Citrus Sinensis ID: 001201

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------1000------1010------1020------1030------1040------1050------1060------1070------1080------1090------1100------1110------1120----
MDLLKYGTGLHIFKGTYTMQETRDRLYALVHKLKDYCLLLDGPTEDWIRMHDLVREVAISIASRDRHVFMLRNDIQIEWPVADMLKNCPTIFLHDCKHWEVPEGLEYPQLEFFCMSPRDHSIKIPNHVFAGMSNLRGLALSNMQFLSLPSLFHLPLNLQTLCLDRCALGDIAIIGNLKKLEILSLVDSNIEQLPEEMAQLTQLRLFDLSGCSKLKVIPPNLLSGLSRLEDLYMGNTSVKWEFEGLNVGRSNASLQELKLLSHLTTLEIQICDAMILPKGLFSKKLERYKIFIGDEWDWSGNYKNKRVLKLKLYTSNVDEVIMQLKGIEELYLDEVPGIKNVLYDLDIEGFLQLKHLHVQNNPFILFIVDSMAWVRYNAFLLLESLVLHNLIHLEKICLGQLRAESFYKLKIIKVRNCDKLKNIFSFSFVRGLPQLQTLNVINCKNMKEIFTVGRENDVDCHEVDKIEFSQLHSLTLKFLPQLTSFYSQVKTSAASQTRLKELSTHTLPREVILEDECDTLMPFFNEKVVFPNLETLELCAISTEKIWCNQLAAVYSQNLTRLIVHGCEKLKYLFPSSMIRNFVQLEHLEICYCSSLESIVGKESGEEATTTFVFPKVTFLKLWNLSELKTFYPGTHTSKWPMLKKLEVYGCDKVKIFTSRFLRFQEINEGQFDIPTQQALFLVEKVTSKLEELKLSGKDIAMICQSQFPKHIFRNLKNLEVVNDESENFRIGFLERFHNLEKLELRWSSYKEIFSNEEIVEHAEMLTQVKSLKLWELSDLMYIWKQDSKLDSITENLESLEVWWCENLINLVPSSASFKNLTTLELWYCQRLMNLVTSSTAKSLVCLTKLRIDGCRMLTEIISKEEDVAEDEIVFSKLKWVSLERLENLTSFCSGNYTLKFPSLEDLFVIECPKMKIFSHRVLSTPRLREVRQNWGLYKGCWEGDLNTTIQQLQKNELPLLLPIASSSSSLAAPTTGNQVPLNLSGNRKTQSFSLQPPLRTTSPTFSSGKPAADNNPSLSLSSCSTRTKKAVLKLEIHGEKARQKAFSIVSKFTGVLSILFDPKDKKMIVIGDIDAVPVVRKLRKQLCATELVSIGPANEHDNEEGERNIEESKNNADETQKQV
ccHHHHHHHcccccccccHHHHHHHHHHHHHHHHHcccccccccccEEEEcHHHHHHHHHHHcccccEEEEEcccccccccccccccccEEEccccccccccccccccccEEEEccccccccccccHHHccccccEEEEEcccccccccccccccccccEEEcccccccccccccccccccEEEccccccccccHHHcccccccEEEEcccccccccccccccccccccEEEcccccccccccccccccccccHHHHcccccccEEEEEEccccccccccccccccccEEEEcccccccccccccccEEEEcccccccHHHHccccccEEEcccccccccccccccccccccccEEEEEcccccEEEEcccccccccccccccEEEEEccccccccccccccccccccccEEEEEcccccccccccccccccccccEEEcccccccccccccccccccccccccccccccccEEEcccccccccccccccccccccccccccccccccccEEEcccccccccccccccccccccccEEccccccccccccccccccccccEEEEEcccccccccccccccccccccEEEEEccccccEEcccccccccccccccccccEEEEEcccccccccccccccccccccEEEEEcccccEEcccccccccccccccccccccccccccccccccccEEEEccccccccccccccccccccccEEEEEccccccccHHHHcccccccEEEEEccccccccccHHHHHHccccccccEEEEcccccccEEcccccccccccccccEEEEEcccccccccccccccccccEEEEEcccccccccccccccccccccEEEEEccccccEEEcccccccccccccccccEEEEccccccccccccccccccccccEEEEEccccccccccccccccccEEEEEEcccccccccccccHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHccccHHHHHHcccHHccccEEEEEEEccccccEEEEcccccHHHHHHHHHHHHcccEEEcccccccccHHHcccHHHHcccHHHHHHcc
cHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHccccccccccEEEEHHHHHHHHHHHHcccccEEEEEcccccccccHcHHccEEEEEEccccHHcccccccccccEEEEEccccccccccHHHHHcccccEEEEccccccccccccHHHHHHccEEEcccccccccccHHHccccEEEEcccccHHHccHHHHHHHccEEEEcccccccccccccHHHHHHcccEEEEcccccEEcccccccccccccHHHHHHcccccEEEEEcccccccHHHccHHHHHHcEEEccccHcccccccHHHHHHHcccccccccHHHHcccccEEEEEccccccccccccccccccccEEEEEEccccEEEcccccccccccHcccccEEEEcccHcHHHHccccccccccccccEEEEcccHHHHHccccHHHcccccccEEEEcccHcHHHHHccccccccccccccccccccccEEEEccccccccccccccccccccccHHHccccccccHHHccccccccccccccccccccccEEEEEccccccccccccccccccccEEEEEcccccccccccHHHHHHHHcccEEEEcccHHHHHHcccccccccccccccccccEEEHcccccccHcccccccccccccEEEEEEcccccEEcccccccccHcccEEEEccccccHHccHHccccHHHHHHHcHHHHHHHcccccHHHHcccccccEEEEccccccHHHHHHcccccEEEEEccccEEEcccccccccccccccHcEEEEcccHcHHHccccccccccccccccEEEEEccccccccccccccccccEEEEEcccHHHHHcccHHHHHcHHHccEEEEcccHHHHHHHcccccccccccccccccEEEEccccccHHccccccccccccccEEEEEccccccEcccccccccccEEEEEEcccccccccccHHHHHHHHHHccccEEccccccccccccccccccccccEcccHHHHHHccccccccccccccccccHHHcccccccccccHHHHHHHHHHHHccccccEEEEEEEEcccccHEEcccccccHEEEEHccccccHHHHHHHHHHHHHEEEcccccccccccccccccEccccccHHHccc
mdllkygtglhifkgtytMQETRDRLYALVHKLKDYcllldgptedwIRMHDLVREVAISIASRDRHVFMLRNDIQIEwpvadmlkncptiflhdckhwevpegleypqleffcmsprdhsikipnhvFAGMSNLRGLALSnmqflslpslfhlplnlqtlcldrcalgdiaiignLKKLEILSLVDSNIEQLPEEMAQLTQLRLfdlsgcsklkvippnllsglsrledlymgnTSVKWEFeglnvgrsnaSLQELKLLSHLTTLEIQICDamilpkglfskKLERYKIFigdewdwsgnyknkrVLKLKLYTSNVDEVIMQLKGIEElyldevpgiknVLYDLDIEGFLQLKHLHVQNNPFILFIVDSMAWVRYNAFLLLESLVLHNLIHLEKICLGQLRAESFYKLKIIKVRNCDKLKNIFSfsfvrglpqlqtlnvincknmkeiftvgrendvdchevdkiefsqlhsltlkflpqlTSFYSQVKTSAASQTRLKElsthtlpreviledecdtlmpffnekvvfpnletlELCAISTEKIWCNQLAAVYSQNLTRLIVHGCeklkylfpssmirnfvqLEHLEICYcsslesivgkesgeeatttfvfpKVTFLKLwnlselktfypgthtskwpmlkklevygcdkvkiFTSRFLRFQeinegqfdiptqQALFLVEKVTSKLEELKLSGKDIAMICQsqfpkhifrnlknlevvndesenfRIGFLERFHNLEKLELRWSSYKEIFSNEEIVEHAEMLTQVKSLKLWELSDLMYIWKQDSKLDSITENLESLEVWWCENLinlvpssasfknltTLELWYCQRLMNLVTSSTAKSLVCLTKLRIDGCRMLTEIISkeedvaedEIVFSKLKWVSLERLEnltsfcsgnytlkfpsledlfviecpkmkifshrvlstprlrevrqnwglykgcwegdLNTTIQQLQKnelplllpiassssslaapttgnqvplnlsgnrktqsfslqpplrttsptfssgkpaadnnpslslsscstrtKKAVLKLEIHGEKARQKAFSIVSKFTGVlsilfdpkdkkmivigdidaVPVVRKLRKQLCATELvsigpanehdneegernieesknnadetqkqv
mdllkygtglhifkgtytmqeTRDRLYALVHKLKDYCLLLDGPTEDWIRMHDLVREVAISiasrdrhvFMLRNDIQIEWPVADMLKNCPTIFLHDCKHWEVPEGLEYPQLEFFCMSPRDHSIKIPNHVFAGMSNLRGLALSNMQFLSLPSLFHLPLNLQTLCLDRCALGDIAIIGNLKKLEILSLVDSNIEQLPEEMAQLTQLRLFDLSGCSKLKVIPPNLLSGLSRLEDLYMGNTSVKWEFEGLNVGRSNASLQELKLLSHLTTLEIQICDAMILPKGLFSKKLERYKIFigdewdwsgnykNKRVLKLKLYTSNVDEVIMQLKGIEELYLDEVPGIKNVLYDLDIEGFLQLKHLHVQNNPFILFIVDSMAWVRYNAFLLLESLVLHNLIHLEKICLGQLRAESFYKLKIIKVRNCDKLKNIFSfsfvrglpqlqTLNVINCKNMKEIFTVGRENDVDCHEVDKIEFSQLHSLTLKFLPQLTSFYSQVKTSAasqtrlkelsthtlprevILEDECDTLMPFFNEKVVFPNLETLELCAISTEKIWCNQLAAVYSQNLTRLIVHGCEKLKYLFPSSMIRNFVQLEHLEICYCSSLESIVGKESGEEATTTFVFPKVTFLKLWNLSELKTfypgthtskwpmlKKLEVYGCDKVKIFTSRFLRFQEINEGQFDIPTQQALFLVEKVTSKLEELKLSGKDIAMICQSQFPKHIFRNLKNLEVVNDESENFRIGFLERFHNLEKLELRWSSYKEIFSNEEIVEHAEMLTQVKSLKLWELSDLMYIWKQDSKLDSITENLESLEVWWCENLINLVPSSASFKNLTTLELWYCQRLMNLvtsstakslVCLTKLRIDGCRMLTEIiskeedvaedeIVFSKLKWVSLERLENLTSFCSGNYTLKFPSLEDLFVIECPKMKifshrvlstprlREVRQNWGLYKGCWEGDLNTTIQQLQKNELPLLLPIASSSSSLAAPTTGNQVPLNLSGNRKTQSFSLQPPLRTTSPtfssgkpaadnnpslslsscstRTKKAVLKLEIHGEKARQKAFSIVSKFTGVLSIlfdpkdkkmiviGDIDAVPVVRKLRKQLCATElvsigpanehdneegernieesknnadetqkqv
MDLLKYGTGLHIFKGTYTMQETRDRLYALVHKLKDYCLLLDGPTEDWIRMHDLVREVAISIASRDRHVFMLRNDIQIEWPVADMLKNCPTIFLHDCKHWEVPEGLEYPQLEFFCMSPRDHSIKIPNHVFAGMSNLRGLALSNMQflslpslfhlplnlQTLCLDRCALGDIAIIGNLKKLEILSLVDSNIEQLPEEMAQLTQLRLFDLSGCSKLKVIPPNLLSGLSRLEDLYMGNTSVKWEFEGLNVGRSNASLQELKLLSHLTTLEIQICDAMILPKGLFSKKLERYKIFIGDEWDWSGNYKNKRVLKLKLYTSNVDEVIMQLKGIEELYLDEVPGIKNVLYDLDIEGFLQLKHLHVQNNPFILFIVDSMAWVRYNAFLLLESLVLHNLIHLEKICLGQLRAESFYKLKIIKVRNCDKLKNIFSFSFVRGLPQLQTLNVINCKNMKEIFTVGRENDVDCHEVDKIEFSQLHSLTLKFLPQLTSFYSQVKTSAASQTRLKELSTHTLPREVILEDECDTLMPFFNEKVVFPNLETLELCAISTEKIWCNQLAAVYSQNLTRLIVHGCEKLKYLFPSSMIRNFVQLEHLEICYCSSLESIVGKESGEEATTTFVFPKVTFLKLWNLSELKTFYPGTHTSKWPMLKKLEVYGCDKVKIFTSRFLRFQEINEGQFDIPTQQALFLVEKVTSKLEELKLSGKDIAMICQSQFPKHIFRNLKNLEVVNDESENFRIGFLERFHNLEKLELRWSSYKEIFSNEEIVEHAEMLTQVKSLKLWELSDLMYIWKQDSKLDSITENLESLEVWWCENLINLVPSSASFKNLTTLELWYCQRLMNLVTSSTAKSLVCLTKLRIDGCRMLTEIISKEEDVAEDEIVFSKLKWVSLERLENLTSFCSGNYTLKFPSLEDLFVIECPKMKIFSHRVLSTPRLREVRQNWGLYKGCWEGDLNTTIQQLQKNElplllpiassssslaapTTGNQVPLNLSGNRKTQSFSLQPPLRTTSPTFSSGKPAADNNPSLSLSSCSTRTKKAVLKLEIHGEKARQKAFSIVSKFTGVLSILFDPKDKKMIVIGDIDAVPVVRKLRKQLCATELVSIGPANEHDNEEGERNIEESKNNADETQKQV
***LKYGTGLHIFKGTYTMQETRDRLYALVHKLKDYCLLLDGPTEDWIRMHDLVREVAISIASRDRHVFMLRNDIQIEWPVADMLKNCPTIFLHDCKHWEVPEGLEYPQLEFFCMSPRDHSIKIPNHVFAGMSNLRGLALSNMQFLSLPSLFHLPLNLQTLCLDRCALGDIAIIGNLKKLEILSLVDSNIEQLPEEMAQLTQLRLFDLSGCSKLKVIPPNLLSGLSRLEDLYMGNTSVKWEFEGLNVGRSNASLQELKLLSHLTTLEIQICDAMILPKGLFSKKLERYKIFIGDEWDWSGNYKNKRVLKLKLYTSNVDEVIMQLKGIEELYLDEVPGIKNVLYDLDIEGFLQLKHLHVQNNPFILFIVDSMAWVRYNAFLLLESLVLHNLIHLEKICLGQLRAESFYKLKIIKVRNCDKLKNIFSFSFVRGLPQLQTLNVINCKNMKEIFTVGRENDVDCHEVDKIEFSQLHSLTLKFLPQLTSFYSQVKT*******LKELSTHTLPREVILEDECDTLMPFFNEKVVFPNLETLELCAISTEKIWCNQLAAVYSQNLTRLIVHGCEKLKYLFPSSMIRNFVQLEHLEICYCSSLESIVGKESGEEATTTFVFPKVTFLKLWNLSELKTFYPGTHTSKWPMLKKLEVYGCDKVKIFTSRFLRFQEINEGQFDIPTQQALFLVEKVTSKLEELKLSGKDIAMICQSQFPKHIFRNLKNLEVVNDESENFRIGFLERFHNLEKLELRWSSYKEIFSNEEIVEHAEMLTQVKSLKLWELSDLMYIWKQDSKLDSITENLESLEVWWCENLINLVPSSASFKNLTTLELWYCQRLMNLVTSSTAKSLVCLTKLRIDGCRMLTEIISKEEDVAEDEIVFSKLKWVSLERLENLTSFCSGNYTLKFPSLEDLFVIECPKMKIFSHRVLSTPRLREVRQNWGLYKGCWEGDLNTTIQQLQKNELPLLLP********************************************************************VLKLEIHGEKARQKAFSIVSKFTGVLSILFDPKDKKMIVIGDIDAVPVVRKLRKQLCATELVSI*****************************
MDLLKYGTGLHIFKGTYTMQETRDRLYALVHKLKDYCLLLDGPTEDWIRMHDLVREVAISIASRDRHVFMLRNDIQIEWPVADMLKNCPTIFLHDCKHWEVPEGLEYPQLEFFCMSPRDHSIKIPNHVFAGMSNLRGLALSNMQFLSLPSLFHLPLNLQTLCLDRCALGDIAIIGNLKKLEILSLVDSNIEQLPEEMAQLTQLRLFDLSGCSKLKVIPPNLLSGLSRLEDLYMGNTSVKWEFEGLNVGRSNASLQELKLLSHLTTLEIQICDAMILPKGLFSKKLERYKIFIGDEWDWSGNYKNKRVLKLKLYTSNVDEVIMQLKGIEELYLDEVPGIKNVLYDLDIEGFLQLKHLHVQNNPFILFIVDSMAWVRYNAFLLLESLVLHNLIHLEKICLGQLRAESFYKLKIIKVRNCDKLKNIFSFSFVRGLPQLQTLNVINCKNMKEIFTV**********VDKIEFSQLHSLTLKFLPQLTSFYSQVKTSAASQTRLKELSTHTLPREVILEDECDTLMPFFNEKVVFPNLETLELCAISTEKIWCNQLAAVYSQNLTRLIVHGCEKLKYLFPSSMIRNFVQLEHLEICYCSSLESIVG**********FVFPKVTFLKLWNLSELKTFYPGTHTSKWPMLKKLEVYGCDKVKIFTSRFLRFQEINEGQFDIPTQQALFLVEKVTSKLEELKLSGKDIAMICQSQFPKHIFRNLKNLEVVNDESENFRIGFLERFHNLEKLELRWSSYKEIFS************QVKSLKLWELSDLMYIWKQDSKLDSITENLESLEVWWCENLINLVPSSASFKNLTTLELWYCQRLMNLVTSSTAKSLVCLTKLRIDGCRMLTEII**********IVFSKLKWVSLERLENLTSFCSGNYTLKFPSLEDLFVIECPKMKIFSHRVLSTPRLREVRQNWGLYKGCWEGDLNTTIQQLQKNELPLLL*********************************QPPLRTTSP************************KKAVLKLEIHGEKARQKAFSIVSKFTGVLSILFDPKDKKMIVIGDIDAVPVVRKLRKQLCATELVSI*****************************
MDLLKYGTGLHIFKGTYTMQETRDRLYALVHKLKDYCLLLDGPTEDWIRMHDLVREVAISIASRDRHVFMLRNDIQIEWPVADMLKNCPTIFLHDCKHWEVPEGLEYPQLEFFCMSPRDHSIKIPNHVFAGMSNLRGLALSNMQFLSLPSLFHLPLNLQTLCLDRCALGDIAIIGNLKKLEILSLVDSNIEQLPEEMAQLTQLRLFDLSGCSKLKVIPPNLLSGLSRLEDLYMGNTSVKWEFEGLNVGRSNASLQELKLLSHLTTLEIQICDAMILPKGLFSKKLERYKIFIGDEWDWSGNYKNKRVLKLKLYTSNVDEVIMQLKGIEELYLDEVPGIKNVLYDLDIEGFLQLKHLHVQNNPFILFIVDSMAWVRYNAFLLLESLVLHNLIHLEKICLGQLRAESFYKLKIIKVRNCDKLKNIFSFSFVRGLPQLQTLNVINCKNMKEIFTVGRENDVDCHEVDKIEFSQLHSLTLKFLPQLTSFYSQ**********LKELSTHTLPREVILEDECDTLMPFFNEKVVFPNLETLELCAISTEKIWCNQLAAVYSQNLTRLIVHGCEKLKYLFPSSMIRNFVQLEHLEICYCSSLESIVGKESGEEATTTFVFPKVTFLKLWNLSELKTFYPGTHTSKWPMLKKLEVYGCDKVKIFTSRFLRFQEINEGQFDIPTQQALFLVEKVTSKLEELKLSGKDIAMICQSQFPKHIFRNLKNLEVVNDESENFRIGFLERFHNLEKLELRWSSYKEIFSNEEIVEHAEMLTQVKSLKLWELSDLMYIWKQDSKLDSITENLESLEVWWCENLINLVPSSASFKNLTTLELWYCQRLMNLVTSSTAKSLVCLTKLRIDGCRMLTEIISKEEDVAEDEIVFSKLKWVSLERLENLTSFCSGNYTLKFPSLEDLFVIECPKMKIFSHRVLSTPRLREVRQNWGLYKGCWEGDLNTTIQQLQKNELPLLLPIASSSSSLAAPTTGNQVPLNLSGNRKTQSFSLQPPLRTTSPTFSSGKPAADNNPSLSLSSCSTRTKKAVLKLEIHGEKARQKAFSIVSKFTGVLSILFDPKDKKMIVIGDIDAVPVVRKLRKQLCATELVSIGPAN*************************
MDLLKYGTGLHIFKGTYTMQETRDRLYALVHKLKDYCLLLDGPTEDWIRMHDLVREVAISIASRDRHVFMLRNDIQIEWPVADMLKNCPTIFLHDCKHWEVPEGLEYPQLEFFCMSPRDHSIKIPNHVFAGMSNLRGLALSNMQFLSLPSLFHLPLNLQTLCLDRCALGDIAIIGNLKKLEILSLVDSNIEQLPEEMAQLTQLRLFDLSGCSKLKVIPPNLLSGLSRLEDLYMGNTSVKWEFEGLNVGRSNASLQELKLLSHLTTLEIQICDAMILPKGLFSKKLERYKIFIGDEWDWSGNYKNKRVLKLKLYTSNVDEVIMQLKGIEELYLDEVPGIKNVLYDLDIEGFLQLKHLHVQNNPFILFIVDSMAWVRYNAFLLLESLVLHNLIHLEKICLGQLRAESFYKLKIIKVRNCDKLKNIFSFSFVRGLPQLQTLNVINCKNMKEIFTVGRENDVDCHEVDKIEFSQLHSLTLKFLPQLTSFYSQVKTSAASQTRLKELSTHTLPREVILEDECDTLMPFFNEKVVFPNLETLELCAISTEKIWCNQLAAVYSQNLTRLIVHGCEKLKYLFPSSMIRNFVQLEHLEICYCSSLESIVGKESGEEATTTFVFPKVTFLKLWNLSELKTFYPGTHTSKWPMLKKLEVYGCDKVKIFTSRFLRFQEINEGQFDIPTQQALFLVEKVTSKLEELKLSGKDIAMICQSQFPKHIFRNLKNLEVVNDESENFRIGFLERFHNLEKLELRWSSYKEIFSNEEIVEHAEMLTQVKSLKLWELSDLMYIWKQDSKLDSITENLESLEVWWCENLINLVPSSASFKNLTTLELWYCQRLMNLVTSSTAKSLVCLTKLRIDGCRMLTEIISKEEDVAEDEIVFSKLKWVSLERLENLTSFCSGNYTLKFPSLEDLFVIECPKMKIFSHRVLSTPRLREVRQNWGLYKGCWEGDLNTTIQQLQKNELPLLLPIASSSSSLAAPTTGNQVPLNLSGNRKTQSFSLQPPLRTTSPTFSSGKPAADNNPSLSLSSCSTRTKKAVLKLEIHGEKARQKAFSIVSKFTGVLSILFDPKDKKMIVIGDIDAVPVVRKLRKQLCATELVSIGP***************************
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDLLKYGTGLHIFKGTYTMQETRDRLYALVHKLKDYCLLLDGPTEDWIRMHDLVREVAISIASRDRHVFMLRNDIQIEWPVADMLKNCPTIFLHDCKHWEVPEGLEYPQLEFFCMSPRDHSIKIPNHVFAGMSNLRGLALSNMQFLSLPSLFHLPLNLQTLCLDRCALGDIAIIGNLKKLEILSLVDSNIEQLPEEMAQLTQLRLFDLSGCSKLKVIPPNLLSGLSRLEDLYMGNTSVKWEFEGLNVGRSNASLQELKLLSHLTTLEIQICDAMILPKGLFSKKLERYKIFIGDEWDWSGNYKNKRVLKLKLYTSNVDEVIMQLKGIEELYLDEVPGIKNVLYDLDIEGFLQLKHLHVQNNPFILFIVDSMAWVRYNAFLLLESLVLHNLIHLEKICLGQLRAESFYKLKIIKVRNCDKLKNIFSFSFVRGLPQLQTLNVINCKNMKEIFTVGRENDVDCHEVDKIEFSQLHSLTLKFLPQLTSFYSQVKTSAASQTRLKELSTHTLPREVILEDECDTLMPFFNEKVVFPNLETLELCAISTEKIWCNQLAAVYSQNLTRLIVHGCEKLKYLFPSSMIRNFVQLEHLEICYCSSLESIVGKESGEEATTTFVFPKVTFLKLWNLSELKTFYPGTHTSKWPMLKKLEVYGCDKVKIFTSRFLRFQEINEGQFDIPTQQALFLVEKVTSKLEELKLSGKDIAMICQSQFPKHIFRNLKNLEVVNDESENFRIGFLERFHNLEKLELRWSSYKEIFSNEEIVEHAEMLTQVKSLKLWELSDLMYIWKQDSKLDSITENLESLEVWWCENLINLVPSSASFKNLTTLELWYCQRLMNLVTSSTAKSLVCLTKLRIDGCRMLTEIISKEEDVAEDEIVFSKLKWVSLERLENLTSFCSGNYTLKFPSLEDLFVIECPKMKIFSHRVLSTPRLREVRQNWGLYKGCWEGDLNTTIQQLQKNELPLLLPIASSSSSLAAPTTGNQVPLNLSGNRKTQSFSLQPPLRTTSPTFSSGKPAADNNPSLSLSSCSTRTKKAVLKLEIHGEKARQKAFSIVSKFTGVLSILFDPKDKKMIVIGDIDAVPVVRKLRKQLCATELVSIGPANEHDxxxxxxxxxxxxxxxxxxxxxV
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query1124 2.2.26 [Sep-21-2011]
O81825919 Probable disease resistan yes no 0.424 0.519 0.266 2e-30
Q9T048985 Disease resistance protei no no 0.362 0.414 0.260 1e-23
Q42484909 Disease resistance protei no no 0.367 0.454 0.243 8e-16
O35930734 Platelet glycoprotein Ib yes no 0.162 0.249 0.296 2e-07
Q9SH22884 Probable disease resistan no no 0.355 0.452 0.232 5e-06
P07359626 Platelet glycoprotein Ib yes no 0.122 0.220 0.296 1e-05
Q01513 2145 Adenylate cyclase OS=Podo yes no 0.073 0.038 0.369 2e-05
Q9RBS21024 Protein PopC OS=Ralstonia yes no 0.096 0.105 0.351 9e-05
Q9SI85893 Probable disease resistan no no 0.346 0.436 0.228 0.0002
Q01631 2300 Adenylate cyclase OS=Neur N/A no 0.090 0.044 0.361 0.0003
>sp|O81825|DRL28_ARATH Probable disease resistance protein At4g27220 OS=Arabidopsis thaliana GN=At4g27220 PE=2 SV=1 Back     alignment and function desciption
 Score =  135 bits (341), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 132/496 (26%), Positives = 224/496 (45%), Gaps = 19/496 (3%)

Query: 2   DLLKYGTGLHIFKGTYTMQETRDRLYALVHKLKDYCLLLDGPTEDWIRMHDLVREVAI-- 59
           +L+ Y     +  G +  ++  +    LV +LKD CLL DG + D ++MHD+VR+ AI  
Sbjct: 383 ELIMYWVAEGLLDGQHHYEDMMNEGVTLVERLKDSCLLEDGDSCDTVKMHDVVRDFAIWF 442

Query: 60  -SIASRDRHVFMLRNDIQIEWPVADMLKNCPTIFLHDCKHWEVPEG-LEYPQLEFFCMSP 117
            S      H  ++     IE+P    + +   + L   K   +P   +E  +     +  
Sbjct: 443 MSSQGEGFHSLVMAGRGLIEFPQDKFVSSVQRVSLMANKLERLPNNVIEGVETLVLLLQG 502

Query: 118 RDHSIKIPNHVFAGMSNLRGLALSNMQFLSLPSLFHLPLNLQTLCLDRC-ALGDIAIIGN 176
             H  ++PN       NLR L LS ++  +LP  F    +L++L L  C  L ++  + +
Sbjct: 503 NSHVKEVPNGFLQAFPNLRILDLSGVRIRTLPDSFSNLHSLRSLVLRNCKKLRNLPSLES 562

Query: 177 LKKLEILSLVDSNIEQLPEEMAQLTQLRLFDLSGCSKLKVIPPNLLSGLSRLEDLYMGNT 236
           L KL+ L L +S I +LP  +  L+ LR   +S   +L+ IP   +  LS LE L M  +
Sbjct: 563 LVKLQFLDLHESAIRELPRGLEALSSLRYICVSNTYQLQSIPAGTILQLSSLEVLDMAGS 622

Query: 237 SVKWEFEGLNVGRSNASLQELKLLSHLTTLEIQICDAMILPKGL--FSKKLERYKIFIGD 294
           +  W  +G       A+L E+  L HL  L I++ D +         +K+L +++     
Sbjct: 623 AYSWGIKG-EEREGQATLDEVTCLPHLQFLAIKLLDVLSFSYEFDSLTKRLTKFQFLFSP 681

Query: 295 EWDWSGNYKNKRVLKLKLYTSNVDEVIMQLKGIEELYLDEVPGIKNVLYDLDIE---GFL 351
               S     +  L +     +   +   L+ +  L L+   G+  +  +L  +    F+
Sbjct: 682 IRSVSPPGTGEGCLAISDVNVSNASIGWLLQHVTSLDLNYCEGLNGMFENLVTKSKSSFV 741

Query: 352 QLKHLHVQNNPFILFIVDSMAWVRYNAFLLLESLVLHNLIHLEKIC-LGQLRAESFYKLK 410
            +K L +   P +   + S    + + F  LE L L N ++LE I  L         KLK
Sbjct: 742 AMKALSIHYFPSL--SLASGCESQLDLFPNLEELSLDN-VNLESIGELNGFLGMRLQKLK 798

Query: 411 IIKVRNCDKLKNIFSFSFVRG-LPQLQTLNVINCKNMKEIFTVGRENDVDCHEVDKIEFS 469
           +++V  C +LK +FS   + G LP LQ + V++C  ++E+F         C E       
Sbjct: 799 LLQVSGCRQLKRLFSDQILAGTLPNLQEIKVVSCLRLEELFNFSSVPVDFCAES---LLP 855

Query: 470 QLHSLTLKFLPQLTSF 485
           +L  + LK+LPQL S 
Sbjct: 856 KLTVIKLKYLPQLRSL 871
Probable disease resistance protein.
Arabidopsis thaliana (taxid: 3702)
>sp|Q9T048|DRL27_ARATH Disease resistance protein At4g27190 OS=Arabidopsis thaliana GN=At4g27190 PE=2 SV=1 Back     alignment and function description
>sp|Q42484|RPS2_ARATH Disease resistance protein RPS2 OS=Arabidopsis thaliana GN=RPS2 PE=1 SV=1 Back     alignment and function description
>sp|O35930|GP1BA_MOUSE Platelet glycoprotein Ib alpha chain OS=Mus musculus GN=Gp1ba PE=2 SV=2 Back     alignment and function description
>sp|Q9SH22|DRL20_ARATH Probable disease resistance protein At1g63360 OS=Arabidopsis thaliana GN=At1g63360 PE=2 SV=1 Back     alignment and function description
>sp|P07359|GP1BA_HUMAN Platelet glycoprotein Ib alpha chain OS=Homo sapiens GN=GP1BA PE=1 SV=1 Back     alignment and function description
>sp|Q01513|CYAA_PODAS Adenylate cyclase OS=Podospora anserina PE=3 SV=1 Back     alignment and function description
>sp|Q9RBS2|POPC_RALSO Protein PopC OS=Ralstonia solanacearum (strain GMI1000) GN=popC PE=4 SV=2 Back     alignment and function description
>sp|Q9SI85|DRL14_ARATH Probable disease resistance protein At1g62630 OS=Arabidopsis thaliana GN=At1g62630 PE=3 SV=2 Back     alignment and function description
>sp|Q01631|CYAA_NEUCR Adenylate cyclase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cr-1 PE=3 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1124
359488108 1436 PREDICTED: disease resistance protein At 0.825 0.646 0.406 1e-171
2960878721152 unnamed protein product [Vitis vinifera] 0.756 0.737 0.426 1e-167
224111296 1315 cc-nbs-lrr resistance protein [Populus t 0.771 0.659 0.408 1e-162
359488288 1340 PREDICTED: LOW QUALITY PROTEIN: probable 0.738 0.619 0.390 1e-160
224143316 1337 cc-nbs-lrr resistance protein [Populus t 0.773 0.649 0.400 1e-157
255563252 1603 Disease resistance protein RPS5, putativ 0.870 0.610 0.380 1e-156
224111284 1340 cc-nbs-lrr resistance protein [Populus t 0.795 0.667 0.386 1e-151
359488027 1520 PREDICTED: disease resistance protein At 0.816 0.603 0.378 1e-151
255542484 2460 phosphoprotein phosphatase, putative [Ri 0.779 0.356 0.405 1e-151
2240834341144 cc-nbs-lrr resistance protein [Populus t 0.579 0.569 0.456 1e-146
>gi|359488108|ref|XP_003633701.1| PREDICTED: disease resistance protein At4g27190-like [Vitis vinifera] Back     alignment and taxonomy information
 Score =  610 bits (1572), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 407/1001 (40%), Positives = 572/1001 (57%), Gaps = 73/1001 (7%)

Query: 2    DLLKYGTGLHIFKGTYTMQETRDRLYALVHKLKDYCLLLDGPTEDWIRMHDLVREVAISI 61
            DLLKYG GL +F+GT T++E ++R+ ALV  LK    LL+     ++RMHDLVR  A  I
Sbjct: 421  DLLKYGVGLRLFQGTNTLEEAKNRIDALVDNLKSSNFLLETGHNAFVRMHDLVRSTARKI 480

Query: 62   ASRDRHVFMLRND-IQIE-WPVADMLKNCPTIFLHDCKHWEVPEGLEYPQLEFF-CMSPR 118
            AS   HVF L+N  +++E WP  D L+    + LHDC   E+PEGL  P+LE F C    
Sbjct: 481  ASDQHHVFTLQNTTVRVEGWPRIDELQKVTWVSLHDCDIRELPEGLACPKLELFGCYDVN 540

Query: 119  DHS-IKIPNHVFAGMSNLRGLALSNMQFLSLPSLFHLPLNLQTLCLDRCALGDIAIIGNL 177
             +S ++IPN+ F  M  L+ L LS MQ  SLP   H   NL+TLCLD C LG+I II  L
Sbjct: 541  TNSAVQIPNNFFEEMKQLKVLDLSRMQLPSLPLSCHCRTNLRTLCLDGCNLGEIVIIAEL 600

Query: 178  KKLEILSLVDSNIEQLPEEMAQLTQLRLFDLSGCSKLKVIPPNLLSGLSRLEDLYMGNTS 237
            KKLEILSL  S+IE+LP E+AQLT LRLFDL G  KLKVIPP+++S LS+LEDL M N+ 
Sbjct: 601  KKLEILSLTYSDIEKLPREIAQLTHLRLFDLKGSYKLKVIPPDVISSLSQLEDLCMENSF 660

Query: 238  VKWEFEGLNVGRSNASLQELKLLSHLTTLEIQICDAMILPKGLFSKKLERYKIFIGDEWD 297
             +WE E    G+SNA L ELK LSHLT+L+IQI DA +LPK +    L RY+IF+GD W 
Sbjct: 661  TQWEGE----GKSNACLAELKHLSHLTSLDIQIPDAKLLPKDIVFDTLVRYRIFVGDVWS 716

Query: 298  WSGNYKNKRVLKLKLYTSN---VDEVIMQLKGIEELYLDEVPGIKNVLYDLDIEGFLQLK 354
            W G  +  + L+L  + ++   VD +I  LK  E+L+L E+ G  NVL  LD EGFL+LK
Sbjct: 717  WGGISEANKTLQLNKFDTSLHLVDGIIKLLKRTEDLHLRELCGGTNVLSKLDGEGFLKLK 776

Query: 355  HLHVQNNPFILFIVDSMAWV-RYNAFLLLESLVLHNLIHLEKICLGQLRAESFYKLKIIK 413
            HL+V+++P I +IV+SM     + AF ++E+L L+ LI+L+++C GQ  A SF  L+ ++
Sbjct: 777  HLNVESSPEIQYIVNSMDLTPSHGAFPVMETLSLNQLINLQEVCRGQFPAGSFGCLRKVE 836

Query: 414  VRNCDKLKNIFSFSFVRGLPQLQTLNVINCKNMKEIFTVGRENDVDCHEVDKIEFSQLHS 473
            V +CD LK +FS S  RGL +L+   V  CK+M E+ + GR+ ++    V+   F +L S
Sbjct: 837  VEDCDGLKFLFSLSVARGLSRLEETKVTRCKSMVEMVSQGRK-EIKEDAVNVPLFPELRS 895

Query: 474  LTLKFLPQLTSF-YSQVKTSAASQTRLKELSTHTLPREVILEDECDTLMPFFNEKVVFPN 532
            LTL+ LP+L++F + +    +   + +   ST  L +  I + +       F+   +  N
Sbjct: 896  LTLEDLPKLSNFCFEENPVLSKPASTIVGPSTPPLNQPEIRDGQL-----LFS---LGGN 947

Query: 533  LETLEL-CAISTEKIWCNQLAAVYSQNLTRLIVHGCEKLKYLF---------------PS 576
            L +L L   +S  K++   L     QNL  L V  C+KL+ +F               P 
Sbjct: 948  LRSLNLKKCMSLLKLFPPSLL----QNLQELTVENCDKLEQVFDLEELNVDDGHVGLLPK 1003

Query: 577  SMIRNFVQLEHL-EICYCSSLESIVGKESGEEATTTFVFPKVTFLKLWNLSELKTFY-PG 634
                  + L  L  IC C S  +              +FPK+ ++ L  L  L +F  PG
Sbjct: 1004 LGKLRLIDLPKLRHICNCGSSRNHFPSSMASAPVGNIIFPKLFYISLGFLPNLTSFVSPG 1063

Query: 635  THT------------------SKWPMLKKLEVYGCDKVKIFTSRFLRFQEIN-EGQFDIP 675
             H+                   +WP+L++L V  C K+ +F      FQ+ + EG  D+P
Sbjct: 1064 YHSLQRLHHADLDTPFPVLFDERWPLLEELRVSECYKLDVFAFETPTFQQRHGEGNLDMP 1123

Query: 676  TQQALFLVEKVTSKLEELKLSGKDIAMICQSQFPKHIFRNLKNLEVVNDESENFRIG--F 733
                 FL       LEEL+L       I   QFP   F  L+ L V +       I    
Sbjct: 1124 L---FFLPHVAFPNLEELRLGDNRDTEIWPEQFPVDSFPRLRVLHVHDYRDILVVIPSFM 1180

Query: 734  LERFHNLEKLEL-RWSSYKEIFSNEEIVE--HAEMLTQVKSLKLWELSDLMYIWKQDSKL 790
            L+R HNLE L++   SS KE+F  E + E   A+ L +++ ++L +L  L  +WK++S+ 
Sbjct: 1181 LQRLHNLEVLKVGSCSSVKEVFQLEGLDEENQAKRLGRLREIELHDLPGLTRLWKENSEP 1240

Query: 791  DSITENLESLEVWWCENLINLVPSSASFKNLTTLELWYCQRLMNLVTSSTAKSLVCLTKL 850
                ++LESLEVW C +LINLVPSS SF+NL TL++  C  L +L++ S AKSLV L  L
Sbjct: 1241 GLDLQSLESLEVWNCGSLINLVPSSVSFQNLATLDVQSCGSLRSLISPSVAKSLVKLKTL 1300

Query: 851  RIDGCRMLTEIISKEEDVAEDEIVFSKLKWVSLERLENLTSFCSGNYTLKFPSLEDLFVI 910
            +I    M+ E+++ E   A DEI F KL+ + L  L NLTSF SG Y   FPSLE + V 
Sbjct: 1301 KIGRSDMMEEVVANEGGEATDEITFYKLQHMELLYLPNLTSFSSGGYIFSFPSLEQMLVK 1360

Query: 911  ECPKMKIFSHRVLSTPRLREVRQNWGLYKGCWEGDLNTTIQ 951
            ECPKMK+FS  +++ PRL+ ++   G  +  W+ DLNT I 
Sbjct: 1361 ECPKMKMFSPSLVTPPRLKRIK--VGDEEWPWQDDLNTAIH 1399

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|296087872|emb|CBI35155.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|224111296|ref|XP_002332952.1| cc-nbs-lrr resistance protein [Populus trichocarpa] gi|222834264|gb|EEE72741.1| cc-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|359488288|ref|XP_003633735.1| PREDICTED: LOW QUALITY PROTEIN: probable disease resistance protein At1g61310-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|224143316|ref|XP_002336027.1| cc-nbs-lrr resistance protein [Populus trichocarpa] gi|222838884|gb|EEE77235.1| cc-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255563252|ref|XP_002522629.1| Disease resistance protein RPS5, putative [Ricinus communis] gi|223538105|gb|EEF39716.1| Disease resistance protein RPS5, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|224111284|ref|XP_002332949.1| cc-nbs-lrr resistance protein [Populus trichocarpa] gi|222834261|gb|EEE72738.1| cc-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|359488027|ref|XP_002269288.2| PREDICTED: disease resistance protein At4g27190-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|255542484|ref|XP_002512305.1| phosphoprotein phosphatase, putative [Ricinus communis] gi|223548266|gb|EEF49757.1| phosphoprotein phosphatase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|224083434|ref|XP_002307025.1| cc-nbs-lrr resistance protein [Populus trichocarpa] gi|222856474|gb|EEE94021.1| cc-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1124
TAIR|locus:2131689919 AT4G27220 [Arabidopsis thalian 0.422 0.516 0.264 4.2e-29
TAIR|locus:2136447985 AT4G27190 [Arabidopsis thalian 0.363 0.415 0.254 2.8e-19
TAIR|locus:2025421177 AT1G01490 [Arabidopsis thalian 0.081 0.519 0.452 1.1e-13
TAIR|locus:2172808103 AT5G23760 "AT5G23760" [Arabido 0.083 0.912 0.443 2.4e-11
TAIR|locus:2149594139 AT5G52750 [Arabidopsis thalian 0.057 0.467 0.560 3.9e-11
TAIR|locus:2149614126 AT5G52760 [Arabidopsis thalian 0.057 0.515 0.537 8e-11
TAIR|locus:2005517909 RPS2 "RESISTANT TO P. SYRINGAE 0.249 0.308 0.237 0.00032
TAIR|locus:2149584118 AT5G52740 "AT5G52740" [Arabido 0.063 0.601 0.459 1.3e-10
TAIR|locus:21171491201 AT4G19050 [Arabidopsis thalian 0.363 0.340 0.237 1.7e-08
TAIR|locus:2094498 1981 AT3G25510 [Arabidopsis thalian 0.233 0.132 0.242 2e-06
TAIR|locus:2131689 AT4G27220 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 359 (131.4 bits), Expect = 4.2e-29, Sum P(2) = 4.2e-29
 Identities = 131/496 (26%), Positives = 220/496 (44%)

Query:     2 DLLKYGTGLHIFKGTYTMQETRDRLYALVHKLKDYCLLLDGPTEDWIRMHDLVREVAISI 61
             +L+ Y     +  G +  ++  +    LV +LKD CLL DG + D ++MHD+VR+ AI  
Sbjct:   383 ELIMYWVAEGLLDGQHHYEDMMNEGVTLVERLKDSCLLEDGDSCDTVKMHDVVRDFAIWF 442

Query:    62 ASRDR---HVFMLRNDIQIEWPVADMLKNCPTIFLHDCKHWEVPEG-LEYPQLEFFCMSP 117
              S      H  ++     IE+P    + +   + L   K   +P   +E  +     +  
Sbjct:   443 MSSQGEGFHSLVMAGRGLIEFPQDKFVSSVQRVSLMANKLERLPNNVIEGVETLVLLLQG 502

Query:   118 RDHSIKIPNHVFAGMSNLRGLALSNMQXXXXXXXXXXXXXXQTLCLDRCA-LGDIAIIGN 176
               H  ++PN       NLR L LS ++              ++L L  C  L ++  + +
Sbjct:   503 NSHVKEVPNGFLQAFPNLRILDLSGVRIRTLPDSFSNLHSLRSLVLRNCKKLRNLPSLES 562

Query:   177 LKKLEILSLVDSNIEQLPEEMAQLTQLRLFDLSGCSKLKVIPPNLLSGLSRLEDLYMGNT 236
             L KL+ L L +S I +LP  +  L+ LR   +S   +L+ IP   +  LS LE L M  +
Sbjct:   563 LVKLQFLDLHESAIRELPRGLEALSSLRYICVSNTYQLQSIPAGTILQLSSLEVLDMAGS 622

Query:   237 SVKWEFEGLNVGRSNASLQELKLLSHLTTLEIQICDAMILPKGLFS--KKLERYKIFIGD 294
             +  W  +G       A+L E+  L HL  L I++ D +       S  K+L +++     
Sbjct:   623 AYSWGIKG-EEREGQATLDEVTCLPHLQFLAIKLLDVLSFSYEFDSLTKRLTKFQFLFSP 681

Query:   295 EWDWSGNYKNKRVLKLK-LYTSN--VDEVIMQLKGIEELYLDEVPGIKNVLYDLDIEGFL 351
                 S     +  L +  +  SN  +  ++  +  ++  Y + + G+   L       F+
Sbjct:   682 IRSVSPPGTGEGCLAISDVNVSNASIGWLLQHVTSLDLNYCEGLNGMFENLVTKSKSSFV 741

Query:   352 QLKHLHVQNNPFILFIVDSMAWVRYNAFLLLESLVLHNLIHLEKIC-LGQLRAESFYKLK 410
              +K L +   P +     S    + + F  LE L L N ++LE I  L         KLK
Sbjct:   742 AMKALSIHYFPSLSLA--SGCESQLDLFPNLEELSLDN-VNLESIGELNGFLGMRLQKLK 798

Query:   411 IIKVRNCDKLKNIFSFSFVRG-LPQLQTLNVINCKNMKEIFTVGRENDVD-CHEVDKIEF 468
             +++V  C +LK +FS   + G LP LQ + V++C  ++E+F       VD C E      
Sbjct:   799 LLQVSGCRQLKRLFSDQILAGTLPNLQEIKVVSCLRLEELFNFSSV-PVDFCAES---LL 854

Query:   469 SQLHSLTLKFLPQLTS 484
              +L  + LK+LPQL S
Sbjct:   855 PKLTVIKLKYLPQLRS 870
GO:0005634 "nucleus" evidence=ISM
GO:0006952 "defense response" evidence=IEA;ISS
GO:0043531 "ADP binding" evidence=IEA
TAIR|locus:2136447 AT4G27190 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2025421 AT1G01490 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2172808 AT5G23760 "AT5G23760" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2149594 AT5G52750 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2149614 AT5G52760 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2005517 RPS2 "RESISTANT TO P. SYRINGAE 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2149584 AT5G52740 "AT5G52740" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2117149 AT4G19050 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2094498 AT3G25510 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
eugene3.03110007
cc-nbs-lrr resistance protein (1315 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1124
PLN032101153 PLN03210, PLN03210, Resistant to P 9e-07
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 5e-05
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 2e-04
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 5e-04
PLN03210 1153 PLN03210, PLN03210, Resistant to P 0.001
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 0.001
pfam0040362 pfam00403, HMA, Heavy-metal-associated domain 0.004
>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information 
 Score = 53.0 bits (127), Expect = 9e-07
 Identities = 70/255 (27%), Positives = 103/255 (40%), Gaps = 52/255 (20%)

Query: 393 LEKICLGQLRAESFYKLKIIKVRNCDKLKNIFSFSFVRGLPQLQTLNVINCKNMKE---- 448
           LEK+  G     S   L+ I +R    LK I   S       L+TL + +C ++ E    
Sbjct: 623 LEKLWDG---VHSLTGLRNIDLRGSKNLKEIPDLSMA---TNLETLKLSDCSSLVELPSS 676

Query: 449 IFTVGRENDVDCHEVDKIE-------FSQLHSLTLKFLPQLTSFYSQVKTSAASQTRLKE 501
           I  + +  D+D    + +E          L+ L L    +L SF     ++  S   L E
Sbjct: 677 IQYLNKLEDLDMSRCENLEILPTGINLKSLYRLNLSGCSRLKSFPD--ISTNISWLDLDE 734

Query: 502 LSTHTLPREVILEDECDTLMPFFNEKVVFPNLETLELCAISTEKIWCNQ-----LAAVYS 556
            +    P  + LE                 NL+ L LC + +EK+W        L  + S
Sbjct: 735 TAIEEFPSNLRLE-----------------NLDELILCEMKSEKLWERVQPLTPLMTMLS 777

Query: 557 QNLTRLIVHGCEKLKYLFPSSMIRNFVQLEHLEICYCSSLESIVGKESGEEATTTFVFPK 616
            +LTRL +     L  L PSS I+N  +LEHLEI  C +LE++          T      
Sbjct: 778 PSLTRLFLSDIPSLVEL-PSS-IQNLHKLEHLEIENCINLETL---------PTGINLES 826

Query: 617 VTFLKLWNLSELKTF 631
           +  L L   S L+TF
Sbjct: 827 LESLDLSGCSRLRTF 841

syringae 6; Provisional. Length = 1153
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|215902 pfam00403, HMA, Heavy-metal-associated domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 1124
PLN00113968 leucine-rich repeat receptor-like protein kinase; 100.0
PLN00113968 leucine-rich repeat receptor-like protein kinase; 100.0
PLN032101153 Resistant to P. syringae 6; Provisional 99.96
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 99.96
KOG4194873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.92
KOG4194873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.89
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.88
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.87
PLN032101153 Resistant to P. syringae 6; Provisional 99.86
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.86
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.85
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.84
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.83
KOG0617264 consensus Ras suppressor protein (contains leucine 99.65
KOG4237498 consensus Extracellular matrix protein slit, conta 99.6
KOG0617264 consensus Ras suppressor protein (contains leucine 99.57
PRK15387788 E3 ubiquitin-protein ligase SspH2; Provisional 99.49
PRK15387788 E3 ubiquitin-protein ligase SspH2; Provisional 99.47
KOG160373 consensus Copper chaperone [Inorganic ion transpor 99.46
PRK15370754 E3 ubiquitin-protein ligase SlrP; Provisional 99.42
KOG4237498 consensus Extracellular matrix protein slit, conta 99.41
PRK15370754 E3 ubiquitin-protein ligase SlrP; Provisional 99.4
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 99.25
KOG4341483 consensus F-box protein containing LRR [General fu 99.15
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.08
KOG0532722 consensus Leucine-rich repeat (LRR) protein, conta 99.07
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.06
KOG0532722 consensus Leucine-rich repeat (LRR) protein, conta 99.05
KOG4341483 consensus F-box protein containing LRR [General fu 99.01
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.0
PF0040362 HMA: Heavy-metal-associated domain; InterPro: IPR0 98.93
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 98.91
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.89
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.88
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.79
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.7
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 98.64
COG260871 CopZ Copper chaperone [Inorganic ion transport and 98.61
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 98.5
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.44
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.32
KOG4656 247 consensus Copper chaperone for superoxide dismutas 98.32
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.29
PLN03150623 hypothetical protein; Provisional 98.25
KOG18591096 consensus Leucine-rich repeat proteins [General fu 98.22
PRK15386426 type III secretion protein GogB; Provisional 98.16
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.14
PLN03150623 hypothetical protein; Provisional 98.13
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.12
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.11
PRK15386426 type III secretion protein GogB; Provisional 98.09
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.04
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.97
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 97.96
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 97.95
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.87
KOG18591096 consensus Leucine-rich repeat proteins [General fu 97.79
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.76
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 97.73
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.64
KOG1947482 consensus Leucine rich repeat proteins, some prote 97.63
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.56
PLN02957 238 copper, zinc superoxide dismutase 97.47
KOG2982418 consensus Uncharacterized conserved protein [Funct 97.39
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.35
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 97.11
PRK10671 834 copA copper exporting ATPase; Provisional 97.06
KOG1947482 consensus Leucine rich repeat proteins, some prote 97.03
KOG2123388 consensus Uncharacterized conserved protein [Funct 96.76
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.65
KOG2982418 consensus Uncharacterized conserved protein [Funct 96.61
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.58
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 96.12
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 96.05
KOG2123388 consensus Uncharacterized conserved protein [Funct 95.53
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 95.36
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.2
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 94.22
COG2217 713 ZntA Cation transport ATPase [Inorganic ion transp 93.65
KOG3864221 consensus Uncharacterized conserved protein [Funct 93.25
TIGR0000368 copper ion binding protein. This model describes a 93.08
KOG3864221 consensus Uncharacterized conserved protein [Funct 92.52
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 92.34
KOG0473326 consensus Leucine-rich repeat protein [Function un 92.01
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 90.55
KOG0473326 consensus Leucine-rich repeat protein [Function un 89.68
KOG0207 951 consensus Cation transport ATPase [Inorganic ion t 87.01
smart0037026 LRR Leucine-rich repeats, outliers. 86.79
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 86.79
PF0268095 DUF211: Uncharacterized ArCR, COG1888; InterPro: I 86.2
PRK10671 834 copA copper exporting ATPase; Provisional 85.59
smart0037026 LRR Leucine-rich repeats, outliers. 84.66
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 84.66
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information 
Probab=100.00  E-value=3.6e-33  Score=360.88  Aligned_cols=512  Identities=18%  Similarity=0.163  Sum_probs=297.0

Q ss_pred             CCcCEEEeecCCCccC-CCCC-CCCCccEEEecCCCCCCCCChhhhcCCCCCcEEEeecCCCc-cCCcccCCCCCCcEEE
Q 001201           86 KNCPTIFLHDCKHWEV-PEGL-EYPQLEFFCMSPRDHSIKIPNHVFAGMSNLRGLALSNMQFL-SLPSLFHLPLNLQTLC  162 (1124)
Q Consensus        86 ~~lr~L~l~~n~i~~l-~~~~-~~~~L~~L~L~~n~~~~~~~~~~f~~l~~Lr~L~Ls~~~i~-~lp~~i~~l~~Lr~L~  162 (1124)
                      .+++.|++++|.+... +..+ .+++|++|+|++|.+...+|..+|.++++||+|+|++|.+. .+|.  +.+++|++|+
T Consensus        69 ~~v~~L~L~~~~i~~~~~~~~~~l~~L~~L~Ls~n~~~~~ip~~~~~~l~~L~~L~Ls~n~l~~~~p~--~~l~~L~~L~  146 (968)
T PLN00113         69 SRVVSIDLSGKNISGKISSAIFRLPYIQTINLSNNQLSGPIPDDIFTTSSSLRYLNLSNNNFTGSIPR--GSIPNLETLD  146 (968)
T ss_pred             CcEEEEEecCCCccccCChHHhCCCCCCEEECCCCccCCcCChHHhccCCCCCEEECcCCccccccCc--cccCCCCEEE
Confidence            4788999999987644 3333 78999999999999888899998889999999999999887 4453  5689999999


Q ss_pred             ccCCCCCC-c-ccccCcccCcEEEccCCCCC-ccchhhhCCCCccEEEecCCCCCCccCccccCCCCCccEEEeecccCc
Q 001201          163 LDRCALGD-I-AIIGNLKKLEILSLVDSNIE-QLPEEMAQLTQLRLFDLSGCSKLKVIPPNLLSGLSRLEDLYMGNTSVK  239 (1124)
Q Consensus       163 L~~~~l~~-l-~~i~~L~~L~~L~Ls~~~i~-~lp~~i~~L~~L~~L~L~~~~~l~~lp~~~i~~L~~L~~L~l~~~~i~  239 (1124)
                      |++|.+.. + ..++++.+|++|++++|.+. .+|..++++++|++|++++|.....+|.. ++++++|++|++++|.+.
T Consensus       147 Ls~n~~~~~~p~~~~~l~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~L~~n~l~~~~p~~-l~~l~~L~~L~L~~n~l~  225 (968)
T PLN00113        147 LSNNMLSGEIPNDIGSFSSLKVLDLGGNVLVGKIPNSLTNLTSLEFLTLASNQLVGQIPRE-LGQMKSLKWIYLGYNNLS  225 (968)
T ss_pred             CcCCcccccCChHHhcCCCCCEEECccCcccccCChhhhhCcCCCeeeccCCCCcCcCChH-HcCcCCccEEECcCCccC
Confidence            99999863 3 77999999999999999876 77889999999999999999855567766 899999999999998876


Q ss_pred             cccccccccCCCcChhhhcCCCCCCEEEeecCCCc-ccCccccccccceEEEEeCCcccccCCCCCceEEEEeccccchh
Q 001201          240 WEFEGLNVGRSNASLQELKLLSHLTTLEIQICDAM-ILPKGLFSKKLERYKIFIGDEWDWSGNYKNKRVLKLKLYTSNVD  318 (1124)
Q Consensus       240 ~~~~~~~~~~~~~~~~~l~~l~~L~~L~l~~~~~~-~l~~~~~~~~L~~l~l~~~~~~~~~~~~~~l~~l~l~~~~~~l~  318 (1124)
                                 ...+..++++++|++|++++|.+. .+|..                                       
T Consensus       226 -----------~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~---------------------------------------  255 (968)
T PLN00113        226 -----------GEIPYEIGGLTSLNHLDLVYNNLTGPIPSS---------------------------------------  255 (968)
T ss_pred             -----------CcCChhHhcCCCCCEEECcCceeccccChh---------------------------------------
Confidence                       456778899999999999988753 22222                                       


Q ss_pred             HHHHhhcccceeeccccCCccccccccccccccccceeeeccCCCeeEEeeCCcccccccccccceeecccccccccccc
Q 001201          319 EVIMQLKGIEELYLDEVPGIKNVLYDLDIEGFLQLKHLHVQNNPFILFIVDSMAWVRYNAFLLLESLVLHNLIHLEKICL  398 (1124)
Q Consensus       319 ~~~~~l~~L~~L~L~~~~~~~~~~~~~~~~~l~~L~~L~L~~~~~l~~l~~~~~~~~~~~~~~L~~L~l~~~~~l~~~~~  398 (1124)
                        ++.+++|+.|+++++.........+  ..+++|++|++++|.....++     .....+++|+.|++.++.-....  
T Consensus       256 --l~~l~~L~~L~L~~n~l~~~~p~~l--~~l~~L~~L~Ls~n~l~~~~p-----~~~~~l~~L~~L~l~~n~~~~~~--  324 (968)
T PLN00113        256 --LGNLKNLQYLFLYQNKLSGPIPPSI--FSLQKLISLDLSDNSLSGEIP-----ELVIQLQNLEILHLFSNNFTGKI--  324 (968)
T ss_pred             --HhCCCCCCEEECcCCeeeccCchhH--hhccCcCEEECcCCeeccCCC-----hhHcCCCCCcEEECCCCccCCcC--
Confidence              2334445555554432221111122  345556666665554211110     11223444555554443211111  


Q ss_pred             cccCccccCCccEEEEccCCCcCcccchhhhhccCcccEEecccccccchhccccccCCcccCcccccccCccCEEeecC
Q 001201          399 GQLRAESFYKLKIIKVRNCDKLKNIFSFSFVRGLPQLQTLNVINCKNMKEIFTVGRENDVDCHEVDKIEFSQLHSLTLKF  478 (1124)
Q Consensus       399 ~~~~~~~~~~L~~L~l~~C~~L~~l~~~~~~~~l~~L~~L~L~~c~~l~~i~~~~~~~~~~~~~~~~~~~~~L~~L~l~~  478 (1124)
                       +.....+++|+.|++++|.-...+|  ..+..+++|+.|+++++.-...++.            ....+++|+.|++.+
T Consensus       325 -~~~~~~l~~L~~L~L~~n~l~~~~p--~~l~~~~~L~~L~Ls~n~l~~~~p~------------~~~~~~~L~~L~l~~  389 (968)
T PLN00113        325 -PVALTSLPRLQVLQLWSNKFSGEIP--KNLGKHNNLTVLDLSTNNLTGEIPE------------GLCSSGNLFKLILFS  389 (968)
T ss_pred             -ChhHhcCCCCCEEECcCCCCcCcCC--hHHhCCCCCcEEECCCCeeEeeCCh------------hHhCcCCCCEEECcC
Confidence             0112245556666666543222222  2345556666666665332222220            112344455555554


Q ss_pred             CCcccccccccccchhcccccceecccCCCceeecccccCcccccccccccccccceeeecccccccccccCcccccCCC
Q 001201          479 LPQLTSFYSQVKTSAASQTRLKELSTHTLPREVILEDECDTLMPFFNEKVVFPNLETLELCAISTEKIWCNQLAAVYSQN  558 (1124)
Q Consensus       479 ~~~l~~~~~~~~~~~~~~~~L~~L~l~~~~~l~~~~~~~~~~~~~~~~~~~~~~L~~L~l~~~~l~~~~~~~~~~~~l~~  558 (1124)
                      ++-...++.    .+..                                  +++|+.|++++|.+....+..+.  .+++
T Consensus       390 n~l~~~~p~----~~~~----------------------------------~~~L~~L~L~~n~l~~~~p~~~~--~l~~  429 (968)
T PLN00113        390 NSLEGEIPK----SLGA----------------------------------CRSLRRVRLQDNSFSGELPSEFT--KLPL  429 (968)
T ss_pred             CEecccCCH----HHhC----------------------------------CCCCCEEECcCCEeeeECChhHh--cCCC
Confidence            432222221    1223                                  44455555555543332222222  2455


Q ss_pred             ccEEEEecCCCccccCcchhhhhccCCCEEEEeccccccceecccccccccceeecCccceeccccCcccceecCCCccC
Q 001201          559 LTRLIVHGCEKLKYLFPSSMIRNFVQLEHLEICYCSSLESIVGKESGEEATTTFVFPKVTFLKLWNLSELKTFYPGTHTS  638 (1124)
Q Consensus       559 L~~L~l~~C~~L~~l~~~~~~~~l~~L~~L~l~~C~~l~~i~~~~~~~~~~~~~~~~~L~~L~L~~c~~L~~~~~~~~~~  638 (1124)
                      |+.|+++++ .++...+ ..+..+++|+.|++++|.-...++...         ..++|+.|++++|.-...++....  
T Consensus       430 L~~L~Ls~N-~l~~~~~-~~~~~l~~L~~L~L~~n~~~~~~p~~~---------~~~~L~~L~ls~n~l~~~~~~~~~--  496 (968)
T PLN00113        430 VYFLDISNN-NLQGRIN-SRKWDMPSLQMLSLARNKFFGGLPDSF---------GSKRLENLDLSRNQFSGAVPRKLG--  496 (968)
T ss_pred             CCEEECcCC-cccCccC-hhhccCCCCcEEECcCceeeeecCccc---------ccccceEEECcCCccCCccChhhh--
Confidence            555555553 3333322 223345555555555555322222211         234555555555543333322211  


Q ss_pred             CCCcccEEEEecCCcceeecccccccccccCCccccccccceeeeeeecCCceEEeeccccccccccccCCccccccccE
Q 001201          639 KWPMLKKLEVYGCDKVKIFTSRFLRFQEINEGQFDIPTQQALFLVEKVTSKLEELKLSGKDIAMICQSQFPKHIFRNLKN  718 (1124)
Q Consensus       639 ~l~~L~~L~i~~C~~L~~lp~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~~~~~~~~L~~  718 (1124)
                      .+++|+.|++++|.-...+|...                       ..+++|++|+|++|.+....+..+  ..+++|+.
T Consensus       497 ~l~~L~~L~Ls~N~l~~~~p~~~-----------------------~~l~~L~~L~Ls~N~l~~~~p~~~--~~l~~L~~  551 (968)
T PLN00113        497 SLSELMQLKLSENKLSGEIPDEL-----------------------SSCKKLVSLDLSHNQLSGQIPASF--SEMPVLSQ  551 (968)
T ss_pred             hhhccCEEECcCCcceeeCChHH-----------------------cCccCCCEEECCCCcccccCChhH--hCcccCCE
Confidence            35667777776664333343221                       345667777777776654433332  23566777


Q ss_pred             EEEeeCCCc-ccchHHHhhcCCCcEEEEEcceeeEEcc
Q 001201          719 LEVVNDESE-NFRIGFLERFHNLEKLELRWSSYKEIFS  755 (1124)
Q Consensus       719 L~i~~c~~l-~~~~~~l~~l~~L~~L~i~c~~l~~l~~  755 (1124)
                      |++++|... .+| ..+.++++|+.|+++.+.+...++
T Consensus       552 L~Ls~N~l~~~~p-~~l~~l~~L~~l~ls~N~l~~~~p  588 (968)
T PLN00113        552 LDLSQNQLSGEIP-KNLGNVESLVQVNISHNHLHGSLP  588 (968)
T ss_pred             EECCCCcccccCC-hhHhcCcccCEEeccCCcceeeCC
Confidence            777777765 344 345567777777777545544333

>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG1603 consensus Copper chaperone [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PF00403 HMA: Heavy-metal-associated domain; InterPro: IPR006121 Proteins that transport heavy metals in micro-organisms and mammals share similarities in their sequences and structures Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG2608 CopZ Copper chaperone [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG4656 consensus Copper chaperone for superoxide dismutase [Inorganic ion transport and metabolism] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>PLN02957 copper, zinc superoxide dismutase Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>PRK10671 copA copper exporting ATPase; Provisional Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>COG2217 ZntA Cation transport ATPase [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>TIGR00003 copper ion binding protein Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0207 consensus Cation transport ATPase [Inorganic ion transport and metabolism] Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>PF02680 DUF211: Uncharacterized ArCR, COG1888; InterPro: IPR003831 This entry describes proteins of unknown function Back     alignment and domain information
>PRK10671 copA copper exporting ATPase; Provisional Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1124
1gwb_B281 Structure Of Glycoprotein 1b Length = 281 2e-06
1p8v_A279 Crystal Structure Of The Complex Of Platelet Recept 2e-06
1m10_B290 Crystal Structure Of The Complex Of Glycoprotein Ib 2e-06
1m0z_A290 Crystal Structure Of The Von Willebrand Factor Bind 2e-06
1u0n_D265 The Ternary Von Willebrand Factor A1-Glycoprotein I 3e-06
1sq0_B288 Crystal Structure Of The Complex Of The Wild-Type V 3e-06
3p72_A269 Structure Of Platelet Glycoprotein 1b Alpha With A 3e-06
>pdb|1GWB|B Chain B, Structure Of Glycoprotein 1b Length = 281 Back     alignment and structure 
Iteration: 1

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 44/149 (29%), Positives = 66/149 (44%), Gaps = 14/149 (9%)
Query: 161 LCLDRCALGDIAIIGNLKKLEILSLVDSNIEQLPEEMAQLTQLRLFDLSGCSKLKVIPPN 220
           L LDRC L  + + G L  L  L L  + ++ LP     L  L + D+S  ++L  +P  
Sbjct: 61  LNLDRCELTKLQVDGTLPVLGTLDLSHNQLQSLPLLGQTLPALTVLDVS-FNRLTSLPLG 119
Query: 221 LLSGLSRLEDLYMGNTSVKWEFEGL--------NVGRSNASLQELKL-----LSHLTTLE 267
            L GL  L++LY+    +K    GL         +  +N +L EL       L +L TL 
Sbjct: 120 ALRGLGELQELYLKGNELKTLPPGLLTPTPKLEKLSLANNNLTELPAGLLNGLENLDTLL 179
Query: 268 IQICDAMILPKGLFSKKLERYKIFIGDEW 296
           +Q      +PKG F   L  +    G+ W
Sbjct: 180 LQENSLYTIPKGFFGSHLLPFAFLHGNPW 208
>pdb|1P8V|A Chain A, Crystal Structure Of The Complex Of Platelet Receptor Gpib-alpha And Alpha-thrombin At 2.6a Length = 279 Back     alignment and structure
>pdb|1M10|B Chain B, Crystal Structure Of The Complex Of Glycoprotein Ib Alpha And The Von Willebrand Factor A1 Domain Length = 290 Back     alignment and structure
>pdb|1M0Z|A Chain A, Crystal Structure Of The Von Willebrand Factor Binding Domain Of Glycoprotein Ib Alpha Length = 290 Back     alignment and structure
>pdb|1U0N|D Chain D, The Ternary Von Willebrand Factor A1-Glycoprotein Ibalpha- Botrocetin Complex Length = 265 Back     alignment and structure
>pdb|1SQ0|B Chain B, Crystal Structure Of The Complex Of The Wild-Type Von Willebrand Factor A1 Domain And Glycoprotein Ib Alpha At 2.6 Angstrom Resolution Length = 288 Back     alignment and structure
>pdb|3P72|A Chain A, Structure Of Platelet Glycoprotein 1b Alpha With A Bound Peptide Inhibitor Length = 269 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1124
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 4e-17
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 4e-11
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-08
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 5e-16
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-12
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-11
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-09
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-06
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 7e-16
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 4e-12
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 1e-15
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 1e-12
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-10
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-15
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-05
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-15
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 4e-13
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 7e-12
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 4e-09
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 4e-05
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 1e-14
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 3e-14
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 1e-12
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-14
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 8e-12
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 4e-10
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 8e-09
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 4e-14
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 7e-13
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 1e-12
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 2e-04
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 4e-14
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 8e-14
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 9e-13
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 4e-12
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-11
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 5e-14
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 9e-12
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 8e-09
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-07
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 2e-13
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 2e-05
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 5e-13
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-12
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 6e-11
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-08
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-07
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 8e-13
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 6e-11
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-08
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-12
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 8e-12
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-11
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 9e-11
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-10
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-12
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-10
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 7e-09
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-07
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 3e-04
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-12
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-11
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-11
1o6v_A466 Internalin A; bacterial infection, extracellular r 3e-10
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-07
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-06
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-12
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-12
4fmz_A347 Internalin; leucine rich repeat, structural genomi 4e-12
4fmz_A347 Internalin; leucine rich repeat, structural genomi 9e-12
4fmz_A347 Internalin; leucine rich repeat, structural genomi 5e-11
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-05
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 2e-12
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 1e-09
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 5e-07
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-12
4ezg_A197 Putative uncharacterized protein; internalin-A, le 6e-11
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-08
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 4e-12
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 5e-12
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 2e-05
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 5e-12
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-10
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 3e-10
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 6e-12
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 3e-07
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 8e-12
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-11
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 1e-11
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 9e-11
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 8e-09
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-11
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-08
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-08
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-04
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 4e-11
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 8e-09
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-05
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 4e-11
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 1e-10
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 6e-09
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 4e-11
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-09
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 4e-09
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 4e-11
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 3e-10
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 1e-09
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 9e-08
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 4e-11
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 8e-09
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-07
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 6e-11
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 7e-11
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 1e-10
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 2e-10
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 3e-05
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-10
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 2e-10
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 2e-09
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 3e-07
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 4e-07
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-04
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-10
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-09
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-07
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 2e-10
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 3e-10
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 7e-09
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 3e-10
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 3e-08
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-06
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 4e-10
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 2e-09
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 4e-06
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 5e-10
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 4e-08
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 1e-07
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 9e-04
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 5e-10
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 3e-08
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 8e-08
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 3e-06
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 1e-05
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 3e-05
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 9e-10
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 1e-09
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 3e-04
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 2e-09
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 2e-06
1vt4_I1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-09
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-07
1vt4_I1221 APAF-1 related killer DARK; drosophila apoptosome, 7e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-04
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 7e-09
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 1e-08
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 2e-08
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 6e-08
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-08
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 4e-06
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-05
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-08
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 4e-08
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 2e-07
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 3e-06
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 3e-06
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 2e-04
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 4e-07
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 9e-06
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 5e-05
3m19_A251 Variable lymphocyte receptor A diversity region; a 4e-07
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 5e-07
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 1e-06
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 1e-06
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 2e-05
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 6e-05
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 7e-05
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 1e-04
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 4e-04
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 1e-04
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 4e-04
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
 Score = 86.0 bits (213), Expect = 4e-17
 Identities = 95/524 (18%), Positives = 169/524 (32%), Gaps = 103/524 (19%)

Query: 107 YPQLEFFCMSPRDHSIKIPNHVFAGMSNLRGLALSNMQFLSLP-SLFHLPLNLQTLCLDR 165
             QL+   +  +   + I    F  + NLR L L + +   L    F    +L  L L  
Sbjct: 47  LEQLQLLELGSQYTPLTIDKEAFRNLPNLRILDLGSSKIYFLHPDAFQGLFHLFELRLYF 106

Query: 166 CALGDIAI----IGNLKKLEILSLVDSNIEQLPEE--MAQLTQLRLFDLSGCSKLKVIPP 219
           C L D  +      NLK L  L L  + I  L       +L  L+  D S   ++ ++  
Sbjct: 107 CGLSDAVLKDGYFRNLKALTRLDLSKNQIRSLYLHPSFGKLNSLKSIDFSSN-QIFLVCE 165

Query: 220 NLLSGLS--RLEDLYMGNTSVK----WEFEGLNVGRSNASLQELKLLSHLTTLEIQICDA 273
           + L  L    L    +   S+      ++        N  L+ L +  +  T+       
Sbjct: 166 HELEPLQGKTLSFFSLAANSLYSRVSVDWGKCMNPFRNMVLEILDVSGNGWTV------- 218

Query: 274 MILPKGLFSKKLERYKIFIGDEWDWSGNYKNKRVLKLKLYTSNVDEV------IMQLKGI 327
                G FS  + + + F               ++       N+ +        +    +
Sbjct: 219 --DITGNFSNAISKSQAFSLIL--------AHHIMGAGFGFHNIKDPDQNTFAGLARSSV 268

Query: 328 EELYLDEVPGIKNVLYDLDIEGFLQLKHLHVQNNPFILFIVDSMAWVRYNAFLLLESLVL 387
             L L         ++ L+   F  LK L V N             + YN    +     
Sbjct: 269 RHLDLS-----HGFVFSLNSRVFETLKDLKVLN-------------LAYNKINKIADEAF 310

Query: 388 HNLIHLEKI-----CLGQLRAESFY---KLKIIKVRNCDKLKNIFSFSFVRGLPQLQTLN 439
           + L +L+ +      LG+L + +FY   K+  I ++    +  I   +F + L +LQTL+
Sbjct: 311 YGLDNLQVLNLSYNLLGELYSSNFYGLPKVAYIDLQKN-HIAIIQDQTF-KFLEKLQTLD 368

Query: 440 VINCKNMKEIFTVGRENDVDCHEVDKIEFSQLHSLTLKFLPQLTSFYSQVKTSAASQTRL 499
           + +   +  I  +    D+            L    L  LP++    + +     S+ RL
Sbjct: 369 LRDN-ALTTIHFIPSIPDIF-----------LSGNKLVTLPKINLTANLIHL---SENRL 413

Query: 500 KELSTHTLP------REVILEDECDTLMPFFNEKVVFPNLETLELCAISTEKIWCNQLAA 553
           + L            + +IL     +           P+LE L L          N L  
Sbjct: 414 ENLDILYFLLRVPHLQILILNQNRFSSCSGDQTPSENPSLEQLFLG--------ENMLQL 465

Query: 554 VYSQNLTRLIVHGCEKLKYL---------FPSSMIRNFVQLEHL 588
            +   L   +  G   L+ L          P  +  +   L  L
Sbjct: 466 AWETELCWDVFEGLSHLQVLYLNHNYLNSLPPGVFSHLTALRGL 509
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query1124
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 99.98
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.98
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.98
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.97
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.97
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.96
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.96
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.96
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.95
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.95
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.95
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.95
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.94
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.94
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.94
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.94
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.93
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.93
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.93
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.92
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.92
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.92
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.91
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.91
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.9
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.9
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.9
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.9
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.89
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 99.89
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 99.88
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.84
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.84
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.84
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.84
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.83
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.83
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.82
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.82
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.82
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.82
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.8
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.8
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.79
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.79
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.79
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.79
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.78
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.78
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.78
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.77
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.77
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.77
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.76
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.76
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.75
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.75
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.75
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.74
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.74
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.73
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.73
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.72
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.72
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.71
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.71
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.7
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.7
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.69
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.69
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.69
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.69
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.68
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 99.68
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.67
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 99.66
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.65
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.63
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.63
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.62
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 99.62
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.61
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.61
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.61
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.6
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.6
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.6
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.58
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.58
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.57
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.57
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.56
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.56
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.55
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.54
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.54
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.53
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 99.53
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.52
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.52
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 99.52
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.51
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.5
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.49
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 99.48
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.48
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.45
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.42
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.41
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.4
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.4
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.39
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.37
4b8c_D727 Glucose-repressible alcohol dehydrogenase transcr 99.35
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.35
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.34
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.34
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.33
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.32
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.29
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.28
4b8c_D727 Glucose-repressible alcohol dehydrogenase transcr 99.25
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.21
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.2
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.16
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.15
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.13
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.11
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.1
3iwl_A68 Copper transport protein ATOX1; beta-alpha-beta-BE 99.07
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.05
1cc8_A73 Protein (metallochaperone ATX1); copper transport, 98.96
2crl_A98 Copper chaperone for superoxide dismutase; SOD1, f 98.92
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 98.87
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 98.75
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 98.74
4a4j_A69 Pacszia, cation-transporting ATPase PACS; hydrolas 98.72
3dxs_X74 Copper-transporting ATPase RAN1; CXXC motif, ferre 98.71
4fdw_A401 Leucine rich hypothetical protein; putative cell s 98.69
4fdw_A401 Leucine rich hypothetical protein; putative cell s 98.68
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 98.68
3fry_A73 Probable copper-exporting P-type ATPase A; transpo 98.66
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 98.63
2xmw_A71 PACS-N, cation-transporting ATPase PACS; hydrolase 98.38
2roe_A66 Heavy metal binding protein; NMR {Thermus thermoph 98.37
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 98.35
2k2p_A85 Uncharacterized protein ATU1203; putative metal-bi 98.32
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 98.31
2xmm_A64 SSR2857 protein, ATX1; metal transport, copper hom 98.3
2l3m_A71 Copper-ION-binding protein; structural genomics, c 98.3
1qup_A 222 Superoxide dismutase 1 copper chaperone; two domai 98.3
1aw0_A72 Menkes copper-transporting ATPase; copper-binding 98.19
1y3j_A77 Copper-transporting ATPase 1; ferrodoxin-like fold 98.18
1mwy_A73 ZNTA; open-faced beta-sandwich fold, beta-alpha-be 98.17
1jk9_B 249 CCS, copper chaperone for superoxide dismutase; pr 98.16
1osd_A72 MERP, hypothetical protein MERP; mercury resistanc 98.15
3cjk_B75 Copper-transporting ATPase 1; HAH1, ATP7B, menkes 98.15
1yjr_A75 Copper-transporting ATPase 1; metallochaperone, pr 98.12
1kvi_A79 Copper-transporting ATPase 1; menkes, Cu-protein, 98.12
2g9o_A90 Copper-transporting ATPase 1; menkes disease, solu 98.11
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.1
2qif_A69 Copper chaperone COPZ; tetranuclear Cu(I) cluster; 98.08
1fvq_A72 Copper-transporting ATPase; APO-CCC2A, hydrolase; 98.08
2aj0_A71 Probable cadmium-transporting ATPase; ferrodoxin-l 98.05
1q8l_A84 Copper-transporting ATPase 1; metal binding protei 98.04
1cpz_A68 Protein (COPZ); copper chaperone, metal transport, 98.03
2ofg_X111 Zinc-transporting ATPase; ferredoxin-like fold, be 98.02
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.01
1yg0_A66 COP associated protein; open-faced beta-sandwich, 97.97
1opz_A76 Potential copper-transporting ATPase; mutation, fo 97.96
2kt2_A69 Mercuric reductase; nmera, MERA, HMA domain, mercu 97.95
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.94
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 97.93
2ldi_A71 Zinc-transporting ATPase; metal homeostasis, metal 97.92
4gt6_A394 Cell surface protein; leucine rich repeats, putati 97.92
2kkh_A95 Putative heavy metal transporter; zinc transport, 97.91
2kyz_A67 Heavy metal binding protein; structural genomics, 97.9
1jww_A80 Potential copper-transporting ATPase; beta-alpha-b 97.88
2a5y_B549 CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis 97.85
4gt6_A394 Cell surface protein; leucine rich repeats, putati 97.85
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 97.85
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 97.81
1p6t_A151 Potential copper-transporting ATPase; COPA, P-type 97.66
2ew9_A149 Copper-transporting ATPase 2; copper trafficking, 97.62
2ew9_A149 Copper-transporting ATPase 2; copper trafficking, 97.61
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.59
2rop_A202 Copper-transporting ATPase 2; wilson protein, mobi 97.54
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.49
1p6t_A151 Potential copper-transporting ATPase; COPA, P-type 96.82
2rop_A202 Copper-transporting ATPase 2; wilson protein, mobi 96.81
3j09_A 723 COPA, copper-exporting P-type ATPase A; copper tra 96.21
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 96.14
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 96.11
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 94.85
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 94.66
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 94.54
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 94.12
1vt4_I1221 APAF-1 related killer DARK; drosophila apoptosome, 90.57
3sfz_A1249 APAF-1, apoptotic peptidase activating factor 1; a 87.78
3bpd_A100 Uncharacterized protein; heptamer, Mg+2 ION, PSI-2 85.77
2x3d_A96 SSO6206; unknown function; 2.70A {Sulfolobus solfa 83.23
2raq_A97 Conserved protein MTH889; alpha-beta protein, stru 82.63
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
Probab=100.00  E-value=1.3e-40  Score=417.55  Aligned_cols=497  Identities=13%  Similarity=0.018  Sum_probs=270.2

Q ss_pred             ccccccceeeeccCCCeeEEeeCCcccccccccccceeecccccccccccccccCccccCCccEEEEccCCCcCcccchh
Q 001201          348 EGFLQLKHLHVQNNPFILFIVDSMAWVRYNAFLLLESLVLHNLIHLEKICLGQLRAESFYKLKIIKVRNCDKLKNIFSFS  427 (1124)
Q Consensus       348 ~~l~~L~~L~L~~~~~l~~l~~~~~~~~~~~~~~L~~L~l~~~~~l~~~~~~~~~~~~~~~L~~L~l~~C~~L~~l~~~~  427 (1124)
                      ..+++|++|++++|.....+       +...+++|++|+++++.-...+..  .....+++|++|++++|. ++...+ .
T Consensus       244 ~~l~~L~~L~Ls~n~l~~~~-------~~~~l~~L~~L~L~~n~l~~~ip~--~~~~~~~~L~~L~Ls~n~-l~~~~p-~  312 (768)
T 3rgz_A          244 STCTELKLLNISSNQFVGPI-------PPLPLKSLQYLSLAENKFTGEIPD--FLSGACDTLTGLDLSGNH-FYGAVP-P  312 (768)
T ss_dssp             TTCSSCCEEECCSSCCEESC-------CCCCCTTCCEEECCSSEEEESCCC--CSCTTCTTCSEEECCSSE-EEECCC-G
T ss_pred             hcCCCCCEEECCCCcccCcc-------CccccCCCCEEECcCCccCCccCH--HHHhhcCcCCEEECcCCc-CCCccc-h
Confidence            34555556666555422111       111455666666665431111110  111235889999999864 443333 3


Q ss_pred             hhhccCcccEEecccccccchhccccccCCcccCcccccccCccCEEeecCCCcccccccccccchhccc-ccceecccC
Q 001201          428 FVRGLPQLQTLNVINCKNMKEIFTVGRENDVDCHEVDKIEFSQLHSLTLKFLPQLTSFYSQVKTSAASQT-RLKELSTHT  506 (1124)
Q Consensus       428 ~~~~l~~L~~L~L~~c~~l~~i~~~~~~~~~~~~~~~~~~~~~L~~L~l~~~~~l~~~~~~~~~~~~~~~-~L~~L~l~~  506 (1124)
                      .+..+++|++|++++|.-...++..           ....+++|+.|+++++.-...++.    .+..++ +|+.|++++
T Consensus       313 ~~~~l~~L~~L~L~~n~l~~~ip~~-----------~l~~l~~L~~L~Ls~n~l~~~~p~----~l~~l~~~L~~L~Ls~  377 (768)
T 3rgz_A          313 FFGSCSLLESLALSSNNFSGELPMD-----------TLLKMRGLKVLDLSFNEFSGELPE----SLTNLSASLLTLDLSS  377 (768)
T ss_dssp             GGGGCTTCCEEECCSSEEEEECCHH-----------HHTTCTTCCEEECCSSEEEECCCT----THHHHTTTCSEEECCS
T ss_pred             HHhcCCCccEEECCCCcccCcCCHH-----------HHhcCCCCCEEeCcCCccCccccH----HHHhhhcCCcEEEccC
Confidence            4788899999999886433344310           134678888888888754334443    244454 778888877


Q ss_pred             CCcee-ecccccCcccccccccccccccceeeecccccccccccCcccccCCCccEEEEecCCCccccCcchhhhhccCC
Q 001201          507 LPREV-ILEDECDTLMPFFNEKVVFPNLETLELCAISTEKIWCNQLAAVYSQNLTRLIVHGCEKLKYLFPSSMIRNFVQL  585 (1124)
Q Consensus       507 ~~~l~-~~~~~~~~~~~~~~~~~~~~~L~~L~l~~~~l~~~~~~~~~~~~l~~L~~L~l~~C~~L~~l~~~~~~~~l~~L  585 (1124)
                      |.... ++..         .....+++|++|++++|.+....+..+.  .+++|+.|++++| .++...| ..+..+++|
T Consensus       378 N~l~~~~~~~---------~~~~~~~~L~~L~L~~n~l~~~~p~~l~--~l~~L~~L~Ls~N-~l~~~~p-~~l~~l~~L  444 (768)
T 3rgz_A          378 NNFSGPILPN---------LCQNPKNTLQELYLQNNGFTGKIPPTLS--NCSELVSLHLSFN-YLSGTIP-SSLGSLSKL  444 (768)
T ss_dssp             SEEEEECCTT---------TTCSTTCCCCEEECCSSEEEEECCGGGG--GCTTCCEEECCSS-EEESCCC-GGGGGCTTC
T ss_pred             CCcCCCcChh---------hhhcccCCccEEECCCCccccccCHHHh--cCCCCCEEECcCC-cccCccc-HHHhcCCCC
Confidence            74321 1100         0001256677777777776544443333  3677777777774 4544334 335667777


Q ss_pred             CEEEEeccccccceecccccccccceeecCccceeccccCcccceecCCCccCCCCcccEEEEecCCcceeecccccccc
Q 001201          586 EHLEICYCSSLESIVGKESGEEATTTFVFPKVTFLKLWNLSELKTFYPGTHTSKWPMLKKLEVYGCDKVKIFTSRFLRFQ  665 (1124)
Q Consensus       586 ~~L~l~~C~~l~~i~~~~~~~~~~~~~~~~~L~~L~L~~c~~L~~~~~~~~~~~l~~L~~L~i~~C~~L~~lp~~~~~~~  665 (1124)
                      +.|++++|.--..++....        .+++|+.|+++++.-...++...  ..+++|+.|++++|.--..+|...    
T Consensus       445 ~~L~L~~n~l~~~~p~~~~--------~l~~L~~L~L~~N~l~~~~p~~l--~~l~~L~~L~L~~N~l~~~~p~~~----  510 (768)
T 3rgz_A          445 RDLKLWLNMLEGEIPQELM--------YVKTLETLILDFNDLTGEIPSGL--SNCTNLNWISLSNNRLTGEIPKWI----  510 (768)
T ss_dssp             CEEECCSSCCCSCCCGGGG--------GCTTCCEEECCSSCCCSCCCGGG--GGCTTCCEEECCSSCCCSCCCGGG----
T ss_pred             CEEECCCCcccCcCCHHHc--------CCCCceEEEecCCcccCcCCHHH--hcCCCCCEEEccCCccCCcCChHH----
Confidence            7777777762223333211        45677777777765433333322  246677777777764333444221    


Q ss_pred             cccCCccccccccceeeeeeecCCceEEeeccccccccccccCCccccccccEEEEeeCCCc-ccchHHHhhcCCCcEEE
Q 001201          666 EINEGQFDIPTQQALFLVEKVTSKLEELKLSGKDIAMICQSQFPKHIFRNLKNLEVVNDESE-NFRIGFLERFHNLEKLE  744 (1124)
Q Consensus       666 ~~~~~~~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~~~~~~~~L~~L~i~~c~~l-~~~~~~l~~l~~L~~L~  744 (1124)
                                         ..+++|+.|++++|.+....+..+  ..+++|+.|++++|+.. .+|..... ...+..+.
T Consensus       511 -------------------~~l~~L~~L~L~~N~l~~~~p~~l--~~l~~L~~L~Ls~N~l~g~ip~~~~~-~~~~~~~~  568 (768)
T 3rgz_A          511 -------------------GRLENLAILKLSNNSFSGNIPAEL--GDCRSLIWLDLNTNLFNGTIPAAMFK-QSGKIAAN  568 (768)
T ss_dssp             -------------------GGCTTCCEEECCSSCCEEECCGGG--GGCTTCCEEECCSSEEESBCCGGGGT-TTTCBCCS
T ss_pred             -------------------hcCCCCCEEECCCCcccCcCCHHH--cCCCCCCEEECCCCccCCcCChHHhc-ccchhhhh
Confidence                               345667777777776654322222  34566666666666654 44443332 22222111


Q ss_pred             EE-cceeeEEccCh----------------hhhhhhhhccccceEeccCcccccccccCCCCcccccCcccEEEEeccCC
Q 001201          745 LR-WSSYKEIFSNE----------------EIVEHAEMLTQVKSLKLWELSDLMYIWKQDSKLDSITENLESLEVWWCEN  807 (1124)
Q Consensus       745 i~-c~~l~~l~~~~----------------~~~~~~~~l~~L~~L~l~~~~~L~~i~~~~~~~~~~l~~L~~L~i~~c~~  807 (1124)
                      +. +..+..+....                .....+..++.++.+.+.. .   .+.+..+.....+++|++|+++++.-
T Consensus       569 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~l~~-~---~~~g~~~~~~~~l~~L~~LdLs~N~l  644 (768)
T 3rgz_A          569 FIAGKRYVYIKNDGMKKECHGAGNLLEFQGIRSEQLNRLSTRNPCNITS-R---VYGGHTSPTFDNNGSMMFLDMSYNML  644 (768)
T ss_dssp             TTCSCEEEEEECCSCCTTCCSSEEEEECTTCCGGGGGGGGGTCCSCTTS-C---EEEEECCCSCSSSBCCCEEECCSSCC
T ss_pred             ccccccccccccccccccccccccccccccccchhhhcccccccccccc-c---eecccCchhhhccccccEEECcCCcc
Confidence            11 11111110000                0000111112222222211 0   01111122345678999999999876


Q ss_pred             cccccCCccccCCccEEEEcCCcCccccchhHHhhccCCccEEEEecccchhhhhccCcccccccccccccceeecccCC
Q 001201          808 LINLVPSSASFKNLTTLELWYCQRLMNLVTSSTAKSLVCLTKLRIDGCRMLTEIISKEEDVAEDEIVFSKLKWVSLERLE  887 (1124)
Q Consensus       808 l~~l~~~~~~~~~L~~L~i~~C~~L~~l~~~~~~~~l~~L~~L~i~~c~~l~~~~~~~~~~~~~~~~~~~L~~L~l~~~~  887 (1124)
                      -..+|..++.+++|+.|++++|.--..+|  ..+..+++|+.|+++++.--..++..       ...+++|+.|++++++
T Consensus       645 ~g~ip~~l~~l~~L~~L~Ls~N~l~g~ip--~~l~~L~~L~~LdLs~N~l~g~ip~~-------l~~l~~L~~L~ls~N~  715 (768)
T 3rgz_A          645 SGYIPKEIGSMPYLFILNLGHNDISGSIP--DEVGDLRGLNILDLSSNKLDGRIPQA-------MSALTMLTEIDLSNNN  715 (768)
T ss_dssp             BSCCCGGGGGCTTCCEEECCSSCCCSCCC--GGGGGCTTCCEEECCSSCCEECCCGG-------GGGCCCCSEEECCSSE
T ss_pred             cccCCHHHhccccCCEEeCcCCccCCCCC--hHHhCCCCCCEEECCCCcccCcCChH-------HhCCCCCCEEECcCCc
Confidence            66788889999999999999986444564  45678999999999998643333322       2258899999999988


Q ss_pred             CcccccCCCccccCCCccEEEEcccCCcccCCCCCcCCCCccEEEeccCCccccccC
Q 001201          888 NLTSFCSGNYTLKFPSLEDLFVIECPKMKIFSHRVLSTPRLREVRQNWGLYKGCWEG  944 (1124)
Q Consensus       888 ~L~~l~~~~~~~~~~sL~~L~i~~C~~l~~lp~~~~~~p~L~~~~~~~~~~~w~~~~  944 (1124)
                      --..+|.++   .+.++....+.++|.+.-.|.        . .|....+++|++++
T Consensus       716 l~g~iP~~~---~~~~~~~~~~~gN~~Lcg~~l--------~-~C~~~~~~~~~~~~  760 (768)
T 3rgz_A          716 LSGPIPEMG---QFETFPPAKFLNNPGLCGYPL--------P-RCDPSNADGYAHHQ  760 (768)
T ss_dssp             EEEECCSSS---SGGGSCGGGGCSCTEEESTTS--------C-CCCSCC--------
T ss_pred             ccccCCCch---hhccCCHHHhcCCchhcCCCC--------c-CCCCCccCCCCCCC
Confidence            777888765   344555556778888765442        2 36677899999994
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3iwl_A Copper transport protein ATOX1; beta-alpha-beta-BETA-alpha-beta, cisplatin, platinum, chaperone, ION transport, metal-binding, metal transport; HET: TCE; 1.60A {Homo sapiens} SCOP: d.58.17.1 PDB: 1fe4_A* 1fee_A* 1tl4_A 1tl5_A 2k1r_B 1fe0_A* 3iwx_A 3cjk_A Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>1cc8_A Protein (metallochaperone ATX1); copper transport, mercury coordination, metal transport; 1.02A {Saccharomyces cerevisiae} SCOP: d.58.17.1 PDB: 1cc7_A 1fd8_A 1fes_A 2ggp_A 3k7r_A Back     alignment and structure
>2crl_A Copper chaperone for superoxide dismutase; SOD1, familial ALS, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>4a4j_A Pacszia, cation-transporting ATPase PACS; hydrolase, copper homeostasis, zinc homeostasis, ATX1, metal-transporting atpases; 1.25A {Synechocystis} PDB: 4a48_A 2gcf_A 2xmw_A Back     alignment and structure
>3dxs_X Copper-transporting ATPase RAN1; CXXC motif, ferredoxin-like fold, ATP- binding, ethylene signaling pathway, hydrolase, ION transport; 1.70A {Arabidopsis thaliana} SCOP: d.58.17.0 Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3fry_A Probable copper-exporting P-type ATPase A; transport protein, metal binding domain, domain SWAP, ATP-BI cell membrane, copper transport; HET: CIT; 2.00A {Archaeoglobus fulgidus} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2xmw_A PACS-N, cation-transporting ATPase PACS; hydrolase, Cu(I)-binding, trafficking; 1.80A {Synechocystis SP} PDB: 2gcf_A Back     alignment and structure
>2roe_A Heavy metal binding protein; NMR {Thermus thermophilus} PDB: 2rog_A Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>2k2p_A Uncharacterized protein ATU1203; putative metal-binding domain ATU1203, ontario centre for ST proteomics, structural genomics; NMR {Agrobacterium tumefaciens str} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>2xmm_A SSR2857 protein, ATX1; metal transport, copper homeostasis, chaperone, P-type atpas; 1.65A {Synechocystis SP} PDB: 2xmv_A 1sb6_A 2xmj_A 2xmk_A 2xmt_A 2xmu_A Back     alignment and structure
>2l3m_A Copper-ION-binding protein; structural genomics, center for structural genomics of infec diseases, csgid, metal binding protein; NMR {Bacillus anthracis} Back     alignment and structure
>1qup_A Superoxide dismutase 1 copper chaperone; two domains, beta-alpha-beta-BETA-alpha-beta and beta barrel; 1.80A {Saccharomyces cerevisiae} SCOP: b.1.8.1 d.58.17.1 Back     alignment and structure
>1aw0_A Menkes copper-transporting ATPase; copper-binding domain, hydrolase; NMR {Homo sapiens} SCOP: d.58.17.1 PDB: 2aw0_A Back     alignment and structure
>1y3j_A Copper-transporting ATPase 1; ferrodoxin-like fold, beta-alpha-beta-BETA-alpha-beta structure, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 1y3k_A Back     alignment and structure
>1mwy_A ZNTA; open-faced beta-sandwich fold, beta-alpha-beta-BETA-alpha- beta, hydrolase; NMR {Escherichia coli} SCOP: d.58.17.1 PDB: 1mwz_A Back     alignment and structure
>1jk9_B CCS, copper chaperone for superoxide dismutase; protein-protein complex, heterodimer, metallochaperone, amyotrophic lateral sclerosis; 2.90A {Saccharomyces cerevisiae} SCOP: b.1.8.1 d.58.17.1 Back     alignment and structure
>1osd_A MERP, hypothetical protein MERP; mercury resistance, metal binding protein, perisplasm, structural genomics; 2.00A {Cupriavidus metallidurans} SCOP: d.58.17.1 PDB: 1afi_A 1afj_A 2hqi_A Back     alignment and structure
>3cjk_B Copper-transporting ATPase 1; HAH1, ATP7B, menkes disease, metal homeostasis, chaperone, ION transport, metal- binding, alternative splicing; 1.80A {Homo sapiens} PDB: 2k1r_A Back     alignment and structure
>1yjr_A Copper-transporting ATPase 1; metallochaperone, protein-protein interaction, copper(I), metal homeostasis, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 1yjt_A 1yju_A 1yjv_A Back     alignment and structure
>1kvi_A Copper-transporting ATPase 1; menkes, Cu-protein, hydrolase; NMR {Homo sapiens} SCOP: d.58.17.1 PDB: 1kvj_A Back     alignment and structure
>2g9o_A Copper-transporting ATPase 1; menkes disease, solution structure, structural genomics, structural proteomics in europe, spine, hydrolase; NMR {Homo sapiens} PDB: 2ga7_A Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>2qif_A Copper chaperone COPZ; tetranuclear Cu(I) cluster; 1.50A {Bacillus subtilis} SCOP: d.58.17.1 PDB: 3i9z_A 1k0v_A 1p8g_A Back     alignment and structure
>1fvq_A Copper-transporting ATPase; APO-CCC2A, hydrolase; NMR {Saccharomyces cerevisiae} SCOP: d.58.17.1 PDB: 1fvs_A 2ggp_B Back     alignment and structure
>2aj0_A Probable cadmium-transporting ATPase; ferrodoxin-like fold, beta-alpha-beta-BETA-alpha-beta, metal binding protein, hydrolase; NMR {Listeria monocytogenes} PDB: 2aj1_A Back     alignment and structure
>1q8l_A Copper-transporting ATPase 1; metal binding protein; NMR {Homo sapiens} SCOP: d.58.17.1 PDB: 1s6o_A 1s6u_A Back     alignment and structure
>1cpz_A Protein (COPZ); copper chaperone, metal transport, gene regulation; NMR {Enterococcus hirae} SCOP: d.58.17.1 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>1yg0_A COP associated protein; open-faced beta-sandwich, missing C-terminal beta-sheet, Met transport; NMR {Helicobacter pylori} Back     alignment and structure
>1opz_A Potential copper-transporting ATPase; mutation, folding, abbab fold, hydrolase; NMR {Bacillus subtilis} SCOP: d.58.17.1 PDB: 1oq3_A 1oq6_A Back     alignment and structure
>2kt2_A Mercuric reductase; nmera, MERA, HMA domain, mercuric resist metal-binding, oxidoreductase; NMR {Pseudomonas aeruginosa} PDB: 2kt3_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>2ldi_A Zinc-transporting ATPase; metal homeostasis, metallochaperones, hydrolase; NMR {Synechocystis SP} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>2kkh_A Putative heavy metal transporter; zinc transport, metal binding, metal selectivity, ferredoxin fold, ATP-binding, hydrolase; NMR {Arabidopsis thaliana} Back     alignment and structure
>2kyz_A Heavy metal binding protein; structural genomics, PSI-biology, protein structure initiative, joint for structural genomics, JCSG; NMR {Thermotoga maritima} Back     alignment and structure
>1jww_A Potential copper-transporting ATPase; beta-alpha-beta-BETA-alpha-beta, hydrolase; NMR {Bacillus subtilis} SCOP: d.58.17.1 PDB: 2voy_A 1kqk_A Back     alignment and structure
>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>1p6t_A Potential copper-transporting ATPase; COPA, P-type ATPase, water-soluble region, beta-alpha-beta- beta-alpha-beta fold; NMR {Bacillus subtilis} SCOP: d.58.17.1 d.58.17.1 PDB: 2rml_A Back     alignment and structure
>2ew9_A Copper-transporting ATPase 2; copper trafficking, ferrodoxin-like fold, structural genomics, structural proteomics in europe, spine, hydrolase; NMR {Homo sapiens} Back     alignment and structure
>2ew9_A Copper-transporting ATPase 2; copper trafficking, ferrodoxin-like fold, structural genomics, structural proteomics in europe, spine, hydrolase; NMR {Homo sapiens} Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>2rop_A Copper-transporting ATPase 2; wilson protein, mobility, protein-protein interaction, alternative splicing, ATP-binding, copper transport cytoplasm; NMR {Homo sapiens} Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>1p6t_A Potential copper-transporting ATPase; COPA, P-type ATPase, water-soluble region, beta-alpha-beta- beta-alpha-beta fold; NMR {Bacillus subtilis} SCOP: d.58.17.1 d.58.17.1 PDB: 2rml_A Back     alignment and structure
>2rop_A Copper-transporting ATPase 2; wilson protein, mobility, protein-protein interaction, alternative splicing, ATP-binding, copper transport cytoplasm; NMR {Homo sapiens} Back     alignment and structure
>3j09_A COPA, copper-exporting P-type ATPase A; copper transporter, adenosine triphosph archaeal proteins, cation transport proteins; 10.00A {Archaeoglobus fulgidus} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>3bpd_A Uncharacterized protein; heptamer, Mg+2 ION, PSI-2, NYSGXRC, structural genom protein structure initiative; 2.80A {Archaeoglobus fulgidus dsm 4304} SCOP: d.58.61.1 Back     alignment and structure
>2x3d_A SSO6206; unknown function; 2.70A {Sulfolobus solfataricus} Back     alignment and structure
>2raq_A Conserved protein MTH889; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; 3.11A {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: d.58.61.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 1124
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 1e-08
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 4e-08
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 9e-05
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 9e-05
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 3e-04
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 6e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 4e-04
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 4e-04
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 7e-04
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 0.001
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]

 Score = 56.2 bits (134), Expect = 1e-08
 Identities = 29/171 (16%), Positives = 60/171 (35%), Gaps = 28/171 (16%)

Query: 86  KNCPTIFLHDCKHWEVPEGLEYPQLEFFCMSPRDHSIKIPNHVFAGMSNLRGLALSNMQF 145
            N   + L+  +  ++        L    ++    S   P    +G++ L  L L   Q 
Sbjct: 219 TNLDELSLNGNQLKDIGTLASLTNLTDLDLANNQISNLAP---LSGLTKLTELKLGANQI 275

Query: 146 LSLPSLFHLPLN---------------------LQTLCLDRCALGDIAIIGNLKKLEILS 184
            ++  L  L                        L  L L    + DI+ + +L KL+ L 
Sbjct: 276 SNISPLAGLTALTNLELNENQLEDISPISNLKNLTYLTLYFNNISDISPVSSLTKLQRLF 335

Query: 185 LVDSNIEQLPEEMAQLTQLRLFDLSGCSKLKVIPPNLLSGLSRLEDLYMGN 235
             ++ +  +   +A LT +         ++  + P  L+ L+R+  L + +
Sbjct: 336 FANNKVSDVSS-LANLTNINWLSAGHN-QISDLTP--LANLTRITQLGLND 382
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query1124
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.81
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.79
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.73
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.7
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.7
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.69
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.67
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.64
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.63
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.62
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.62
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.62
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.59
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.58
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.58
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.56
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.56
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.48
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.42
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.4
d1fe0a_66 ATX1 metallochaperone protein (ATOX1) {Human (Homo 99.4
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.4
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.38
d1qupa272 Copper chaperone for superoxide dismutase, N-termi 99.38
d1cc8a_72 ATX1 metallochaperone protein (ATOX1) {Baker's yea 99.38
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.37
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.35
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.33
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.31
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.31
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.22
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.11
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.1
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.01
d1sb6a_64 Copper chaperone {Synechocystis sp. pcc 6803, Scat 99.0
d2aw0a_72 Menkes copper-transporting ATPase {Human (Homo sap 99.0
d2ggpb172 Copper transporter domain ccc2a {Baker's yeast (Sa 99.0
d1osda_72 Mercuric ion binding protein MerP {Ralstonia metal 98.97
d2qifa169 Copper chaperone {Bacillus subtilis, CopZ [TaxId: 98.97
d1kvja_79 Menkes copper-transporting ATPase {Human (Homo sap 98.92
d1cpza_68 Copper chaperone {Enterococcus hirae [TaxId: 1354] 98.9
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.86
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.83
d1p6ta172 Potential copper-translocating P-type ATPase CopA 98.77
d1p6ta279 Potential copper-translocating P-type ATPase CopA 98.76
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 98.75
d1q8la_84 Menkes copper-transporting ATPase {Human (Homo sap 98.74
d1mwza_73 Metal ion-transporting ATPase ZntA, N-terminal dom 98.71
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 98.67
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 98.46
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.69
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.29
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 96.77
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 96.74
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 95.89
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 95.85
d2raqa193 Uncharacterized protein MTH889 {Methanobacterium t 86.62
d3bpda191 Uncharacterized protein AF1549 {Archaeoglobus fulg 84.65
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]

Probab=99.81  E-value=2.6e-18  Score=194.89  Aligned_cols=340  Identities=20%  Similarity=0.231  Sum_probs=186.0

Q ss_pred             CCCCCcEEEeecCCCccCCcccCCCCCCcEEEccCCCCCCcccccCcccCcEEEccCCCCCccchhhhCCCCccEEEecC
Q 001201          131 GMSNLRGLALSNMQFLSLPSLFHLPLNLQTLCLDRCALGDIAIIGNLKKLEILSLVDSNIEQLPEEMAQLTQLRLFDLSG  210 (1124)
Q Consensus       131 ~l~~Lr~L~Ls~~~i~~lp~~i~~l~~Lr~L~L~~~~l~~l~~i~~L~~L~~L~Ls~~~i~~lp~~i~~L~~L~~L~L~~  210 (1124)
                      .+.+|++|+++++.|+.+ +.+..+++||+|+|++|.|+.+..++++++|++|++++|.+..++. ++.+++|++|++++
T Consensus        42 ~l~~l~~L~l~~~~I~~l-~gl~~L~nL~~L~Ls~N~l~~l~~l~~L~~L~~L~L~~n~i~~i~~-l~~l~~L~~L~~~~  119 (384)
T d2omza2          42 DLDQVTTLQADRLGIKSI-DGVEYLNNLTQINFSNNQLTDITPLKNLTKLVDILMNNNQIADITP-LANLTNLTGLTLFN  119 (384)
T ss_dssp             HHTTCCEEECCSSCCCCC-TTGGGCTTCCEEECCSSCCCCCGGGTTCTTCCEEECCSSCCCCCGG-GTTCTTCCEEECCS
T ss_pred             HhCCCCEEECCCCCCCCc-cccccCCCCCEEeCcCCcCCCCccccCCcccccccccccccccccc-cccccccccccccc
Confidence            455677777777777766 3566777777777777777777667777777777777777766653 66777777777766


Q ss_pred             CCCCCccCccccCCCCCccEEEeecccCccccccccccCCCcChhhhcCCCCCCEEEee--cCCCcccCccccccccceE
Q 001201          211 CSKLKVIPPNLLSGLSRLEDLYMGNTSVKWEFEGLNVGRSNASLQELKLLSHLTTLEIQ--ICDAMILPKGLFSKKLERY  288 (1124)
Q Consensus       211 ~~~l~~lp~~~i~~L~~L~~L~l~~~~i~~~~~~~~~~~~~~~~~~l~~l~~L~~L~l~--~~~~~~l~~~~~~~~L~~l  288 (1124)
                      +. +..++.  ......+..+....+.+..             ..........+.....  ......+            
T Consensus       120 ~~-~~~~~~--~~~~~~~~~~~~~~~~l~~-------------~~~~~~~~~~~~~~~~~~~~~~~~~------------  171 (384)
T d2omza2         120 NQ-ITDIDP--LKNLTNLNRLELSSNTISD-------------ISALSGLTSLQQLSFGNQVTDLKPL------------  171 (384)
T ss_dssp             SC-CCCCGG--GTTCTTCSEEEEEEEEECC-------------CGGGTTCTTCSEEEEEESCCCCGGG------------
T ss_pred             cc-cccccc--ccccccccccccccccccc-------------cccccccccccccccccccchhhhh------------
Confidence            65 555544  3445555666555554431             0111111111111111  1100000            


Q ss_pred             EEEeCCcccccCCCCCceEEEEeccccchhHHHHhhcccceeeccccCCccccccccccccccccceeeeccCCCeeEEe
Q 001201          289 KIFIGDEWDWSGNYKNKRVLKLKLYTSNVDEVIMQLKGIEELYLDEVPGIKNVLYDLDIEGFLQLKHLHVQNNPFILFIV  368 (1124)
Q Consensus       289 ~l~~~~~~~~~~~~~~l~~l~l~~~~~~l~~~~~~l~~L~~L~L~~~~~~~~~~~~~~~~~l~~L~~L~L~~~~~l~~l~  368 (1124)
                                 ...                      ..........+  .....  .....+++++.+.++++. +.   
T Consensus       172 -----------~~~----------------------~~~~~~~~~~~--~~~~~--~~~~~l~~~~~l~l~~n~-i~---  210 (384)
T d2omza2         172 -----------ANL----------------------TTLERLDISSN--KVSDI--SVLAKLTNLESLIATNNQ-IS---  210 (384)
T ss_dssp             -----------TTC----------------------TTCCEEECCSS--CCCCC--GGGGGCTTCSEEECCSSC-CC---
T ss_pred             -----------ccc----------------------ccccccccccc--ccccc--cccccccccceeeccCCc-cC---
Confidence                       000                      00000000000  00000  111344555555555553 11   


Q ss_pred             eCCcccccccccccceeecccccccccccccccCccccCCccEEEEccCCCcCcccchhhhhccCcccEEecccccccch
Q 001201          369 DSMAWVRYNAFLLLESLVLHNLIHLEKICLGQLRAESFYKLKIIKVRNCDKLKNIFSFSFVRGLPQLQTLNVINCKNMKE  448 (1124)
Q Consensus       369 ~~~~~~~~~~~~~L~~L~l~~~~~l~~~~~~~~~~~~~~~L~~L~l~~C~~L~~l~~~~~~~~l~~L~~L~L~~c~~l~~  448 (1124)
                         .......+++|+.|++.++ .++.+    .....+++|+.|++.+| .++.+++   +..+++|++|+++++ .+..
T Consensus       211 ---~~~~~~~~~~L~~L~l~~n-~l~~~----~~l~~l~~L~~L~l~~n-~l~~~~~---~~~~~~L~~L~l~~~-~l~~  277 (384)
T d2omza2         211 ---DITPLGILTNLDELSLNGN-QLKDI----GTLASLTNLTDLDLANN-QISNLAP---LSGLTKLTELKLGAN-QISN  277 (384)
T ss_dssp             ---CCGGGGGCTTCCEEECCSS-CCCCC----GGGGGCTTCSEEECCSS-CCCCCGG---GTTCTTCSEEECCSS-CCCC
T ss_pred             ---CCCcccccCCCCEEECCCC-CCCCc----chhhcccccchhccccC-ccCCCCc---ccccccCCEeeccCc-ccCC
Confidence               1122334455666666553 23322    11235667777777774 3555533   566777777777663 3333


Q ss_pred             hccccccCCcccCcccccccCccCEEeecCCCcccccccccccchhcccccceecccCCCceeecccccCcccccccccc
Q 001201          449 IFTVGRENDVDCHEVDKIEFSQLHSLTLKFLPQLTSFYSQVKTSAASQTRLKELSTHTLPREVILEDECDTLMPFFNEKV  528 (1124)
Q Consensus       449 i~~~~~~~~~~~~~~~~~~~~~L~~L~l~~~~~l~~~~~~~~~~~~~~~~L~~L~l~~~~~l~~~~~~~~~~~~~~~~~~  528 (1124)
                      +.             ....++.++.+.+.++. +..+.     .+..+++++.|+++++....+            ....
T Consensus       278 ~~-------------~~~~~~~l~~l~~~~n~-l~~~~-----~~~~~~~l~~L~ls~n~l~~l------------~~l~  326 (384)
T d2omza2         278 IS-------------PLAGLTALTNLELNENQ-LEDIS-----PISNLKNLTYLTLYFNNISDI------------SPVS  326 (384)
T ss_dssp             CG-------------GGTTCTTCSEEECCSSC-CSCCG-----GGGGCTTCSEEECCSSCCSCC------------GGGG
T ss_pred             CC-------------ccccccccccccccccc-ccccc-----ccchhcccCeEECCCCCCCCC------------cccc
Confidence            33             12345666666665542 22222     245667777777777642211            1234


Q ss_pred             cccccceeeecccccccccccCcccccCCCccEEEEecCCCccccCcchhhhhccCCCEEEEecc
Q 001201          529 VFPNLETLELCAISTEKIWCNQLAAVYSQNLTRLIVHGCEKLKYLFPSSMIRNFVQLEHLEICYC  593 (1124)
Q Consensus       529 ~~~~L~~L~l~~~~l~~~~~~~~~~~~l~~L~~L~l~~C~~L~~l~~~~~~~~l~~L~~L~l~~C  593 (1124)
                      .+++|++|++++|.++.+.  .+  ..+++|++|++++ ++++.+.|   +.++++|+.|+|+++
T Consensus       327 ~l~~L~~L~L~~n~l~~l~--~l--~~l~~L~~L~l~~-N~l~~l~~---l~~l~~L~~L~L~~N  383 (384)
T d2omza2         327 SLTKLQRLFFANNKVSDVS--SL--ANLTNINWLSAGH-NQISDLTP---LANLTRITQLGLNDQ  383 (384)
T ss_dssp             GCTTCCEEECCSSCCCCCG--GG--GGCTTCCEEECCS-SCCCBCGG---GTTCTTCSEEECCCE
T ss_pred             cCCCCCEEECCCCCCCCCh--hH--cCCCCCCEEECCC-CcCCCChh---hccCCCCCEeeCCCC
Confidence            6889999999999877653  23  2489999999987 57888744   678999999999875
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1fe0a_ d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX1) {Human (Homo sapiens), HAH1 [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1qupa2 d.58.17.1 (A:2-73) Copper chaperone for superoxide dismutase, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1cc8a_ d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sb6a_ d.58.17.1 (A:) Copper chaperone {Synechocystis sp. pcc 6803, Scatx1 [TaxId: 1148]} Back     information, alignment and structure
>d2aw0a_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ggpb1 d.58.17.1 (B:1-72) Copper transporter domain ccc2a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1osda_ d.58.17.1 (A:) Mercuric ion binding protein MerP {Ralstonia metallidurans CH34 [TaxId: 266264]} Back     information, alignment and structure
>d2qifa1 d.58.17.1 (A:1-69) Copper chaperone {Bacillus subtilis, CopZ [TaxId: 1423]} Back     information, alignment and structure
>d1kvja_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cpza_ d.58.17.1 (A:) Copper chaperone {Enterococcus hirae [TaxId: 1354]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p6ta1 d.58.17.1 (A:1-72) Potential copper-translocating P-type ATPase CopA (YvgX) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1p6ta2 d.58.17.1 (A:73-151) Potential copper-translocating P-type ATPase CopA (YvgX) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q8la_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mwza_ d.58.17.1 (A:) Metal ion-transporting ATPase ZntA, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2raqa1 d.58.61.1 (A:3-95) Uncharacterized protein MTH889 {Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d3bpda1 d.58.61.1 (A:1-91) Uncharacterized protein AF1549 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure