQLELRRKEKGSKDKVVKREICAVVTKGTLTEGELLSANPDASYLMALTESNQSPASQST  470 (1129)
Q Consensus       391 ~~kLV~~GyKVavvEQ~Et~~~~~~r~k~~~~~~kvv~Rev~~V~TpGTl~d~~~l~~~~~~~yllaI~e~~~~~~~~~~  470 (1129)
                      +.+|+++|||||+|||+||+.++++|++.+|+++|||+||||+|+|+||++|..++. ++.+.|||||+|+..+..  .+
T Consensus       312 a~q~iq~GYkvarVEQtEt~l~~e~r~~~~~~kdkvvrRev~~ilt~GT~td~~l~~-~~~akylmai~e~~~~~~--~~  388 (1125)
T KOG0217|consen  312 ADQFIQKGYKVARVEQTETPLGKEIRERKTGKKDKVVRREVCRILTNGTLTDIALLT-SDLAKYLMAIKESEESYS--TG  388 (1125)
T ss_pred             HHHHHhccceeeeeccccChHHhhhhhcccccchhhHHHHHHHHhcCCcchhHHHhc-cHHHHHHHHHhhcCCCCC--cC
Confidence            999999999999999999999999999999999999999999999999999976664 456789999999876421  45


Q ss_pred             CcEEEEEEEEccCCeEEEEEecCcchhHHHHHHHHccCccEEEecCCCCChHHHHHHHhhcCCCccccccCCccccChhh
Q 001187          471 DRCFGICVVDVATSRIILGQVMDDLDCSVLCCLLSELRPVEIIKPANMLSPETERAILRHTRNPLVNDLVPLSEFWDAET  550 (1129)
Q Consensus       471 ~~~~Gva~vD~stg~~~l~qf~Dd~~~s~L~t~L~~~~P~EIl~~~~~ls~~t~~~l~~~~~~~~~~~~~~~~~f~~~~~  550 (1129)
                      ...||+|++|++||+|+++||+||.+++.|.|+|+|++|+|+|.+.++++..|..+++....+..+..++|..+||+.++
T Consensus       389 ~~s~gvc~iDtstge~~~~eF~DDr~~s~L~tlLs~~rp~E~I~e~~~ls~~t~~~ik~~~~~~~~~n~~~~~eFwdsek  468 (1125)
T KOG0217|consen  389 EVSFGVCFIDTSTGEINIGEFCDDRHCSKLDTLLSQVRPVELIEERKNLSDPTKVIIKLKLSSNLVENLVPKSEFWDSEK  468 (1125)
T ss_pred             ceeeeEEEEEcccceEEEEEeecchhhhHHHHHHHcccHHHHHHHhhccCCceeeeeeeeecchhhhcccChhhhcchhh
Confidence            67899999999999999999999999999999999999999999999999988887776666667777788889999999


Q ss_pred             HHHHH--HHHHhhcccccccccccccccccccCCCCcccchhhhhhhccCCChhHHHHHHHHHHHHHHHhccchhhhccc
Q 001187          551 TVLEI--KNIYNRITAESLNKADSNVANSQAEGDGLTCLPGILSELISTGDSGSQVLSALGGTLFYLKKSFLDETLLRFA  628 (1129)
Q Consensus       551 ~~~~l--~~~~~~~~~~~~~k~~~~~~~~~~~~~~~~~~p~~l~~~~~~~~~~~~al~Algall~YL~~~~l~~~ll~~~  628 (1129)
                      +..++  .+||...                    +...+|.++..   ...+++++++|+|++++||+.+++++.+++++
T Consensus       469 ~~~eii~~dy~~~~--------------------g~e~~~sil~~---p~~~~~la~safg~~~~Ylk~~~id~~llsm~  525 (1125)
T KOG0217|consen  469 TGREIISEDYFESL--------------------GLEDSPSILKS---PNTDKELALSAFGGLFYYLKKLLIDEELLSMK  525 (1125)
T ss_pred             HHHHHhhhhhhhcc--------------------cccCchhhccC---CCccchhhHHHHHHHHHHHHHHhhHHHHhhhh
Confidence            88765  2455410                    12234444332   23356899999999999999999999999999


Q ss_pred             ceeecCCCCCccCCCCCeeecCHHHHHhccCcccccCCCCcccHHHHHhhhcChHHHHHHHHhhhCCCCCHHHHHHHHHH
Q 001187          629 KFELLPCSGFGDMAKKPYMVLDAPALENLEVFENSRSGDSSGTLYAQLNHCVTAFGKRLLRTWLARPLYNSGLIRERQDA  708 (1129)
Q Consensus       629 ~f~~~~~~~~~~~~~~~~M~LD~~Tl~~LEI~~~~~~g~~~gSL~~lLn~c~T~~GkRlLr~wl~~PL~d~~~I~~Rlda  708 (1129)
                      +|+.|+...      ...|+||++||+|||||.|+++|+.+||||.++|+|.||||||||++||++||+|.+.|++||||
T Consensus       526 n~~ey~~~~------~s~mvlD~~tL~NleIf~Ns~~G~~~gtL~~~~~~csTpfGKRllk~Wl~~Pl~~~~~I~~R~da  599 (1125)
T KOG0217|consen  526 NFEEYDSLD------QSEMVLDGATLENLEIFSNSRNGGDEGTLFYAVNRCSTPFGKRLLKTWLMAPLCDKEDIKQRQDA  599 (1125)
T ss_pred             hhhhcchhc------ccceeecchhhhhhhhhccCCCCCCchhHHHHHhhccChHHHHHHHHHhhCcCCCHHHHHHHHHH
Confidence            999886432      23499999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHcCCchhHHHHHHhcCCCCCHHHHHHHHhccccccCCCCccchhhHHHHHHHHHHHHHHHhhhHHHHHHHHHHHHH
Q 001187          709 VAGLRGVNQPFALEFRKALSRLPDMERLLARLFASSEANGRNSNKVVLYEDAAKKQLQEFISALHGCELMDQACSSLGAI  788 (1129)
Q Consensus       709 Ve~L~~~~~~~~~~lr~~L~~lpDleRll~ri~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~L~~~~~~~~~~~~l~~~  788 (1129)
                      |+.|.. ++..+.++...|+++||+||+|.|+|..+..              .++++.+|+.+|.+|+.+...+..+...
T Consensus       600 v~~l~~-~~~~~~~~~e~l~klPDlERlL~Rih~~~~~--------------~~k~i~~f~rvLegfk~~~~~~~~~~~v  664 (1125)
T KOG0217|consen  600 VDSLGK-APMDRTKVGETLKKLPDLERLLVRIHNGGEK--------------NKKKIADFIRVLEGFKEINKLLGSLINV  664 (1125)
T ss_pred             HHHHhc-CchhHHHHHHHHhhCCcHHHHHHHHHhcCcc--------------chhHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            999986 5666778999999999999999999975432              3578999999999999998888776655


Q ss_pred             Hhhcch-hhHHhhhcCCCCchhHHHHHHHHHhhhchhhhcCCCCeeeCCCCChhHHHHHHHHHHHHHHHHHHHHHHHHHh
Q 001187          789 LENTES-RQLHHILTPGKGLPAIVSILKHFKDAFDWVEANNSGRIIPHGGVDMDYDSACKKVKEIEASLTKHLKEQRKLL  867 (1129)
Q Consensus       789 l~~~~s-~~l~~l~~~~~~~~~l~~~l~~i~~~~d~~~~~~~g~ii~~~g~d~~lD~~~~~l~~l~~~L~~~l~~~~~~l  867 (1129)
                      +..... .++..++   ..+|++..-+..|..+|||..+.++|.|+|..|+|.+||.+...+.+++++|.++|+++++.+
T Consensus       665 ~~~~~~~~~is~~~---~~~p~~~~~i~~~~~af~r~~a~~eg~i~P~~Gfd~eyD~a~k~~~e~e~~L~~~L~~~rk~l  741 (1125)
T KOG0217|consen  665 LKEGEGLRLISELL---ESMPNLSEEIENWTEAFDRVKAVKEGVIVPLEGFDEEYDEAMKRVDEAENELLAYLEEYRKRL  741 (1125)
T ss_pred             HHhhHHHHHHHHHh---cCcchhhHHHHHHHHHHHHHHHhhcCccCCCccccHHHHHHhhHHHHHHHHHHHHHHHHHHhc
Confidence            542222 2233332   348999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCCCceEEEeCCceEEEEccccccCCCCCcEEEeeeecceEEEeChhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhh
Q 001187          868 GDTSITYVTIGKDLYLLEVPESLRGSVPRDYELRSSKKGFFRYWTPNIKKLLGELSQAESEKESALKSILQRLIGQFCEH  947 (1129)
Q Consensus       868 ~~~~i~~~~~~~~~y~iev~~~~~~~vp~~~~~~ss~k~~~ry~tp~l~~l~~el~~~~~~~~~~~~~il~~l~~~~~~~  947 (1129)
                      +|.+|.|+++++..|++|||++....+|.+|++.+++||+.||+||++.++...+.++++++.....++.++++.+|.+|
T Consensus       742 ~c~si~~~~vGk~~y~lEvP~n~~~~s~~~~~~~S~~Kg~~RY~tp~~~kli~~l~~aee~~~~~~~d~~~r~~~~f~~~  821 (1125)
T KOG0217|consen  742 GCSSIVFVDVGKDVYQLEVPENGGVPSSLRYELMSAKKGVSRYYTPDLRKLIAHLDEAEERKKSSLSDLKRRLIVRFDEH  821 (1125)
T ss_pred             CCCceeEeecCceEEEEecCcccCCCCchHHHHHHhhcCcccccCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhh
Confidence            99999999999999999999999888888899999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHhhcCCCccceeecCCCCCCCCcEEEeccCCCccccccCCCCcccccccccCCCCCC
Q 001187          948 HNKWRQMVAATAELDALISLAIASDFYEGPTCRPVILDSCSNEEPYISAKSLGHPVLRSDSLGKGEFVPNDITIGGHGNA 1027 (1129)
Q Consensus       948 ~~~l~~~~~~la~LD~L~SlA~~a~~~~~~~~rP~~~~~~~~~~~~l~i~~~RHP~le~~~~~~~~fvpNdi~l~~~~~~ 1027 (1129)
                      +..|+++++++|.||||+|||.+|..+++++|||+|++..+ +.+++.++.+||||+..... .+.|||||+.++..+..
T Consensus       822 ~~~w~~tv~~~a~iD~l~sla~~s~~~~~~~Crp~i~~~~d-t~~~l~~~~~~Hpcfsl~s~-~~~fipN~v~~g~~~e~  899 (1125)
T KOG0217|consen  822 YIIWQATVKALASIDCLLSLAETSKGLGGPMCRPEIVESTD-TPGFLIVKGLRHPCFSLPST-GTSFIPNDVELGGAEEN  899 (1125)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHhhccCCCCcccceeecccC-CCceeEEecccCceeecCcC-CCccccchhhccccccc
Confidence            99999999999999999999999999999999999997532 33489999999999976432 36899999999965667


Q ss_pred             ceEEEEecCCCchhHHHHHHHHHHHHhHcCCeecCCCcccchhhhhhhccCccchHhhcccchHHHHHHHHHHHHhCCCC
Q 001187         1028 SFILLTGPNMGGKSTLLRQVCLAVILAQVGADVPAEIFEISPVDRIFVRMGAKDHIMAGQSTFLTELSETALMLSSATRN 1107 (1129)
Q Consensus      1028 ~~~iitGpN~~GKSt~lr~i~l~vilAQiG~~VPA~~a~l~~~d~i~trig~~d~i~~g~StF~~em~e~~~il~~at~~ 1107 (1129)
                      ++.++||||||||||+|||+|+++|||||||+|||+.++++++|+||||+||+|+|+.|.||||+|+.|++.||++||++
T Consensus       900 ~~~llTGpNmgGKSTllRq~c~~vilaq~G~~VPa~~~~~tpidrI~tRlGA~D~im~g~STF~vELsET~~IL~~aT~~  979 (1125)
T KOG0217|consen  900 REGLLTGPNMGGKSTLLRQACIAVILAQIGCDVPAEVMELTPIDRIFTRLGANDDIMSGESTFFVELSETKKILKHATRH  979 (1125)
T ss_pred             eeeeeccCCcCCchHHHHHHHHHHHHHHhCCCccHHHhcccchHHHhhhcccccchhcCCceEEEeccchHHHHhhcCcc
Confidence            78889999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             cEEEEeCCCCCCChHHHHhhhC
Q 001187         1108 SLVVLDELGRGTSTSDGQAIAS 1129 (1129)
Q Consensus      1108 sLvllDElGRGTst~DG~AIA~ 1129 (1129)
                      ||||+|||||||+|+||.|||.
T Consensus       980 SLvi~DELGRGtst~DG~aIA~ 1001 (1125)
T KOG0217|consen  980 SLVIVDELGRGTSTFDGTAIAE 1001 (1125)
T ss_pred             ceeeehhhcCcccccCCcchHH
Confidence            9999999999999999999994



>TIGR01070 mutS1 DNA mismatch repair protein MutS Back     alignment and domain information
>PRK05399 DNA mismatch repair protein MutS; Provisional Back     alignment and domain information
>COG0249 MutS Mismatch repair ATPase (MutS family) [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0218 consensus Mismatch repair MSH3 [Replication, recombination and repair] Back     alignment and domain information
>KOG0219 consensus Mismatch repair ATPase MSH2 (MutS family) [Replication, recombination and repair] Back     alignment and domain information
>KOG0220 consensus Mismatch repair ATPase MSH4 (MutS family) [Replication, recombination and repair] Back     alignment and domain information
>KOG0221 consensus Mismatch repair ATPase MSH5 (MutS family) [Replication, recombination and repair] Back     alignment and domain information
>PRK00409 recombination and DNA strand exchange inhibitor protein; Reviewed Back     alignment and domain information
>TIGR01069 mutS2 MutS2 family protein Back     alignment and domain information
>PF00488 MutS_V: MutS domain V C-terminus Back     alignment and domain information
>smart00533 MUTSd DNA-binding domain of DNA mismatch repair MUTS family Back     alignment and domain information
>COG1193 Mismatch repair ATPase (MutS family) [DNA replication, recombination, and repair] Back     alignment and domain information
>cd03286 ABC_MSH6_euk MutS6 homolog in eukaryotes Back     alignment and domain information
>cd03287 ABC_MSH3_euk MutS3 homolog in eukaryotes Back     alignment and domain information
>PF01624 MutS_I: MutS domain I C-terminus Back     alignment and domain information
>cd03285 ABC_MSH2_euk MutS2 homolog in eukaryotes Back     alignment and domain information
>cd03281 ABC_MSH5_euk MutS5 homolog in eukaryotes Back     alignment and domain information
>cd03282 ABC_MSH4_euk MutS4 homolog in eukaryotes Back     alignment and domain information
>cd03284 ABC_MutS1 MutS1 homolog in eukaryotes Back     alignment and domain information
>cd03280 ABC_MutS2 MutS2 homologs in bacteria and eukaryotes Back     alignment and domain information
>PF05192 MutS_III: MutS domain III C-terminus Back     alignment and domain information
>cd03243 ABC_MutS_homologs The MutS protein initiates DNA mismatch repair by recognizing mispaired and unpaired bases embedded in duplex DNA and activating endo- and exonucleases to remove the mismatch Back     alignment and domain information
>cd03283 ABC_MutS-like MutS-like homolog in eukaryotes Back     alignment and domain information
>smart00534 MUTSac ATPase domain of DNA mismatch repair MUTS family Back     alignment and domain information
>cd03227 ABC_Class2 ABC-type Class 2 contains systems involved in cellular processes other than transport Back     alignment and domain information
>PF05188 MutS_II: MutS domain II; InterPro: IPR007860 Mismatch repair contributes to the overall fidelity of DNA replication and is essential for combating the adverse effects of damage to the genome Back     alignment and domain information
>PF05190 MutS_IV: MutS family domain IV C-terminus Back     alignment and domain information
>PF09465 LBR_tudor: Lamin-B receptor of TUDOR domain; InterPro: IPR019023 The Lamin-B receptor is a chromatin and lamin binding protein in the inner nuclear membrane Back     alignment and domain information
>COG1121 ZnuC ABC-type Mn/Zn transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG1131 CcmA ABC-type multidrug transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>COG1120 FepC ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>COG0411 LivG ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>cd03214 ABC_Iron-Siderophores_B12_Hemin ABC transporters, involved in the uptake of siderophores, heme, and vitamin B12, are widely conserved in bacteria and archaea Back     alignment and domain information
>TIGR01188 drrA daunorubicin resistance ABC transporter ATP-binding subunit Back     alignment and domain information
>COG0410 LivF ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>COG4152 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>PRK13537 nodulation ABC transporter NodI; Provisional Back     alignment and domain information
>cd03216 ABC_Carb_Monos_I This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information
>PRK13536 nodulation factor exporter subunit NodI; Provisional Back     alignment and domain information
>COG4555 NatA ABC-type Na+ transport system, ATPase component [Energy production and conversion / Inorganic ion transport and metabolism] Back     alignment and domain information
>cd03230 ABC_DR_subfamily_A This family of ATP-binding proteins belongs to a multisubunit transporter involved in drug resistance (BcrA and DrrA), nodulation, lipid transport, and lantibiotic immunity Back     alignment and domain information
>cd03215 ABC_Carb_Monos_II This family represents domain II of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information
>cd03238 ABC_UvrA The excision repair protein UvrA; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion Back     alignment and domain information
>cd03221 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth Back     alignment and domain information
>cd03228 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-like transporters are involved in drug, peptide, and lipid export Back     alignment and domain information
>TIGR01166 cbiO cobalt transport protein ATP-binding subunit Back     alignment and domain information
>cd03263 ABC_subfamily_A The ABCA subfamily mediates the transport of a variety of lipid compounds Back     alignment and domain information
>TIGR03522 GldA_ABC_ATP gliding motility-associated ABC transporter ATP-binding subunit GldA Back     alignment and domain information
>cd03255 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of liporoteins from the cytoplasmic membrane (LolCDE) Back     alignment and domain information
>TIGR02673 FtsE cell division ATP-binding protein FtsE Back     alignment and domain information
>TIGR01288 nodI ATP-binding ABC transporter family nodulation protein NodI Back     alignment and domain information
>cd03265 ABC_DrrA DrrA is the ATP-binding protein component of a bacterial exporter complex that confers resistance to the antibiotics daunorubicin and doxorubicin Back     alignment and domain information
>cd00267 ABC_ATPase ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>cd03269 ABC_putative_ATPase This subfamily is involved in drug resistance, nodulation, lipid transport, and bacteriocin and lantibiotic immunity Back     alignment and domain information
>cd03292 ABC_FtsE_transporter FtsE is a hydrophilic nucleotide-binding protein that binds FtsX to form a heterodimeric ATP-binding cassette (ABC)-type transporter that associates with the bacterial inner membrane Back     alignment and domain information
>cd03213 ABCG_EPDR ABCG transporters are involved in eye pigment (EP) precursor transport, regulation of lipid-trafficking mechanisms, and pleiotropic drug resistance (DR) Back     alignment and domain information
>cd03225 ABC_cobalt_CbiO_domain1 Domain I of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota Back     alignment and domain information
>cd03268 ABC_BcrA_bacitracin_resist The BcrA subfamily represents ABC transporters involved in peptide antibiotic resistance Back     alignment and domain information
>TIGR03608 L_ocin_972_ABC putative bacteriocin export ABC transporter, lactococcin 972 group Back     alignment and domain information
>cd03226 ABC_cobalt_CbiO_domain2 Domain II of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota Back     alignment and domain information
>COG4619 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>cd03247 ABCC_cytochrome_bd The CYD subfamily implicated in cytochrome bd biogenesis Back     alignment and domain information
>cd03259 ABC_Carb_Solutes_like ABC Carbohydrate and Solute Transporters-like subgroup Back     alignment and domain information
>PRK10584 putative ABC transporter ATP-binding protein YbbA; Provisional Back     alignment and domain information
>cd03223 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette transporter (Pat) is involved in the import of very long-chain fatty acids (VLCFA) into the peroxisome Back     alignment and domain information
>cd03293 ABC_NrtD_SsuB_transporters NrtD and SsuB are the ATP-binding subunits of the bacterial ABC-type nitrate and sulfonate transport systems, respectively Back     alignment and domain information
>cd03244 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C Back     alignment and domain information
>TIGR02315 ABC_phnC phosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>cd03261 ABC_Org_Solvent_Resistant ABC (ATP-binding cassette) transport system involved in resistant to organic solvents; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>cd03258 ABC_MetN_methionine_transporter MetN (also known as YusC) is an ABC-type transporter encoded by metN of the metNPQ operon in Bacillus subtilis that is involved in methionine transport Back     alignment and domain information
>PRK09544 znuC high-affinity zinc transporter ATPase; Reviewed Back     alignment and domain information
>cd03229 ABC_Class3 This class is comprised of all BPD (Binding Protein Dependent) systems that are largely represented in archaea and eubacteria and are primarily involved in scavenging solutes from the environment Back     alignment and domain information
>PRK13540 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>PRK11264 putative amino-acid ABC transporter ATP-binding protein YecC; Provisional Back     alignment and domain information
>cd03262 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP-binding components of the bacterial periplasmic histidine and glutamine permeases, repectively Back     alignment and domain information
>cd03222 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor (RLI) is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids Back     alignment and domain information
>TIGR00960 3a0501s02 Type II (General) Secretory Pathway (IISP) Family protein Back     alignment and domain information
>cd03232 ABC_PDR_domain2 The pleiotropic drug resistance-like (PDR) family of ATP-binding cassette (ABC) transporters Back     alignment and domain information
>cd03235 ABC_Metallic_Cations ABC component of the metal-type transporters Back     alignment and domain information
>PRK11247 ssuB aliphatic sulfonates transport ATP-binding subunit; Provisional Back     alignment and domain information
>cd03294 ABC_Pro_Gly_Bertaine This family comprises the glycine betaine/L-proline ATP binding subunit in bacteria and its equivalents in archaea Back     alignment and domain information
>cd03218 ABC_YhbG The ABC transporters belonging to the YhbG family are similar to members of the Mj1267_LivG family, which is involved in the transport of branched-chain amino acids Back     alignment and domain information
>PRK11300 livG leucine/isoleucine/valine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK10247 putative ABC transporter ATP-binding protein YbbL; Provisional Back     alignment and domain information
>cd03246 ABCC_Protease_Secretion This family represents the ABC component of the protease secretion system PrtD, a 60-kDa integral membrane protein sharing 37% identity with HlyB, the ABC component of the alpha-hemolysin secretion pathway, in the C-terminal domain Back     alignment and domain information
>cd03266 ABC_NatA_sodium_exporter NatA is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled proton or K+ uptake Back     alignment and domain information
>cd03219 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC transporter subfamily is involved in the transport of the hydrophobic amino acids leucine, isoleucine and valine Back     alignment and domain information
>TIGR02211 LolD_lipo_ex lipoprotein releasing system, ATP-binding protein Back     alignment and domain information
>cd03301 ABC_MalK_N The N-terminal ATPase domain of the maltose transporter, MalK Back     alignment and domain information
>COG1119 ModF ABC-type molybdenum transport system, ATPase component/photorepair protein PhrA [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd03256 ABC_PhnC_transporter ABC-type phosphate/phosphonate transport system Back     alignment and domain information
>PF00005 ABC_tran: ABC transporter This structure is on hold until Dec 1999; InterPro: IPR003439 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energise diverse biological systems Back     alignment and domain information
>PRK11248 tauB taurine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03264 ABC_drug_resistance_like ABC-type multidrug transport system, ATPase component Back     alignment and domain information
>TIGR01189 ccmA heme ABC exporter, ATP-binding protein CcmA Back     alignment and domain information
>PRK11629 lolD lipoprotein transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR01978 sufC FeS assembly ATPase SufC Back     alignment and domain information
>cd03267 ABC_NatA_like Similar in sequence to NatA, this is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled to proton or K+ uptake Back     alignment and domain information
>TIGR03864 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system Back     alignment and domain information
>cd03250 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C Back     alignment and domain information
>PRK10908 cell division protein FtsE; Provisional Back     alignment and domain information
>TIGR01184 ntrCD nitrate transport ATP-binding subunits C and D Back     alignment and domain information
>PRK13539 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>TIGR02314 ABC_MetN D-methionine ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK13538 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>COG3839 MalK ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK13647 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13632 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03231 ABC_CcmA_heme_exporter CcmA, the ATP-binding component of the bacterial CcmAB transporter Back     alignment and domain information
>cd03278 ABC_SMC_barmotin Barmotin is a tight junction-associated protein expressed in rat epithelial cells which is thought to have an important regulatory role in tight junction barrier function Back     alignment and domain information
>cd03220 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transporter subfamily is involved in extracellular polysaccharide export Back     alignment and domain information
>cd03296 ABC_CysA_sulfate_importer Part of the ABC transporter complex cysAWTP involved in sulfate import Back     alignment and domain information
>TIGR03005 ectoine_ehuA ectoine/hydroxyectoine ABC transporter, ATP-binding protein Back     alignment and domain information
>TIGR01277 thiQ thiamine ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK10895 lipopolysaccharide ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG1137 YhbG ABC-type (unclassified) transport system, ATPase component [General function prediction only] Back     alignment and domain information
>cd03260 ABC_PstB_phosphate_transporter Phosphate uptake is of fundamental importance in the cell physiology of bacteria because phosphate is required as a nutrient Back     alignment and domain information
>cd03237 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 of RNase L inhibitor Back     alignment and domain information
>PRK09984 phosphonate/organophosphate ester transporter subunit; Provisional Back     alignment and domain information
>TIGR00968 3a0106s01 sulfate ABC transporter, ATP-binding protein Back     alignment and domain information
>TIGR03410 urea_trans_UrtE urea ABC transporter, ATP-binding protein UrtE Back     alignment and domain information
>PRK11650 ugpC glycerol-3-phosphate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG1116 TauB ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK11000 maltose/maltodextrin transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13635 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13638 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03217 ABC_FeS_Assembly ABC-type transport system involved in Fe-S cluster assembly, ATPase component Back     alignment and domain information
>PRK11831 putative ABC transporter ATP-binding protein YrbF; Provisional Back     alignment and domain information
>cd03295 ABC_OpuCA_Osmoprotection OpuCA is a the ATP binding component of a bacterial solute transporter that serves a protective role to cells growing in a hyperosmolar environment Back     alignment and domain information
>PRK14275 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13541 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>PRK09493 glnQ glutamine ABC transporter ATP-binding protein; Reviewed Back     alignment and domain information
>cd03298 ABC_ThiQ_thiamine_transporter ABC-type thiamine tranport system; part of the binding-protein-dependent transport system tbpA-thiPQ for thiamine and TPP Back     alignment and domain information
>PRK13546 teichoic acids export protein ATP-binding subunit; Provisional Back     alignment and domain information
>cd03245 ABCC_bacteriocin_exporters ABC-type bacteriocin exporters Back     alignment and domain information
>PRK10253 iron-enterobactin transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG3842 PotA ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>PRK13637 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13641 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR03411 urea_trans_UrtD urea ABC transporter, ATP-binding protein UrtD Back     alignment and domain information
>PRK14250 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03224 ABC_TM1139_LivF_branched LivF (TM1139) is part of the LIV-I bacterial ABC-type two-component transport system that imports neutral, branched-chain amino acids Back     alignment and domain information
>PRK13548 hmuV hemin importer ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR03740 galliderm_ABC gallidermin-class lantibiotic protection ABC transporter, ATP-binding subunit Back     alignment and domain information
>PRK11153 metN DL-methionine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14245 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13644 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13633 cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK03695 vitamin B12-transporter ATPase; Provisional Back     alignment and domain information
>cd03233 ABC_PDR_domain1 The pleiotropic drug resistance (PDR) family of ATP-binding cassette (ABC) transporters Back     alignment and domain information
>KOG4675 consensus Uncharacterized conserved protein, contains ENT domain [General function prediction only] Back     alignment and domain information
>PRK13648 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG4133 CcmA ABC-type transport system involved in cytochrome c biogenesis, ATPase component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK13547 hmuV hemin importer ATP-binding subunit; Provisional Back     alignment and domain information
>COG1118 CysA ABC-type sulfate/molybdate transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK15439 autoinducer 2 ABC transporter ATP-binding protein LsrA; Provisional Back     alignment and domain information
>TIGR03265 PhnT2 putative 2-aminoethylphosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK13646 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK10575 iron-hydroxamate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK15177 Vi polysaccharide export ATP-binding protein VexC; Provisional Back     alignment and domain information
>PRK14264 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR02770 nickel_nikD nickel import ATP-binding protein NikD Back     alignment and domain information
>TIGR01186 proV glycine betaine/L-proline transport ATP binding subunit Back     alignment and domain information
>PRK11124 artP arginine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK09536 btuD corrinoid ABC transporter ATPase; Reviewed Back     alignment and domain information
>PRK13652 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR02982 heterocyst_DevA ABC exporter ATP-binding subunit, DevA family Back     alignment and domain information
>TIGR00972 3a0107s01c2 phosphate ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK11614 livF leucine/isoleucine/valine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK10419 nikE nickel transporter ATP-binding protein NikE; Provisional Back     alignment and domain information
>cd03257 ABC_NikE_OppD_transporters The ABC transporter subfamily specific for the transport of dipeptides, oligopeptides (OppD), and nickel (NikDE) Back     alignment and domain information
>PRK13543 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>TIGR03873 F420-0_ABC_ATP proposed F420-0 ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK13640 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK10771 thiQ thiamine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR02142 modC_ABC molybdenum ABC transporter, ATP-binding protein Back     alignment and domain information
>TIGR03258 PhnT 2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT Back     alignment and domain information
>cd03252 ABCC_Hemolysin The ABC-transporter hemolysin B is a central component of the secretion machinery that translocates the toxin, hemolysin A, in a Sec-independent fashion across both membranes of E Back     alignment and domain information
>PRK11432 fbpC ferric transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK15056 manganese/iron transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10744 pstB phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR02323 CP_lyasePhnK phosphonate C-P lyase system protein PhnK Back     alignment and domain information
>PRK11144 modC molybdate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11231 fecE iron-dicitrate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR02769 nickel_nikE nickel import ATP-binding protein NikE Back     alignment and domain information
>cd03297 ABC_ModC_molybdenum_transporter ModC is an ABC-type transporter and the ATPase component of a molybdate transport system that also includes the periplasmic binding protein ModA and the membrane protein ModB Back     alignment and domain information
>PRK14237 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13649 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03300 ABC_PotA_N PotA is an ABC-type transporter and the ATPase component of the spermidine/putrescine-preferential uptake system consisting of PotA, -B, -C, and -D Back     alignment and domain information
>PRK10938 putative molybdenum transport ATP-binding protein ModF; Provisional Back     alignment and domain information
>COG1134 TagH ABC-type polysaccharide/polyol phosphate transport system, ATPase component [Carbohydrate transport and metabolism / Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK14242 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10619 histidine/lysine/arginine/ornithine transporter subunit; Provisional Back     alignment and domain information
>PRK10851 sulfate/thiosulfate transporter subunit; Provisional Back     alignment and domain information
>PRK15112 antimicrobial peptide ABC system ATP-binding protein SapF; Provisional Back     alignment and domain information
>PRK14268 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK09452 potA putrescine/spermidine ABC transporter ATPase protein; Reviewed Back     alignment and domain information
>COG0396 sufC Cysteine desulfurase activator ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK13636 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03251 ABCC_MsbA MsbA is an essential ABC transporter, closely related to eukaryotic MDR proteins Back     alignment and domain information
>PRK13545 tagH teichoic acids export protein ATP-binding subunit; Provisional Back     alignment and domain information
>cd03254 ABCC_Glucan_exporter_like Glucan exporter ATP-binding protein Back     alignment and domain information
>PRK10070 glycine betaine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14269 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03249 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) is a mitochondrial ATP-binding cassette protein involved in iron homeostasis and one of four ABC transporters expressed in the mitochondrial inner membrane, the other three being MDL1(ABC7), MDL2, and ATM1 Back     alignment and domain information
>cd03236 ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 of RNase L inhibitor Back     alignment and domain information
>PRK10418 nikD nickel transporter ATP-binding protein NikD; Provisional Back     alignment and domain information
>COG1127 Ttg2A ABC-type transport system involved in resistance to organic solvents, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PRK11607 potG putrescine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14235 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13650 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03248 ABCC_TAP TAP, the Transporter Associated with Antigen Processing; TAP is essential for peptide delivery from the cytosol into the lumen of the endoplasmic reticulum (ER), where these peptides are loaded on major histocompatibility complex (MHC) I molecules Back     alignment and domain information
>cd03253 ABCC_ATM1_transporter ATM1 is an ABC transporter that is expressed in the mitochondria Back     alignment and domain information
>cd03234 ABCG_White The White subfamily represents ABC transporters homologous to the Drosophila white gene, which acts as a dimeric importer for eye pigment precursors Back     alignment and domain information
>PRK14241 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13639 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG0488 Uup ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] Back     alignment and domain information
>PRK14273 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14254 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11701 phnK phosphonate C-P lyase system protein PhnK; Provisional Back     alignment and domain information
>PRK13651 cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG4674 Uncharacterized ABC-type transport system, ATPase component [General function prediction only] Back     alignment and domain information
>PRK14244 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>PRK10938 putative molybdenum transport ATP-binding protein ModF; Provisional Back     alignment and domain information
>PRK14261 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13549 xylose transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR02324 CP_lyasePhnL phosphonate C-P lyase system protein PhnL Back     alignment and domain information
>PRK10762 D-ribose transporter ATP binding protein; Provisional Back     alignment and domain information
>PRK14274 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK09700 D-allose transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14265 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10636 putative ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14251 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14248 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13642 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14256 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR03269 met_CoM_red_A2 methyl coenzyme M reductase system, component A2 Back     alignment and domain information
>PRK14262 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14247 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14239 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13645 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR03771 anch_rpt_ABC anchored repeat-type ABC transporter, ATP-binding subunit Back     alignment and domain information
>PRK14267 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR01257 rim_protein retinal-specific rim ABC transporter Back     alignment and domain information
>COG1129 MglA ABC-type sugar transport system, ATPase component [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK14259 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK15064 ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13631 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14260 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13634 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK15079 oligopeptide ABC transporter ATP-binding protein OppF; Provisional Back     alignment and domain information
>cd03289 ABCC_CFTR2 The CFTR subfamily domain 2 Back     alignment and domain information
>COG3638 ABC-type phosphate/phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG0219 consensus Mismatch repair ATPase MSH2 (MutS family) [Replication, recombination and repair] Back     alignment and domain information
>PRK14253 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13409 putative ATPase RIL; Provisional Back     alignment and domain information
>PRK14271 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10636 putative ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>CHL00131 ycf16 sulfate ABC transporter protein; Validated Back     alignment and domain information
>TIGR03719 ABC_ABC_ChvD ATP-binding cassette protein, ChvD family Back     alignment and domain information
>PRK11819 putative ABC transporter ATP-binding protein; Reviewed Back     alignment and domain information
>COG1136 SalX ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>PRK10982 galactose/methyl galaxtoside transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11819 putative ABC transporter ATP-binding protein; Reviewed Back     alignment and domain information
>PRK14240 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR03415 ABC_choXWV_ATP choline ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK14270 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14263 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14246 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03369 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-type transporter 1) Back     alignment and domain information
>cd03299 ABC_ModC_like Archeal protein closely related to ModC Back     alignment and domain information
>PRK13409 putative ATPase RIL; Provisional Back     alignment and domain information
>TIGR03269 met_CoM_red_A2 methyl coenzyme M reductase system, component A2 Back     alignment and domain information
>COG1122 CbiO ABC-type cobalt transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG4604 CeuD ABC-type enterochelin transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK15064 ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14255 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR01257 rim_protein retinal-specific rim ABC transporter Back     alignment and domain information
>cd03291 ABCC_CFTR1 The CFTR subfamily domain 1 Back     alignment and domain information
>PRK14249 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK15439 autoinducer 2 ABC transporter ATP-binding protein LsrA; Provisional Back     alignment and domain information
>KOG0062 consensus ATPase component of ABC transporters with duplicated ATPase domains/Translation elongation factor EF-3b [Amino acid transport and metabolism; Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK14243 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK09580 sufC cysteine desulfurase ATPase component; Reviewed Back     alignment and domain information
>cd03290 ABCC_SUR1_N The SUR domain 1 Back     alignment and domain information
>PRK15134 microcin C ABC transporter ATP-binding protein YejF; Provisional Back     alignment and domain information
>cd03288 ABCC_SUR2 The SUR domain 2 Back     alignment and domain information
>PRK11288 araG L-arabinose transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14252 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14266 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13643 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14238 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03239 ABC_SMC_head The structural maintenance of chromosomes (SMC) proteins are essential for successful chromosome transmission during replication and segregation of the genome in all organisms Back     alignment and domain information
>PRK14272 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR02633 xylG D-xylose ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK09700 D-allose transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14236 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR02633 xylG D-xylose ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK15134 microcin C ABC transporter ATP-binding protein YejF; Provisional Back     alignment and domain information
>TIGR03719 ABC_ABC_ChvD ATP-binding cassette protein, ChvD family Back     alignment and domain information
>PRK11147 ABC transporter ATPase component; Reviewed Back     alignment and domain information
>COG2274 SunT ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain [Defense mechanisms] Back     alignment and domain information
>PRK13549 xylose transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG3840 ThiQ ABC-type thiamine transport system, ATPase component [Coenzyme metabolism] Back     alignment and domain information
>PRK14257 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10261 glutathione transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11288 araG L-arabinose transporter ATP-binding protein; Provisional Back     alignment and domain information
>PLN03073 ABC transporter F family; Provisional Back     alignment and domain information
>cd03274 ABC_SMC4_euk Eukaryotic SMC4 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains Back     alignment and domain information
>cd03279 ABC_sbcCD SbcCD and other Mre11/Rad50 (MR) complexes are implicated in the metabolism of DNA ends Back     alignment and domain information
>PRK14258 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PLN03211 ABC transporter G-25; Provisional Back     alignment and domain information
>PRK10762 D-ribose transporter ATP binding protein; Provisional Back     alignment and domain information
>PRK11022 dppD dipeptide transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11147 ABC transporter ATPase component; Reviewed Back     alignment and domain information
>COG4586 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>cd03272 ABC_SMC3_euk Eukaryotic SMC3 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains Back     alignment and domain information
>PRK10982 galactose/methyl galaxtoside transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK15093 antimicrobial peptide ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03270 ABC_UvrA_I The excision repair protein UvrA domain I; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion Back     alignment and domain information
>COG1125 OpuBA ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR01842 type_I_sec_PrtD type I secretion system ABC transporter, PrtD family Back     alignment and domain information
>TIGR00954 3a01203 Peroxysomal Fatty Acyl CoA Transporter (FAT) Family protei Back     alignment and domain information
>PRK11308 dppF dipeptide transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK10261 glutathione transporter ATP-binding protein; Provisional Back     alignment and domain information
>KOG0927 consensus Predicted transporter (ABC superfamily) [General function prediction only] Back     alignment and domain information
>TIGR02204 MsbA_rel ABC transporter, permease/ATP-binding protein Back     alignment and domain information
>COG3845 ABC-type uncharacterized transport systems, ATPase components [General function prediction only] Back     alignment and domain information
>PRK13657 cyclic beta-1,2-glucan ABC transporter; Provisional Back     alignment and domain information
>PRK10522 multidrug transporter membrane component/ATP-binding component; Provisional Back     alignment and domain information
>PRK10535 macrolide transporter ATP-binding /permease protein; Provisional Back     alignment and domain information
>COG1117 PstB ABC-type phosphate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR03797 NHPM_micro_ABC2 NHPM bacteriocin system ABC transporter, ATP-binding protein Back     alignment and domain information
>COG0488 Uup ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] Back     alignment and domain information
>COG4778 PhnL ABC-type phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK10789 putative multidrug transporter membrane\ATP-binding components; Provisional Back     alignment and domain information
>TIGR01192 chvA glucan exporter ATP-binding protein Back     alignment and domain information
>COG4559 ABC-type hemin transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>smart00382 AAA ATPases associated with a variety of cellular activities Back     alignment and domain information
>TIGR01187 potA spermidine/putrescine ABC transporter ATP-binding subunit Back     alignment and domain information
>PLN03073 ABC transporter F family; Provisional Back     alignment and domain information
>TIGR03375 type_I_sec_LssB type I secretion system ATPase, LssB family Back     alignment and domain information
>PRK10790 putative multidrug transporter membrane\ATP-binding components; Provisional Back     alignment and domain information
>COG1101 PhnK ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>cd03275 ABC_SMC1_euk Eukaryotic SMC1 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains Back     alignment and domain information
>cd03277 ABC_SMC5_euk Eukaryotic SMC5 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains Back     alignment and domain information
>TIGR00955 3a01204 The Eye Pigment Precursor Transporter (EPP) Family protein Back     alignment and domain information
>PRK11174 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed Back     alignment and domain information
>cd03276 ABC_SMC6_euk Eukaryotic SMC6 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains Back     alignment and domain information
>COG4988 CydD ABC-type transport system involved in cytochrome bd biosynthesis, ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00333 TUDOR Tudor domain Back     alignment and domain information
>PRK09473 oppD oligopeptide transporter ATP-binding component; Provisional Back     alignment and domain information
>cd03271 ABC_UvrA_II The excision repair protein UvrA domain II; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion Back     alignment and domain information
>TIGR03796 NHPM_micro_ABC1 NHPM bacteriocin system ABC transporter, peptidase/ATP-binding protein Back     alignment and domain information
>cd03240 ABC_Rad50 The catalytic domains of Rad50 are similar to the ATP-binding cassette of ABC transporters, but are not associated with membrane-spanning domains Back     alignment and domain information
>COG2884 FtsE Predicted ATPase involved in cell division [Cell division and chromosome partitioning] Back     alignment and domain information
>PRK11160 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed Back     alignment and domain information
>TIGR02203 MsbA_lipidA lipid A export permease/ATP-binding protein MsbA Back     alignment and domain information
>TIGR01194 cyc_pep_trnsptr cyclic peptide transporter Back     alignment and domain information
>PF13555 AAA_29: P-loop containing region of AAA domain Back     alignment and domain information
>PTZ00243 ABC transporter; Provisional Back     alignment and domain information
>TIGR02857 CydD thiol reductant ABC exporter, CydD subunit Back     alignment and domain information
>KOG0059 consensus Lipid exporter ABCA1 and related proteins, ABC superfamily [Lipid transport and metabolism; General function prediction only] Back     alignment and domain information
>TIGR01193 bacteriocin_ABC ABC-type bacteriocin transporter Back     alignment and domain information
>COG4615 PvdE ABC-type siderophore export system, fused ATPase and permease components [Secondary metabolites biosynthesis, transport, and catabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG0927 consensus Predicted transporter (ABC superfamily) [General function prediction only] Back     alignment and domain information
>PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>TIGR00958 3a01208 Conjugate Transporter-2 (CT2) Family protein Back     alignment and domain information
>TIGR01846 type_I_sec_HlyB type I secretion system ABC transporter, HlyB family Back     alignment and domain information
>TIGR02868 CydC thiol reductant ABC exporter, CydC subunit Back     alignment and domain information
>PLN03140 ABC transporter G family member; Provisional Back     alignment and domain information
>COG4148 ModC ABC-type molybdate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd04508 TUDOR Tudor domains are found in many eukaryotic organisms and have been implicated in protein-protein interactions in which methylated protein substrates bind to these domains Back     alignment and domain information
>TIGR01271 CFTR_protein cystic fibrosis transmembrane conductor regulator (CFTR) Back     alignment and domain information
>COG4525 TauB ABC-type taurine transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>smart00743 Agenet Tudor-like domain present in plant sequences Back     alignment and domain information
>COG4178 ABC-type uncharacterized transport system, permease and ATPase components [General function prediction only] Back     alignment and domain information
>PRK06995 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>PTZ00265 multidrug resistance protein (mdr1); Provisional Back     alignment and domain information
>TIGR00956 3a01205 Pleiotropic Drug Resistance (PDR) Family protein Back     alignment and domain information
>PRK14721 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK11176 lipid transporter ATP-binding/permease protein; Provisional Back     alignment and domain information
>COG1124 DppF ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG0064 consensus Peroxisomal long-chain acyl-CoA transporter, ABC superfamily [Lipid transport and metabolism] Back     alignment and domain information
>PLN03140 ABC transporter G family member; Provisional Back     alignment and domain information
>COG3910 Predicted ATPase [General function prediction only] Back     alignment and domain information
>cd03273 ABC_SMC2_euk Eukaryotic SMC2 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains Back     alignment and domain information
>COG4107 PhnK ABC-type phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG0061 consensus Transporter, ABC superfamily (Breast cancer resistance protein) [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>TIGR00956 3a01205 Pleiotropic Drug Resistance (PDR) Family protein Back     alignment and domain information
>COG2401 ABC-type ATPase fused to a predicted acetyltransferase domain [General function prediction only] Back     alignment and domain information
>PRK12727 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>KOG0057 consensus Mitochondrial Fe/S cluster exporter, ABC superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG4138 BtuD ABC-type cobalamin transport system, ATPase component [Coenzyme metabolism] Back     alignment and domain information
>TIGR00957 MRP_assoc_pro multi drug resistance-associated protein (MRP) Back     alignment and domain information
>PRK14723 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>COG4598 HisP ABC-type histidine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>PRK13695 putative NTPase; Provisional Back     alignment and domain information
>COG1132 MdlB ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms] Back     alignment and domain information
>KOG0060 consensus Long-chain acyl-CoA transporter, ABC superfamily (involved in peroxisome organization and biogenesis) [Lipid transport and metabolism; General function prediction only] Back     alignment and domain information
>PF09038 53-BP1_Tudor: Tumour suppressor p53-binding protein-1 Tudor; InterPro: IPR015125 This domain consist of ten beta-strands and a carboxy-terminal alpha-helix Back     alignment and domain information
>COG4608 AppF ABC-type oligopeptide transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR03499 FlhF flagellar biosynthetic protein FlhF Back     alignment and domain information
>TIGR02858 spore_III_AA stage III sporulation protein AA Back     alignment and domain information
>COG4618 ArpD ABC-type protease/lipase transport system, ATPase and permease components [General function prediction only] Back     alignment and domain information
>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport Back     alignment and domain information
>PRK12723 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>COG1135 AbcC ABC-type metal ion transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>PRK09183 transposase/IS protein; Provisional Back     alignment and domain information
>KOG0056 consensus Heavy metal exporter HMT1, ABC superfamily [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily Back     alignment and domain information
>COG4175 ProV ABC-type proline/glycine betaine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>COG1618 Predicted nucleotide kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK04296 thymidine kinase; Provisional Back     alignment and domain information
>cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases Back     alignment and domain information
>COG1245 Predicted ATPase, RNase L inhibitor (RLI) homolog [General function prediction only] Back     alignment and domain information
>PLN03232 ABC transporter C family member; Provisional Back     alignment and domain information
>COG4987 CydC ABC-type transport system involved in cytochrome bd biosynthesis, fused ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14974 cell division protein FtsY; Provisional Back     alignment and domain information
>cd00820 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPCK), a critical gluconeogenic enzyme, catalyzes the first committed step in the diversion of tricarboxylic acid cycle intermediates toward gluconeogenesis Back     alignment and domain information
>PF03266 NTPase_1: NTPase; InterPro: IPR004948 This entry represents a family of nucleoside-triphosphatases which have activity towards ATP, GTP, CTP, TTP and UTP and may hydrolyse nucleoside diphosphates with lower efficiency [] Back     alignment and domain information
>PRK08533 flagellar accessory protein FlaH; Reviewed Back     alignment and domain information
>cd01120 RecA-like_NTPases RecA-like NTPases Back     alignment and domain information
>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B Back     alignment and domain information
>PF13173 AAA_14: AAA domain Back     alignment and domain information
>COG4181 Predicted ABC-type transport system involved in lysophospholipase L1 biosynthesis, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PF13476 AAA_23: AAA domain; PDB: 3AV0_B 3AUY_B 3AUX_A 2O5V_A 3QG5_B 3QF7_A 3THO_A Back     alignment and domain information
>PRK06731 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>PRK06067 flagellar accessory protein FlaH; Validated Back     alignment and domain information
>PRK10416 signal recognition particle-docking protein FtsY; Provisional Back     alignment and domain information
>PLN03130 ABC transporter C family member; Provisional Back     alignment and domain information
>PRK10078 ribose 1,5-bisphosphokinase; Provisional Back     alignment and domain information
>COG1123 ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] Back     alignment and domain information
>TIGR00602 rad24 checkpoint protein rad24 Back     alignment and domain information
>PHA00729 NTP-binding motif containing protein Back     alignment and domain information
>PRK06526 transposase; Provisional Back     alignment and domain information
>TIGR02322 phosphon_PhnN phosphonate metabolism protein/1,5-bisphosphokinase (PRPP-forming) PhnN Back     alignment and domain information
>TIGR00750 lao LAO/AO transport system ATPase Back     alignment and domain information
>KOG0055 consensus Multidrug/pheromone exporter, ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK12726 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK06921 hypothetical protein; Provisional Back     alignment and domain information
>PF05729 NACHT: NACHT domain Back     alignment and domain information
>PLN03232 ABC transporter C family member; Provisional Back     alignment and domain information
>KOG1970 consensus Checkpoint RAD17-RFC complex, RAD17/RAD24 component [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] Back     alignment and domain information
>TIGR01271 CFTR_protein cystic fibrosis transmembrane conductor regulator (CFTR) Back     alignment and domain information
>TIGR00235 udk uridine kinase Back     alignment and domain information
>PRK09825 idnK D-gluconate kinase; Provisional Back     alignment and domain information
>COG3950 Predicted ATP-binding protein involved in virulence [General function prediction only] Back     alignment and domain information
>PRK00349 uvrA excinuclease ABC subunit A; Reviewed Back     alignment and domain information
>TIGR03263 guanyl_kin guanylate kinase Back     alignment and domain information
>cd01131 PilT Pilus retraction ATPase PilT Back     alignment and domain information
>COG4161 ArtP ABC-type arginine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>cd01128 rho_factor Transcription termination factor rho is a bacterial ATP-dependent RNA/DNA helicase Back     alignment and domain information
>PTZ00243 ABC transporter; Provisional Back     alignment and domain information
>TIGR02788 VirB11 P-type DNA transfer ATPase VirB11 Back     alignment and domain information
>PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] Back     alignment and domain information
>PTZ00265 multidrug resistance protein (mdr1); Provisional Back     alignment and domain information
>PLN03130 ABC transporter C family member; Provisional Back     alignment and domain information
>PF03215 Rad17: Rad17 cell cycle checkpoint protein Back     alignment and domain information
>cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes Back     alignment and domain information
>KOG0066 consensus eIF2-interacting protein ABC50 (ABC superfamily) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0058 consensus Peptide exporter, ABC superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd01121 Sms Sms (bacterial radA) DNA repair protein Back     alignment and domain information
>cd02025 PanK Pantothenate kinase (PanK) catalyzes the phosphorylation of pantothenic acid to form 4'-phosphopantothenic, which is the first of five steps in coenzyme A (CoA) biosynthetic pathway Back     alignment and domain information
>COG4136 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>PRK09270 nucleoside triphosphate hydrolase domain-containing protein; Reviewed Back     alignment and domain information
>PRK00771 signal recognition particle protein Srp54; Provisional Back     alignment and domain information
>PRK12377 putative replication protein; Provisional Back     alignment and domain information
>PRK09435 membrane ATPase/protein kinase; Provisional Back     alignment and domain information
>TIGR02237 recomb_radB DNA repair and recombination protein RadB Back     alignment and domain information
>PRK07952 DNA replication protein DnaC; Validated Back     alignment and domain information
>cd02023 UMPK Uridine monophosphate kinase (UMPK, EC 2 Back     alignment and domain information
>PRK06893 DNA replication initiation factor; Validated Back     alignment and domain information
>PF02463 SMC_N: RecF/RecN/SMC N terminal domain; InterPro: IPR003395 This domain is found at the N terminus of structural maintenance of chromosomes (SMC) proteins, which function together with other proteins in a range of chromosomal transactions, including chromosome condensation, sister-chromatid cohesion, recombination, DNA repair and epigenetic silencing of gene expression [] Back     alignment and domain information
>TIGR03238 dnd_assoc_3 dnd system-associated protein 3 Back     alignment and domain information
>PLN00104 MYST -like histone acetyltransferase; Provisional Back     alignment and domain information
>TIGR00554 panK_bact pantothenate kinase, bacterial type Back     alignment and domain information
>cd01123 Rad51_DMC1_radA Rad51_DMC1_radA,B Back     alignment and domain information
>KOG2355 consensus Predicted ABC-type transport, ATPase component/CCR4 associated factor [General function prediction only; Transcription] Back     alignment and domain information
>cd03241 ABC_RecN RecN ATPase involved in DNA repair; ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds including sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>cd03242 ABC_RecF RecF is a recombinational DNA repair ATPase that maintains replication in the presence of DNA damage Back     alignment and domain information
>COG1245 Predicted ATPase, RNase L inhibitor (RLI) homolog [General function prediction only] Back     alignment and domain information
>PF13304 AAA_21: AAA domain; PDB: 3QKS_B 1US8_B 1F2U_B 1F2T_B 3QKT_A 1II8_B 3QKR_B 3QKU_A Back     alignment and domain information
>TIGR00957 MRP_assoc_pro multi drug resistance-associated protein (MRP) Back     alignment and domain information
>COG4167 SapF ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>PRK00300 gmk guanylate kinase; Provisional Back     alignment and domain information
>PRK05416 glmZ(sRNA)-inactivating NTPase; Provisional Back     alignment and domain information
>PRK08181 transposase; Validated Back     alignment and domain information
>cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs Back     alignment and domain information
>PRK00411 cdc6 cell division control protein 6; Reviewed Back     alignment and domain information
>PRK05480 uridine/cytidine kinase; Provisional Back     alignment and domain information
>PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A Back     alignment and domain information
>TIGR00064 ftsY signal recognition particle-docking protein FtsY Back     alignment and domain information
>TIGR01360 aden_kin_iso1 adenylate kinase, isozyme 1 subfamily Back     alignment and domain information
>TIGR02524 dot_icm_DotB Dot/Icm secretion system ATPase DotB Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1129
2o8b_B 1022 Human Mutsalpha (Msh2MSH6) BOUND TO ADP AND A G T M 1e-161
3thw_B 918 Human Mutsbeta Complexed With An Idl Of 4 Bases (Lo 2e-71
1wbb_A800 Crystal Structure Of E. Coli Dna Mismatch Repair En 2e-43
1wbd_A800 Crystal Structure Of E. Coli Dna Mismatch Repair En 2e-43
1wb9_A800 Crystal Structure Of E. Coli Dna Mismatch Repair En 2e-43
1oh5_A800 The Crystal Structure Of E. Coli Muts Binding To Dn 2e-43
3k0s_A799 Crystal Structure Of E.Coli Dna Mismatch Repair Pro 9e-43
1ng9_A800 E.Coli Muts R697a: An Atpase-Asymmetry Mutant Lengt 1e-42
1nne_A765 Crystal Structure Of The Muts-adpbef3-dna Complex L 1e-41
2o8e_A 934 Human Mutsalpha (Msh2MSH6) BOUND TO A G T MISPAIR, 2e-40
2o8b_A 934 Human Mutsalpha (Msh2MSH6) BOUND TO ADP AND A G T M 2e-40
1e3m_A800 The Crystal Structure Of E. Coli Muts Binding To Dn 4e-39
1ewr_A649 Crystal Structure Of Taq Muts Length = 649 4e-39
1fw6_A768 Crystal Structure Of A Taq Muts-Dna-Adp Ternary Com 7e-39
1ewq_A765 Crystal Structure Taq Muts Complexed With A Heterod 7e-39
>pdb|2O8B|B Chain B, Human Mutsalpha (Msh2MSH6) BOUND TO ADP AND A G T MISPAIR Length = 1022 Back     alignment and structure

Iteration: 1

Score = 567 bits (1462), Expect = e-161, Method: Compositional matrix adjust. Identities = 338/889 (38%), Positives = 500/889 (56%), Gaps = 52/889 (5%) Query: 278 GDVSERFSAREADKFHFLGPD-RRDAKRRRPGDVYYDPRTLYLPPDFLRNLSEGQKQWWE 336 GD S R + + +L + RRD RRRP +D TLY+P DFL + + G ++WW+ Sbjct: 18 GDDSSRPTVWYHETLEWLKEEKRRDEHRRRPDHPDFDASTLYVPEDFLNSCTPGMRKWWQ 77 Query: 337 FKSKHMDKVIFFKMGKFYELFEMDAHVGAKELDLQYMKGEQPHCGFPERNFSMNVEKLAR 396 KS++ D VI +K+GKFYEL+ MDA +G EL L +MKG H GFPE F + L + Sbjct: 78 IKSQNFDLVICYKVGKFYELYHMDALIGVSELGLVFMKGNWAHSGFPEIAFGRYSDSLVQ 137 Query: 397 KGYRVLVVEQTETPEQLELRRKEKG---SKDKVVKREICAVVTKGTLTEGELLSANPD-- 451 KGY+V VEQTETPE +E R ++ D+VV+REIC ++TKGT T +L +P Sbjct: 138 KGYKVARVEQTETPEMMEARCRKMAHISKYDRVVRREICRIITKGTQTYS-VLEGDPSEN 196 Query: 452 -ASYLMALTESNQSPASQSTDRCFGICVVDVATSRIILGQVMXXXXXXXXXXXXXXXRPV 510 + YL++L E + + + R +G+C VD + + +GQ PV Sbjct: 197 YSKYLLSLKEKEEDSSGHT--RAYGVCFVDTSLGKFFIGQFSDDRHCSRFRTLVAHYPPV 254 Query: 511 EIIKPANMLSPETERAILRHTRNPLVNDLVPLSEFWDAETTV---LEIKNIYNRITAESL 567 +++ LS ET+ + L L+P S+FWDA T+ LE + +++ Sbjct: 255 QVLFEKGNLSKETKTILKSSLSCSLQEGLIPGSQFWDASKTLRTLLEEEYFREKLSDGIG 314 Query: 568 NKADSNVANSQAEGDGLTCLPGILSELISTGDSGSQVLSALGGTLFYLKKSFLDETLLRF 627 + +E D + PG SEL LSALGG +FYLKK +D+ LL Sbjct: 315 VMLPQVLKGMTSESDSIGLTPGEKSEL---------ALSALGGCVFYLKKCLIDQELLSM 365 Query: 628 AKFE--------LLPCSGFGDMAKKPY--MVLDAPALENLEVFENSRSGDSSGTLYAQLN 677 A FE + + G + K Y MVLDA L NLE+F N +G + GTL +++ Sbjct: 366 ANFEEYIPLDSDTVSTTRSGAIFTKAYQRMVLDAVTLNNLEIFLNGTNGSTEGTLLERVD 425 Query: 678 HCVTAFGKRLLRTWLARPLYNSGLIRERQDAVAGLRGVNQPFALEFRKALSRLPDMERLL 737 C T FGKRLL+ WL PL N I +R DA+ L V + E + L +LPD+ERLL Sbjct: 426 TCHTPFGKRLLKQWLCAPLCNHYAINDRLDAIEDLMVVPDKIS-EVVELLKKLPDLERLL 484 Query: 738 ARLF---ASSEANGRNSNKVVLYEDA--AKKQLQEFISALHGCELMDQACSSLGAILENT 792 +++ + ++ ++ ++YE+ +KK++ +F+SAL G ++M + + + + Sbjct: 485 SKIHNVGSPLKSQNHPDSRAIMYEETTYSKKKIIDFLSALEGFKVMCKIIGIMEEVADGF 544 Query: 793 ESRQLHHILT-----PGKGLPAIVSILKHFKDAFDWVEANNSGRIIPHGGVDMDYDSACK 847 +S+ L +++ P P + L + AFD +A +G I P G D DYD A Sbjct: 545 KSKILKQVISLQTKNPEGRFPDLTVELNRWDTAFDHEKARKTGLITPKAGFDSDYDQALA 604 Query: 848 KVKEIEASLTKHLKEQRKLLGDTSITYVTIGKDLYLLEVPESLRG-SVPRDYELRSSKKG 906 ++E E SL ++L++QR +G +I Y IG++ Y LE+PE+ ++P +YEL+S+KKG Sbjct: 605 DIRENEQSLLEYLEKQRNRIGCRTIVYWGIGRNRYQLEIPENFTTRNLPEEYELKSTKKG 664 Query: 907 FFRYWTPNIKKLLGELSQAESEKESALKSILQRLIGQFCEHHNKWRQMVAATAELDALIS 966 RYWT I+K L L AE ++ +LK ++RL F +++ W+ V A LD L+ Sbjct: 665 CKRYWTKTIEKKLANLINAEERRDVSLKDCMRRLFYNFDKNYKDWQSAVECIAVLDVLLC 724 Query: 967 LAIASDFYEGPTCRPVILDSCSNEEPYISAKSLGHPVLRSDSLGKGEFVPNDITIGG--- 1023 LA S +GP CRPVIL + P++ K HP + G +F+PNDI IG Sbjct: 725 LANYSRGGDGPMCRPVILLP-EDTPPFLELKGSRHPCITKTFFGD-DFIPNDILIGCEEE 782 Query: 1024 ---HGNASFILLTGPNMGGKSTLLRQVCLAVILAQVGADVPAEIFEISPVDRIFVRMGAK 1080 +G A +L+TGPNMGGKSTL+RQ L ++AQ+G VPAE+ ++P+DR+F R+GA Sbjct: 783 EQENGKAYCVLVTGPNMGGKSTLMRQAGLLAVMAQMGCYVPAEVCRLTPIDRVFTRLGAS 842 Query: 1081 DHIMAGQSTFLTELSETALMLSSATRNSLVVLDELGRGTSTSDGQAIAS 1129 D IM+G+STF ELSETA +L AT +SLV++DELGRGT+T DG AIA+ Sbjct: 843 DRIMSGESTFFVELSETASILMHATAHSLVLVDELGRGTATFDGTAIAN 891
>pdb|3THW|B Chain B, Human Mutsbeta Complexed With An Idl Of 4 Bases (Loop4) And Adp Length = 918 Back     alignment and structure
>pdb|1WBB|A Chain A, Crystal Structure Of E. Coli Dna Mismatch Repair Enzyme Muts, E38a Mutant, In Complex With A G.T Mismatch Length = 800 Back     alignment and structure
>pdb|1WBD|A Chain A, Crystal Structure Of E. Coli Dna Mismatch Repair Enzyme Muts, E38q Mutant, In Complex With A G.T Mismatch Length = 800 Back     alignment and structure
>pdb|1WB9|A Chain A, Crystal Structure Of E. Coli Dna Mismatch Repair Enzyme Muts, E38t Mutant, In Complex With A G.T Mismatch Length = 800 Back     alignment and structure
>pdb|1OH5|A Chain A, The Crystal Structure Of E. Coli Muts Binding To Dna With A C:a Mismatch Length = 800 Back     alignment and structure
>pdb|3K0S|A Chain A, Crystal Structure Of E.Coli Dna Mismatch Repair Protein Muts, D693n Mutant, In Complex With Gt Mismatched Dna Length = 799 Back     alignment and structure
>pdb|1NG9|A Chain A, E.Coli Muts R697a: An Atpase-Asymmetry Mutant Length = 800 Back     alignment and structure
>pdb|1NNE|A Chain A, Crystal Structure Of The Muts-adpbef3-dna Complex Length = 765 Back     alignment and structure
>pdb|2O8E|A Chain A, Human Mutsalpha (Msh2MSH6) BOUND TO A G T MISPAIR, WITH ADP BOUND TO Msh2 Only Length = 934 Back     alignment and structure
>pdb|2O8B|A Chain A, Human Mutsalpha (Msh2MSH6) BOUND TO ADP AND A G T MISPAIR Length = 934 Back     alignment and structure
>pdb|1E3M|A Chain A, The Crystal Structure Of E. Coli Muts Binding To Dna With A G:t Mismatch Length = 800 Back     alignment and structure
>pdb|1EWR|A Chain A, Crystal Structure Of Taq Muts Length = 649 Back     alignment and structure
>pdb|1FW6|A Chain A, Crystal Structure Of A Taq Muts-Dna-Adp Ternary Complex Length = 768 Back     alignment and structure
>pdb|1EWQ|A Chain A, Crystal Structure Taq Muts Complexed With A Heteroduplex Dna At 2.2 A Resolution Length = 765 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1129
2o8b_B 1022 DNA mismatch repair protein MSH6; DNA damage respo 0.0
3thx_B 918 DNA mismatch repair protein MSH3; ABC family ATPas 0.0
3thx_A 934 DNA mismatch repair protein MSH2; ABC family ATPas 1e-132
1wb9_A800 DNA mismatch repair protein MUTS; DNA-binding, ATP 1e-57
1wb9_A800 DNA mismatch repair protein MUTS; DNA-binding, ATP 3e-57
1ewq_A765 DNA mismatch repair protein MUTS; multiple domains 5e-57
1ewq_A765 DNA mismatch repair protein MUTS; multiple domains 5e-56
1vt4_I1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-13
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-10
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-06
1twf_A1733 B220, DNA-directed RNA polymerase II largest subun 8e-07
1twf_A1733 B220, DNA-directed RNA polymerase II largest subun 1e-05
1twf_A1733 B220, DNA-directed RNA polymerase II largest subun 4e-05
1twf_A1733 B220, DNA-directed RNA polymerase II largest subun 2e-04
1twf_A1733 B220, DNA-directed RNA polymerase II largest subun 4e-04
1twf_A1733 B220, DNA-directed RNA polymerase II largest subun 8e-04
3h0g_A1752 DNA-directed RNA polymerase II subunit RPB1; trans 1e-05
3h0g_A1752 DNA-directed RNA polymerase II subunit RPB1; trans 5e-05
3h0g_A1752 DNA-directed RNA polymerase II subunit RPB1; trans 2e-04
3h0g_A1752 DNA-directed RNA polymerase II subunit RPB1; trans 3e-04
3h0g_A1752 DNA-directed RNA polymerase II subunit RPB1; trans 4e-04
3h0g_A1752 DNA-directed RNA polymerase II subunit RPB1; trans 6e-04
3h0g_A1752 DNA-directed RNA polymerase II subunit RPB1; trans 7e-04
3h0g_A1752 DNA-directed RNA polymerase II subunit RPB1; trans 9e-04
1ye8_A178 Protein THEP1, hypothetical UPF0334 kinase-like pr 7e-04
>2o8b_B DNA mismatch repair protein MSH6; DNA damage response, somatic hypermutat protein-DNA complex, DNA mispair, cancer; HET: DNA ADP; 2.75A {Homo sapiens} PDB: 2o8c_B* 2o8d_B* 2o8e_B* 2o8f_B* Length = 1022 Back     alignment and structure
 Score =  893 bits (2310), Expect = 0.0
 Identities = 331/883 (37%), Positives = 485/883 (54%), Gaps = 42/883 (4%)

Query: 278  GDVSERFSAREADKFHFLGPD-RRDAKRRRPGDVYYDPRTLYLPPDFLRNLSEGQKQWWE 336
            GD S R +    +   +L  + RRD  RRRP    +D  TLY+P DFL + + G ++WW+
Sbjct: 18   GDDSSRPTVWYHETLEWLKEEKRRDEHRRRPDHPDFDASTLYVPEDFLNSCTPGMRKWWQ 77

Query: 337  FKSKHMDKVIFFKMGKFYELFEMDAHVGAKELDLQYMKGEQPHCGFPERNFSMNVEKLAR 396
             KS++ D VI +K+GKFYEL+ MDA +G  EL L +MKG   H GFPE  F    + L +
Sbjct: 78   IKSQNFDLVICYKVGKFYELYHMDALIGVSELGLVFMKGNWAHSGFPEIAFGRYSDSLVQ 137

Query: 397  KGYRVLVVEQTETPEQLELRRKEKGS---KDKVVKREICAVVTKGTLTEGELLSANPDAS 453
            KGY+V  VEQTETPE +E R ++       D+VV+REIC ++TKGT T   L     + +
Sbjct: 138  KGYKVARVEQTETPEMMEARCRKMAHISKYDRVVRREICRIITKGTQTYSVLEGDPSE-N 196

Query: 454  YLMAL-TESNQSPASQSTDRCFGICVVDVATSRIILGQVMDDLDCSVLCCLLSELRPVEI 512
            Y   L +   +   S    R +G+C VD +  +  +GQ  DD  CS    L++   PV++
Sbjct: 197  YSKYLLSLKEKEEDSSGHTRAYGVCFVDTSLGKFFIGQFSDDRHCSRFRTLVAHYPPVQV 256

Query: 513  IKPANMLSPETERAILRHTRNPLVNDLVPLSEFWDAETTVLEIKNIYNRITAESLNKADS 572
            +     LS ET+  +       L   L+P S+FWDA  T+  +         E   +  S
Sbjct: 257  LFEKGNLSKETKTILKSSLSCSLQEGLIPGSQFWDASKTLRTLLE------EEYFREKLS 310

Query: 573  NVANSQAEGDGLTCLPGILSELISTGDSGSQVLSALGGTLFYLKKSFLDETLLRFAKFEL 632
            +                  S  ++ G+     LSALGG +FYLKK  +D+ LL  A FE 
Sbjct: 311  DGIGVMLPQVLKGMTSESDSIGLTPGEKSELALSALGGCVFYLKKCLIDQELLSMANFEE 370

Query: 633  LPCSGFGDMAKKP----------YMVLDAPALENLEVFENSRSGDSSGTLYAQLNHCVTA 682
                    ++              MVLDA  L NLE+F N  +G + GTL  +++ C T 
Sbjct: 371  YIPLDSDTVSTTRSGAIFTKAYQRMVLDAVTLNNLEIFLNGTNGSTEGTLLERVDTCHTP 430

Query: 683  FGKRLLRTWLARPLYNSGLIRERQDAVAGLRGVNQPFALEFRKALSRLPDMERLLARLFA 742
            FGKRLL+ WL  PL N   I +R DA+  L         E  + L +LPD+ERLL+++  
Sbjct: 431  FGKRLLKQWLCAPLCNHYAINDRLDAIEDLMV-VPDKISEVVELLKKLPDLERLLSKIHN 489

Query: 743  SSEA---NGRNSNKVVLYEDAA--KKQLQEFISALHGCELMDQACSSLGAILENTESRQL 797
                        ++ ++YE+    KK++ +F+SAL G ++M +    +  + +  +S+ L
Sbjct: 490  VGSPLKSQNHPDSRAIMYEETTYSKKKIIDFLSALEGFKVMCKIIGIMEEVADGFKSKIL 549

Query: 798  HHILT-----PGKGLPAIVSILKHFKDAFDWVEANNSGRIIPHGGVDMDYDSACKKVKEI 852
              +++     P    P +   L  +  AFD  +A  +G I P  G D DYD A   ++E 
Sbjct: 550  KQVISLQTKNPEGRFPDLTVELNRWDTAFDHEKARKTGLITPKAGFDSDYDQALADIREN 609

Query: 853  EASLTKHLKEQRKLLGDTSITYVTIGKDLYLLEVPESLRG-SVPRDYELRSSKKGFFRYW 911
            E SL ++L++QR  +G  +I Y  IG++ Y LE+PE+    ++P +YEL+S+KKG  RYW
Sbjct: 610  EQSLLEYLEKQRNRIGCRTIVYWGIGRNRYQLEIPENFTTRNLPEEYELKSTKKGCKRYW 669

Query: 912  TPNIKKLLGELSQAESEKESALKSILQRLIGQFCEHHNKWRQMVAATAELDALISLAIAS 971
            T  I+K L  L  AE  ++ +LK  ++RL   F +++  W+  V   A LD L+ LA  S
Sbjct: 670  TKTIEKKLANLINAEERRDVSLKDCMRRLFYNFDKNYKDWQSAVECIAVLDVLLCLANYS 729

Query: 972  DFYEGPTCRPVILDSCSNEEPYISAKSLGHPVLRSDSLGKGEFVPNDITIGG------HG 1025
               +GP CRPVIL    +  P++  K   HP + + +    +F+PNDI IG       +G
Sbjct: 730  RGGDGPMCRPVILLP-EDTPPFLELKGSRHPCI-TKTFFGDDFIPNDILIGCEEEEQENG 787

Query: 1026 NASFILLTGPNMGGKSTLLRQVCLAVILAQVGADVPAEIFEISPVDRIFVRMGAKDHIMA 1085
             A  +L+TGPNMGGKSTL+RQ  L  ++AQ+G  VPAE+  ++P+DR+F R+GA D IM+
Sbjct: 788  KAYCVLVTGPNMGGKSTLMRQAGLLAVMAQMGCYVPAEVCRLTPIDRVFTRLGASDRIMS 847

Query: 1086 GQSTFLTELSETALMLSSATRNSLVVLDELGRGTSTSDGQAIA 1128
            G+STF  ELSETA +L  AT +SLV++DELGRGT+T DG AIA
Sbjct: 848  GESTFFVELSETASILMHATAHSLVLVDELGRGTATFDGTAIA 890


>3thx_B DNA mismatch repair protein MSH3; ABC family ATPase, mismatch recognition, mismatched unpaired DNA binding protein-DNA complex; HET: DNA ADP; 2.70A {Homo sapiens} PDB: 3thw_B* 3thy_B* 3thz_B* Length = 918 Back     alignment and structure
>3thx_A DNA mismatch repair protein MSH2; ABC family ATPase, mismatch recognition, mismatched unpaired DNA binding protein-DNA complex; HET: DNA ADP; 2.70A {Homo sapiens} PDB: 2o8c_A* 2o8d_A* 2o8f_A* 3thw_A* 2o8b_A* 3thy_A* 3thz_A* 2o8e_A* Length = 934 Back     alignment and structure
>1wb9_A DNA mismatch repair protein MUTS; DNA-binding, ATP-binding, DNA binding, DNA repair, mismatch recognition; HET: DNA ADP; 2.10A {Escherichia coli} SCOP: a.113.1.1 c.37.1.12 c.55.6.1 d.75.2.1 PDB: 1wbb_A* 1e3m_A* 1oh5_A* 1oh6_A* 1oh7_A* 1oh8_A* 1w7a_A* 2wtu_A* 1wbd_A* 1ng9_A* 3k0s_A* Length = 800 Back     alignment and structure
>1wb9_A DNA mismatch repair protein MUTS; DNA-binding, ATP-binding, DNA binding, DNA repair, mismatch recognition; HET: DNA ADP; 2.10A {Escherichia coli} SCOP: a.113.1.1 c.37.1.12 c.55.6.1 d.75.2.1 PDB: 1wbb_A* 1e3m_A* 1oh5_A* 1oh6_A* 1oh7_A* 1oh8_A* 1w7a_A* 2wtu_A* 1wbd_A* 1ng9_A* 3k0s_A* Length = 800 Back     alignment and structure
>1ewq_A DNA mismatch repair protein MUTS; multiple domains of protein, mostly mixed alpha-beta structures, one domain is entirely helical; HET: DNA; 2.20A {Thermus aquaticus} SCOP: a.113.1.1 c.37.1.12 c.55.6.1 d.75.2.1 PDB: 1nne_A* 1fw6_A* 1ewr_A* Length = 765 Back     alignment and structure
>1ewq_A DNA mismatch repair protein MUTS; multiple domains of protein, mostly mixed alpha-beta structures, one domain is entirely helical; HET: DNA; 2.20A {Thermus aquaticus} SCOP: a.113.1.1 c.37.1.12 c.55.6.1 d.75.2.1 PDB: 1nne_A* 1fw6_A* 1ewr_A* Length = 765 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 Back     alignment and structure
>1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 Back     alignment and structure
>1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 Back     alignment and structure
>1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 Back     alignment and structure
>1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 Back     alignment and structure
>1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 Back     alignment and structure
>3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 Back     alignment and structure
>3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 Back     alignment and structure
>3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 Back     alignment and structure
>3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 Back     alignment and structure
>3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 Back     alignment and structure
>3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 Back     alignment and structure
>3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 Back     alignment and structure
>3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 Back     alignment and structure
>1ye8_A Protein THEP1, hypothetical UPF0334 kinase-like protein AQ_1292; mixed alpha-beta protein, rossman fold, signaling protein, transferase; 1.40A {Aquifex aeolicus} SCOP: c.37.1.11 Length = 178 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query1129
2o8b_B 1022 DNA mismatch repair protein MSH6; DNA damage respo 100.0
3thx_B 918 DNA mismatch repair protein MSH3; ABC family ATPas 100.0
1wb9_A800 DNA mismatch repair protein MUTS; DNA-binding, ATP 100.0
1ewq_A765 DNA mismatch repair protein MUTS; multiple domains 100.0
3thx_A 934 DNA mismatch repair protein MSH2; ABC family ATPas 100.0
1vpl_A256 ABC transporter, ATP-binding protein; TM0544, stru 98.47
2pcj_A224 ABC transporter, lipoprotein-releasing system ATP- 98.43
3gfo_A275 Cobalt import ATP-binding protein CBIO 1; structur 98.39
3tui_C 366 Methionine import ATP-binding protein METN; ABC-tr 98.37
4g1u_C266 Hemin import ATP-binding protein HMUV; membrane tr 98.35
1sgw_A214 Putative ABC transporter; structural genomics, P p 98.33
3tif_A235 Uncharacterized ABC transporter ATP-binding prote; 98.29
2nq2_C253 Hypothetical ABC transporter ATP-binding protein H 98.29
2qi9_C249 Vitamin B12 import ATP-binding protein BTUD; inner 98.29
1b0u_A262 Histidine permease; ABC transporter, transport pro 98.28
3d31_A 348 Sulfate/molybdate ABC transporter, ATP-binding pro 98.27
3fvq_A 359 Fe(3+) IONS import ATP-binding protein FBPC; nucle 98.27
2olj_A263 Amino acid ABC transporter; ABC domain, ATPase, hy 98.26
2ff7_A247 Alpha-hemolysin translocation ATP-binding protein 98.25
2ixe_A271 Antigen peptide transporter 1; ABC ATPase, hydrola 98.24
2yyz_A 359 Sugar ABC transporter, ATP-binding protein; sugar 98.23
2pjz_A263 Hypothetical protein ST1066; ATP binding protein, 98.2
1g6h_A257 High-affinity branched-chain amino acid transport 98.19
2ihy_A279 ABC transporter, ATP-binding protein; ATPase, ABC 98.19
2d2e_A250 SUFC protein; ABC-ATPase, SUF protein, 310-helix, 98.18
2onk_A240 Molybdate/tungstate ABC transporter, ATP-binding p 98.17
1ji0_A240 ABC transporter; ATP binding protein, structural g 98.17
1z47_A 355 CYSA, putative ABC-transporter ATP-binding protein 98.16
2pze_A229 Cystic fibrosis transmembrane conductance regulat; 98.15
2yz2_A266 Putative ABC transporter ATP-binding protein TM_0; 98.13
2zu0_C267 Probable ATP-dependent transporter SUFC; iron-sulf 98.11
1ye8_A178 Protein THEP1, hypothetical UPF0334 kinase-like pr 98.1
1v43_A 372 Sugar-binding transport ATP-binding protein; ATPas 98.1
2cbz_A237 Multidrug resistance-associated protein 1; ABC pro 98.1
3rlf_A 381 Maltose/maltodextrin import ATP-binding protein M; 98.09
2it1_A 362 362AA long hypothetical maltose/maltodextrin trans 98.09
1oxx_K 353 GLCV, glucose, ABC transporter, ATP binding protei 98.07
2bbs_A290 Cystic fibrosis transmembrane conductance regulato 98.03
1g29_1 372 MALK, maltose transport protein MALK; ATPase, acti 98.01
1mv5_A 243 LMRA, multidrug resistance ABC transporter ATP-bin 97.99
2ghi_A260 Transport protein; multidrug resistance protein, M 97.98
3ozx_A 538 RNAse L inhibitor; ATP binding cassette protein, h 97.92
3gd7_A 390 Fusion complex of cystic fibrosis transmembrane co 97.91
1yqt_A 538 RNAse L inhibitor; ATP-binding cassette, ribosome 97.9
3nh6_A306 ATP-binding cassette SUB-family B member 6, mitoc; 97.84
3bk7_A 607 ABC transporter ATP-binding protein; ABC ATPase, i 97.83
4gp7_A171 Metallophosphoesterase; polynucleotide kinase phos 97.82
3j16_B 608 RLI1P; ribosome recycling, translation, eukarya, r 97.77
2iw3_A 986 Elongation factor 3A; acetylation, ATP-binding, pr 97.71
2i3b_A189 HCR-ntpase, human cancer-related ntpase; AAA, ross 97.66
3ozx_A 538 RNAse L inhibitor; ATP binding cassette protein, h 97.65
3j16_B608 RLI1P; ribosome recycling, translation, eukarya, r 97.6
3qf4_A587 ABC transporter, ATP-binding protein; multidrug tr 97.54
1yqt_A538 RNAse L inhibitor; ATP-binding cassette, ribosome 97.54
3bk7_A607 ABC transporter ATP-binding protein; ABC ATPase, i 97.52
2jeo_A 245 Uridine-cytidine kinase 1; UCK, transferase, ATP-b 97.51
3b5x_A582 Lipid A export ATP-binding/permease protein MSBA; 97.49
3ec2_A180 DNA replication protein DNAC; helicase loader, rep 97.48
2ehv_A 251 Hypothetical protein PH0186; KAIC, RECA ATPase, un 97.48
3qf4_B598 Uncharacterized ABC transporter ATP-binding prote 97.45
2l8d_A66 Lamin-B receptor; DNA binding protein; NMR {Gallus 97.43
4a82_A578 Cystic fibrosis transmembrane conductance regulat; 97.42
2dig_A68 Lamin-B receptor; tudor domain, integral nuclear e 97.41
3b60_A582 Lipid A export ATP-binding/permease protein MSBA; 97.34
3ux8_A 670 Excinuclease ABC, A subunit; UVRA, nucleotide exci 97.34
2yl4_A595 ATP-binding cassette SUB-family B member 10, mitoc 97.34
4a74_A 231 DNA repair and recombination protein RADA; hydrola 97.29
1cr0_A 296 DNA primase/helicase; RECA-type protein fold, tran 97.27
2kjq_A149 DNAA-related protein; solution structure, NESG, st 97.26
3ux8_A 670 Excinuclease ABC, A subunit; UVRA, nucleotide exci 97.21
2iw3_A 986 Elongation factor 3A; acetylation, ATP-binding, pr 97.2
1nlf_A 279 Regulatory protein REPA; replicative DNA helicase 97.19
2cvh_A220 DNA repair and recombination protein RADB; filamen 97.18
2ygr_A 993 Uvrabc system protein A; hydrolase, nucleotide exc 97.16
2w0m_A 235 SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus 97.15
2eyu_A 261 Twitching motility protein PILT; pilus retraction 97.1
2r6f_A 972 Excinuclease ABC subunit A; UVRA, nucleotide excis 97.05
3p8d_A67 Medulloblastoma antigen MU-MB-50.72; tudor domain, 97.04
1znw_A207 Guanylate kinase, GMP kinase; ATP:GMP-phosphotrans 97.04
3aez_A 312 Pantothenate kinase; transferase, homodimer, COA b 97.03
1n0w_A 243 DNA repair protein RAD51 homolog 1; DNA repair, ho 97.0
1htw_A158 HI0065; nucleotide-binding fold, structural genomi 97.0
3pih_A 916 Uvrabc system protein A; hydrolase, ABC ATPase, DN 96.97
2npi_A 460 Protein CLP1; CLP1-PCF11 complex, ATP binding, ter 96.95
2g3r_A123 Tumor suppressor P53-binding protein 1; tandem tud 96.95
2equ_A74 PHD finger protein 20-like 1; tudor domain, struct 96.91
3jvv_A 356 Twitching mobility protein; hexameric P-loop ATPas 96.85
2pt7_A330 CAG-ALFA; ATPase, protein-protein complex, type IV 96.84
3qii_A85 PHD finger protein 20; tudor domain, structural ge 96.83
3sop_A 270 Neuronal-specific septin-3; hydrolase; HET: GDP; 2 96.81
1z6g_A218 Guanylate kinase; structural genomics, SGC, struct 96.75
1mhn_A59 SurviVal motor neuron protein; SMN, SMA, spinal mu 96.69
3hr8_A 356 Protein RECA; alpha and beta proteins (A/B, A+B), 96.64
3tr0_A205 Guanylate kinase, GMP kinase; purines, pyrimidines 96.59
2vf7_A 842 UVRA2, excinuclease ABC, subunit A.; DNA-binding p 96.53
2zr9_A 349 Protein RECA, recombinase A; recombination, RECA m 96.53
3lnc_A 231 Guanylate kinase, GMP kinase; ALS collaborative cr 96.5
3a00_A186 Guanylate kinase, GMP kinase; domain movement, dim 96.49
2yhs_A 503 FTSY, cell division protein FTSY; cell cycle, prot 96.48
2ldm_A81 Uncharacterized protein; PHF20, tudor domain, epig 95.49
3e70_C328 DPA, signal recognition particle receptor; FTSY, S 96.48
3b85_A208 Phosphate starvation-inducible protein; PHOH2, ATP 96.47
2px0_A296 Flagellar biosynthesis protein FLHF; SRP GTPase, f 96.45
1vma_A 306 Cell division protein FTSY; TM0570, structural gen 96.42
1pzn_A 349 RAD51, DNA repair and recombination protein RAD51, 96.41
4a4f_A64 SurviVal of motor neuron-related-splicing factor; 96.31
4f4c_A 1321 Multidrug resistance protein PGP-1; ABC transporte 96.31
2eqj_A66 Metal-response element-binding transcription facto 96.3
1zp6_A191 Hypothetical protein ATU3015; alpha-beta protein., 96.27
3kta_A182 Chromosome segregation protein SMC; structural mai 96.27
1ssf_A156 Transformation related protein 53 binding protein 96.24
1s96_A 219 Guanylate kinase, GMP kinase; E.coli, dimer, SAD, 96.24
3s6w_A54 Tudor domain-containing protein 3; methylated argi 96.21
3asz_A 211 Uridine kinase; cytidine phosphorylation, transfer 96.19
3szr_A 608 Interferon-induced GTP-binding protein MX1; interf 96.19
3c8u_A208 Fructokinase; YP_612366.1, putative fructose trans 96.16
1g5v_A88 SurviVal motor neuron protein 1; mRNA processing, 96.14
1lvg_A198 Guanylate kinase, GMP kinase; transferase; HET: AD 96.14
2v9p_A305 Replication protein E1; AAA+ molecular motor, DNA 96.13
3g5u_A 1284 MCG1178, multidrug resistance protein 1A; P-glycop 96.03
2bdt_A189 BH3686; alpha-beta protein, structural genomics, P 95.99
4eun_A200 Thermoresistant glucokinase; putative sugar kinase 95.94
3g5u_A 1284 MCG1178, multidrug resistance protein 1A; P-glycop 95.93
1ls1_A295 Signal recognition particle protein; FFH, SRP54, S 95.93
1kgd_A180 CASK, peripheral plasma membrane CASK; maguk, guan 95.91
2dr3_A 247 UPF0273 protein PH0284; RECA superfamily ATPase, h 95.85
3lda_A 400 DNA repair protein RAD51; DNA binding protein, ATP 95.84
1in4_A 334 RUVB, holliday junction DNA helicase RUVB; AAA+-cl 95.82
3b9q_A302 Chloroplast SRP receptor homolog, alpha subunit CP 95.69
1zu4_A 320 FTSY; GTPase, signal recognition particle, SRP, re 95.63
1f2t_A149 RAD50 ABC-ATPase; DNA double-strand break repair, 95.62
1kag_A173 SKI, shikimate kinase I; transferase, structural g 95.62
3euj_A 483 Chromosome partition protein MUKB, linker; MUKB, M 95.61
2j41_A207 Guanylate kinase; GMP, GMK, transferase, ATP-bindi 95.59
3tau_A208 Guanylate kinase, GMP kinase; structural genomics, 95.56
4aby_A 415 DNA repair protein RECN; hydrolase, double strand 95.53
1sq5_A 308 Pantothenate kinase; P-loop, transferase; HET: PAU 95.44
3qf7_A 365 RAD50; ABC-ATPase, ATPase, hydrolase; HET: ANP; 1. 95.43
2gza_A361 Type IV secretion system protein VIRB11; ATPase, h 95.43
3vaa_A199 Shikimate kinase, SK; structural genomics, center 95.42
1knq_A175 Gluconate kinase; ALFA/beta structure, transferase 95.38
1fnn_A 389 CDC6P, cell division control protein 6; ORC1, AAA 95.37
2bbw_A 246 Adenylate kinase 4, AK4; nucleotide kinase, nucleo 95.36
2og2_A359 Putative signal recognition particle receptor; nuc 95.34
2m0o_A79 PHD finger protein 1; tudor domain, H3K36ME3 bindi 95.28
3pnw_C77 Tudor domain-containing protein 3; FAB, structural 95.28
3uie_A200 Adenylyl-sulfate kinase 1, chloroplastic; rossmann 95.25
2w58_A202 DNAI, primosome component (helicase loader); ATP-b 95.24
2qby_A 386 CDC6 homolog 1, cell division control protein 6 ho 95.23
3kl4_A 433 SRP54, signal recognition 54 kDa protein; signal r 95.22
1jbk_A195 CLPB protein; beta barrel, chaperone; 1.80A {Esche 95.21
1tf7_A 525 KAIC; homohexamer, hexamer, circadian clock protei 95.21
1tf7_A 525 KAIC; homohexamer, hexamer, circadian clock protei 95.19
4e22_A 252 Cytidylate kinase; P-loop, CMP/ATP binding, transf 95.17
2d9t_A78 Tudor domain-containing protein 3; structural geno 95.17
2b8t_A 223 Thymidine kinase; deoxyribonucleoside kinase, zinc 95.1
2r6a_A 454 DNAB helicase, replicative helicase; replication, 95.03
3qks_A203 DNA double-strand break repair RAD50 ATPase; RECA- 94.97
1u94_A 356 RECA protein, recombinase A; homologous recombinat 94.97
1p9r_A 418 General secretion pathway protein E; bacterial typ 94.96
1nij_A 318 Hypothetical protein YJIA; structural genomics, P- 94.9
2qag_B 427 Septin-6, protein NEDD5; cell cycle, cell division 94.89
1tq4_A 413 IIGP1, interferon-inducible GTPase; interferon gam 94.81
2obl_A 347 ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O 94.8
2qm8_A 337 GTPase/ATPase; G protein, G3E, metallochaperone, c 94.78
1rj9_A304 FTSY, signal recognition protein; SRP-GTPase domai 94.78
2orw_A184 Thymidine kinase; TMTK, TP4A, transferase; HET: 4T 94.77
2p65_A187 Hypothetical protein PF08_0063; CLPB, malaria, str 94.76
1v5w_A 343 DMC1, meiotic recombination protein DMC1/LIM15 hom 94.69
2vp4_A 230 Deoxynucleoside kinase; ATP-binding, DNA synthesis 94.68
1njg_A 250 DNA polymerase III subunit gamma; rossman-like fol 94.66
1rz3_A201 Hypothetical protein rbstp0775; MCSG, structural g 94.64
3bos_A242 Putative DNA replication factor; P-loop containing 94.58
2o5v_A 359 DNA replication and repair protein RECF; ABC ATPas 94.56
1jjv_A 206 Dephospho-COA kinase; P-loop nucleotide-binding fo 94.55
2if2_A 204 Dephospho-COA kinase; alpha-beta protein, structur 94.52
3ney_A197 55 kDa erythrocyte membrane protein; structural ge 94.43
2ewv_A 372 Twitching motility protein PILT; pilus retraction 94.42
4f4c_A 1321 Multidrug resistance protein PGP-1; ABC transporte 94.39
1e69_A 322 Chromosome segregation SMC protein; structural mai 94.34
2dpy_A 438 FLII, flagellum-specific ATP synthase; beta barrel 94.3
3b9p_A 297 CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc 94.28
1lw7_A365 Transcriptional regulator NADR; NMN, NMN adenylyl 94.25
1xp8_A 366 RECA protein, recombinase A; recombination, radior 94.22
2z43_A324 DNA repair and recombination protein RADA; archaea 94.21
3llm_A235 ATP-dependent RNA helicase A; alpha-beta-alpha, st 94.21
3h4m_A 285 Proteasome-activating nucleotidase; ATPase, PAN, A 94.13
3qkt_A 339 DNA double-strand break repair RAD50 ATPase; RECA- 94.12
4hcz_A58 PHD finger protein 1; protein-peptide complex, tud 94.07
2v1u_A 387 Cell division control protein 6 homolog; DNA repli 93.95
1cke_A 227 CK, MSSA, protein (cytidine monophosphate kinase); 93.94
1qhl_A227 Protein (cell division protein MUKB); SMC, chromos 93.92
3tqc_A 321 Pantothenate kinase; biosynthesis of cofactors, pr 93.92
2pez_A179 Bifunctional 3'-phosphoadenosine 5'- phosphosulfat 93.89
3dm5_A 443 SRP54, signal recognition 54 kDa protein; protein- 93.88
1sxj_E 354 Activator 1 40 kDa subunit; clamp loader, processi 93.86
2vhj_A 331 Ntpase P4, P4; non- hydrolysable ATP analogue, hyd 93.86
3m6a_A 543 ATP-dependent protease LA 1; alpha, beta, ATP-bind 93.85
1w1w_A 430 Structural maintenance of chromosome 1; cohesin, c 93.8
3t61_A202 Gluconokinase; PSI-biology, structural genomics, p 93.79
2x8a_A 274 Nuclear valosin-containing protein-like; nuclear p 93.76
3auy_A 371 DNA double-strand break repair RAD50 ATPase; DNA r 93.76
1svm_A 377 Large T antigen; AAA+ fold, viral protein; HET: AT 93.74
2oap_1 511 GSPE-2, type II secretion system protein; hexameri 93.69
2qt1_A207 Nicotinamide riboside kinase 1; non-protein kinase 93.56
1l8q_A 324 Chromosomal replication initiator protein DNAA; AA 93.31
2yv5_A302 YJEQ protein; hydrolase, GTPase, permutation, stru 93.3
2qor_A204 Guanylate kinase; phosphotransferase, purine metab 93.27
3pfi_A 338 Holliday junction ATP-dependent DNA helicase RUVB; 93.27
2z4s_A 440 Chromosomal replication initiator protein DNAA; AA 93.19
1lv7_A 257 FTSH; alpha/beta domain, four helix bundle, hydrol 93.17
2i1q_A 322 DNA repair and recombination protein RADA; ATPase, 93.09
3io5_A 333 Recombination and repair protein; storage dimer, i 93.09
3cf0_A 301 Transitional endoplasmic reticulum ATPase; AAA, P9 93.06
1u0l_A301 Probable GTPase ENGC; permutation, OB-fold, zinc-f 93.06
1ixz_A 254 ATP-dependent metalloprotease FTSH; AAA domain fol 93.01
2yvu_A186 Probable adenylyl-sulfate kinase; transferase, str 92.85
3fdr_A94 Tudor and KH domain-containing protein; TDRD2, str 92.8
3cm0_A186 Adenylate kinase; ATP-binding, cytoplasm, nucleoti 92.75
3t15_A 293 Ribulose bisphosphate carboxylase/oxygenase activ 92.65
2ce7_A 476 Cell division protein FTSH; metalloprotease; HET: 92.65
3nwj_A250 ATSK2; P loop, shikimate, nucleoside monophosphate 92.62
2rcn_A358 Probable GTPase ENGC; YJEQ, circularly permuted, G 92.59
2xau_A 773 PRE-mRNA-splicing factor ATP-dependent RNA helica; 92.54
1y63_A184 LMAJ004144AAA protein; structural genomics, protei 92.54
1iy2_A 278 ATP-dependent metalloprotease FTSH; AAA domain fol 92.49
3kb2_A173 SPBC2 prophage-derived uncharacterized protein YOR 92.44
2qz4_A 262 Paraplegin; AAA+, SPG7, protease, ADP, structural 92.43
4eaq_A 229 DTMP kinase, thymidylate kinase; structural genomi 92.42
3pvs_A 447 Replication-associated recombination protein A; ma 92.41
1oix_A191 RAS-related protein RAB-11A; small G protein, intr 92.38
1pui_A210 ENGB, probable GTP-binding protein ENGB; structura 92.26
1ypw_A 806 Transitional endoplasmic reticulum ATPase; AAA, P9 92.16
3k1j_A 604 LON protease, ATP-dependent protease LON; ATP-bind 92.04
2f9l_A199 RAB11B, member RAS oncogene family; RAB11B GTPase, 92.04
2ze6_A 253 Isopentenyl transferase; crown GALL tumor, cytokin 92.03
2orv_A 234 Thymidine kinase; TP4A (P1-(5'-adenosyl)P4-(5'- (2 92.0
1xx6_A191 Thymidine kinase; NESG, northeast structural genom 91.94
3lw7_A179 Adenylate kinase related protein (ADKA-like); AMP, 91.91
3eie_A 322 Vacuolar protein sorting-associated protein 4; AAA 91.88
2xk0_A69 Polycomb protein PCL; transcription, aromatic CAGE 91.76
3cr8_A552 Sulfate adenylyltranferase, adenylylsulfate kinase 91.74
2f1r_A171 Molybdopterin-guanine dinucleotide biosynthesis pr 91.65
4ad8_A 517 DNA repair protein RECN; DNA binding protein, ATPa 91.65
1ly1_A181 Polynucleotide kinase; PNK, phosphatase, transfera 91.65
4fcw_A 311 Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 91.63
2ius_A 512 DNA translocase FTSK; nucleotide-binding, chromoso 91.62
2eqk_A85 Tudor domain-containing protein 4; structural geno 91.61
3syl_A 309 Protein CBBX; photosynthesis, rubisco activase, AA 91.56
1hqc_A 324 RUVB; extended AAA-ATPase domain, complex with nuc 91.47
1qhx_A178 CPT, protein (chloramphenicol phosphotransferase); 91.46
1m7g_A211 Adenylylsulfate kinase; APS kinase, transferase, s 91.4
1t9h_A307 YLOQ, probable GTPase ENGC; N-terminal beta-barrel 91.37
2qgz_A308 Helicase loader, putative primosome component; str 91.31
2rhm_A193 Putative kinase; P-loop containing nucleoside trip 91.27
1via_A175 Shikimate kinase; structural genomics, transferase 91.25
3d8b_A 357 Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s 91.25
1d2n_A 272 N-ethylmaleimide-sensitive fusion protein; hexamer 91.2
1xwi_A 322 SKD1 protein; VPS4B, AAA ATPase, protein transport 91.09
1vht_A 218 Dephospho-COA kinase; structural genomics, transfe 91.08
2diq_A110 Tudor and KH domain-containing protein; tudor doma 91.07
3n70_A145 Transport activator; sigma-54, ntpase, PSI, MCSG, 91.01
2qag_C 418 Septin-7; cell cycle, cell division, GTP-binding, 90.94
2qnr_A 301 Septin-2, protein NEDD5; structural genomics conso 90.92
1sxj_D 353 Activator 1 41 kDa subunit; clamp loader, processi 90.91
1kht_A192 Adenylate kinase; phosphotransferase, signaling pr 90.9
1ex7_A186 Guanylate kinase; substrate-induced FIT, domain mo 90.85
1q3t_A 236 Cytidylate kinase; nucleotide monophosphate kinase 90.77
1gvn_B 287 Zeta; postsegregational killing system, plasmid; 1 90.7
2p5t_B 253 PEZT; postsegregational killing system, phosphoryl 90.67
3co5_A143 Putative two-component system transcriptional RES 90.63
3uk6_A 368 RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding 90.5
3vfd_A 389 Spastin; ATPase, microtubule severing, hydrolase; 90.45
1w5s_A 412 Origin recognition complex subunit 2 ORC2; replica 90.23
2chg_A226 Replication factor C small subunit; DNA-binding pr 90.09
2vli_A183 Antibiotic resistance protein; transferase, tunica 90.07
1tev_A196 UMP-CMP kinase; ploop, NMP binding region, LID reg 89.94
2qby_B 384 CDC6 homolog 3, cell division control protein 6 ho 89.93
1np6_A174 Molybdopterin-guanine dinucleotide biosynthesis pr 89.92
4b4t_M 434 26S protease regulatory subunit 6A; hydrolase, AAA 89.76
3iij_A180 Coilin-interacting nuclear ATPase protein; alpha a 89.7
4b4t_J 405 26S protease regulatory subunit 8 homolog; hydrola 89.65
4a1f_A 338 DNAB helicase, replicative DNA helicase; hydrolase 89.51
2q6t_A 444 DNAB replication FORK helicase; hydrolase; 2.90A { 89.45
2qp9_X 355 Vacuolar protein sorting-associated protein 4; ATP 89.37
3cmw_A 1706 Protein RECA, recombinase A; homologous recombinat 89.36
2c95_A196 Adenylate kinase 1; transferase, AP4A, nucleotide 89.31
2j9r_A214 Thymidine kinase; TK1, DNK, lasso, transferase, AT 89.31
1udx_A 416 The GTP-binding protein OBG; TGS domain, riken str 89.31
2jaq_A 205 Deoxyguanosine kinase; transferase, deoxyribonucle 89.25
1uf9_A203 TT1252 protein; P-loop, nucleotide binding domain, 89.2
1gtv_A 214 TMK, thymidylate kinase; transferase, transferase 89.16
1odf_A 290 YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser 89.12
2e5q_A63 PHD finger protein 19; tudor domain, isoform B, st 89.07
2www_A 349 Methylmalonic aciduria type A protein, mitochondri 88.96
2p67_A 341 LAO/AO transport system kinase; ARGK, structural G 88.86
4b4t_L 437 26S protease subunit RPT4; hydrolase, AAA-atpases, 88.79
3e1s_A 574 Exodeoxyribonuclease V, subunit RECD; alpha and be 88.77
3bh0_A 315 DNAB-like replicative helicase; ATPase, replicatio 88.76
2plr_A 213 DTMP kinase, probable thymidylate kinase; TMP-bind 88.74
1nks_A194 Adenylate kinase; thermophilic, transferase; HET: 88.61
2v3c_C 432 SRP54, signal recognition 54 kDa protein; nucleoti 88.49
2v54_A204 DTMP kinase, thymidylate kinase; nucleotide biosyn 88.46
2z0h_A197 DTMP kinase, thymidylate kinase; ATP-binding, nucl 88.45
2wwf_A212 Thymidilate kinase, putative; transferase, malaria 88.41
3e2i_A219 Thymidine kinase; Zn-binding, ATP-binding, DNA syn 88.29
3ake_A 208 Cytidylate kinase; CMP kinase, CMP complex, open c 88.29
2zan_A 444 Vacuolar protein sorting-associating protein 4B; S 88.13
1qf9_A194 UMP/CMP kinase, protein (uridylmonophosphate/cytid 88.13
1nn5_A 215 Similar to deoxythymidylate kinase (thymidylate K; 88.11
2e5p_A68 Protein PHF1, PHD finger protein 1; tudor domain, 88.06
3r20_A 233 Cytidylate kinase; structural genomics, seattle st 88.03
4b4t_K 428 26S protease regulatory subunit 6B homolog; hydrol 87.95
3trf_A185 Shikimate kinase, SK; amino acid biosynthesis, tra 87.88
1tue_A212 Replication protein E1; helicase, replication, E1E 87.82
1j8m_F297 SRP54, signal recognition 54 kDa protein; signalin 87.74
1e6c_A173 Shikimate kinase; phosphoryl transfer, ADP, shikim 87.73
1jr3_A 373 DNA polymerase III subunit gamma; processivity, pr 87.62
2bwj_A199 Adenylate kinase 5; phosphoryl transfer reaction, 87.44
1ni3_A 392 YCHF GTPase, YCHF GTP-binding protein; structural 87.4
2wji_A165 Ferrous iron transport protein B homolog; membrane 87.33
3a4m_A 260 L-seryl-tRNA(SEC) kinase; P-loop motif, walker A m 87.28
1sxj_C 340 Activator 1 40 kDa subunit; clamp loader, processi 87.24
4b4t_H 467 26S protease regulatory subunit 7 homolog; hydrola 87.15
1qvr_A 854 CLPB protein; coiled coil, AAA ATPase, chaperone; 87.03
1ukz_A203 Uridylate kinase; transferase; HET: ADP AMP; 1.90A 87.02
1zd8_A 227 GTP:AMP phosphotransferase mitochondrial; ATP:AMP 87.0
1ofh_A 310 ATP-dependent HSL protease ATP-binding subunit HSL 86.89
3zvl_A416 Bifunctional polynucleotide phosphatase/kinase; hy 86.75
3hu3_A 489 Transitional endoplasmic reticulum ATPase; VCP, tr 86.73
2wjg_A188 FEOB, ferrous iron transport protein B homolog; me 86.71
2iyv_A184 Shikimate kinase, SK; transferase, aromatic amino 86.58
4b4t_I 437 26S protease regulatory subunit 4 homolog; hydrola 86.48
2pbr_A195 DTMP kinase, thymidylate kinase; transferase, nucl 86.47
3cmu_A 2050 Protein RECA, recombinase A; homologous recombinat 86.43
3nbx_X 500 ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structu 86.29
1zak_A 222 Adenylate kinase; ATP:AMP-phosphotransferase, tran 86.29
1iqp_A 327 RFCS; clamp loader, extended AAA-ATPase domain, co 86.23
1aky_A 220 Adenylate kinase; ATP:AMP phosphotransferase, myok 86.17
2cdn_A201 Adenylate kinase; phosphoryl transfer, associative 86.0
3cf2_A 806 TER ATPase, transitional endoplasmic reticulum ATP 85.96
2xb4_A 223 Adenylate kinase; ATP-binding, nucleotide-binding, 85.92
3fb4_A 216 Adenylate kinase; psychrophIle, phosphotransferase 85.84
2pt5_A168 Shikimate kinase, SK; aromatic amino acid biosynth 85.73
1sxj_A 516 Activator 1 95 kDa subunit; clamp loader, processi 85.73
2c9o_A 456 RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP- 85.6
1xjc_A169 MOBB protein homolog; structural genomics, midwest 85.56
1ltq_A 301 Polynucleotide kinase; phosphatase, alpha/beta, P- 85.43
3u61_B 324 DNA polymerase accessory protein 44; AAA+, ATP hyd 85.31
1um8_A 376 ATP-dependent CLP protease ATP-binding subunit CL; 85.26
2gj8_A172 MNME, tRNA modification GTPase TRME; G-domain dime 85.26
2qen_A 350 Walker-type ATPase; unknown function; HET: ADP; 2. 85.18
3ld9_A223 DTMP kinase, thymidylate kinase; ssgcid, NIH, niai 85.06
3bgw_A 444 DNAB-like replicative helicase; ATPase, replicatio 85.05
2zej_A184 Dardarin, leucine-rich repeat kinase 2; parkinson' 85.02
3dl0_A 216 Adenylate kinase; phosphotransferase, zinc coordin 85.01
3cmu_A 2050 Protein RECA, recombinase A; homologous recombinat 84.78
1w4r_A195 Thymidine kinase; type II, human, cytosolic, phosp 84.37
1uj2_A 252 Uridine-cytidine kinase 2; alpha/beta mononucleoti 84.23
2iut_A 574 DNA translocase FTSK; nucleotide-binding, chromoso 84.14
4ag6_A 392 VIRB4 ATPase, type IV secretory pathway VIRB4 comp 84.14
2ffh_A 425 Protein (FFH); SRP54, signal recognition particle, 84.11
3hws_A 363 ATP-dependent CLP protease ATP-binding subunit CL; 84.1
2chq_A 319 Replication factor C small subunit; DNA-binding pr 83.93
1sky_E 473 F1-ATPase, F1-ATP synthase; F1FO ATP synthase, alp 83.69
2wac_A218 CG7008-PA; unknown function, tudor, beta-barrel, n 83.56
1a7j_A 290 Phosphoribulokinase; transferase, calvin cycle; 2. 83.37
1ypw_A 806 Transitional endoplasmic reticulum ATPase; AAA, P9 83.36
2f6r_A 281 COA synthase, bifunctional coenzyme A synthase; 18 83.34
3tlx_A 243 Adenylate kinase 2; structural genomics, structura 83.3
4edh_A 213 DTMP kinase, thymidylate kinase; structural genomi 82.92
2dhr_A 499 FTSH; AAA+ protein, hexameric Zn metalloprotease, 82.81
1zuh_A168 Shikimate kinase; alpha-beta protein, transferase; 82.77
3be4_A 217 Adenylate kinase; malaria, cryptosporidium parvum 82.67
1e4v_A 214 Adenylate kinase; transferase(phosphotransferase); 82.62
2zts_A 251 Putative uncharacterized protein PH0186; KAIC like 82.57
1ega_A 301 Protein (GTP-binding protein ERA); GTPase, RNA-bin 82.51
2grj_A192 Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosp 82.2
3ntk_A169 Maternal protein tudor; tudor domain, OB-fold, GER 81.84
3lv8_A 236 DTMP kinase, thymidylate kinase; structural genomi 81.84
2eko_A87 Histone acetyltransferase htatip; chromo domain, h 81.18
3v9p_A227 DTMP kinase, thymidylate kinase; ssgcid, STRU geno 81.06
3dlm_A213 Histone-lysine N-methyltransferase setdb1; setdb1_ 81.05
4tmk_A 213 Protein (thymidylate kinase); ATP:DTMP phosphotran 81.03
1wgs_A133 MYST histone acetyltransferase 1; tudor domain, MY 81.0
3umf_A217 Adenylate kinase; rossmann fold, transferase; 2.05 80.79
3cmw_A 1706 Protein RECA, recombinase A; homologous recombinat 80.72
2ocp_A 241 DGK, deoxyguanosine kinase; protein-nucleotide com 80.68
2ga8_A 359 Hypothetical 39.9 kDa protein; YFR007W, YFH7, unkn 80.6
3exa_A 322 TRNA delta(2)-isopentenylpyrophosphate transferase 80.57
3foz_A 316 TRNA delta(2)-isopentenylpyrophosphate transferas; 80.4
3crm_A 323 TRNA delta(2)-isopentenylpyrophosphate transferase 80.22
3d3q_A 340 TRNA delta(2)-isopentenylpyrophosphate transferase 80.22
2ro0_A92 Histone acetyltransferase ESA1; HAT, chromodomain, 80.1
>2o8b_B DNA mismatch repair protein MSH6; DNA damage response, somatic hypermutat protein-DNA complex, DNA mispair, cancer; HET: DNA ADP; 2.75A {Homo sapiens} PDB: 2o8c_B* 2o8d_B* 2o8e_B* 2o8f_B* Back     alignment and structure
Probab=100.00  E-value=3.1e-147  Score=1412.14  Aligned_cols=829  Identities=40%  Similarity=0.677  Sum_probs=675.6

Q ss_pred             ccccccccccccccccccCC-CCcccCCCCCCCCCCCCCCCCCCchhhcCCCHHHHHHHHHHHhCCCeEEEEeeCceEEE
Q 001187          278 GDVSERFSAREADKFHFLGP-DRRDAKRRRPGDVYYDPRTLYLPPDFLRNLSEGQKQWWEFKSKHMDKVIFFKMGKFYEL  356 (1129)
Q Consensus       278 ~~~~~~~~~~~~~~~~~l~~-~~rD~~~r~p~~p~ydp~Tl~ip~~~~~~~TP~~~Qyw~iK~~~~D~vlffkvGkFYEl  356 (1129)
                      |+..+++..|.|++|+||++ +|||++||||+||+|||||||||+++|+++||||||||+||++|||+||||||||||||
T Consensus        18 ~~~~~~~~~~~~~~~~~l~~~~~rD~~~r~~~~p~ydp~tl~ip~~~~~~~TPmm~Qy~~iK~~~~d~llffr~GdFYEl   97 (1022)
T 2o8b_B           18 GDDSSRPTVWYHETLEWLKEEKRRDEHRRRPDHPDFDASTLYVPEDFLNSCTPGMRKWWQIKSQNFDLVICYKVGKFYEL   97 (1022)
T ss_dssp             ------CCSCGGGGCGGGSTTTCCCTTCCCTTSTTCCTTCCCCCHHHHTTSCHHHHHHHHHHHHCTTSEEEEEETTEEEE
T ss_pred             CCccccccccccccchhcCccccccccCCCCCCCCCCCCcccCCchhhccCCHHHHHHHHHHHhCCCEEEEEECCCEEEE
Confidence            45677888999999999987 79999999999999999999999999999999999999999999999999999999999


Q ss_pred             ehhhHHHHhhhcceeeecCCCCcCCcCcccHhHHHHHHHHcCCeEEEEecCCChhHHHHHhhhcC---CCCceeeeeEEE
Q 001187          357 FEMDAHVGAKELDLQYMKGEQPHCGFPERNFSMNVEKLARKGYRVLVVEQTETPEQLELRRKEKG---SKDKVVKREICA  433 (1129)
Q Consensus       357 y~~DA~i~a~~L~L~~t~g~~p~~GfPe~sl~~y~~kLV~~GyKVavvEQ~Et~~~~~~r~k~~~---~~~kvv~Rev~~  433 (1129)
                      |++||+++|++|+|++|+|++||||||+|+++.|+++||++|||||||||+|+|++++.|.+.++   +++++|+||||+
T Consensus        98 f~~DA~~~a~~L~i~lt~~~~pmaGvP~ha~~~yl~~Lv~~GykVai~eQ~e~p~~~~~r~~~~~~~~k~~~~v~Rev~r  177 (1022)
T 2o8b_B           98 YHMDALIGVSELGLVFMKGNWAHSGFPEIAFGRYSDSLVQKGYKVARVEQTETPEMMEARCRKMAHISKYDRVVRREICR  177 (1022)
T ss_dssp             EHHHHHHHHHHHCCCCCSSSSCEEEEEGGGHHHHHHHHHHTTCCEEEEEECSCHHHHHHHHHTCSSCCSGGGSCCEEEEE
T ss_pred             ehhhHHHHHHhcCeEEecCCCCCCCCchhHHHHHHHHHHHCCCeEEEEeCCCCchhhhhhhhhcccccccCCceeeeEEE
Confidence            99999999999999999999999999999999999999999999999999999998888877543   456899999999


Q ss_pred             EeeCcceeeccc---cCCCCCCcEEEEEEecCCCCCCCCCCcEEEEEEEEccCCeEEEEEecCcchhHHHHHHHHccCcc
Q 001187          434 VVTKGTLTEGEL---LSANPDASYLMALTESNQSPASQSTDRCFGICVVDVATSRIILGQVMDDLDCSVLCCLLSELRPV  510 (1129)
Q Consensus       434 V~TpGTl~d~~~---l~~~~~~~yllaI~e~~~~~~~~~~~~~~Gva~vD~stg~~~l~qf~Dd~~~s~L~t~L~~~~P~  510 (1129)
                      ||||||++++.+   +. ...++||+||++.....  ......|||||+|++||+|++++|.|+..+++|.+.|.+++|+
T Consensus       178 vvTpGT~~d~~~~~~l~-~~~~n~l~ai~~~~~~~--~~~~~~~Gla~~D~sTGe~~~~e~~d~~~~~~L~~~L~~~~P~  254 (1022)
T 2o8b_B          178 IITKGTQTYSVLEGDPS-ENYSKYLLSLKEKEEDS--SGHTRAYGVCFVDTSLGKFFIGQFSDDRHCSRFRTLVAHYPPV  254 (1022)
T ss_dssp             EECTTSCCCCTTSCCCS-CSSCCEEEEEEEEECSC--C-CCEEEEEEEECTTTCCEEEEEEEECSSCHHHHHHHHHSCEE
T ss_pred             EECCCeeeccccccccc-CCCCcEEEEEEEccccc--cCCCcEEEEEEEECCCCEEEEEEecCchHHHHHHHHHHhcCCc
Confidence            999999999874   33 34789999999742110  1123579999999999999999999998899999999999999


Q ss_pred             EEEecCCCCChHHHHHHHhhcCCCccccccCCccccChhhHHHHHH--HHHhhcccccccccccccccccccCCCCcccc
Q 001187          511 EIIKPANMLSPETERAILRHTRNPLVNDLVPLSEFWDAETTVLEIK--NIYNRITAESLNKADSNVANSQAEGDGLTCLP  588 (1129)
Q Consensus       511 EIl~~~~~ls~~t~~~l~~~~~~~~~~~~~~~~~f~~~~~~~~~l~--~~~~~~~~~~~~k~~~~~~~~~~~~~~~~~~p  588 (1129)
                      |||++.+..+..+.+++.......+...+.+..+||+...+...+.  .+|.....                .....+||
T Consensus       255 Eil~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~f~~~~~----------------~~~~~~~~  318 (1022)
T 2o8b_B          255 QVLFEKGNLSKETKTILKSSLSCSLQEGLIPGSQFWDASKTLRTLLEEEYFREKLS----------------DGIGVMLP  318 (1022)
T ss_dssp             EEEEETTTCCHHHHHHHTTTTTTSEEEEECBTTTBCCHHHHHHHHHHTTTTSSSSC----------------CCC-CCCC
T ss_pred             EEEecCCccchHHHHHHHhhhhhhhhhhcccchhhcchhhHHhhhhhhhhcccccc----------------cccchhhH
Confidence            9999988777776666543322222222335668998776665443  34432110                00123566


Q ss_pred             hhhhhhhcc----C----CChhHHHHHHHHHHHHHHHhccchhhhcccceeecCCCCC----------ccCCCCCeeecC
Q 001187          589 GILSELIST----G----DSGSQVLSALGGTLFYLKKSFLDETLLRFAKFELLPCSGF----------GDMAKKPYMVLD  650 (1129)
Q Consensus       589 ~~l~~~~~~----~----~~~~~al~Algall~YL~~~~l~~~ll~~~~f~~~~~~~~----------~~~~~~~~M~LD  650 (1129)
                      ..+..+...    +    .+..++++|+|+||+||+.++++..++..++|..+.....          ......+||+||
T Consensus       319 ~~l~~~~~~~~~~~~~~~~~~~~a~~A~gall~Yl~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~m~LD  398 (1022)
T 2o8b_B          319 QVLKGMTSESDSIGLTPGEKSELALSALGGCVFYLKKCLIDQELLSMANFEEYIPLDSDTVSTTRSGAIFTKAYQRMVLD  398 (1022)
T ss_dssp             HHHHHTEECCSTTCSEECGGGHHHHHHHHHHHHHHHHHTCHHHHHTTCCEEECCCGGGGTCC---------CCCCBCBCC
T ss_pred             HHHHHhhcchhhcccccccccHHHHHHHHHHHHHHHHhCcchhhhccccccccccccccccccccccccccCCCCeEEeC
Confidence            665543311    1    1246789999999999999988766665566654422110          012456799999


Q ss_pred             HHHHHhccCcccccCCCCcccHHHHHhhhcChHHHHHHHHhhhCCCCCHHHHHHHHHHHHHHHcCCchhHHHHHHhcCCC
Q 001187          651 APALENLEVFENSRSGDSSGTLYAQLNHCVTAFGKRLLRTWLARPLYNSGLIRERQDAVAGLRGVNQPFALEFRKALSRL  730 (1129)
Q Consensus       651 ~~Tl~~LEI~~~~~~g~~~gSL~~lLn~c~T~~GkRlLr~wl~~PL~d~~~I~~RldaVe~L~~~~~~~~~~lr~~L~~l  730 (1129)
                      ++|++||||++|.++|+.+||||++||+|+|+||+||||+||++||+|++.|++|||+|++|+. +..++..++..|+++
T Consensus       399 ~~T~~nLEl~~~~~~g~~~gSLl~~Ld~t~T~mG~RLLr~WL~~PL~d~~~I~~RldaVe~l~~-~~~~~~~l~~~L~~i  477 (1022)
T 2o8b_B          399 AVTLNNLEIFLNGTNGSTEGTLLERVDTCHTPFGKRLLKQWLCAPLCNHYAINDRLDAIEDLMV-VPDKISEVVELLKKL  477 (1022)
T ss_dssp             HHHHHHTTCSSCCSSSSCCCSHHHHHCCCSSHHHHHHHHHHHHSCBCCHHHHHHHHHHHHHHHT-CHHHHHHHHHHHTTC
T ss_pred             HHHHHhhcCCccCCCCCCCCcHHHHhCcCCCchhHHHHHHHHhCccCCHHHHHHHHHHHHHHHh-ChHHHHHHHHHHhcC
Confidence            9999999999998888889999999999999999999999999999999999999999999996 567788999999999


Q ss_pred             CCHHHHHHHHhccccc---cCCCCccchhhHHH--HHHHHHHHHHHHhhhHHHHHHHHHHHHHHhhcchhhHHhhhcC--
Q 001187          731 PDMERLLARLFASSEA---NGRNSNKVVLYEDA--AKKQLQEFISALHGCELMDQACSSLGAILENTESRQLHHILTP--  803 (1129)
Q Consensus       731 pDleRll~ri~~~~~~---~~~~~~~~~~~~~~--~~~~l~~~~~~L~~~~~~~~~~~~l~~~l~~~~s~~l~~l~~~--  803 (1129)
                      |||||+++||+..+..   ..+...++++|++.  ..+++.+|+..+.++..+..+...+........+.+|..+...  
T Consensus       478 ~DlERll~Ri~~~~~~~~~~~~~~~~~i~~~~~~~~~~~l~~l~~~l~~l~~~~~i~~~l~~~~~~~~s~lL~~~~~~~~  557 (1022)
T 2o8b_B          478 PDLERLLSKIHNVGSPLKSQNHPDSRAIMYEETTYSKKKIIDFLSALEGFKVMCKIIGIMEEVADGFKSKILKQVISLQT  557 (1022)
T ss_dssp             CCHHHHHHHHHHHHCHHHHHHCGGGGCCCSCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTCCCHHHHHHTSBTT
T ss_pred             ccHHHHHHHHHhcCCcccccccchhhhhhhhhhccchhhHHHHHHHHHHHHHHHHHHHHHHhhhcccCcHHHHHHHHhhc
Confidence            9999999999762111   01122345555542  5678888888877666555544444333334556677776532  


Q ss_pred             ---CCCchhHHHHHHHHHhhhchhhhcCCCCeeeCCCCChhHHHHHHHHHHHHHHHHHHHHHHHHHhCCCCceEEEeCCc
Q 001187          804 ---GKGLPAIVSILKHFKDAFDWVEANNSGRIIPHGGVDMDYDSACKKVKEIEASLTKHLKEQRKLLGDTSITYVTIGKD  880 (1129)
Q Consensus       804 ---~~~~~~l~~~l~~i~~~~d~~~~~~~g~ii~~~g~d~~lD~~~~~l~~l~~~L~~~l~~~~~~l~~~~i~~~~~~~~  880 (1129)
                         ...++++.+++..|..+||...+.+.|.+++++|++++||++++.+++++++|.++++++++.++..+++|++++++
T Consensus       558 ~~~~~~~~~l~~~~~~~~~~id~~~~~~~g~i~~~~g~~~~ld~~r~~~~~~~~~l~~~~~~~~~~~~~~~l~~~~~~~~  637 (1022)
T 2o8b_B          558 KNPEGRFPDLTVELNRWDTAFDHEKARKTGLITPKAGFDSDYDQALADIRENEQSLLEYLEKQRNRIGCRTIVYWGIGRN  637 (1022)
T ss_dssp             TSSSSCBCCCHHHHHHHHTTSCHHHHHHSCCCCCTTCC-CHHHHHHHHHHHHHHHHHHHHTSSGGGSSCSCCEEECCGGG
T ss_pred             cccccchHHHHHHHHHHHHHhCchhhhcCCcEeeCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHhCCCceeEEEecCc
Confidence               14678888999999999998766678888889999999999999999999999999988888899888999999889


Q ss_pred             eEEEEccccccCC-CCCcEEEeeeecceEEEeChhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhHHHHHHHHHHHH
Q 001187          881 LYLLEVPESLRGS-VPRDYELRSSKKGFFRYWTPNIKKLLGELSQAESEKESALKSILQRLIGQFCEHHNKWRQMVAATA  959 (1129)
Q Consensus       881 ~y~iev~~~~~~~-vp~~~~~~ss~k~~~ry~tp~l~~l~~el~~~~~~~~~~~~~il~~l~~~~~~~~~~l~~~~~~la  959 (1129)
                      +|+|+|+...... +|++|++.+++++..||+||+++++..++..+++++...+.+++.++++.+.++...|..+++++|
T Consensus       638 ~y~i~v~~~~~~~~vp~~~~~~~t~~~~~rf~t~el~~~~~~l~~~~~~~~~~~~~l~~~l~~~~~~~~~~l~~~~~~la  717 (1022)
T 2o8b_B          638 RYQLEIPENFTTRNLPEEYELKSTKKGCKRYWTKTIEKKLANLINAEERRDVSLKDCMRRLFYNFDKNYKDWQSAVECIA  717 (1022)
T ss_dssp             CCEEEECTTTTSSCCCC-CEEEEETTEEEECCTTTHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTHHHHHHHHHHHH
T ss_pred             eEEEEEehhhhcccCCCceEEeeeccCccEEechHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            9999999988777 899999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHHhhcCCCccceeecCCCCCCCCcEEEeccCCCccccccCCCCcccccccccCCCC------CCceEEEE
Q 001187          960 ELDALISLAIASDFYEGPTCRPVILDSCSNEEPYISAKSLGHPVLRSDSLGKGEFVPNDITIGGHG------NASFILLT 1033 (1129)
Q Consensus       960 ~LD~L~SlA~~a~~~~~~~~rP~~~~~~~~~~~~l~i~~~RHP~le~~~~~~~~fvpNdi~l~~~~------~~~~~iit 1033 (1129)
                      +||||+|||.+|.....+||||+|.+. .++.+.|.|++||||+++.. ...+.|||||++|+...      .+++++||
T Consensus       718 ~lD~l~s~A~~a~~~~~~~~~P~~~~~-~~~~~~l~i~~~rHP~l~~~-~~~~~~v~ndi~l~~~~~~~~~~~g~i~~It  795 (1022)
T 2o8b_B          718 VLDVLLCLANYSRGGDGPMCRPVILLP-EDTPPFLELKGSRHPCITKT-FFGDDFIPNDILIGCEEEEQENGKAYCVLVT  795 (1022)
T ss_dssp             HHHHHHHHHHHTTCSSSCEECCEECCT-TTSCCCEEEEEECCCC-------CCCCCCEEEEESCCCSCC---CCCEEEEE
T ss_pred             HHHHHHhHHHHHhhccCCccCCccccC-CCCCceEEEEeccccEEEEE-ecCCceEeeeeeeccccccccCCCCcEEEEE
Confidence            999999999999743558999999842 11345799999999999752 22347999999998632      16899999


Q ss_pred             ecCCCchhHHHHHHHHHHHHhHcCCeecCCCcccchhhhhhhccCccchHhhcccchHHHHHHHHHHHHhCCCCcEEEEe
Q 001187         1034 GPNMGGKSTLLRQVCLAVILAQVGADVPAEIFEISPVDRIFVRMGAKDHIMAGQSTFLTELSETALMLSSATRNSLVVLD 1113 (1129)
Q Consensus      1034 GpN~~GKSt~lr~i~l~vilAQiG~~VPA~~a~l~~~d~i~trig~~d~i~~g~StF~~em~e~~~il~~at~~sLvllD 1113 (1129)
                      ||||||||||||++|++++|||+||||||+.+.++++|+||+|+|+.|++..|.|||++||.+++.|+..+++++|||||
T Consensus       796 GpNgsGKSTlLr~iGl~~~~aqiG~~Vpq~~~~l~v~d~I~~rig~~d~~~~~~stf~~em~~~a~al~la~~~sLlLLD  875 (1022)
T 2o8b_B          796 GPNMGGKSTLMRQAGLLAVMAQMGCYVPAEVCRLTPIDRVFTRLGASDRIMSGESTFFVELSETASILMHATAHSLVLVD  875 (1022)
T ss_dssp             CCTTSSHHHHHHHHHHHHHHHTTTCCEESSEEEECCCSBEEEECC---------CHHHHHHHHHHHHHHHCCTTCEEEEE
T ss_pred             CCCCCChHHHHHHHHHHHHHhheeEEeccCcCCCCHHHHHHHHcCCHHHHhhchhhhHHHHHHHHHHHHhCCCCcEEEEE
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCCCCCChHHHHhhh
Q 001187         1114 ELGRGTSTSDGQAIA 1128 (1129)
Q Consensus      1114 ElGRGTst~DG~AIA 1128 (1129)
                      |+|+||++.||.+||
T Consensus       876 Ep~~Gtd~~dg~~~~  890 (1022)
T 2o8b_B          876 ELGRGTATFDGTAIA  890 (1022)
T ss_dssp             CTTTTSCHHHHHHHH
T ss_pred             CCCCCCChHHHHHHH
Confidence            999999999998865



>3thx_B DNA mismatch repair protein MSH3; ABC family ATPase, mismatch recognition, mismatched unpaired DNA binding protein-DNA complex; HET: DNA ADP; 2.70A {Homo sapiens} PDB: 3thw_B* 3thy_B* 3thz_B* Back     alignment and structure
>1wb9_A DNA mismatch repair protein MUTS; DNA-binding, ATP-binding, DNA binding, DNA repair, mismatch recognition; HET: DNA ADP; 2.10A {Escherichia coli} SCOP: a.113.1.1 c.37.1.12 c.55.6.1 d.75.2.1 PDB: 1wbb_A* 1e3m_A* 1oh5_A* 1oh6_A* 1oh7_A* 1oh8_A* 1w7a_A* 2wtu_A* 1wbd_A* 1ng9_A* 3k0s_A* Back     alignment and structure
>1ewq_A DNA mismatch repair protein MUTS; multiple domains of protein, mostly mixed alpha-beta structures, one domain is entirely helical; HET: DNA; 2.20A {Thermus aquaticus} SCOP: a.113.1.1 c.37.1.12 c.55.6.1 d.75.2.1 PDB: 1nne_A* 1fw6_A* 1ewr_A* Back     alignment and structure
>3thx_A DNA mismatch repair protein MSH2; ABC family ATPase, mismatch recognition, mismatched unpaired DNA binding protein-DNA complex; HET: DNA ADP; 2.70A {Homo sapiens} PDB: 2o8c_A* 2o8d_A* 2o8f_A* 3thw_A* 2o8b_A* 3thy_A* 3thz_A* 2o8e_A* Back     alignment and structure
>1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein; structural genomics; 1.70A {Aquifex aeolicus} PDB: 2pcl_A Back     alignment and structure
>3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124} Back     alignment and structure
>3tui_C Methionine import ATP-binding protein METN; ABC-transporter, type I ABC type importer, methionine uptake transporter, membrane protein; HET: ADP; 2.90A {Escherichia coli} PDB: 3tuj_C 3tuz_C* 3dhw_C Back     alignment and structure
>4g1u_C Hemin import ATP-binding protein HMUV; membrane transporter, type II ABC importer, HMUT, plasma MEM transport protein-hydrolase complex; 3.01A {Yersinia pestis} Back     alignment and structure
>1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12 Back     alignment and structure
>3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A* Back     alignment and structure
>2nq2_C Hypothetical ABC transporter ATP-binding protein HI1470; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae} Back     alignment and structure
>2qi9_C Vitamin B12 import ATP-binding protein BTUD; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_C* 4dbl_C Back     alignment and structure
>1b0u_A Histidine permease; ABC transporter, transport protein; HET: ATP; 1.50A {Salmonella typhimurium} SCOP: c.37.1.12 Back     alignment and structure
>3d31_A Sulfate/molybdate ABC transporter, ATP-binding protein; ATP-binding, nucleotide-binding, membrane, transmembrane, transport protein; 3.00A {Methanosarcina acetivorans} SCOP: b.40.6.3 c.37.1.12 Back     alignment and structure
>3fvq_A Fe(3+) IONS import ATP-binding protein FBPC; nucleotide binding domain, ABC motor domain, ferric iron TRA ATP-binding, cell inner membrane; HET: ATP; 1.90A {Neisseria gonorrhoeae} Back     alignment and structure
>2olj_A Amino acid ABC transporter; ABC domain, ATPase, hydrolase; HET: ADP; 2.05A {Geobacillus stearothermophilus} PDB: 2olk_A* 2ouk_A 2q0h_A* 3c4j_A* 3c41_J* Back     alignment and structure
>2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A* Back     alignment and structure
>2ixe_A Antigen peptide transporter 1; ABC ATPase, hydrolase; HET: ATP; 2.0A {Rattus norvegicus} PDB: 2ixg_A* 2ixf_A* 1jj7_A* Back     alignment and structure
>2yyz_A Sugar ABC transporter, ATP-binding protein; sugar transport, alpha and beta proteins (A/B) TM0421, structural genomics, NPPSFA; 2.11A {Thermotoga maritima} Back     alignment and structure
>2pjz_A Hypothetical protein ST1066; ATP binding protein, structural genomics, NPPSFA; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>1g6h_A High-affinity branched-chain amino acid transport ATP-binding protein; beta-core domain; HET: ADP; 1.60A {Methanocaldococcus jannaschii} SCOP: c.37.1.12 PDB: 1gaj_A 1g9x_A* Back     alignment and structure
>2ihy_A ABC transporter, ATP-binding protein; ATPase, ABC cassette, hydrolase; HET: MSE; 1.90A {Staphylococcus aureus} Back     alignment and structure
>2d2e_A SUFC protein; ABC-ATPase, SUF protein, 310-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics, binding; 1.70A {Thermus thermophilus} PDB: 2d2f_A* Back     alignment and structure
>2onk_A Molybdate/tungstate ABC transporter, ATP-binding protein; membrane protein; 3.10A {Archaeoglobus fulgidus} SCOP: c.37.1.12 Back     alignment and structure
>1ji0_A ABC transporter; ATP binding protein, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: ATP; 2.00A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>1z47_A CYSA, putative ABC-transporter ATP-binding protein; alpha/beta motif, beta sandwich, ligand binding protein; 1.90A {Alicyclobacillus acidocaldarius} Back     alignment and structure
>2pze_A Cystic fibrosis transmembrane conductance regulat; NBD, ABC transporter, CFTR, hydrolase; HET: ATP; 1.70A {Homo sapiens} PDB: 2pzg_A* 2pzf_A* 1ckx_A 1cky_A 1ckw_A 1ckz_A Back     alignment and structure
>2yz2_A Putative ABC transporter ATP-binding protein TM_0; cobalt transport, TM02 hydrolase, inner membrane, membrane, nucleotide-binding; 2.30A {Thermotoga maritima} Back     alignment and structure
>2zu0_C Probable ATP-dependent transporter SUFC; iron-sulfur cluster, ABC-ATPase, ATP-binding, cytoplasm, nucleotide-binding; HET: MES; 2.20A {Escherichia coli} PDB: 2d3w_A Back     alignment and structure
>1ye8_A Protein THEP1, hypothetical UPF0334 kinase-like protein AQ_1292; mixed alpha-beta protein, rossman fold, signaling protein, transferase; 1.40A {Aquifex aeolicus} SCOP: c.37.1.11 Back     alignment and structure
>1v43_A Sugar-binding transport ATP-binding protein; ATPase, active transport, sugar uptake and regulation, transport protein; 2.20A {Pyrococcus horikoshii} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 1vci_A* Back     alignment and structure
>2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens} Back     alignment and structure
>3rlf_A Maltose/maltodextrin import ATP-binding protein M; integral membrane protein, ATPase, ABC transporter, membrane transmembrane; HET: UMQ MAL PGV ANP; 2.20A {Escherichia coli} PDB: 1q1e_A 1q12_A* 2awo_A* 3fh6_A 3puv_A* 3puw_A* 3pux_A* 3puy_A* 3puz_A* 3pv0_A* 2awn_A* 2r6g_A* 1q1b_A Back     alignment and structure
>2it1_A 362AA long hypothetical maltose/maltodextrin transport ATP-binding protein; structural genomics, NPPSFA; 1.94A {Pyrococcus horikoshii} Back     alignment and structure
>1oxx_K GLCV, glucose, ABC transporter, ATP binding protein; ABC-ATPase, ATP-binding cassette, ATPase, transport protein; 1.45A {Sulfolobus solfataricus} SCOP: b.40.6.3 c.37.1.12 PDB: 1oxs_C 1oxt_A 1oxu_A* 1oxv_A* Back     alignment and structure
>2bbs_A Cystic fibrosis transmembrane conductance regulator; ATP binding cassette, transport protein; HET: ATP; 2.05A {Homo sapiens} PDB: 2bbt_A* 1xmi_A* 1xmj_A* 2bbo_A* 3si7_A* 1r0w_A 1q3h_A 1r0x_A* 1r0y_A* 1r0z_A* 1r10_A* 1xf9_A* 1xfa_A* Back     alignment and structure
>1g29_1 MALK, maltose transport protein MALK; ATPase, active transport, maltose uptake and regulation, sugar binding protein; 1.90A {Thermococcus litoralis} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 2d62_A Back     alignment and structure
>1mv5_A LMRA, multidrug resistance ABC transporter ATP-binding and permease protein; asymmetric dimer, tetramer, P-glycoprotein; HET: ATP ADP; 3.10A {Lactococcus lactis} SCOP: c.37.1.12 Back     alignment and structure
>2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str} Back     alignment and structure
>3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} Back     alignment and structure
>3gd7_A Fusion complex of cystic fibrosis transmembrane conductance regulator, residues 1193-1427...; CFTR, ABC transporter, nucleotide binding domain, NBD; HET: B44; 2.70A {Homo sapiens} Back     alignment and structure
>1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} Back     alignment and structure
>3nh6_A ATP-binding cassette SUB-family B member 6, mitoc; ABC-transporter, ABCB6, nucleotide binding domain, heme BIOS transport protein; 2.00A {Homo sapiens} PDB: 3nh9_A* 3nha_A* 3nhb_A* Back     alignment and structure
>3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* Back     alignment and structure
>4gp7_A Metallophosphoesterase; polynucleotide kinase phosphatase, RNA repair, transferase; HET: ATP CIT; 2.00A {Clostridium thermocellum} PDB: 4gp6_A* Back     alignment and structure
>3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; 7.20A {Saccharomyces cerevisiae} Back     alignment and structure
>2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A Back     alignment and structure
>2i3b_A HCR-ntpase, human cancer-related ntpase; AAA, rossmann, hydrolase; NMR {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} Back     alignment and structure
>3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; 7.20A {Saccharomyces cerevisiae} Back     alignment and structure
>3qf4_A ABC transporter, ATP-binding protein; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} Back     alignment and structure
>1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} Back     alignment and structure
>3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* Back     alignment and structure
>2jeo_A Uridine-cytidine kinase 1; UCK, transferase, ATP-binding, nucleoside kinase, nucleotide-binding; 2.50A {Homo sapiens} PDB: 2uvq_A* Back     alignment and structure
>3b5x_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; 5.50A {Vibrio cholerae} Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Back     alignment and structure
>3qf4_B Uncharacterized ABC transporter ATP-binding prote TM_0288; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} Back     alignment and structure
>2l8d_A Lamin-B receptor; DNA binding protein; NMR {Gallus gallus} Back     alignment and structure
>4a82_A Cystic fibrosis transmembrane conductance regulat; CFTR, ION channel, transport protein, casse protein; 2.00A {Homo sapiens} PDB: 2onj_A* 2hyd_A Back     alignment and structure
>2dig_A Lamin-B receptor; tudor domain, integral nuclear envelope inner membrane protein, nuclear protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.34.9.1 Back     alignment and structure
>3b60_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; HET: ANP; 3.70A {Salmonella typhimurium} SCOP: c.37.1.12 f.37.1.1 PDB: 3b5y_A* 3b5z_A* 3b5w_A Back     alignment and structure
>3ux8_A Excinuclease ABC, A subunit; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, DN binding protein; HET: ADP; 2.10A {Geobacillus} Back     alignment and structure
>4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A* Back     alignment and structure
>1cr0_A DNA primase/helicase; RECA-type protein fold, transferase; HET: DNA; 2.30A {Enterobacteria phage T7} SCOP: c.37.1.11 PDB: 1cr1_A* 1cr2_A* 1cr4_A* 1e0j_A* 1e0k_A* Back     alignment and structure
>2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} Back     alignment and structure
>3ux8_A Excinuclease ABC, A subunit; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, DN binding protein; HET: ADP; 2.10A {Geobacillus} Back     alignment and structure
>2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A Back     alignment and structure
>1nlf_A Regulatory protein REPA; replicative DNA helicase structural changes, replication; 1.95A {Escherichia coli} SCOP: c.37.1.11 PDB: 1g8y_A 1olo_A Back     alignment and structure
>2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* Back     alignment and structure
>2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} Back     alignment and structure
>2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus} Back     alignment and structure
>2r6f_A Excinuclease ABC subunit A; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, at cassette, DNA damage, DNA excision; HET: ADP; 3.20A {Geobacillus stearothermophilus} PDB: 3uwx_A Back     alignment and structure
>3p8d_A Medulloblastoma antigen MU-MB-50.72; tudor domain, lysine-methylated P53 binding, histone binding binding; 2.00A {Homo sapiens} Back     alignment and structure
>1znw_A Guanylate kinase, GMP kinase; ATP:GMP-phosphotransferase, TR; 2.10A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1znx_A* 1zny_A* 1znz_A* 1s4q_A 1z8f_A Back     alignment and structure
>3aez_A Pantothenate kinase; transferase, homodimer, COA biosynthesis, nucleotide binding binding, cytoplasm, nucleotide-binding; HET: GDP PAZ; 2.20A {Mycobacterium tuberculosis} PDB: 2ges_A* 2geu_A* 2gev_A* 2zs7_A* 2zs8_A* 2zs9_A* 2zsa_A* 2zsb_A* 2zsd_A* 2zse_A* 2zsf_A* 2get_A* 3af0_A* 3af1_A* 3af2_A* 3af3_A* 3af4_A* 3avp_A* 3avo_A* 3avq_A* Back     alignment and structure
>1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>1htw_A HI0065; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; HET: ADP; 1.70A {Haemophilus influenzae} SCOP: c.37.1.18 PDB: 1fl9_A Back     alignment and structure
>3pih_A Uvrabc system protein A; hydrolase, ABC ATPase, DNA repair, nucleotide excision repai hydrolase-DNA complex; HET: DNA; 2.90A {Thermotoga maritima} Back     alignment and structure
>2npi_A Protein CLP1; CLP1-PCF11 complex, ATP binding, ternary complex, transcript; HET: ATP; 2.95A {Saccharomyces cerevisiae} Back     alignment and structure
>2g3r_A Tumor suppressor P53-binding protein 1; tandem tudor domains, cell cycle-transcription complex; 1.25A {Homo sapiens} SCOP: b.34.9.1 b.34.9.1 PDB: 2ig0_A* 3lgf_A* 3lgl_A* 3lh0_A* 1xni_A Back     alignment and structure
>2equ_A PHD finger protein 20-like 1; tudor domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A* Back     alignment and structure
>2pt7_A CAG-ALFA; ATPase, protein-protein complex, type IV secretion, hydrolas binding complex; 2.40A {Helicobacter pylori} SCOP: c.37.1.11 PDB: 1nly_A* 1nlz_A 1opx_A* 1g6o_A Back     alignment and structure
>3qii_A PHD finger protein 20; tudor domain, structural genomics, structural GE consortium, SGC, transcription regulator; 2.30A {Homo sapiens} Back     alignment and structure
>3sop_A Neuronal-specific septin-3; hydrolase; HET: GDP; 2.88A {Homo sapiens} Back     alignment and structure
>1z6g_A Guanylate kinase; structural genomics, SGC, structural genom consortium, transferase; HET: EPE; 2.18A {Plasmodium falciparum} Back     alignment and structure
>1mhn_A SurviVal motor neuron protein; SMN, SMA, spinal muscular atrophy, RNA binding protein; 1.80A {Homo sapiens} SCOP: b.34.9.1 PDB: 4a4e_A* 4a4g_A* Back     alignment and structure
>3hr8_A Protein RECA; alpha and beta proteins (A/B, A+B), ATP-binding, cytoplasm, damage, DNA recombination, DNA repair, DNA-binding; 1.95A {Thermotoga maritima} Back     alignment and structure
>3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii} Back     alignment and structure
>2vf7_A UVRA2, excinuclease ABC, subunit A.; DNA-binding protein, nucleotide-binding, zinc-binding domain, SOS response, metal-binding; HET: ADP; 2.30A {Deinococcus radiodurans} PDB: 2vf8_A* Back     alignment and structure
>2zr9_A Protein RECA, recombinase A; recombination, RECA mutants, DNA-repair, ATP-binding, DNA DA recombination, DNA repair, DNA-binding; HET: DTP; 2.50A {Mycobacterium smegmatis str} PDB: 2zr0_A* 2zra_A* 2zrb_A 2zrm_A* 1ubc_A* 1ubf_A* 1ubg_A* 1ube_A* 2g88_A* 2odw_A* 2oe2_A 2oep_A* 2oes_A 2ofo_A 2zr7_A 2odn_A* 2zrn_A 2zro_A* 2zrp_A* 2zre_A* ... Back     alignment and structure
>3lnc_A Guanylate kinase, GMP kinase; ALS collaborative crystallography, emerald biostructures, ATP-binding, cytoplasm, nucleotide-binding; HET: 5GP; 1.95A {Anaplasma phagocytophilum} Back     alignment and structure
>2yhs_A FTSY, cell division protein FTSY; cell cycle, protein targeting, simibi class GTPase, GTP-BIND membrane, nucleotide-binding; 1.60A {Escherichia coli} PDB: 2qy9_A 2xxa_B* 1fts_A Back     alignment and structure
>2ldm_A Uncharacterized protein; PHF20, tudor domain, epigenetics, methylated P53, transcript factor, transcription-protein binding complex; HET: M2L; NMR {Homo sapiens} Back     alignment and structure
>3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B* Back     alignment and structure
>3b85_A Phosphate starvation-inducible protein; PHOH2, ATPase, PFAM: PF02562, ST genomics, PSI-2, protein structure initiative; 2.35A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* Back     alignment and structure
>1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 Back     alignment and structure
>1pzn_A RAD51, DNA repair and recombination protein RAD51, RADA; heptameric ring, heptamer, ring, oligomer, RAD51 polymerizat motif; HET: DNA; 2.85A {Pyrococcus furiosus} SCOP: a.60.4.1 c.37.1.11 Back     alignment and structure
>4a4f_A SurviVal of motor neuron-related-splicing factor; RNA binding protein; HET: 2MR; NMR {Homo sapiens} PDB: 4a4h_A* Back     alignment and structure
>4f4c_A Multidrug resistance protein PGP-1; ABC transporter, ATPase, multi-drug transporter, exporter, A binding, hydrolase,protein transport; HET: NDG NAG BMA MAN 0SA; 3.40A {Caenorhabditis elegans} Back     alignment and structure
>2eqj_A Metal-response element-binding transcription factor 2; structure genomics,tudor domain, zinc-regulated factor 1, ZIRF1; NMR {Mus musculus} Back     alignment and structure
>1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 Back     alignment and structure
>3kta_A Chromosome segregation protein SMC; structural maintenance of chromosomes, ABC ATPase, CFTR adenylate kinase, AP5A, transferase; HET: AP5; 1.63A {Pyrococcus furiosus} PDB: 1xex_A* 1xew_X* Back     alignment and structure
>1ssf_A Transformation related protein 53 binding protein 1; tudor domains, tandem, SH3-like fold, beta barrel, alpha- helix, cell cycle; NMR {Mus musculus} SCOP: b.34.9.1 b.34.9.1 Back     alignment and structure
>1s96_A Guanylate kinase, GMP kinase; E.coli, dimer, SAD, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.1 PDB: 2an9_A* 2anb_A* 2anc_A 2f3r_A* 2f3t_A* Back     alignment and structure
>3s6w_A Tudor domain-containing protein 3; methylated arginine recognize, ISO-propanol, transcri; 1.78A {Homo sapiens} PDB: 3pmt_A* Back     alignment and structure
>3asz_A Uridine kinase; cytidine phosphorylation, transferase; HET: C5P; 2.25A {Thermus thermophilus} PDB: 3asy_A* Back     alignment and structure
>3szr_A Interferon-induced GTP-binding protein MX1; interferon-induced antiviral GTPase, membrane associated, PR binding; 3.50A {Homo sapiens} PDB: 3zys_B Back     alignment and structure
>3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP} Back     alignment and structure
>1g5v_A SurviVal motor neuron protein 1; mRNA processing, translation; NMR {Homo sapiens} SCOP: b.34.9.1 Back     alignment and structure
>1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1 Back     alignment and structure
>2v9p_A Replication protein E1; AAA+ molecular motor, DNA replication, DNA translocation, nucleotide-binding, DNA-binding; 3.00A {Bovine papillomavirus type 1} PDB: 2gxa_A* Back     alignment and structure
>3g5u_A MCG1178, multidrug resistance protein 1A; P-glycoprotein, PGP, cyclic peptide, membrane protein; 3.80A {Mus musculus} PDB: 3g61_A* 3g60_A* Back     alignment and structure
>2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG, function; 2.40A {Bacillus halodurans} SCOP: c.37.1.25 Back     alignment and structure
>4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} Back     alignment and structure
>3g5u_A MCG1178, multidrug resistance protein 1A; P-glycoprotein, PGP, cyclic peptide, membrane protein; 3.80A {Mus musculus} PDB: 3g61_A* 3g60_A* Back     alignment and structure
>1ls1_A Signal recognition particle protein; FFH, SRP54, SRP, GTPase, ultrahigh resolution, protein transport; 1.10A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 1jpn_B* 1jpj_A* 1ry1_U* 2j45_A* 1o87_A* 2c04_A* 2j46_A* 1rj9_B* 2c03_A* 2j7p_A* 1okk_A* 2cnw_A* 1ng1_A* 2xkv_A 3ng1_A 1ffh_A 2ng1_A* Back     alignment and structure
>1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii} Back     alignment and structure
>3lda_A DNA repair protein RAD51; DNA binding protein, ATP-binding, DNA damage, DNA recombinat repair, nucleotide-binding; HET: DNA; 2.50A {Saccharomyces cerevisiae} PDB: 1szp_A* Back     alignment and structure
>1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* Back     alignment and structure
>3b9q_A Chloroplast SRP receptor homolog, alpha subunit CPFTSY; protein translocation, GTP-binding, nucleotide-binding, protein transport; 1.75A {Arabidopsis thaliana} Back     alignment and structure
>1zu4_A FTSY; GTPase, signal recognition particle, SRP, receptor, protein transport; 1.95A {Mycoplasma mycoides} PDB: 1zu5_A Back     alignment and structure
>1f2t_A RAD50 ABC-ATPase; DNA double-strand break repair, replication; 1.60A {Pyrococcus furiosus} SCOP: c.37.1.12 PDB: 1f2u_A* 1us8_A* Back     alignment and structure
>1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2 Back     alignment and structure
>3euj_A Chromosome partition protein MUKB, linker; MUKB, MUKE, chromosome condensation, condensin, SMC, N subunit, ABC-type ATPase, WHD, ATP-binding; HET: AGS; 3.10A {Haemophilus ducreyi} PDB: 3euk_A* Back     alignment and structure
>2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus} Back     alignment and structure
>3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes} Back     alignment and structure
>4aby_A DNA repair protein RECN; hydrolase, double strand break repair, ATPase, nucleotide binding domain; HET: DNA; 3.00A {Deinococcus radiodurans} Back     alignment and structure
>1sq5_A Pantothenate kinase; P-loop, transferase; HET: PAU ADP; 2.20A {Escherichia coli} SCOP: c.37.1.6 PDB: 1esm_A* 1esn_A* Back     alignment and structure
>3qf7_A RAD50; ABC-ATPase, ATPase, hydrolase; HET: ANP; 1.90A {Thermotoga maritima} PDB: 3qg5_A 3tho_A* Back     alignment and structure
>2gza_A Type IV secretion system protein VIRB11; ATPase, hydrolase; 2.60A {Brucella suis} Back     alignment and structure
>3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A* Back     alignment and structure
>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>2bbw_A Adenylate kinase 4, AK4; nucleotide kinase, nucleotide binding, human, structura genomics, structural genomics consortium, SGC, transferase; HET: GP5; 2.05A {Homo sapiens} PDB: 2ar7_A* 3ndp_A Back     alignment and structure
>2og2_A Putative signal recognition particle receptor; nucleotide-binding, protein transport; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>2m0o_A PHD finger protein 1; tudor domain, H3K36ME3 binding, peptide binding protein; HET: M3L; NMR {Homo sapiens} Back     alignment and structure
>3pnw_C Tudor domain-containing protein 3; FAB, structural genomics consortium, antibody, SGC, protein immune system complex; 2.05A {Homo sapiens} Back     alignment and structure
>3uie_A Adenylyl-sulfate kinase 1, chloroplastic; rossmann fold, transferase-transferase complex; HET: ADX ANP; 1.79A {Arabidopsis thaliana} SCOP: c.37.1.0 PDB: 4fxp_A* Back     alignment and structure
>2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} Back     alignment and structure
>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A Back     alignment and structure
>1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* Back     alignment and structure
>1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* Back     alignment and structure
>4e22_A Cytidylate kinase; P-loop, CMP/ATP binding, transferase; 2.32A {Yersinia pseudotuberculosis} Back     alignment and structure
>2d9t_A Tudor domain-containing protein 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: b.34.9.1 Back     alignment and structure
>2b8t_A Thymidine kinase; deoxyribonucleoside kinase, zinc-binding domain, TK1, UU-TK, transferase; HET: THM; 2.00A {Ureaplasma parvum} SCOP: c.37.1.24 g.39.1.14 PDB: 2uz3_A* Back     alignment and structure
>2r6a_A DNAB helicase, replicative helicase; replication, DNAB; 2.90A {Geobacillus stearothermophilus} PDB: 2r6c_A 2r6d_A 2r6e_A 2vyf_A 2vye_A Back     alignment and structure
>3qks_A DNA double-strand break repair RAD50 ATPase; RECA-like fold, coiled-coils, ATPase, exonuclease, endonucle binding, DNA binding; HET: DNA; 2.10A {Pyrococcus furiosus} PDB: 3qkr_A* Back     alignment and structure
>1u94_A RECA protein, recombinase A; homologous recombination, ATPase, DNA repair, DNA binding protein; 1.90A {Escherichia coli} SCOP: c.37.1.11 d.48.1.1 PDB: 1u98_A 1u99_A 1xms_A* 1xmv_A* 2rec_A 2reb_A 1n03_A* 1rea_A 1aa3_A Back     alignment and structure
>1p9r_A General secretion pathway protein E; bacterial type II secretion system cytoplasmic protein - GSPE, putative ATPase/ ATP binding protein; 2.50A {Vibrio cholerae} SCOP: c.37.1.11 PDB: 1p9w_A* Back     alignment and structure
>1nij_A Hypothetical protein YJIA; structural genomics, P-loop protein, GTP binding, structure function project, S2F, unknown function; 2.00A {Escherichia coli} SCOP: c.37.1.10 d.237.1.1 Back     alignment and structure
>2qag_B Septin-6, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>1tq4_A IIGP1, interferon-inducible GTPase; interferon gamma, dimer, immunology, signaling protein; HET: GDP; 1.95A {Mus musculus} SCOP: c.37.1.8 PDB: 1tqd_A* 1tq6_A* 1tpz_A* 1tq2_A* Back     alignment and structure
>2obl_A ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O127} PDB: 2obm_A* Back     alignment and structure
>2qm8_A GTPase/ATPase; G protein, G3E, metallochaperone, chaperone; HET: MSE; 1.70A {Methylobacterium extorquens} SCOP: c.37.1.10 PDB: 2qm7_A* Back     alignment and structure
>1rj9_A FTSY, signal recognition protein; SRP-GTPase domain, heterodimer, nucleotide twinning, protein complex, protein transport; HET: GCP; 1.90A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 2q9c_A* 2q9b_A* 2q9a_A* 1okk_D* 2xkv_D 2iyl_D* 2cnw_D* 2j7p_D* Back     alignment and structure
>2orw_A Thymidine kinase; TMTK, TP4A, transferase; HET: 4TA; 1.50A {Thermotoga maritima} PDB: 2qpo_A 2qq0_A* 2qqe_A* Back     alignment and structure
>2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} Back     alignment and structure
>1v5w_A DMC1, meiotic recombination protein DMC1/LIM15 homolog; DNA-binding protein, ring protein, octamer, AAA ATPase; 3.20A {Homo sapiens} SCOP: c.37.1.11 PDB: 2zjb_A Back     alignment and structure
>2vp4_A Deoxynucleoside kinase; ATP-binding, DNA synthesis, phosphoprotein, feedback inhibition, deoxyribonucleoside kinase, salvage pathway; HET: DCP; 2.20A {Drosophila melanogaster} SCOP: c.37.1.1 PDB: 1j90_A* 2jj8_A* 2vp2_A* 1oe0_A* 2vp5_A* 2vp6_A* 2vp9_A* 2vpp_A* 2vqs_A* 2vp0_A* 1ot3_A* 2jcs_A* 1zm7_A* 1zmx_A* Back     alignment and structure
>1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* Back     alignment and structure
>1rz3_A Hypothetical protein rbstp0775; MCSG, structural genomics, PSI, protein structure initiative; 1.90A {Geobacillus stearothermophilus} SCOP: c.37.1.6 Back     alignment and structure
>3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A Back     alignment and structure
>2o5v_A DNA replication and repair protein RECF; ABC ATPase, walker A motif, P-loop, signature motif, replication/recombination complex; HET: DNA; 1.61A {Deinococcus radiodurans} Back     alignment and structure
>1jjv_A Dephospho-COA kinase; P-loop nucleotide-binding fold, structure 2 function project, S2F, structural genomics, transferase; HET: ATP; 2.00A {Haemophilus influenzae} SCOP: c.37.1.1 Back     alignment and structure
>2if2_A Dephospho-COA kinase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 3.00A {Aquifex aeolicus} Back     alignment and structure
>3ney_A 55 kDa erythrocyte membrane protein; structural genomics consortium, SGC, 55 kDa erythrocyte MEMB protein; 2.26A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>2ewv_A Twitching motility protein PILT; pilus retraction motor, ATPase, hexameric PILT, protein TRAN; HET: ADP; 2.80A {Aquifex aeolicus} PDB: 2eww_A* 2gsz_A* Back     alignment and structure
>4f4c_A Multidrug resistance protein PGP-1; ABC transporter, ATPase, multi-drug transporter, exporter, A binding, hydrolase,protein transport; HET: NDG NAG BMA MAN 0SA; 3.40A {Caenorhabditis elegans} Back     alignment and structure
>1e69_A Chromosome segregation SMC protein; structural maintenance of chromosomes, coiled coil; 3.1A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>2dpy_A FLII, flagellum-specific ATP synthase; beta barrel, alpha-beta structure, hydrolase; HET: ADP; 2.40A {Salmonella typhimurium} Back     alignment and structure
>3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} Back     alignment and structure
>1lw7_A Transcriptional regulator NADR; NMN, NMN adenylyl transferase, ribosylnicotinamide KINA transferase; HET: NAD; 2.90A {Haemophilus influenzae} SCOP: c.26.1.3 c.37.1.1 Back     alignment and structure
>1xp8_A RECA protein, recombinase A; recombination, radioresistance, DNA-repair, ATPase, DNA-BIND protein, DNA binding protein; HET: AGS; 2.50A {Deinococcus radiodurans} SCOP: c.37.1.11 d.48.1.1 Back     alignment and structure
>2z43_A DNA repair and recombination protein RADA; archaea, filament, DNA binding, molecular SWI RECA, DMC1; HET: DNA; 1.93A {Sulfolobus solfataricus} PDB: 2bke_A* 2dfl_A* 2zub_A* 2zuc_A* 2zud_A* Back     alignment and structure
>3llm_A ATP-dependent RNA helicase A; alpha-beta-alpha, structural genomics, structural genomics consortium, SGC, activator, ATP-binding, DNA-binding; HET: ADP; 2.80A {Homo sapiens} Back     alignment and structure
>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Back     alignment and structure
>3qkt_A DNA double-strand break repair RAD50 ATPase; RECA-like fold, coiled-coils, ATP binding, DNA bindi MRE11, replication; HET: DNA ANP; 1.90A {Pyrococcus furiosus} PDB: 3qku_A* 1ii8_A 3qks_B* 3qkr_B* 1ii8_B Back     alignment and structure
>4hcz_A PHD finger protein 1; protein-peptide complex, tudor, histone binding, H3K36ME3, N nucleus, transcription; HET: M3L; 1.85A {Homo sapiens} Back     alignment and structure
>2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} Back     alignment and structure
>1cke_A CK, MSSA, protein (cytidine monophosphate kinase); nucleotide monophosphate kinase,, transferase; 1.75A {Escherichia coli} SCOP: c.37.1.1 PDB: 1kdo_A* 1kdp_A* 1kdr_A* 1kdt_A* 2cmk_A* 2fem_A 2feo_A* Back     alignment and structure
>1qhl_A Protein (cell division protein MUKB); SMC, chromosome partitioning; 2.20A {Escherichia coli} SCOP: c.37.1.12 Back     alignment and structure
>3tqc_A Pantothenate kinase; biosynthesis of cofactors, prosthetic groups, carriers, TRAN; HET: ADP; 2.30A {Coxiella burnetii} Back     alignment and structure
>2pez_A Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthetase 1 (PAPS synthetase...; NMP-kinase fold, protein in complex with nucleic acid; HET: GGZ DAT; 1.40A {Homo sapiens} PDB: 2pey_A* 2ax4_A* Back     alignment and structure
>3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} Back     alignment and structure
>1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2vhj_A Ntpase P4, P4; non- hydrolysable ATP analogue, hydrolase, virus dsRNA, molecular motor, packaging ATPase, hexameric helicase; HET: ADP; 1.80A {Pseudomonas phage PHI12} PDB: 2vhq_A* 1w44_A* 1w46_A* 1w47_A* 1w48_A* 1w49_A* 1w4a_A* 1w4b_A* 1w4c_A 2vht_A* 2vhu_A* 2vhc_A* Back     alignment and structure
>3m6a_A ATP-dependent protease LA 1; alpha, beta, ATP-binding, hydrolase, nucleotide-binding, Pro serine protease, stress response; HET: ADP; 3.40A {Bacillus subtilis} PDB: 1x37_A Back     alignment and structure
>1w1w_A Structural maintenance of chromosome 1; cohesin, chromosome segregation, cell adhesion, kleisin, MIT cell cycle; HET: ATG; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.12 Back     alignment and structure
>3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti} Back     alignment and structure
>2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} Back     alignment and structure
>3auy_A DNA double-strand break repair RAD50 ATPase; DNA repair, ABC transporter ATPase domain-like; HET: DNA ADP; 2.70A {Methanocaldococcus jannaschii} PDB: 3aux_A* 3av0_B* Back     alignment and structure
>1svm_A Large T antigen; AAA+ fold, viral protein; HET: ATP; 1.94A {Simian virus 40} SCOP: c.37.1.20 PDB: 1svl_A* 1svo_A 1n25_A 2h1l_A Back     alignment and structure
>2oap_1 GSPE-2, type II secretion system protein; hexameric ATPase, hydrolase; HET: ANP; 2.95A {Archaeoglobus fulgidus} PDB: 2oaq_1 Back     alignment and structure
>2qt1_A Nicotinamide riboside kinase 1; non-protein kinase, NAD+, NRK1, nicotinic acid riboside kinase activity, NAD biosynthesis; HET: NNR; 1.32A {Homo sapiens} PDB: 2qsy_A* 2qsz_A* 2qt0_A* 2p0e_A* 2qg6_A* 2ql6_A* Back     alignment and structure
>1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* Back     alignment and structure
>2yv5_A YJEQ protein; hydrolase, GTPase, permutation, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GDP; 1.90A {Aquifex aeolicus} Back     alignment and structure
>2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax} Back     alignment and structure
>3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} Back     alignment and structure
>2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* Back     alignment and structure
>1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>2i1q_A DNA repair and recombination protein RADA; ATPase, recombinase, ATP complex, calcium stimulation, RECA, DMC1; HET: DNA ANP; 1.90A {Methanococcus voltae} SCOP: a.60.4.1 c.37.1.11 PDB: 1xu4_A* 2b21_A* 2fpk_A* 2fpl_A* 2fpm_A* 1t4g_A* 3fyh_A* 2f1j_A* 2f1i_A* 2f1h_A* 3ntu_A* 3ewa_A* 3ew9_A* 3etl_A* 4dc9_A* 2gdj_A* Back     alignment and structure
>3io5_A Recombination and repair protein; storage dimer, inactive conformation, RECA like core domain, binding, DNA damage, DNA recombination; 2.40A {Enterobacteria phage T4} Back     alignment and structure
>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} Back     alignment and structure
>1u0l_A Probable GTPase ENGC; permutation, OB-fold, zinc-finger, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; HET: GDP; 2.80A {Thermotoga maritima} SCOP: b.40.4.5 c.37.1.8 Back     alignment and structure
>1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* Back     alignment and structure
>2yvu_A Probable adenylyl-sulfate kinase; transferase, structural genomics, NPPSFA, national P protein structural and functional analyses; 2.10A {Aeropyrum pernix} Back     alignment and structure
>3fdr_A Tudor and KH domain-containing protein; TDRD2, structural genomics, structural genomics consortium, SGC, alternative splicing, RNA-binding; 1.75A {Homo sapiens} SCOP: b.34.9.1 Back     alignment and structure
>3cm0_A Adenylate kinase; ATP-binding, cytoplasm, nucleotide biosynthesis, nucleotide-binding, transferase, structural genomics; 1.80A {Thermus thermophilus} Back     alignment and structure
>3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A Back     alignment and structure
>2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* Back     alignment and structure
>3nwj_A ATSK2; P loop, shikimate, nucleoside monophosphate kinase, shikimat ATP binding, chloroplast, transferase; 2.35A {Arabidopsis thaliana} Back     alignment and structure
>2rcn_A Probable GTPase ENGC; YJEQ, circularly permuted, GTP-binding, hydrolase, nucleotide-binding; HET: GDP; 2.25A {Salmonella typhimurium} PDB: 2ykr_W 4a2i_V Back     alignment and structure
>2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B* Back     alignment and structure
>1y63_A LMAJ004144AAA protein; structural genomics, protein structure initiative, PSI, SGPP structural genomics of pathogenic protozoa consortium; HET: ADP; 1.70A {Leishmania major} SCOP: c.37.1.1 Back     alignment and structure
>1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 Back     alignment and structure
>3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} SCOP: c.37.1.1 PDB: 2axp_A* Back     alignment and structure
>2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} Back     alignment and structure
>4eaq_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, MTBI, transferase; HET: ATM; 1.85A {Staphylococcus aureus subsp} PDB: 4dwj_A* 4f4i_A Back     alignment and structure
>3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} Back     alignment and structure
>1oix_A RAS-related protein RAB-11A; small G protein, intracellular trafficking, GTP-binding, lipoprotein, prenylation, protein transport; HET: GDP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1oiw_A* 1oiv_A* 3rwo_B* 3rwm_B* Back     alignment and structure
>1pui_A ENGB, probable GTP-binding protein ENGB; structural genomics, nysgxrc T16, GTPase, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: c.37.1.8 Back     alignment and structure
>3k1j_A LON protease, ATP-dependent protease LON; ATP-binding, nucleotide-binding, Pro hydrolase; HET: ADP PE8; 2.00A {Thermococcus onnurineus} Back     alignment and structure
>2f9l_A RAB11B, member RAS oncogene family; RAB11B GTPase, vesicle transport, hydrolase; HET: GDP; 1.55A {Homo sapiens} SCOP: c.37.1.8 PDB: 2f9m_A* 1yzk_A* 2hv8_A* 2gzd_A* 2gzh_A* 2d7c_A* 3bfk_A* Back     alignment and structure
>2ze6_A Isopentenyl transferase; crown GALL tumor, cytokinin biosynthesis; HET: DST AMP; 2.10A {Agrobacterium tumefaciens} PDB: 2ze5_A* 2ze7_A* 2ze8_A Back     alignment and structure
>2orv_A Thymidine kinase; TP4A (P1-(5'-adenosyl)P4-(5'- (2'deoxythymidil))tetraphosphate, transferase; HET: 4TA; 2.30A {Homo sapiens} SCOP: c.37.1.24 g.39.1.14 Back     alignment and structure
>1xx6_A Thymidine kinase; NESG, northeast structural genomics consortium, protein STRU initiative, PSI, structural genomics, DNA synthesis; HET: ADP; 2.00A {Clostridium acetobutylicum} SCOP: c.37.1.24 g.39.1.14 Back     alignment and structure
>3lw7_A Adenylate kinase related protein (ADKA-like); AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 2.30A {Sulfolobus solfataricus} PDB: 3h0k_A Back     alignment and structure
>3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C Back     alignment and structure
>2xk0_A Polycomb protein PCL; transcription, aromatic CAGE; NMR {Drosophila melanogaster} Back     alignment and structure
>3cr8_A Sulfate adenylyltranferase, adenylylsulfate kinase; APS kinase, transferase, sulfate metabolism, nucleotide 2 kinase; 2.95A {Thiobacillus denitrificans} Back     alignment and structure
>2f1r_A Molybdopterin-guanine dinucleotide biosynthesis protein B (MOBB); structural genomics, PSI, protein structure initiative; 2.10A {Archaeoglobus fulgidus} Back     alignment and structure
>4ad8_A DNA repair protein RECN; DNA binding protein, ATPase domain; HET: DNA; 4.00A {Deinococcus radiodurans} Back     alignment and structure
>1ly1_A Polynucleotide kinase; PNK, phosphatase, transferase; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 Back     alignment and structure
>4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* Back     alignment and structure
>2ius_A DNA translocase FTSK; nucleotide-binding, chromosome partition, ATP-binding, DNA- binding, cell division, transmembrane, inner membrane; HET: DNA; 2.7A {Escherichia coli} PDB: 2j5p_A* Back     alignment and structure
>2eqk_A Tudor domain-containing protein 4; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* Back     alignment and structure
>1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* Back     alignment and structure
>1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A* Back     alignment and structure
>1m7g_A Adenylylsulfate kinase; APS kinase, transferase, sulfate Met nucleotide 2 kinase; HET: AV2 ADX ADP; 1.43A {Penicillium chrysogenum} SCOP: c.37.1.4 PDB: 1d6j_A* 1m7h_A* 3cr7_A* Back     alignment and structure
>1t9h_A YLOQ, probable GTPase ENGC; N-terminal beta-barrel domain with oligonucleotide binding fold, central GTP binding domain; 1.60A {Bacillus subtilis} SCOP: b.40.4.5 c.37.1.8 Back     alignment and structure
>2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} Back     alignment and structure
>2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus} Back     alignment and structure
>1via_A Shikimate kinase; structural genomics, transferase; HET: MSE; 1.57A {Campylobacter jejuni} SCOP: c.37.1.2 Back     alignment and structure
>3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} Back     alignment and structure
>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* Back     alignment and structure
>1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} Back     alignment and structure
>1vht_A Dephospho-COA kinase; structural genomics, transferase; HET: BA3; 1.59A {Escherichia coli} SCOP: c.37.1.1 PDB: 1vhl_A* 1viy_A 1t3h_A 1n3b_A Back     alignment and structure
>2diq_A Tudor and KH domain-containing protein; tudor domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.34.9.1 Back     alignment and structure
>3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} Back     alignment and structure
>2qag_C Septin-7; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>2qnr_A Septin-2, protein NEDD5; structural genomics consortium, SGC, mitosis, GDP, C cycle, cell division, GTP-binding, nucleotide-binding; HET: GDP; 2.60A {Homo sapiens} PDB: 2qa5_A* 3ftq_A* Back     alignment and structure
>1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1kht_A Adenylate kinase; phosphotransferase, signaling protein, transferase; HET: AMP; 2.50A {Methanococcus voltae} SCOP: c.37.1.1 PDB: 3h86_B* 1ki9_A Back     alignment and structure
>1ex7_A Guanylate kinase; substrate-induced FIT, domain movement, GMP, ATP, substrate specificity, X-RAY diffraction, transferase; HET: 5GP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1ex6_A* 1gky_A* 3sqk_A 4f4j_A Back     alignment and structure
>1q3t_A Cytidylate kinase; nucleotide monophosphate kinase, CMP kinase, transferase; NMR {Streptococcus pneumoniae} SCOP: c.37.1.1 Back     alignment and structure
>1gvn_B Zeta; postsegregational killing system, plasmid; 1.95A {Streptococcus pyogenes} SCOP: c.37.1.21 PDB: 3q8x_B* Back     alignment and structure
>2p5t_B PEZT; postsegregational killing system, phosphoryltransferase, HEL helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae} Back     alignment and structure
>3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae} Back     alignment and structure
>3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D* Back     alignment and structure
>3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} Back     alignment and structure
>1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A* Back     alignment and structure
>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} Back     alignment and structure
>2vli_A Antibiotic resistance protein; transferase, tunicamycin, phosphotransferase; 1.95A {Deinococcus radiodurans} Back     alignment and structure
>1tev_A UMP-CMP kinase; ploop, NMP binding region, LID region, conformational changes, transferase; 2.10A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>1np6_A Molybdopterin-guanine dinucleotide biosynthesis protein B; mixed alpha-beta fold, elongated beta-sheet, walker A motif, P-loop structural motif; 1.90A {Escherichia coli} SCOP: c.37.1.10 PDB: 1p9n_A Back     alignment and structure
>4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3iij_A Coilin-interacting nuclear ATPase protein; alpha and beta proteins (A/B), protein binding, transferase, phosphotransferase; HET: ADP; 1.76A {Homo sapiens} SCOP: c.37.1.1 PDB: 3iik_A 3iil_A* 3iim_A* 1rkb_A Back     alignment and structure
>4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4a1f_A DNAB helicase, replicative DNA helicase; hydrolase, DNA replication, ATPase; HET: FLC; 2.50A {Helicobacter pylori} Back     alignment and structure
>2q6t_A DNAB replication FORK helicase; hydrolase; 2.90A {Thermus aquaticus} Back     alignment and structure
>2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* Back     alignment and structure
>3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A* Back     alignment and structure
>2c95_A Adenylate kinase 1; transferase, AP4A, nucleotide kinase, transferase ATP-bindi; HET: B4P; 1.71A {Homo sapiens} PDB: 1z83_A* 3adk_A Back     alignment and structure
>2j9r_A Thymidine kinase; TK1, DNK, lasso, transferase, ATP-binding, deoxyribonucleoside kinase, DNA synthesis, phosphate accept nucleotide-binding; HET: THM; 2.7A {Bacillus anthracis} PDB: 2ja1_A* Back     alignment and structure
>1udx_A The GTP-binding protein OBG; TGS domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.07A {Thermus thermophilus} SCOP: b.117.1.1 c.37.1.8 d.242.1.1 Back     alignment and structure
>2jaq_A Deoxyguanosine kinase; transferase, deoxyribonucleoside kinase; HET: DCP; 2.3A {Mycoplasma mycoides subsp} PDB: 2jat_A* 2jas_A* Back     alignment and structure
>1uf9_A TT1252 protein; P-loop, nucleotide binding domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: ATP; 2.80A {Thermus thermophilus} SCOP: c.37.1.1 Back     alignment and structure
>1gtv_A TMK, thymidylate kinase; transferase, transferase (ATP:TMP phosphotransferase); HET: TYD TMP; 1.55A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1g3u_A* 1gsi_A* 1mrn_A* 1mrs_A* 1n5i_A* 1n5j_A* 1n5k_A* 1n5l_A* 1w2g_A* 1w2h_A* Back     alignment and structure
>1odf_A YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser2 intergenic region; yeast protein, ATP binding protein; 2.25A {Saccharomyces cerevisiae} SCOP: c.37.1.6 Back     alignment and structure
>2e5q_A PHD finger protein 19; tudor domain, isoform B, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2www_A Methylmalonic aciduria type A protein, mitochondrial; transport protein, nucleotide-binding; HET: GDP 2PE; 2.64A {Homo sapiens} Back     alignment and structure
>2p67_A LAO/AO transport system kinase; ARGK, structural GEN PSI-2, protein structure initiative, NEW YORK SGX research for structural genomics; 1.80A {Escherichia coli} SCOP: c.37.1.10 Back     alignment and structure
>4b4t_L 26S protease subunit RPT4; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3e1s_A Exodeoxyribonuclease V, subunit RECD; alpha and beta protein, ATP-binding, nucleotide-binding, HYD; 2.20A {Deinococcus radiodurans} PDB: 3gp8_A 3gpl_A* Back     alignment and structure
>3bh0_A DNAB-like replicative helicase; ATPase, replication; 2.35A {Bacillus phage SPP1} Back     alignment and structure
>2plr_A DTMP kinase, probable thymidylate kinase; TMP-binding, ATP-binding, structural GEN NPPSFA; HET: 1PE PGE EPE PG4; 1.60A {Sulfolobus tokodaii} Back     alignment and structure
>1nks_A Adenylate kinase; thermophilic, transferase; HET: AMP ADP; 2.57A {Sulfolobus acidocaldarius} SCOP: c.37.1.1 Back     alignment and structure
>2v3c_C SRP54, signal recognition 54 kDa protein; nucleotide-binding, signal recognition particle, GTP-binding, RNA-binding; 2.50A {Methanocaldococcus jannaschii} PDB: 3ndb_B Back     alignment and structure
>2v54_A DTMP kinase, thymidylate kinase; nucleotide biosynthesis, ATP-binding, nucleotide-binding, poxvirus, transferase; HET: TYD POP; 2.4A {Vaccinia virus copenhagen} PDB: 2w0s_A* Back     alignment and structure
>2wwf_A Thymidilate kinase, putative; transferase, malaria; HET: TMP ADP; 1.89A {Plasmodium falciparum} PDB: 2wwg_A* 2wwh_A* 2wwi_A* Back     alignment and structure
>3e2i_A Thymidine kinase; Zn-binding, ATP-binding, DNA synthesis, nucleotide-B transferase; HET: MSE; 2.01A {Staphylococcus aureus} Back     alignment and structure
>3ake_A Cytidylate kinase; CMP kinase, CMP complex, open conformation, nucleotide metab transferase; HET: C5P; 1.50A {Thermus thermophilus} PDB: 3akc_A* 3akd_A* Back     alignment and structure
>2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A Back     alignment and structure
>1qf9_A UMP/CMP kinase, protein (uridylmonophosphate/cytidylmonophosphate kinase); nucleoside monophosphate kinase, NMP kinase; HET: ADP C5P; 1.70A {Dictyostelium discoideum} SCOP: c.37.1.1 PDB: 1uke_A* 2ukd_A* 3ukd_A* 4ukd_A* 5ukd_A* Back     alignment and structure
>1nn5_A Similar to deoxythymidylate kinase (thymidylate K; P-loop, D4TMP, transferase; HET: 2DT ANP; 1.50A {Homo sapiens} SCOP: c.37.1.1 PDB: 1e2e_A* 1e2d_A* 1e2g_A* 1e2q_A* 1e99_A* 1e9a_A* 1e9b_A* 1nmx_A* 1nmz_A* 1nn0_A* 1nn1_A* 1e2f_A* 1nn3_A* 2xx3_A* 1e9c_A* 1e9d_A* 1e9e_A* 1e98_A* 1nmy_A* 1e9f_A* Back     alignment and structure
>2e5p_A Protein PHF1, PHD finger protein 1; tudor domain, PHF1 protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3r20_A Cytidylate kinase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, ADP, DCMP, D transferase; 2.00A {Mycobacterium smegmatis} SCOP: c.37.1.0 PDB: 3r8c_A 4die_A* Back     alignment and structure
>4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii} Back     alignment and structure
>1tue_A Replication protein E1; helicase, replication, E1E2 complex, AAA+ protein; 2.10A {Human papillomavirus type 18} SCOP: c.37.1.20 Back     alignment and structure
>1j8m_F SRP54, signal recognition 54 kDa protein; signaling protein; 2.00A {Acidianus ambivalens} SCOP: a.24.13.1 c.37.1.10 PDB: 1j8y_F Back     alignment and structure
>1e6c_A Shikimate kinase; phosphoryl transfer, ADP, shikimate pathway, P-loop protein, transferase; 1.8A {Erwinia chrysanthemi} SCOP: c.37.1.2 PDB: 1shk_A 2shk_A* Back     alignment and structure
>1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B* Back     alignment and structure
>2bwj_A Adenylate kinase 5; phosphoryl transfer reaction, transferase; HET: AMP; 2.3A {Homo sapiens} Back     alignment and structure
>1ni3_A YCHF GTPase, YCHF GTP-binding protein; structural genomics, GTP1OBG, PSI, protein structure initiative; 2.80A {Schizosaccharomyces pombe} SCOP: c.37.1.8 d.15.10.2 Back     alignment and structure
>2wji_A Ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GNP; 1.90A {Methanocaldococcus jannaschii} PDB: 2wjj_A* 2wjh_A* Back     alignment and structure
>3a4m_A L-seryl-tRNA(SEC) kinase; P-loop motif, walker A motif, ATP binding motif, ATP- binding, nucleotide-binding, transferase; HET: ADP; 1.79A {Methanocaldococcus jannaschii} PDB: 3a4l_A* 3a4n_A 3am1_A* 3add_A* 3adc_A* 3adb_A* Back     alignment and structure
>1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>4b4t_H 26S protease regulatory subunit 7 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 Back     alignment and structure
>1ukz_A Uridylate kinase; transferase; HET: ADP AMP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1uky_A* Back     alignment and structure
>1zd8_A GTP:AMP phosphotransferase mitochondrial; ATP:AMP phosphotransferase, myokinase, structural genomics, structural genomics consortium, SGC; 1.48A {Homo sapiens} PDB: 2ak3_A* Back     alignment and structure
>1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A* Back     alignment and structure
>3zvl_A Bifunctional polynucleotide phosphatase/kinase; hydrolase-transferase complex, base excision repair, BER, non-homologous END-joining, NHEJ; 1.65A {Mus musculus} PDB: 3zvm_A* 3zvn_A* 1yj5_A 3u7e_B* 3u7f_B* 3u7h_B* 3u7g_A* Back     alignment and structure
>3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* Back     alignment and structure
>2wjg_A FEOB, ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GDP; 2.20A {Methanocaldococcus jannaschii} Back     alignment and structure
>2iyv_A Shikimate kinase, SK; transferase, aromatic amino acid biosynthesis, P-loop kinase, metal- binding, shikimate pathway; HET: ADP; 1.35A {Mycobacterium tuberculosis} SCOP: c.37.1.2 PDB: 2iyr_A* 2iyq_A* 2iyt_A 2iyu_A* 2iys_A* 2iyw_A* 2iyx_A* 2iyy_A* 2iyz_A* 2g1k_A* 1l4y_A* 1u8a_A* 1we2_A* 1zyu_A* 2dfn_A* 2dft_A* 2g1j_A 1l4u_A* 3baf_A* Back     alignment and structure
>4b4t_I 26S protease regulatory subunit 4 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2pbr_A DTMP kinase, thymidylate kinase; transferase, nucleotide biosynthesis, TMP-binding, A binding, structural genomics, NPPSFA; 1.96A {Aquifex aeolicus} Back     alignment and structure
>3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} Back     alignment and structure
>3nbx_X ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structure, rossman fold, hydro; HET: ADP; 2.91A {Escherichia coli} Back     alignment and structure
>1zak_A Adenylate kinase; ATP:AMP-phosphotransferase, transferase; HET: AP5; 3.50A {Zea mays} SCOP: c.37.1.1 g.41.2.1 Back     alignment and structure
>1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1aky_A Adenylate kinase; ATP:AMP phosphotransferase, myokinase, transferase (phosphotransferase); HET: AP5; 1.63A {Saccharomyces cerevisiae} SCOP: c.37.1.1 g.41.2.1 PDB: 2aky_A* 3aky_A* 1dvr_A* Back     alignment and structure
>2cdn_A Adenylate kinase; phosphoryl transfer, associative mechanism, ATP-binding, nucleotide biosynthesis, nucleotide-binding, transferase; HET: ADP; 1.9A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1p4s_A Back     alignment and structure
>3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* Back     alignment and structure
>2xb4_A Adenylate kinase; ATP-binding, nucleotide-binding, transferase; HET: SRT; 1.80A {Desulfovibrio gigas} PDB: 3l0s_A* 3l0p_A* Back     alignment and structure
>3fb4_A Adenylate kinase; psychrophIle, phosphotransferase, ATP-binding, nucleotide-binding, transferase; HET: AP5; 2.00A {Marinibacillus marinus} Back     alignment and structure
>2pt5_A Shikimate kinase, SK; aromatic amino acid biosynthesis, P-loop kinase, SHI kinase, shikimate pathway; 2.10A {Aquifex aeolicus} Back     alignment and structure
>1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2c9o_A RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-binding, chromatin regulator, growth regulation, hydrolase, nuclear protein, DNA recombination; HET: ADP; 2.2A {Homo sapiens} PDB: 2xsz_A* Back     alignment and structure
>1xjc_A MOBB protein homolog; structural genomics, midwest center for structural GEN PSI, protein structure initiative, MCSG; 2.10A {Geobacillus stearothermophilus} SCOP: c.37.1.10 Back     alignment and structure
>1ltq_A Polynucleotide kinase; phosphatase, alpha/beta, P-loop, transferase; HET: ADP; 2.33A {Enterobacteria phage T4} SCOP: c.108.1.9 c.37.1.1 PDB: 1rc8_A* 1rpz_A* 1rrc_A* 2ia5_A Back     alignment and structure
>3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B* Back     alignment and structure
>1um8_A ATP-dependent CLP protease ATP-binding subunit CL; CLPP binding loop, chaperone; HET: ADP; 2.60A {Helicobacter pylori} SCOP: c.37.1.20 Back     alignment and structure
>2gj8_A MNME, tRNA modification GTPase TRME; G-domain dimer, alpha-beta-sandwich, hydrolase; HET: GDP; 1.70A {Escherichia coli BL21} SCOP: c.37.1.8 PDB: 2gj9_A* 2gja_A* 1rfl_A Back     alignment and structure
>2qen_A Walker-type ATPase; unknown function; HET: ADP; 2.25A {Pyrococcus abyssi} Back     alignment and structure
>3ld9_A DTMP kinase, thymidylate kinase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ehrlich chaffeensis; 2.15A {Ehrlichia chaffeensis} Back     alignment and structure
>3bgw_A DNAB-like replicative helicase; ATPase, replication; 3.91A {Bacillus phage SPP1} Back     alignment and structure
>2zej_A Dardarin, leucine-rich repeat kinase 2; parkinson'S disease, LRRK2, ROC, GTPase, ROCO, ATP-B disease mutation, GTP-binding, GTPase activation; HET: GDP; 2.00A {Homo sapiens} PDB: 3d6t_B* Back     alignment and structure
>3dl0_A Adenylate kinase; phosphotransferase, zinc coordination, ATP-binding, binding, nucleotide biosynthesis, nucleotide-binding, trans; HET: AP5; 1.58A {Bacillus subtilis} PDB: 1p3j_A* 2ori_A* 2eu8_A* 2oo7_A* 2p3s_A* 2qaj_A* 2osb_A* 3dkv_A* 1zin_A* 1zio_A* 1zip_A* 1s3g_A* Back     alignment and structure
>3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} Back     alignment and structure
>1w4r_A Thymidine kinase; type II, human, cytosolic, phosphorylation, transferase; HET: TTP; 1.83A {Homo sapiens} PDB: 1xbt_A* 2wvj_A* 2j87_A* Back     alignment and structure
>1uj2_A Uridine-cytidine kinase 2; alpha/beta mononucleotide-binding HOLD, transferase; HET: C5P ADP; 1.80A {Homo sapiens} SCOP: c.37.1.6 PDB: 1uei_A* 1uej_A* 1udw_A 1ufq_A* 1xrj_A* Back     alignment and structure
>2iut_A DNA translocase FTSK; nucleotide-binding, chromosome partition, ATP-binding, DNA- cell division, DNA translocation, KOPS, membrane; HET: DNA SAP; 2.25A {Pseudomonas aeruginosa} PDB: 2iuu_A* Back     alignment and structure
>4ag6_A VIRB4 ATPase, type IV secretory pathway VIRB4 components-like P; hydrolase, type IV secretion, conjugation; 2.35A {Thermoanaerobacter pseudethanolicus} PDB: 4ag5_A Back     alignment and structure
>2ffh_A Protein (FFH); SRP54, signal recognition particle, GTPase, M domain, RNA-binding, signal sequence-binding, helix-turn-helix, protein targeting; 3.20A {Thermus aquaticus} SCOP: a.24.13.1 a.36.1.1 c.37.1.10 PDB: 2iy3_A Back     alignment and structure
>3hws_A ATP-dependent CLP protease ATP-binding subunit CL; CLPXP, AAA+ molecular machine, hexamer, asymmetric,, ATP-BIN chaperone, metal-binding; HET: ADP; 3.25A {Escherichia coli} PDB: 3hte_A Back     alignment and structure
>2chq_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATP ATP-binding, nucleotide-binding; HET: ANP; 3.5A {Archaeoglobus fulgidus} PDB: 2chv_A Back     alignment and structure
>1sky_E F1-ATPase, F1-ATP synthase; F1FO ATP synthase, alpha3BETA3 SUBC F1-ATPase, hydrolase; 3.20A {Bacillus SP} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 Back     alignment and structure
>2wac_A CG7008-PA; unknown function, tudor, beta-barrel, nuclease domain, tudor P100, SND1, methylated arginine, SDMA, splicing; 2.10A {Drosophila melanogaster} Back     alignment and structure
>1a7j_A Phosphoribulokinase; transferase, calvin cycle; 2.50A {Rhodobacter sphaeroides} SCOP: c.37.1.6 Back     alignment and structure
>2f6r_A COA synthase, bifunctional coenzyme A synthase; 18044849, bifunctional coenzyme A synthase (COA synthase), S genomics; HET: ACO UNL; 1.70A {Mus musculus} Back     alignment and structure
>3tlx_A Adenylate kinase 2; structural genomics, structural genomics consortium, SGC, RO fold, transferase, ATP binding, phosphorylation; HET: ADP ATP AMP; 2.75A {Plasmodium falciparum} Back     alignment and structure
>4edh_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology; HET: TMP ADP; 1.32A {Pseudomonas aeruginosa PAO1} PDB: 4e5u_A* 4esh_A* 4gmd_A* 3uwk_A* 3uwo_A* 3uxm_A* Back     alignment and structure
>2dhr_A FTSH; AAA+ protein, hexameric Zn metalloprotease, hydrolase; HET: ADP; 3.90A {Thermus thermophilus} Back     alignment and structure
>1zuh_A Shikimate kinase; alpha-beta protein, transferase; 1.80A {Helicobacter pylori} PDB: 1zui_A* 3hr7_A 3muf_A* 3mrs_A 3n2e_A* Back     alignment and structure
>3be4_A Adenylate kinase; malaria, cryptosporidium parvum nonprotein inhibitors, nucleotide-binding, transferase; HET: AP5; 1.60A {Cryptosporidium parvum iowa II} Back     alignment and structure
>1e4v_A Adenylate kinase; transferase(phosphotransferase); HET: AP5; 1.85A {Escherichia coli} SCOP: c.37.1.1 g.41.2.1 PDB: 1e4y_A* 1ake_A* 1ank_A* 2eck_A* 3hpq_A* 4ake_A 3hpr_A* Back     alignment and structure
>2zts_A Putative uncharacterized protein PH0186; KAIC like protein, ATP-binding, nucleotide-binding, ATP- binding protein; HET: ADP; 2.07A {Pyrococcus horikoshii} Back     alignment and structure
>1ega_A Protein (GTP-binding protein ERA); GTPase, RNA-binding, RAS-like, hydrolase; 2.40A {Escherichia coli} SCOP: c.37.1.8 d.52.3.1 PDB: 1x1l_X 3ieu_A* 1x18_X Back     alignment and structure
>2grj_A Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosphocoenzyme kinase, structural genomics, joint center for structural GE JCSG; HET: ADP COD; 2.60A {Thermotoga maritima} Back     alignment and structure
>3ntk_A Maternal protein tudor; tudor domain, OB-fold, GERM cell formation, transcription; 1.80A {Drosophila melanogaster} PDB: 3nth_A* 3nti_A* Back     alignment and structure
>3lv8_A DTMP kinase, thymidylate kinase; structural genomics, in diseases, center for structural genomics of infectious DISE ATP-binding; HET: ADP TMP TYD; 1.80A {Vibrio cholerae o1 biovar eltor} PDB: 3n2i_A* Back     alignment and structure
>2eko_A Histone acetyltransferase htatip; chromo domain, histone tail, chromatin organization modifier, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3v9p_A DTMP kinase, thymidylate kinase; ssgcid, STRU genomics, seattle structural genomics center for infectious transferase; 1.90A {Burkholderia thailandensis} Back     alignment and structure
>3dlm_A Histone-lysine N-methyltransferase setdb1; setdb1_human, structural genomics, structural genomics consortium, SGC, alternative splicing; 1.77A {Homo sapiens} Back     alignment and structure
>4tmk_A Protein (thymidylate kinase); ATP:DTMP phosphotransferase, transferase; HET: T5A; 1.98A {Escherichia coli} SCOP: c.37.1.1 PDB: 5tmp_A* Back     alignment and structure
>1wgs_A MYST histone acetyltransferase 1; tudor domain, MYST family, struct genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: b.34.13.3 Back     alignment and structure
>3umf_A Adenylate kinase; rossmann fold, transferase; 2.05A {Schistosoma mansoni} Back     alignment and structure
>3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A* Back     alignment and structure
>2ocp_A DGK, deoxyguanosine kinase; protein-nucleotide complex, transferase; HET: DTP; 2.80A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>2ga8_A Hypothetical 39.9 kDa protein; YFR007W, YFH7, unknown function; HET: CME; 1.77A {Saccharomyces cerevisiae} PDB: 2gaa_A* Back     alignment and structure
>3exa_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.30A {Bacillus halodurans} PDB: 2qgn_A Back     alignment and structure
>3foz_A TRNA delta(2)-isopentenylpyrophosphate transferas; nucleoside modification, isopentenyl-tRNA transferase, transferase-RNA complex; 2.50A {Escherichia coli k-12} PDB: 2zxu_A* 2zm5_A Back     alignment and structure
>3crm_A TRNA delta(2)-isopentenylpyrophosphate transferase; ATP-binding, nucleotide-binding, nucleotidyltransferase, tRNA processing; 1.90A {Pseudomonas aeruginosa} PDB: 3crq_A 3crr_A Back     alignment and structure
>3d3q_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2; 2.70A {Staphylococcus epidermidis atcc 12228} Back     alignment and structure
>2ro0_A Histone acetyltransferase ESA1; HAT, chromodomain, tudor domain, RNA binding, activator, chromatin regulator, transcription; NMR {Saccharomyces cerevisiae} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 1129
d1wb9a1297 a.113.1.1 (A:270-566) DNA repair protein MutS, dom 6e-42
d1ewqa1275 a.113.1.1 (A:267-541) DNA repair protein MutS, dom 1e-36
d1wb9a2234 c.37.1.12 (A:567-800) DNA repair protein MutS, the 2e-31
d1wb9a4115 d.75.2.1 (A:2-116) DNA repair protein MutS, domain 4e-28
d1ewqa4120 d.75.2.1 (A:1-120) DNA repair protein MutS, domain 6e-27
d1ewqa2224 c.37.1.12 (A:542-765) DNA repair protein MutS, the 2e-26
d1wb9a3153 c.55.6.1 (A:117-269) DNA repair protein MutS, doma 1e-04
>d1wb9a1 a.113.1.1 (A:270-566) DNA repair protein MutS, domain III {Escherichia coli [TaxId: 562]} Length = 297 Back     information, alignment and structure

class: All alpha proteins
fold: DNA repair protein MutS, domain III
superfamily: DNA repair protein MutS, domain III
family: DNA repair protein MutS, domain III
domain: DNA repair protein MutS, domain III
species: Escherichia coli [TaxId: 562]
 Score =  153 bits (388), Expect = 6e-42
 Identities = 72/322 (22%), Positives = 125/322 (38%), Gaps = 29/322 (9%)

Query: 650 DAPALENLEVFENSRSGDSSGTLYAQLNHCVTAFGKRLLRTWLARPLYNSGLIRERQDAV 709
           DA    NLE+ +N   G +  TL + L+  VT  G R+L+ WL  P+ ++ ++ ERQ  +
Sbjct: 1   DAATRRNLEITQNLA-GGAENTLASVLDCTVTPMGSRMLKRWLHMPVRDTRVLLERQQTI 59

Query: 710 AGLRGVNQPFALEFRKALSRLPDMERLLARLFASSEANGRNSNKVVLYEDAAKKQLQEFI 769
             L    Q F    +  L ++ D+ER+LARL A   A  R+                   
Sbjct: 60  GAL----QDFTAGLQPVLRQVGDLERILARL-ALRTARPRD------------------- 95

Query: 770 SALHGCELMDQACSSLGAILENTESRQLHHILTPGKGLPAIVSILKHFKDAFDWVEANNS 829
             L       Q    L A LE  +S  +  +         +  +L+        V   + 
Sbjct: 96  --LARMRHAFQQLPELRAQLETVDSAPVQALREKMGEFAELRDLLERAIIDTPPVLVRDG 153

Query: 830 GRIIPHGGVDMDYDSACKKVKEIEASLTKHLKEQRKLLGDTSITYVTIGKDLYLLEVPES 889
           G I    G + + D            L +    +R+  G  ++         Y +++   
Sbjct: 154 GVIAS--GYNEELDEWRALADGATDYLERLEVRERERTGLDTLKVGFNAVHGYYIQISRG 211

Query: 890 LRGSVPRDYELRSSKKGFFRYWTPNIKKLLGELSQAESEKESALKSILQRLIGQFCEHHN 949
                P +Y  R + K   RY  P +K+   ++  ++ +  +  K + + L      H  
Sbjct: 212 QSHLAPINYMRRQTLKNAERYIIPELKEYEDKVLTSKGKALALEKQLYEELFDLLLPHLE 271

Query: 950 KWRQMVAATAELDALISLAIAS 971
             +Q  +A AELD L++LA  +
Sbjct: 272 ALQQSASALAELDVLVNLAERA 293


>d1ewqa1 a.113.1.1 (A:267-541) DNA repair protein MutS, domain III {Thermus aquaticus [TaxId: 271]} Length = 275 Back     information, alignment and structure
>d1wb9a2 c.37.1.12 (A:567-800) DNA repair protein MutS, the C-terminal domain {Escherichia coli [TaxId: 562]} Length = 234 Back     information, alignment and structure
>d1wb9a4 d.75.2.1 (A:2-116) DNA repair protein MutS, domain I {Escherichia coli [TaxId: 562]} Length = 115 Back     information, alignment and structure
>d1ewqa4 d.75.2.1 (A:1-120) DNA repair protein MutS, domain I {Thermus aquaticus [TaxId: 271]} Length = 120 Back     information, alignment and structure
>d1ewqa2 c.37.1.12 (A:542-765) DNA repair protein MutS, the C-terminal domain {Thermus aquaticus [TaxId: 271]} Length = 224 Back     information, alignment and structure
>d1wb9a3 c.55.6.1 (A:117-269) DNA repair protein MutS, domain II {Escherichia coli [TaxId: 562]} Length = 153 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query1129
d1wb9a2234 DNA repair protein MutS, the C-terminal domain {Es 100.0
d1ewqa2224 DNA repair protein MutS, the C-terminal domain {Th 100.0
d1wb9a1297 DNA repair protein MutS, domain III {Escherichia c 100.0
d1ewqa1275 DNA repair protein MutS, domain III {Thermus aquat 100.0
d1wb9a4115 DNA repair protein MutS, domain I {Escherichia col 100.0
d1ewqa4120 DNA repair protein MutS, domain I {Thermus aquatic 100.0
d1ewqa3146 DNA repair protein MutS, domain II {Thermus aquati 99.51
d1wb9a3153 DNA repair protein MutS, domain II {Escherichia co 99.47
d1ji0a_240 Branched chain aminoacid ABC transporter {Thermoto 98.57
d1g6ha_254 MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 98.46
d3d31a2229 Sulfate/molybdate ABC transporter, ATP-binding pro 98.44
d3dhwc1240 Methionine import ATP-binding protein MetN {Escher 98.42
d1vpla_238 Putative ABC transporter TM0544 {Thermotoga mariti 98.41
d2awna2232 Maltose transport protein MalK, N-terminal domain 98.39
d1oxxk2242 Glucose transport protein GlcV, N-terminal domain 98.32
d1l2ta_230 MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 98.31
d1v43a3 239 Hypothetical protein PH0022, N-terminal domain {Py 98.28
d1sgwa_200 Putative ABC transporter PF0895 {Pyrococcus furios 98.24
d1g2912240 Maltose transport protein MalK, N-terminal domain 98.23
d1l7vc_231 ABC transporter involved in vitamin B12 uptake, Bt 98.19
d1b0ua_258 ATP-binding subunit of the histidine permease {Sal 98.18
d2onka1240 Molybdate/tungstate import ATP-binding protein Wtp 98.18
d2pmka1241 Haemolysin B ATP-binding protein {Escherichia coli 98.05
d1jj7a_ 251 Peptide transporter Tap1, C-terminal ABC domain {H 98.01
d1mv5a_ 242 Multidrug resistance ABC transporter LmrA, C-termi 97.91
d1r0wa_281 Cystic fibrosis transmembrane conductance regulato 97.91
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 97.89
d3b60a1 253 Multidrug resistance ABC transporter MsbA, C-termi 97.85
d2hyda1255 Putative multidrug export ATP-binding/permease pro 97.75
d2diga155 Lamin-b receptor {Human (Homo sapiens) [TaxId: 960 97.15
d2d9ta160 Tudor domain-containing protein 3, TDRD3 {Mouse (M 96.66
d1mhna_59 Survival motor neuron protein 1, smn {Human (Homo 96.27
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 95.98
d2i3ba1189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 95.78
d1ls1a2207 GTPase domain of the signal sequence recognition p 95.35
g1f2t.1 292 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 95.15
d1np6a_170 Molybdopterin-guanine dinucleotide biosynthesis pr 95.15
d2g3ra153 p53-binding protein 1, 53BP1 {Human (Homo sapiens) 95.03
d1okkd2207 GTPase domain of the signal recognition particle r 94.98
g1xew.1 329 Smc head domain {Pyrococcus furiosus [TaxId: 2261] 94.86
g1ii8.1 369 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 94.82
d1xp8a1 268 RecA protein, ATPase-domain {Deinococcus radiodura 94.82
d1qhla_222 Cell division protein MukB {Escherichia coli [TaxI 94.67
d1vmaa2213 GTPase domain of the signal recognition particle r 94.48
d1u94a1 263 RecA protein, ATPase-domain {Escherichia coli [Tax 94.43
d2qy9a2211 GTPase domain of the signal recognition particle r 94.32
d1e69a_ 308 Smc head domain {Thermotoga maritima [TaxId: 2336] 94.3
d2bdta1176 Hypothetical protein BH3686 {Bacillus halodurans [ 94.17
d1j8yf2211 GTPase domain of the signal sequence recognition p 94.08
d1znwa1182 Guanylate kinase {Mycobacterium tuberculosis [TaxI 94.08
d1knqa_171 Gluconate kinase {Escherichia coli [TaxId: 562]} 94.03
d1qhxa_178 Chloramphenicol phosphotransferase {Streptomyces v 94.02
d1d2na_ 246 Hexamerization domain of N-ethylmalemide-sensitive 93.95
d1zp6a1176 Hypothetical protein Atu3015 {Agrobacterium tumefa 93.85
d1khta_190 Adenylate kinase {Archaeon Methanococcus voltae [T 93.76
d1w1wa_ 427 Smc head domain {Baker's yeast (Saccharomyces cere 93.49
d1kaga_169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 93.32
d1yj5a2172 5' polynucleotide kinase-3' phosphatase, C-termina 93.32
d1lw7a2192 Transcriptional regulator NadR, ribosylnicotinamid 93.27
d1xjca_165 Molybdopterin-guanine dinucleotide biosynthesis pr 93.26
d1mo6a1 269 RecA protein, ATPase-domain {Mycobacterium tubercu 93.22
d1g6oa_323 Hexameric traffic ATPase, HP0525 {Helicobacter pyl 93.21
d1nksa_194 Adenylate kinase {Archaeon Sulfolobus acidocaldari 92.84
d1y63a_174 Probable kinase LmjF30.1890 {Leishmania major [Tax 92.52
d1r7ra3 265 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 92.42
d1in4a2 238 Holliday junction helicase RuvB {Thermotoga mariti 92.3
d2diqa197 Tudor and KH domain-containing protein TDRKH {Huma 92.25
d1m8pa3183 ATP sulfurylase C-terminal domain {Fungus (Penicil 92.12
d2p67a1 327 LAO/AO transport system kinase ArgK {Escherichia c 92.07
d1lv7a_ 256 AAA domain of cell division protein FtsH {Escheric 91.91
d1ixza_ 247 AAA domain of cell division protein FtsH {Thermus 91.87
d1rkba_173 Adenylate kinase {Human (Homo sapiens), isoenzyme 91.63
d1e32a2 258 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 91.45
d1cr2a_ 277 Gene 4 protein (g4p, DNA primase), helicase domain 91.4
d1yrba1 244 ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss 91.3
d1gkya_186 Guanylate kinase {Baker's yeast (Saccharomyces cer 91.15
d1rz3a_198 Hypothetical protein rbstp0775 {Bacillus stearothe 90.91
d1s96a_ 205 Guanylate kinase {Escherichia coli [TaxId: 562]} 90.82
d1jjva_ 205 Dephospho-CoA kinase {Haemophilus influenzae [TaxI 90.8
d1lvga_190 Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 90.8
d1nn5a_ 209 Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 90.59
d1uf9a_191 Dephospho-CoA kinase {Thermus thermophilus [TaxId: 90.33
d1vhta_ 208 Dephospho-CoA kinase {Escherichia coli [TaxId: 562 90.28
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 90.11
d1kgda_178 Guanylate kinase-like domain of Cask {Human (Homo 90.02
d1bifa1 213 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata 89.44
d2hqxa190 P100 co-activator, SND1 {Human (Homo sapiens) [Tax 89.39
d1tf7a2 242 Circadian clock protein KaiC {Synechococcus sp. st 89.35
d1sxja2 253 Replication factor C1 {Baker's yeast (Saccharomyce 89.26
d1e6ca_170 Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax 89.06
d1x6va3195 Adenosine-5'phosphosulfate kinase (APS kinase) {Hu 89.06
d1ofha_ 309 HslU {Haemophilus influenzae [TaxId: 727]} 88.93
d1uj2a_ 213 Uridine-cytidine kinase 2 {Human (Homo sapiens) [T 88.57
d1fnna2 276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 88.51
d1sxjd2 237 Replication factor C2 {Baker's yeast (Saccharomyce 88.35
d1gvnb_ 273 Plasmid maintenance system epsilon/zeta, toxin zet 88.31
d1w44a_321 NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} 88.23
d3adka_194 Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} 87.87
d2qm8a1 323 Metallochaperone MeaB {Methylobacterium extorquens 87.78
d1qf9a_194 UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 87.64
d1a1va1136 HCV helicase domain {Human hepatitis C virus (HCV) 87.59
d1viaa_161 Shikimate kinase (AroK) {Campylobacter jejuni [Tax 87.51
d1ukza_196 Uridylate kinase {Baker's yeast (Saccharomyces cer 87.16
d4tmka_ 210 Thymidylate kinase {Escherichia coli [TaxId: 562]} 86.61
d1sxje2 252 Replication factor C5 {Baker's yeast (Saccharomyce 86.34
d2iyva1165 Shikimate kinase (AroK) {Mycobacterium tuberculosi 86.25
d1teva_194 UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] 86.08
d1n0wa_ 242 DNA repair protein Rad51, catalytic domain {Human 85.74
d1tmka_ 214 Thymidylate kinase {Baker's yeast (Saccharomyces c 84.96
d1zina1182 Adenylate kinase {Bacillus stearothermophilus [Tax 84.8
d1tf7a1 242 Circadian clock protein KaiC {Synechococcus sp. st 84.73
d1sxjc2227 Replication factor C3 {Baker's yeast (Saccharomyce 84.03
d1sxjb2224 Replication factor C4 {Baker's yeast (Saccharomyce 83.93
d2vp4a1197 Deoxyribonucleoside kinase {Fruit fly (Drosophila 83.88
d1a5ta2207 delta prime subunit of DNA polymerase III, N-domai 83.87
d1m7ga_208 Adenosine-5'phosphosulfate kinase (APS kinase) {Fu 83.7
d1wgsa_133 Probable histone acetyltransferase MYST1 {Mouse (M 83.63
d2fnaa2 283 Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ 83.56
d1zaka1189 Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} 82.68
d1p9ra_ 401 Extracellular secretion NTPase EpsE {Vibrio choler 82.46
d1r6bx2 268 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 81.38
d1akya1180 Adenylate kinase {Baker's yeast (Saccharomyces cer 81.14
d1e4va1179 Adenylate kinase {Escherichia coli [TaxId: 562]} 80.95
d1ckea_ 225 CMP kinase {Escherichia coli [TaxId: 562]} 80.55
d1s3ga1182 Adenylate kinase {Bacillus globisporus [TaxId: 145 80.39
d1ixsb2 239 Holliday junction helicase RuvB {Thermus thermophi 80.07
>d1wb9a2 c.37.1.12 (A:567-800) DNA repair protein MutS, the C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: ABC transporter ATPase domain-like
domain: DNA repair protein MutS, the C-terminal domain
species: Escherichia coli [TaxId: 562]
Probab=100.00  E-value=1.9e-41  Score=365.46  Aligned_cols=142  Identities=44%  Similarity=0.740  Sum_probs=122.6

Q ss_pred             ccceeecCCCCCCCCcEEEeccCCCccccccCCCCcccccccccCCCCCCceEEEEecCCCchhHHHHHHHHHHHHhHcC
Q 001187          978 TCRPVILDSCSNEEPYISAKSLGHPVLRSDSLGKGEFVPNDITIGGHGNASFILLTGPNMGGKSTLLRQVCLAVILAQVG 1057 (1129)
Q Consensus       978 ~~rP~~~~~~~~~~~~l~i~~~RHP~le~~~~~~~~fvpNdi~l~~~~~~~~~iitGpN~~GKSt~lr~i~l~vilAQiG 1057 (1129)
                      ||||+|++     ++.|.|+++|||+++..  ....|||||+.++.  ..++++||||||||||||||+||++++|||+|
T Consensus         1 y~~P~~~~-----~~~l~i~~~rHPlle~~--~~~~~VpNdi~l~~--~~~~~iiTGpN~~GKSt~lk~i~l~~~laq~G   71 (234)
T d1wb9a2           1 YTCPTFID-----KPGIRITEGRHPVVEQV--LNEPFIANPLNLSP--QRRMLIITGPNMGGKSTYMRQTALIALMAYIG   71 (234)
T ss_dssp             CBCCEECS-----SSCEEEEEECCTTHHHH--CSSCCCCEEEEECS--SSCEEEEECCTTSSHHHHHHHHHHHHHHHTTT
T ss_pred             CCCCEEcC-----CCcEEEEEeECCEEEcc--cCCCccceeEEECC--CceEEEEeccCchhhHHHHHHHHHHHHHHHcC
Confidence            79999984     46799999999999752  34579999999985  35899999999999999999999999999999


Q ss_pred             CeecCCCcccchhhhhhhccCccchHhhcccchHHHHHHHHHHHHhCCCCcEEEEeCCCCCCChHHHHhhh
Q 001187         1058 ADVPAEIFEISPVDRIFVRMGAKDHIMAGQSTFLTELSETALMLSSATRNSLVVLDELGRGTSTSDGQAIA 1128 (1129)
Q Consensus      1058 ~~VPA~~a~l~~~d~i~trig~~d~i~~g~StF~~em~e~~~il~~at~~sLvllDElGRGTst~DG~AIA 1128 (1129)
                      |||||++|.++++|+||+|||..|++..|.|||+.||.+++.|+++++++|||||||+||||++.||.|||
T Consensus        72 ~~VpA~~a~~~~~d~I~~~~~~~d~~~~~~S~F~~E~~~~~~il~~~~~~sLvliDE~~~gT~~~eg~~l~  142 (234)
T d1wb9a2          72 SYVPAQKVEIGPIDRIFTRVGAADDLASGRSTFMVEMTETANILHNATEYSLVLMDEIGRGTSTYDGLSLA  142 (234)
T ss_dssp             CCBSSSEEEECCCCEEEEEEC-----------CHHHHHHHHHHHHHCCTTEEEEEESCCCCSSSSHHHHHH
T ss_pred             CeEecCceecccchhheeEEccCcccccchhHHHHHHHHHHHHHHhcccccEEeecccccCCChhhhhHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999997



>d1ewqa2 c.37.1.12 (A:542-765) DNA repair protein MutS, the C-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1wb9a1 a.113.1.1 (A:270-566) DNA repair protein MutS, domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ewqa1 a.113.1.1 (A:267-541) DNA repair protein MutS, domain III {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1wb9a4 d.75.2.1 (A:2-116) DNA repair protein MutS, domain I {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ewqa4 d.75.2.1 (A:1-120) DNA repair protein MutS, domain I {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1ewqa3 c.55.6.1 (A:121-266) DNA repair protein MutS, domain II {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1wb9a3 c.55.6.1 (A:117-269) DNA repair protein MutS, domain II {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Back     information, alignment and structure
>d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Back     information, alignment and structure
>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2diga1 b.34.9.1 (A:8-62) Lamin-b receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2d9ta1 b.34.9.1 (A:8-67) Tudor domain-containing protein 3, TDRD3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1mhna_ b.34.9.1 (A:) Survival motor neuron protein 1, smn {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2g3ra1 b.34.9.1 (A:1485-1537) p53-binding protein 1, 53BP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1qhla_ c.37.1.12 (A:) Cell division protein MukB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e69a_ c.37.1.12 (A:) Smc head domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1w1wa_ c.37.1.12 (A:) Smc head domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2diqa1 b.34.9.1 (A:8-104) Tudor and KH domain-containing protein TDRKH {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} Back     information, alignment and structure
>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jjva_ c.37.1.1 (A:) Dephospho-CoA kinase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1vhta_ c.37.1.1 (A:) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2hqxa1 b.34.9.1 (A:8-97) P100 co-activator, SND1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Back     information, alignment and structure
>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tmka_ c.37.1.1 (A:) Thymidylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1wgsa_ b.34.13.3 (A:) Probable histone acetyltransferase MYST1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure