Citrus Sinensis ID: 001271
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
|
|
Close Homologs for Annotation Transfer
Close Homologs in SWISS-PROT Database Detected by BLAST 
Original result of BLAST against SWISS-PROT Database
| ID | Alignment graph | Length |
Definition |
RBH(Q2H) |
RBH(H2Q) |
Q cover |
H cover |
Identity |
E-value |
| Query | 1111 | 2.2.26 [Sep-21-2011] | |||||||
| Q6P4K6 | 1129 | Serine/threonine-protein | yes | no | 0.322 | 0.317 | 0.293 | 2e-25 | |
| Q8N1F8 | 1099 | Serine/threonine-protein | yes | no | 0.218 | 0.221 | 0.333 | 2e-21 | |
| Q5F479 | 1073 | Serine/threonine-protein | yes | no | 0.198 | 0.205 | 0.307 | 1e-20 | |
| Q6IRN0 | 1137 | Serine/threonine-protein | N/A | no | 0.309 | 0.302 | 0.291 | 4e-20 | |
| Q80TM9 | 1593 | Nischarin OS=Mus musculus | yes | no | 0.187 | 0.130 | 0.318 | 2e-19 | |
| Q3TAA7 | 1072 | Serine/threonine-protein | no | no | 0.287 | 0.297 | 0.300 | 5e-19 | |
| Q9Y2I1 | 1504 | Nischarin OS=Homo sapiens | no | no | 0.184 | 0.136 | 0.315 | 6e-19 | |
| Q4G017 | 1502 | Nischarin OS=Rattus norve | no | no | 0.184 | 0.136 | 0.310 | 2e-18 | |
| Q4LDG9 | 190 | Dynein light chain 1, axo | no | no | 0.101 | 0.594 | 0.371 | 6e-10 | |
| Q6DHB1 | 192 | Dynein light chain 1, axo | no | no | 0.101 | 0.588 | 0.380 | 7e-10 |
| >sp|Q6P4K6|S11IP_XENTR Serine/threonine-protein kinase 11-interacting protein OS=Xenopus tropicalis GN=stk11ip PE=2 SV=1 | Back alignment and function desciption |
|---|
Score = 119 bits (297), Expect = 2e-25, Method: Compositional matrix adjust.
Identities = 114/388 (29%), Positives = 191/388 (49%), Gaps = 30/388 (7%)
Query: 10 LEKLVKFVEQQAGPLIEGSIVLKLNPAGLHYVQSRLEALRELERLLAGAPLDYLRAYVSD 69
++ L + + + +++GS +L L L V R E+L P +A +
Sbjct: 10 VQALAQILHEHGDKVLDGSRILALLTPCLQVVT------RLFEQLFPRGPGTGFQALPAH 63
Query: 70 LGDHRALEQLRRILKLL---TSLKVVSALPPPARDPTP--LSLLPFCRLKVLELRGCDLS 124
D + + + +L +L SLK+V PA P +++ PF L+ LELR C L
Sbjct: 64 PADSVPILRAQFMLDMLQKTPSLKLVH----PAECPRQFDVNIFPFKSLRSLELR-C-LP 117
Query: 125 TSAAKGLLELRHTLEKIICHNSTNALRHVFASRIVEIKDSPQWNRLSFVSCSCNRLVIMD 184
+GL + LE + C+ ++L V A ++ + W L + S N L +D
Sbjct: 118 PHCLRGLRSVYSQLEVLTCYRCVSSLEEVIALCGGDLSSALPWLVLHTLDFSYNTLKNLD 177
Query: 185 ESLQLLPAVETLDLSRNKFAKVDNLRKCVN-LKHLDLGFNNLRSIAAFS-EVSCHIVKLV 242
SL+LL +++ LDLS N+ + + K ++ L++L+LG+N+L ++ S + + L+
Sbjct: 178 GSLELLNSLKILDLSHNQITECGSYLKVLSELQYLNLGYNHLTAVPELSVGNTAKLHSLI 237
Query: 243 LRNNALTTLRGIENLKSLEGLDISYNIISTFSELEFLASLPYLLNLWLEGNPLCCSRWYR 302
L++N L+ G+ENL +L+ LD+SYN++ S+L LA L L L+LEGNPL + YR
Sbjct: 238 LKHNQLSGTSGLENLPNLQHLDLSYNLLLEHSQLSGLARLHNLKQLFLEGNPLYFQKDYR 297
Query: 303 AQVFSYFAHPAKLKV--DGKEISTRELWERQLIIARRQKRPAGFGFYSPAKGNADGDGNA 360
A + +H A V DGK +S+ E+ Q + + +P+ S G+ +A
Sbjct: 298 ALTAQHLSHKASDNVLLDGKLLSSSEIMNAQAFGEKVRLQPSSSATESSCTGDLTDSYSA 357
Query: 361 NRK------RKKA---CRLASIESEEES 379
K RKK+ R ASI +S
Sbjct: 358 AEKSAPRLPRKKSRVKVRTASISERSDS 385
|
Xenopus tropicalis (taxid: 8364) |
| >sp|Q8N1F8|S11IP_HUMAN Serine/threonine-protein kinase 11-interacting protein OS=Homo sapiens GN=STK11IP PE=1 SV=3 | Back alignment and function description |
|---|
| >sp|Q5F479|S11IP_CHICK Serine/threonine-protein kinase 11-interacting protein OS=Gallus gallus GN=STK11IP PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q6IRN0|S11IP_XENLA Serine/threonine-protein kinase 11-interacting protein OS=Xenopus laevis GN=stk11ip PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q80TM9|NISCH_MOUSE Nischarin OS=Mus musculus GN=Nisch PE=1 SV=2 | Back alignment and function description |
|---|
| >sp|Q3TAA7|S11IP_MOUSE Serine/threonine-protein kinase 11-interacting protein OS=Mus musculus GN=Stk11ip PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|Q9Y2I1|NISCH_HUMAN Nischarin OS=Homo sapiens GN=NISCH PE=1 SV=3 | Back alignment and function description |
|---|
| >sp|Q4G017|NISCH_RAT Nischarin OS=Rattus norvegicus GN=Nisch PE=2 SV=2 | Back alignment and function description |
|---|
| >sp|Q4LDG9|DNAL1_HUMAN Dynein light chain 1, axonemal OS=Homo sapiens GN=DNAL1 PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|Q6DHB1|DNAL1_DANRE Dynein light chain 1, axonemal OS=Danio rerio GN=dnal1 PE=2 SV=1 | Back alignment and function description |
|---|
Close Homologs in the Non-Redundant Database Detected by BLAST
Original result of BLAST against Nonredundant Database
| GI | Alignment Graph | Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 1111 | ||||||
| 359491520 | 1089 | PREDICTED: uncharacterized protein LOC10 | 0.939 | 0.958 | 0.581 | 0.0 | |
| 356524698 | 1091 | PREDICTED: uncharacterized protein LOC10 | 0.953 | 0.970 | 0.540 | 0.0 | |
| 297734346 | 992 | unnamed protein product [Vitis vinifera] | 0.882 | 0.987 | 0.549 | 0.0 | |
| 449439162 | 1090 | PREDICTED: uncharacterized protein LOC10 | 0.951 | 0.969 | 0.534 | 0.0 | |
| 449527667 | 977 | PREDICTED: LOW QUALITY PROTEIN: uncharac | 0.840 | 0.955 | 0.542 | 0.0 | |
| 297847122 | 1066 | leucine-rich repeat family protein [Arab | 0.935 | 0.974 | 0.484 | 0.0 | |
| 42562612 | 1063 | Outer arm dynein light chain 1 protein [ | 0.936 | 0.979 | 0.478 | 0.0 | |
| 42571803 | 1051 | Outer arm dynein light chain 1 protein [ | 0.917 | 0.969 | 0.470 | 0.0 | |
| 297830430 | 1009 | hypothetical protein ARALYDRAFT_898146 [ | 0.879 | 0.968 | 0.474 | 0.0 | |
| 357521685 | 1238 | hypothetical protein MTR_8g107440 [Medic | 0.735 | 0.659 | 0.569 | 0.0 |
| >gi|359491520|ref|XP_002278916.2| PREDICTED: uncharacterized protein LOC100250985 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 1197 bits (3098), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 672/1156 (58%), Positives = 806/1156 (69%), Gaps = 112/1156 (9%)
Query: 1 MAIVTGDRYLEKLVKFVEQQAGPLIEGSIVLKLNPAGLHYVQSRLEALRELERLLAGAPL 60
MAIVTGDRYLE LVKFVE+QAGPLIEGS+VLKLNP GLHYVQSRLEAL ELE LLAGAP+
Sbjct: 1 MAIVTGDRYLESLVKFVEKQAGPLIEGSVVLKLNPVGLHYVQSRLEALHELESLLAGAPV 60
Query: 61 DYLRAYVSDLGDHRALEQLRRILKLLTSLKVVSALPPPARDPTPLSLLPFCRLKVLELRG 120
DYLRAY+SDLGDHRALEQLRRIL+LLTSLKVVS LPP RDPT LSLLPF RL+VLELRG
Sbjct: 61 DYLRAYISDLGDHRALEQLRRILRLLTSLKVVSVLPPSVRDPTRLSLLPFGRLRVLELRG 120
Query: 121 CDLSTSAAKGLLELRHTLEKIICHNSTNALRHVFASRIVEIKDSPQWNRLSFVSCSCNRL 180
CDLSTSAA+GLLELRHTLEKIICHNST+ALRH+FASRIV IKDSPQW RLSFVSC+CN L
Sbjct: 121 CDLSTSAARGLLELRHTLEKIICHNSTDALRHLFASRIVAIKDSPQWKRLSFVSCACNGL 180
Query: 181 VIMDESLQLLPAVETLDLSRNKFAKVDNLRKCVNLKHLDLGFNNLRSIAAFSEVSCHIVK 240
++MDESLQLLPAVETLDLSRNKF+KVDNLRKC LKHLDLGFN+LR+I++FSEVSCHIVK
Sbjct: 181 LLMDESLQLLPAVETLDLSRNKFSKVDNLRKCTKLKHLDLGFNHLRTISSFSEVSCHIVK 240
Query: 241 LVLRNNALTTLRGIENLKSLEGLDISYNIISTFSELEFLASLPYLLNLWLEGNPLCCSRW 300
LV+RNNALTTLRGIENLKSLE LD+SYN+IS FSE+E LA LP L LWLEGNP+CC+RW
Sbjct: 241 LVMRNNALTTLRGIENLKSLEDLDLSYNVISNFSEIEILAGLPSLRRLWLEGNPICCARW 300
Query: 301 YRAQVFSYFAHPAKLKVDGKEISTRELWERQLIIARRQKRPAGFGFYSPAKGNADGDGNA 360
YRAQVFS+FAHP K+K+D EISTRE W+RQ+IIA RQKRPA FGFY PA+ +A G+G
Sbjct: 301 YRAQVFSFFAHPDKVKLDEMEISTREFWKRQIIIASRQKRPASFGFYYPAREDA-GEGGI 359
Query: 361 NRKRKKACRLASIESEEESTCVGSDRESVSCDNEIESKEENVASDDDAEIIDLMSRVEHM 420
+ KRKK RLA IE+ E S + SD++SVSCDNE+ SKE+N SDD+AEI+DLM RVE M
Sbjct: 360 STKRKKLSRLACIET-EGSMYICSDQDSVSCDNEVRSKEDNAISDDEAEIVDLMKRVELM 418
Query: 421 KRERSILWLREFKEWMDHTSENFVDGSICSGATLMNCEEDNYIKNKRSQPHLAESSKYVS 480
K+ERS+LWLREFKEWMD S++F +G+ ++++ +NY++ K Q HL ESS+YVS
Sbjct: 419 KKERSVLWLREFKEWMDLASDSFAEGN--KYGSVLDSGTENYMRKKAGQRHLGESSRYVS 476
Query: 481 GSVQASGDESSTNILESENSYADMPTGLHAYQSFDHIGSLGITGGFSLPGIGRMELRQEN 540
SVQASGDES T+ILES NS+AD+ GL Q D G G
Sbjct: 477 DSVQASGDESGTDILESNNSFADISIGL-VPQYVDRSGESG------------------- 516
Query: 541 EKPYLHDGAGAATVQSKSFHQDTFTIQDRRMVENIHESPLTPIDDITDAFSSSARPGSPP 600
F ++D T +D I D S S PGSPP
Sbjct: 517 ---------------------SMFALRD------------TGVDAIQDQ-SKSYSPGSPP 542
Query: 601 HYREDILHRRHNLVAEILQLSAESYSVVSSDSKTSCSDDDFREYGPSMLEVDQSINPEHE 660
HY+ED+LHRRH LV +ILQLSAESYSV SSDS TS +D E S+ EV+QS+N E
Sbjct: 543 HYQEDLLHRRHILVEDILQLSAESYSVASSDSNTS-DSNDLCEVESSVSEVEQSVNEEIS 601
Query: 661 YSSAEVHSLLNLFEEDHNDQPHEIDCQRENCK--------------------------NN 694
S HSL F + +Q H+I REN + +N
Sbjct: 602 NRSVG-HSLTTFFGNIYYEQRHQIPLVRENGRYLLDSHAGQASATLKLLKPEQSLQLCSN 660
Query: 695 GFSAGGNDGEVDSSVNQEAHLLEKNKRKHTRRVISLLKEQNTVAKTEALQNLNGNLNISE 754
F AG +DGE+ S N+EA L+K K K R I + + N V + E Q L GN +
Sbjct: 661 DFCAGAHDGEIASLSNEEADWLDKKKCKRKPRKIVSVSQNNMVGRAEDSQTLVGNPDFCG 720
Query: 755 ADNVGEQGKHIFGLNYLLRTSDKKQTRENAVMTPYISGIGSVAKFL---SSVKEDFVEDY 811
D EQG+ IFG N+ D +QT +A +TP I G + L ++ +DF+++Y
Sbjct: 721 GDMEDEQGEQIFGWNFWDGFVDGEQTCASATITPLIDDAGRILSGLRGPTTGADDFIKNY 780
Query: 812 FNKNVADSKSHETCMQY--TVCWILEQDFMHRGREVAVLRSSENKFYVLLFGVTVDGTGS 869
FN N+ADS +ETC QY + C+ LE + + REVA+L SSE+K YVLL VT DG+G+
Sbjct: 781 FNLNIADSSVNETCKQYMRSSCF-LELESRYTEREVAILLSSEHKLYVLLVDVTFDGSGT 839
Query: 870 ILNLLGCHKIEDIREVLIGLGLQVLRVSTEMGATYLLMTRSIEKSRQLFCTLQIFYLVSA 929
IL LLGCH++ED+REVL+G+GLQV+RV E A Y+ +TRS+EKSRQL CTLQ+
Sbjct: 840 ILKLLGCHRLEDVREVLVGVGLQVVRVYIERDAAYMFLTRSMEKSRQLLCTLQVVDSNET 899
Query: 930 NDKCSLRSLEQVQVELFEKQICGGLKVGIFQYSMVLFW------------CSED--KESW 975
KCSLRSLEQVQVELFEK ICGG K+ IFQYS+VLFW C D E W
Sbjct: 900 CSKCSLRSLEQVQVELFEKHICGGSKISIFQYSLVLFWRNNIEGMFMHLHCGNDFSYELW 959
Query: 976 LSRSLFLIEGHVLVCIEDLMQFSSLSVDVFSPPYYLVDLCCSIDNVSEIVIDARETCCVS 1035
LSRSLF+I GH+LVCIED MQFS+LS+D S Y+ +D CCSI +VSE+VI+ARE+ CV+
Sbjct: 960 LSRSLFVIGGHLLVCIEDFMQFSALSIDASSSTYFSLDSCCSITDVSEMVIEARESQCVT 1019
Query: 1036 LAVQHSTSEFCPLVTAASGVTACKKVAAIRTKRTYIGSLKWKFKWFSEEDLFNFVALVKA 1095
LA+ +TSE CP K+ + ++T GSL WK KWFSEE LF FVAL KA
Sbjct: 1020 LALVRATSELCP------STNTDKEQVGLDKEKTASGSLTWKLKWFSEESLFKFVALFKA 1073
Query: 1096 MHAETTASPLQIRCVS 1111
+HA T SPL +RC+S
Sbjct: 1074 IHAGATMSPLPVRCIS 1089
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|356524698|ref|XP_003530965.1| PREDICTED: uncharacterized protein LOC100788364 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|297734346|emb|CBI15593.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|449439162|ref|XP_004137356.1| PREDICTED: uncharacterized protein LOC101203626 [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|449527667|ref|XP_004170831.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC101228525 [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|297847122|ref|XP_002891442.1| leucine-rich repeat family protein [Arabidopsis lyrata subsp. lyrata] gi|297337284|gb|EFH67701.1| leucine-rich repeat family protein [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|42562612|ref|NP_175287.2| Outer arm dynein light chain 1 protein [Arabidopsis thaliana] gi|332194190|gb|AEE32311.1| Outer arm dynein light chain 1 protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|42571803|ref|NP_973992.1| Outer arm dynein light chain 1 protein [Arabidopsis thaliana] gi|332194191|gb|AEE32312.1| Outer arm dynein light chain 1 protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|297830430|ref|XP_002883097.1| hypothetical protein ARALYDRAFT_898146 [Arabidopsis lyrata subsp. lyrata] gi|297328937|gb|EFH59356.1| hypothetical protein ARALYDRAFT_898146 [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|357521685|ref|XP_003631131.1| hypothetical protein MTR_8g107440 [Medicago truncatula] gi|355525153|gb|AET05607.1| hypothetical protein MTR_8g107440 [Medicago truncatula] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST
Original result of BLAST against Gene Ontology (AMIGO)
| ID |
Alignment graph |
Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 1111 | ||||||
| TAIR|locus:2198065 | 1063 | AT1G48540 [Arabidopsis thalian | 0.547 | 0.571 | 0.582 | 1.1e-246 | |
| TAIR|locus:2088525 | 1010 | AT3G17920 [Arabidopsis thalian | 0.431 | 0.474 | 0.675 | 7.6e-242 | |
| UNIPROTKB|Q5F479 | 1073 | STK11IP "Serine/threonine-prot | 0.217 | 0.225 | 0.306 | 4.8e-23 | |
| RGD|1305046 | 1072 | Stk11ip "serine/threonine kina | 0.223 | 0.231 | 0.329 | 2e-22 | |
| UNIPROTKB|F1ML95 | 1073 | STK11IP "Uncharacterized prote | 0.223 | 0.231 | 0.321 | 4e-22 | |
| ZFIN|ZDB-GENE-040426-1022 | 1160 | stk11ip "serine/threonine kina | 0.282 | 0.270 | 0.276 | 2.5e-21 | |
| MGI|MGI:1918978 | 1072 | Stk11ip "serine/threonine kina | 0.223 | 0.231 | 0.329 | 2.5e-21 | |
| UNIPROTKB|C9JQV3 | 1088 | STK11IP "Serine/threonine-prot | 0.218 | 0.223 | 0.333 | 4.2e-21 | |
| UNIPROTKB|Q8N1F8 | 1099 | STK11IP "Serine/threonine-prot | 0.218 | 0.221 | 0.333 | 4.4e-21 | |
| UNIPROTKB|F1P3Y6 | 1001 | F1P3Y6 "Uncharacterized protei | 0.198 | 0.220 | 0.307 | 6.5e-21 |
| TAIR|locus:2198065 AT1G48540 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 1806 (640.8 bits), Expect = 1.1e-246, Sum P(3) = 1.1e-246
Identities = 362/621 (58%), Positives = 455/621 (73%)
Query: 1 MAIVTGDRYLEKLVKFVEQQAGPLIEGSIVLKLNPAGLHYVQSXXXXXXXXXXXXXXXXX 60
MAIVTGDRY+EKL KF+E +A L+E +++LKLNPAGLHY+
Sbjct: 1 MAIVTGDRYVEKLQKFLEDEAESLLEETMILKLNPAGLHYLHLRLDSLRELERMLSNAPV 60
Query: 61 DYLRAYVSDLGDHRALEQLRRILKLLTSLKVVSALPPPARDPTPLSLLPFCRLKVLELRG 120
DYLRAYVSDLGD+RALEQLRRIL++LTSLKVVS LP PARDPTPLSL PF LKVLELR
Sbjct: 61 DYLRAYVSDLGDYRALEQLRRILRILTSLKVVSTLPSPARDPTPLSLFPFGSLKVLELRR 120
Query: 121 CDLSTSAAKGLLELRHTLEKIICHNSTNALRHVFASRIVEIKDSPQWNRLSFVSCSCNRL 180
CDLSTS AKGL+ELRHTLEKIICHNST+ALRHVFASRI EI +SP+WN+L+ +SC+CNRL
Sbjct: 121 CDLSTSPAKGLIELRHTLEKIICHNSTDALRHVFASRIAEITNSPEWNKLAVISCACNRL 180
Query: 181 VIMDESLQLLPAVETLDLSRNKFAKVDNLRKCVNLKHLDLGFNNLRSIAAFSEVSCHIVK 240
V+MDESLQLLPA E+LDLSRNKF KVDNLR+C LKHLDLGFN+LR+++ S+VSCH+VK
Sbjct: 181 VLMDESLQLLPAAESLDLSRNKFVKVDNLRRCTKLKHLDLGFNHLRTVSYLSQVSCHLVK 240
Query: 241 LVLRNNALTTLRGIENLKSLEGLDISYNIISTFSELEFLASLPYLLNLWLEGNPLCCSRW 300
LVLRNNALTTLRGIENLKSL+GLD+SYNIIS FSELEFL SL L LWLEGNP+CC+RW
Sbjct: 241 LVLRNNALTTLRGIENLKSLQGLDVSYNIISNFSELEFLWSLSQLKELWLEGNPVCCARW 300
Query: 301 YRAQVFSYFAHPAKLKVDGKEISTRELWERQLIIARRQKRPAGFGFYSPAKGNADGDGNA 360
YRA VFSY A P +LK+DGK+I TRE W+RQ+I+A RQ PA +GFYSPA+ + +G+
Sbjct: 301 YRAHVFSYVALPDELKLDGKQIGTREFWKRQIIVAHRQSEPASYGFYSPAREEDNEEGSC 360
Query: 361 NRKRKKACRLASIESEEESTCVGSDRESVSCDNEIESKEENVASDDDAEIIDLMSRVEHM 420
NRK+KK CRLASI SE EST V SD ES +CD+E +EN+ + +A+I L+S+VEH+
Sbjct: 361 NRKKKKICRLASIHSEAESTYVNSDHESATCDHE---NKENMKFNQEADIFGLISKVEHL 417
Query: 421 KRERSILWLREFKEWMDHTSENFVDGSICSGATLMNCEEDNYIKNKR-SQPHLAESSKYV 479
K+ERS+LWLREFKEWMD ++E+F D +C + +N E+ Y K + S+ H + +Y
Sbjct: 418 KKERSVLWLREFKEWMDRSTEDFAD--VCKDSQGINLEKKYYTKIREISRHHGGGTPRYT 475
Query: 480 SGSVQASGDESSTNILESENSYADMPTGLHAYQSFDHIGSLGITGGFSLPGIGRMELRQE 539
SGS++AS +S LE S D G+ + + + IT S + + Q+
Sbjct: 476 SGSLRASRAKSYRKNLECNGSCVDHKAGMDYMKYVEGNETQKITDDISSISLQSTDRNQK 535
Query: 540 NEKPYLHDGAGAATVQSKSFHQDTFTIQDRRMVENIHESPLTPIDDITDAFSSSARPGSP 599
+++ +HD + +V+ T + ++ EN + S L DIT + S PGSP
Sbjct: 536 HQE-CVHDEMESLSVEPNDLLPTT--LAKEKLAENGNMSTL----DITQHMTGSTYPGSP 588
Query: 600 PHYREDILHRRHNLVAEILQL 620
PHY++D+L+RRHNLV EILQL
Sbjct: 589 PHYQKDVLYRRHNLVEEILQL 609
|
|
| TAIR|locus:2088525 AT3G17920 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q5F479 STK11IP "Serine/threonine-protein kinase 11-interacting protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| RGD|1305046 Stk11ip "serine/threonine kinase 11 interacting protein" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1ML95 STK11IP "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-040426-1022 stk11ip "serine/threonine kinase 11 interacting protein" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1918978 Stk11ip "serine/threonine kinase 11 interacting protein" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|C9JQV3 STK11IP "Serine/threonine-protein kinase 11-interacting protein" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q8N1F8 STK11IP "Serine/threonine-protein kinase 11-interacting protein" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1P3Y6 F1P3Y6 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Annotation Transfer from SWISS-PROT Entries
Original result of BLAST against SWISS-PROT
No confident hit for EC number transfering in SWISSPROT detected by BLAST
EC Number Prediction by Ezypred Server
Original result from Ezypred Server
Fail to connect to Ezypred Server
EC Number Prediction by EFICAz Software
No EC number assignment, probably not an enzyme!
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST
Original result of RPS-BLAST against CDD database part I
| ID | Alignment Graph | Length |
Definition |
E-value |
| Query | 1111 | |||
| COG4886 | 394 | COG4886, COG4886, Leucine-rich repeat (LRR) protei | 3e-08 | |
| pfam12799 | 43 | pfam12799, LRR_4, Leucine Rich repeats (2 copies) | 5e-06 | |
| pfam12799 | 43 | pfam12799, LRR_4, Leucine Rich repeats (2 copies) | 6e-05 | |
| cd00116 | 319 | cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo | 1e-04 | |
| cd00116 | 319 | cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo | 1e-04 | |
| pfam13855 | 60 | pfam13855, LRR_8, Leucine rich repeat | 4e-04 | |
| pfam13855 | 60 | pfam13855, LRR_8, Leucine rich repeat | 7e-04 | |
| pfam13855 | 60 | pfam13855, LRR_8, Leucine rich repeat | 8e-04 | |
| pfam13855 | 60 | pfam13855, LRR_8, Leucine rich repeat | 0.001 |
| >gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] | Back alignment and domain information |
|---|
Score = 56.9 bits (137), Expect = 3e-08
Identities = 60/207 (28%), Positives = 87/207 (42%), Gaps = 18/207 (8%)
Query: 102 PTPLSLLPFCRLKVLELRGCDLST-----SAAKGLLELRH---TLEKIICHNST-NALRH 152
P+PL LP LK L+L DLS S L L + + +AL
Sbjct: 156 PSPLRNLPN--LKNLDLSFNDLSDLPKLLSNLSNLNNLDLSGNKISDLPPEIELLSALEE 213
Query: 153 VFASR---IVEIKDSPQWNRLSFVSCSCNRLVIMDESLQLLPAVETLDLSRNKFAKVDNL 209
+ S I + LS + S N+L + ES+ L +ETLDLS N+ + + +L
Sbjct: 214 LDLSNNSIIELLSSLSNLKNLSGLELSNNKLEDLPESIGNLSNLETLDLSNNQISSISSL 273
Query: 210 RKCVNLKHLDLGFNNLRSIAAFSEVSCHIVKLVLRNNALTTLR-GIENLKSLEGLDISYN 268
NL+ LDL N+L S A ++ +L N LT ++ L +I N
Sbjct: 274 GSLTNLRELDLSGNSL-SNALPLIALLLLLLELLLNLLLTLKALELKLNSILLNNNILSN 332
Query: 269 IISTFSELEFLASLPYLLNLWLEGNPL 295
++ E L+ L L NLW N L
Sbjct: 333 GETSSPEA--LSILESLNNLWTLDNAL 357
|
Length = 394 |
| >gnl|CDD|205079 pfam12799, LRR_4, Leucine Rich repeats (2 copies) | Back alignment and domain information |
|---|
| >gnl|CDD|205079 pfam12799, LRR_4, Leucine Rich repeats (2 copies) | Back alignment and domain information |
|---|
| >gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily | Back alignment and domain information |
|---|
| >gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily | Back alignment and domain information |
|---|
| >gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat | Back alignment and domain information |
|---|
| >gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat | Back alignment and domain information |
|---|
| >gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat | Back alignment and domain information |
|---|
| >gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch
Original result of HHsearch against CDD database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 1111 | |||
| KOG1859 | 1096 | consensus Leucine-rich repeat proteins [General fu | 100.0 | |
| KOG4194 | 873 | consensus Membrane glycoprotein LIG-1 [Signal tran | 99.87 | |
| KOG0444 | 1255 | consensus Cytoskeletal regulator Flightless-I (con | 99.85 | |
| KOG4194 | 873 | consensus Membrane glycoprotein LIG-1 [Signal tran | 99.84 | |
| PLN00113 | 968 | leucine-rich repeat receptor-like protein kinase; | 99.84 | |
| PLN00113 | 968 | leucine-rich repeat receptor-like protein kinase; | 99.84 | |
| KOG0444 | 1255 | consensus Cytoskeletal regulator Flightless-I (con | 99.79 | |
| KOG0472 | 565 | consensus Leucine-rich repeat protein [Function un | 99.75 | |
| KOG0472 | 565 | consensus Leucine-rich repeat protein [Function un | 99.75 | |
| PRK15370 | 754 | E3 ubiquitin-protein ligase SlrP; Provisional | 99.69 | |
| PRK15387 | 788 | E3 ubiquitin-protein ligase SspH2; Provisional | 99.67 | |
| PRK15387 | 788 | E3 ubiquitin-protein ligase SspH2; Provisional | 99.66 | |
| KOG1259 | 490 | consensus Nischarin, modulator of integrin alpha5 | 99.66 | |
| KOG0618 | 1081 | consensus Serine/threonine phosphatase 2C containi | 99.65 | |
| KOG0618 | 1081 | consensus Serine/threonine phosphatase 2C containi | 99.61 | |
| PRK15370 | 754 | E3 ubiquitin-protein ligase SlrP; Provisional | 99.55 | |
| PF14580 | 175 | LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ | 99.55 | |
| PLN03210 | 1153 | Resistant to P. syringae 6; Provisional | 99.54 | |
| KOG4237 | 498 | consensus Extracellular matrix protein slit, conta | 99.54 | |
| KOG4237 | 498 | consensus Extracellular matrix protein slit, conta | 99.53 | |
| cd00116 | 319 | LRR_RI Leucine-rich repeats (LRRs), ribonuclease i | 99.53 | |
| cd00116 | 319 | LRR_RI Leucine-rich repeats (LRRs), ribonuclease i | 99.51 | |
| PLN03210 | 1153 | Resistant to P. syringae 6; Provisional | 99.5 | |
| KOG0617 | 264 | consensus Ras suppressor protein (contains leucine | 99.44 | |
| KOG0617 | 264 | consensus Ras suppressor protein (contains leucine | 99.44 | |
| KOG3207 | 505 | consensus Beta-tubulin folding cofactor E [Posttra | 99.42 | |
| KOG0532 | 722 | consensus Leucine-rich repeat (LRR) protein, conta | 99.42 | |
| PF14580 | 175 | LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ | 99.15 | |
| KOG2982 | 418 | consensus Uncharacterized conserved protein [Funct | 99.13 | |
| COG4886 | 394 | Leucine-rich repeat (LRR) protein [Function unknow | 99.04 | |
| KOG0532 | 722 | consensus Leucine-rich repeat (LRR) protein, conta | 99.04 | |
| COG4886 | 394 | Leucine-rich repeat (LRR) protein [Function unknow | 99.01 | |
| KOG0531 | 414 | consensus Protein phosphatase 1, regulatory subuni | 98.96 | |
| KOG1909 | 382 | consensus Ran GTPase-activating protein [RNA proce | 98.89 | |
| KOG0531 | 414 | consensus Protein phosphatase 1, regulatory subuni | 98.84 | |
| KOG3207 | 505 | consensus Beta-tubulin folding cofactor E [Posttra | 98.81 | |
| KOG1909 | 382 | consensus Ran GTPase-activating protein [RNA proce | 98.8 | |
| KOG1259 | 490 | consensus Nischarin, modulator of integrin alpha5 | 98.8 | |
| KOG1644 | 233 | consensus U2-associated snRNP A' protein [RNA proc | 98.61 | |
| KOG1859 | 1096 | consensus Leucine-rich repeat proteins [General fu | 98.34 | |
| PLN03150 | 623 | hypothetical protein; Provisional | 98.32 | |
| PLN03150 | 623 | hypothetical protein; Provisional | 98.31 | |
| PF13855 | 61 | LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF | 98.16 | |
| PF13855 | 61 | LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF | 98.14 | |
| COG5238 | 388 | RNA1 Ran GTPase-activating protein (RanGAP) involv | 98.08 | |
| KOG2123 | 388 | consensus Uncharacterized conserved protein [Funct | 98.07 | |
| KOG2982 | 418 | consensus Uncharacterized conserved protein [Funct | 98.02 | |
| KOG4658 | 889 | consensus Apoptotic ATPase [Signal transduction me | 97.91 | |
| KOG4658 | 889 | consensus Apoptotic ATPase [Signal transduction me | 97.81 | |
| COG5238 | 388 | RNA1 Ran GTPase-activating protein (RanGAP) involv | 97.78 | |
| KOG1644 | 233 | consensus U2-associated snRNP A' protein [RNA proc | 97.54 | |
| PF12799 | 44 | LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ | 97.54 | |
| KOG4579 | 177 | consensus Leucine-rich repeat (LRR) protein associ | 97.51 | |
| KOG2739 | 260 | consensus Leucine-rich acidic nuclear protein [Cel | 97.51 | |
| KOG4579 | 177 | consensus Leucine-rich repeat (LRR) protein associ | 97.5 | |
| KOG2120 | 419 | consensus SCF ubiquitin ligase, Skp2 component [Po | 97.47 | |
| PF12799 | 44 | LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ | 97.28 | |
| KOG3665 | 699 | consensus ZYG-1-like serine/threonine protein kina | 97.2 | |
| PRK15386 | 426 | type III secretion protein GogB; Provisional | 97.19 | |
| PRK15386 | 426 | type III secretion protein GogB; Provisional | 97.0 | |
| KOG2120 | 419 | consensus SCF ubiquitin ligase, Skp2 component [Po | 96.94 | |
| KOG2123 | 388 | consensus Uncharacterized conserved protein [Funct | 96.72 | |
| KOG3665 | 699 | consensus ZYG-1-like serine/threonine protein kina | 96.68 | |
| KOG2739 | 260 | consensus Leucine-rich acidic nuclear protein [Cel | 96.25 | |
| PF13306 | 129 | LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ | 95.54 | |
| KOG3763 | 585 | consensus mRNA export factor TAP/MEX67 [RNA proces | 95.22 | |
| PF13306 | 129 | LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ | 93.69 | |
| KOG4308 | 478 | consensus LRR-containing protein [Function unknown | 93.65 | |
| KOG4308 | 478 | consensus LRR-containing protein [Function unknown | 92.72 | |
| KOG1947 | 482 | consensus Leucine rich repeat proteins, some prote | 92.34 | |
| PF00560 | 22 | LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le | 87.88 | |
| KOG4341 | 483 | consensus F-box protein containing LRR [General fu | 87.59 | |
| KOG0473 | 326 | consensus Leucine-rich repeat protein [Function un | 85.2 | |
| KOG4341 | 483 | consensus F-box protein containing LRR [General fu | 82.84 | |
| PF00560 | 22 | LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le | 82.09 |
| >KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] | Back alignment and domain information |
|---|
Probab=100.00 E-value=2.7e-94 Score=833.49 Aligned_cols=1012 Identities=39% Similarity=0.537 Sum_probs=838.5
Q ss_pred ccchhHHHHHHHHhhcCCccccCCcEEEec-CCCccchHHhhhhcccchhhccCCCccccccccccCCCCCcchhHHHHh
Q 001271 5 TGDRYLEKLVKFVEQQAGPLIEGSIVLKLN-PAGLHYVQSRLEALRELERLLAGAPLDYLRAYVSDLGDHRALEQLRRIL 83 (1111)
Q Consensus 5 ~gd~yl~~li~~L~~~~~slL~~lk~L~Ls-~~~L~~Lp~~L~~L~~Le~L~~~~~l~~Lrl~vLdLs~n~~L~~Lp~~L 83 (1111)
+||+|+.++..+|..+++.++.+..+|.|+ +..++....+|..++.|+.-..+.+.++|++.+.+.++.+.+.++...+
T Consensus 1 ~~d~~l~kLa~lLre~gD~lLsg~~tL~L~~p~l~~lnh~~l~s~~EL~lg~~g~~~~~f~a~~s~~ads~vl~qLq~i~ 80 (1096)
T KOG1859|consen 1 TGDRYLEKLANLLRENGDKLLSGTFTLKLNGPALLHLNHLRLISLRELELGLSGAPVDYFRAYVSDNADSRVLEQLQRIL 80 (1096)
T ss_pred CccHHHHHHHHHHHhcccceecceeEEEeccHHHHHHHHHHHHhhHHHhhccCCCCCceeEEecCCcccchHHHHHHHHH
Confidence 589999999999999999999999999999 6666666777888899998888999999999999999999999998888
Q ss_pred cCCCCCcEEEccCCCCCCCC-CccCCCCCCCCEEEeeCCCCCccchhhHhhhhhhhhhhhccCCCccchhhhcccccccc
Q 001271 84 KLLTSLKVVSALPPPARDPT-PLSLLPFCRLKVLELRGCDLSTSAAKGLLELRHTLEKIICHNSTNALRHVFASRIVEIK 162 (1111)
Q Consensus 84 ~~L~nLk~LdLs~N~Is~~i-P~sLs~L~nL~~LdLS~N~Ls~~~P~~L~~L~~LleLlLs~N~L~sL~~l~~~~I~~L~ 162 (1111)
.-+++++.|.+-.-.-.+.. |-.+..|..|++|.|.+++|.. ..++..+.+.++.++++|.+.++++++...+.++.
T Consensus 81 d~lqkt~~lkl~~~pa~~pt~pi~ifpF~sLr~LElrg~~L~~--~~GL~~lr~qLe~LIC~~Sl~Al~~v~ascggd~~ 158 (1096)
T KOG1859|consen 81 DFLQKTKVLKLLPSPARDPTEPISIFPFRSLRVLELRGCDLST--AKGLQELRHQLEKLICHNSLDALRHVFASCGGDIS 158 (1096)
T ss_pred HHHhhheeeeecccCCCCCCCCceeccccceeeEEecCcchhh--hhhhHHHHHhhhhhhhhccHHHHHHHHHHhccccc
Confidence 88899999888776665555 8889999999999999999976 67899999999999999999999999999999999
Q ss_pred CCCCCCCccEEEccCCccccchhhhcCCCCCcEEEccCCCCCCCCCcCCCCCCcEEECCCCCCCCccccccccccceEee
Q 001271 163 DSPQWNRLSFVSCSCNRLVIMDESLQLLPAVETLDLSRNKFAKVDNLRKCVNLKHLDLGFNNLRSIAAFSEVSCHIVKLV 242 (1111)
Q Consensus 163 ~l~~L~~L~~L~Ls~N~LssLP~~L~~L~nL~~LdLS~N~Ls~L~~L~~L~sL~~LdLS~N~Lt~L~~l~~~L~sL~~L~ 242 (1111)
+.+.|..|...++++|.|..++.++.-++.|+.|+|++|+++.+..+..|+.|++|||++|.++.++.+...-..|..|+
T Consensus 159 ns~~Wn~L~~a~fsyN~L~~mD~SLqll~ale~LnLshNk~~~v~~Lr~l~~LkhLDlsyN~L~~vp~l~~~gc~L~~L~ 238 (1096)
T KOG1859|consen 159 NSPVWNKLATASFSYNRLVLMDESLQLLPALESLNLSHNKFTKVDNLRRLPKLKHLDLSYNCLRHVPQLSMVGCKLQLLN 238 (1096)
T ss_pred cchhhhhHhhhhcchhhHHhHHHHHHHHHHhhhhccchhhhhhhHHHHhcccccccccccchhccccccchhhhhheeee
Confidence 99999999999999999999999999999999999999999999999999999999999999999998776656799999
Q ss_pred ccCCccCCcccCCCCCCCCEEEccCCCCCCCchhhhhcCCCCCcEEEecCCCCCCCccchhhHhhhcC---CCCeeecCC
Q 001271 243 LRNNALTTLRGIENLKSLEGLDISYNIISTFSELEFLASLPYLLNLWLEGNPLCCSRWYRAQVFSYFA---HPAKLKVDG 319 (1111)
Q Consensus 243 LS~N~Lt~L~~L~~L~sL~~LdLS~N~Is~l~~l~~L~~L~~L~~L~LsgNpLs~~~~~r~~if~~l~---~L~~L~Ldg 319 (1111)
|++|.++.+.++.++.+|+.|||++|-|.+...+..+..+..|+.|+|.|||++|.+++|...+.++. .+..+.|||
T Consensus 239 lrnN~l~tL~gie~LksL~~LDlsyNll~~hseL~pLwsLs~L~~L~LeGNPl~c~p~hRaataqYl~~~~a~~~f~LDg 318 (1096)
T KOG1859|consen 239 LRNNALTTLRGIENLKSLYGLDLSYNLLSEHSELEPLWSLSSLIVLWLEGNPLCCAPWHRAATAQYLHKNSAPVKFKLDG 318 (1096)
T ss_pred ecccHHHhhhhHHhhhhhhccchhHhhhhcchhhhHHHHHHHHHHHhhcCCccccCHHHHHHHHhHhccccCCcceEecc
Confidence 99999999999999999999999999999988888899999999999999999999999999998887 788899999
Q ss_pred CcCChhHHHHHHHHHHhhccCCCCCCcCCCCCCCCCCCCCccchhccchhhhhccccccccccc--CCCCCCCCCccccc
Q 001271 320 KEISTRELWERQLIIARRQKRPAGFGFYSPAKGNADGDGNANRKRKKACRLASIESEEESTCVG--SDRESVSCDNEIES 397 (1111)
Q Consensus 320 N~It~~E~~~~~~l~~~~~~~p~~~g~~~p~k~~~~~eds~~rk~~k~~Rla~I~e~e~~t~~~--Sdees~s~d~~~~s 397 (1111)
..++..++|+.+.....+..+|..+++|.+++.....++++.++.+++.+++.+..+.+.+.+. |+.++..++-+..+
T Consensus 319 k~l~~~efwk~~s~~~hr~~~p~s~~~~S~a~~~~~~dgS~~~s~gki~tl~~ihs~~~s~~v~r~S~~e~at~DpE~~s 398 (1096)
T KOG1859|consen 319 KALGGREFWKRQSGVSHRSSRPASYGFYSPARSENTSDGSQFRSKGKIYTLASIHSEDESTYVNRISDCESATCDPEESS 398 (1096)
T ss_pred eeccchhhhhhhhheecCCCCCCCCCCCCchhccCCCccchhhhcCceeecccccchhhhheeccccccccccCCccccc
Confidence 9999999999999999999999999999999999999999999999999999999999888877 78888877766543
Q ss_pred c--ccccCCcchhHHHHHHHHHHHHHhhhhhhHHHHhhhhhccccccccCCccccccccccccchhhhhhcCCCcccccc
Q 001271 398 K--EENVASDDDAEIIDLMSRVEHMKRERSILWLREFKEWMDHTSENFVDGSICSGATLMNCEEDNYIKNKRSQPHLAES 475 (1111)
Q Consensus 398 ~--ee~~~se~daeiael~sklE~lkKe~g~~WL~efkew~~e~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 475 (1111)
. .+.+....++...+++.++++++++++..|+++|+|||+...+.+.+.......+..+++. .++.....+.+-..+
T Consensus 399 ~~~t~a~~f~q~~pe~el~s~~~hl~~~r~vl~lR~~~Ew~~~p~~~~~~~s~~sqpt~seq~~-~tk~rn~p~~e~~g~ 477 (1096)
T KOG1859|consen 399 EINTEAAKFSQEAPEFELISKVEHLKKERSVLWLREFKEWLDSPNEDFMDVSKTSQPTESEQKY-YTKLRNEPLHEGSGT 477 (1096)
T ss_pred cCCCccccccCCCchhhhccchHHHhhhhhHHHHHHHhhhhcCCchhhccccCCCCCcchhcCc-ccccCCCCcccccCC
Confidence 3 3444445555578999999999999999999999999999999999999998888888885 444444444444589
Q ss_pred ccccccceeccCCCCcccccccCCccccCcccccccccccccCCCCccCCCcCCCCCccccccccCCCCcCCccccccc-
Q 001271 476 SKYVSGSVQASGDESSTNILESENSYADMPTGLHAYQSFDHIGSLGITGGFSLPGIGRMELRQENEKPYLHDGAGAATV- 554 (1111)
Q Consensus 476 s~~~~~~~~~~~~~~~~n~~e~~~s~~d~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~- 554 (1111)
.+|..+++...-..+.+|.+|..++|.|.-+|+..+++.....+.-.+..-..+...-.+++|..+.-+ ++++...
T Consensus 478 p~~tp~sl~~~i~~~p~~n~e~~~~~~~~~~g~~~e~~~e~~et~~et~~e~~~~~~et~ln~~~~~c~---legpp~~~ 554 (1096)
T KOG1859|consen 478 PRYTPGSLHHNISSTPTNNVELASTFDATITGIKSEANDESGETLYETCTEGEETNQETDLNQKHQLCT---LEGPPDRH 554 (1096)
T ss_pred CcCCCCccchhhccCcccchhhcccccccccchhhhcccccccccccccccchhhhhhhhccccceecc---ccCCcccc
Confidence 999999999988999999999999999999999999998877766666544444444456676655433 5555433
Q ss_pred ------ccccccCCCccccccccccccCCCCCCccCCccCCCCCCCCCCCCCcchhhhhhhhhhhHHHHHhhccce----
Q 001271 555 ------QSKSFHQDTFTIQDRRMVENIHESPLTPIDDITDAFSSSARPGSPPHYREDILHRRHNLVAEILQLSAES---- 624 (1111)
Q Consensus 555 ------~~~s~~~~~~~~~~~~~~~n~~~s~~~~~~~~~~~~~~~~~p~spp~~~~d~l~rr~~~~~e~lq~s~~~---- 624 (1111)
.+.|.+-.+|+++..+..|||+++.+ ++.+.-..+..|.||||||+|+|+||+||++||||++||+
T Consensus 555 ~~~~~l~vss~~l~e~~l~~a~~dE~~~m~tl----ea~q~e~~s~~~sSp~~~~kD~L~~r~~lsl~il~ic~d~~~~~ 630 (1096)
T KOG1859|consen 555 EELLRLYVSSSNLQEDPLSDAESDENGNMSTL----EAKQSETGSLTPSSPPHYQKDVLTRRANLSLEILQICADSRSIN 630 (1096)
T ss_pred hhhheeecccccccccchhhhhhhcccceeee----ecccccccccCCCCCCCccccccccchhHHHHHHHhCccccccc
Confidence 36778888999999999999999999 6666666778999999999999999999999999999999
Q ss_pred eeeeeCCCCCcCCccCCCCCCC--CccccccccCcccccCcccccccccccc-------cc-c-CCC-CCC--ccccc-c
Q 001271 625 YSVVSSDSKTSCSDDDFREYGP--SMLEVDQSINPEHEYSSAEVHSLLNLFE-------ED-H-NDQ-PHE--IDCQR-E 689 (1111)
Q Consensus 625 ~~~~s~~~~~s~s~~~~~~~~~--~~~~~~~~~~~~~~~~~~~~~~~~~~~~-------~~-~-~~~-~~~--~~~~~-~ 689 (1111)
|+|+++|+.++|+++++++.+. ++.|++ ...+++..|++. .- | -+| +.| |---+ +
T Consensus 631 y~v~~~D~~ss~~e~en~ls~~~~~~~eq~----------~~~rdL~~~r~~i~~C~~cgt~F~~eqp~kg~~~kelr~p 700 (1096)
T KOG1859|consen 631 YSVASSDKQSSCSEVENYLSEELESNLEQI----------LLQRDLTENRISIYRCVNCGTQFLIEQPEKGSKIKELRCP 700 (1096)
T ss_pred ceeecccccchhhhhhhcccHhhhhhHhhh----------hhhhhhhccccceeeeccccccccccCcccccchhhhcCc
Confidence 9999999999999999999887 676643 344444444421 00 0 011 111 11111 2
Q ss_pred cc---cCcccCCCCCCCCccccchhhhhhhHhhc--cccceeeeecccccc--cchhhhhhhhccCCCcCCccccccccc
Q 001271 690 NC---KNNGFSAGGNDGEVDSSVNQEAHLLEKNK--RKHTRRVISLLKEQN--TVAKTEALQNLNGNLNISEADNVGEQG 762 (1111)
Q Consensus 690 ~~---~~~~f~~~~~~~~~~~~~~~~~~~~~~~~--~~~~~~~~~~~~~~~--~~~~~~~~~~~~~~~~~~~~~~~~~~~ 762 (1111)
++ .+.+|.+|.|.-+-.+.|+|+.+|.+|+- |||++|.....++.. -+|+-+..--..- |.-+-
T Consensus 701 d~~k~~t~~v~~~~~s~~~~~~v~a~~rl~p~~~~~rkp~e~~~ap~~~es~~ci~kg~~shl~~a-------d~s~~-- 771 (1096)
T KOG1859|consen 701 DSRKVYTTNVTSGLHSLKPSGGVNAEPRLSPKMIVERKPVERLVAPINEESSNCIGKGEASHLSDA-------DISDS-- 771 (1096)
T ss_pred chhhcccccccccccccCCccceecccccCcchhhhccchhhhccccccccccccCccchhhhhhc-------ccCCc--
Confidence 22 37899999999777799999999999977 999999988777755 2222211111111 11110
Q ss_pred ceeeeccccccccccccccccc-ccccc--ccCccccceec-----ccchhhH-HHHhhcccccCCchhHhhccceEE-E
Q 001271 763 KHIFGLNYLLRTSDKKQTRENA-VMTPY--ISGIGSVAKFL-----SSVKEDF-VEDYFNKNVADSKSHETCMQYTVC-W 832 (1111)
Q Consensus 763 ~~~~~~~~~~~~~~~~~~~~~~-~~~~~--~~~~~~~~~~~-----~~~~~~~-~~~~f~~~~~~~~~~e~c~~~~~~-~ 832 (1111)
+ ...++...--.+|. -.+.| -|-..+...|+ ......| ++.||-+..|++..-|+|+.|+.| +
T Consensus 772 ----~---e~~~~rDh~fw~ns~lp~~c~~~~~~~rs~~FLe~E~~~~~~e~~q~~~~~paklav~S~~~~c~~~vS~~~ 844 (1096)
T KOG1859|consen 772 ----D---EDNTIRDHEFWENSSLPHLCTSHDEVARSKSFLETEFGLLLAEQAQVEELFPAKLAVSSHVETCRSYVSCDV 844 (1096)
T ss_pred ----c---ccccccccchhccCCCCcccccchhhHHHHHHHHHHhhhhhhhhcccccccchhhccCCCCceeEEEecccc
Confidence 0 00000000011111 00000 01111111121 1113444 788999999999999999999999 9
Q ss_pred EEecCCcccceE-------EEEEeecCCeeEEEEEeeeecCCcccccccccccchhhHHHhhhccceEEEEEeecCcEEE
Q 001271 833 ILEQDFMHRGRE-------VAVLRSSENKFYVLLFGVTVDGTGSILNLLGCHKIEDIREVLIGLGLQVLRVSTEMGATYL 905 (1111)
Q Consensus 833 ~~~~~~~~~~~e-------~~~l~ss~~k~~~ll~~~~~d~~~~~~~~l~~~~~~~~~~v~~g~glq~~r~~~~~~~~~~ 905 (1111)
|+|.+++|+||| ++||++||||+||+|++|..|-.++.+++++.|-+.|+|.|.||||+|++
T Consensus 845 i~~~~sTyeqre~~a~~lq~~Ll~~sqd~l~~gl~g~S~~le~sa~s~~c~~~~~d~q~~~~~l~~~~~----------- 913 (1096)
T KOG1859|consen 845 ILQICSTYEQRETDAPQLQNVLLLSSQDKLYVGLVGVSTDLEKSALSALCSHFISDFQDVSVGLGLQKV----------- 913 (1096)
T ss_pred hhhhhchhhhcCCCchhhhheeecccccceeeeeccccchhhhhhcccccccchhhhhhhhhHHHHHHH-----------
Confidence 999999999999 99999999999999999999999999999999999999999999999864
Q ss_pred EEeccHHHHHHHhhheeeecccccCCccccchhhhHHHHHHHhhhcCCcceeeeeeeeeeEEecCCC-cceEE--eeEEE
Q 001271 906 LMTRSIEKSRQLFCTLQIFYLVSANDKCSLRSLEQVQVELFEKQICGGLKVGIFQYSMVLFWCSEDK-ESWLS--RSLFL 982 (1111)
Q Consensus 906 ~~t~~~~~~~~~~~~~~~~~~~~~~~~~~~~s~e~~q~~l~~~~~~~~~~~~~~~y~~~~~~~~~~~-~~~~~--rsl~~ 982 (1111)
.+|.+|+.+|++.||-+.++.|++|--++|..+.-+ +.|+. |+.||
T Consensus 914 -------------------------------~Les~~~~~~~~~~~~~~~~~i~hrl~~~f~~~~fkE~~e~f~~ra~lv 962 (1096)
T KOG1859|consen 914 -------------------------------LLESEATVFQPYKFNYSDFNDIDHRLKLYFYQRKFKEDGELFKWRAKLV 962 (1096)
T ss_pred -------------------------------HHhccchhhhccccccccccchhhhhhhhhhhhhhhhhhHHHHHHHHHh
Confidence 367889999999999999999999999999999988 99997 99999
Q ss_pred ec-CeEEEEecccccccCcccC-CCCCCcee---eecccccccc-------ceeeeeccCceEEEEeeecCCcccccccc
Q 001271 983 IE-GHVLVCIEDLMQFSSLSVD-VFSPPYYL---VDLCCSIDNV-------SEIVIDARETCCVSLAVQHSTSEFCPLVT 1050 (1111)
Q Consensus 983 ~~-~~~~~c~e~~~q~~~~~~~-~~~~~y~~---~d~~c~i~~~-------~e~v~~~~~~~~~~~~~~~~~~~~~~~~~ 1050 (1111)
.| ++.++|-.++|+-..+|.| |..+||+. .++-|++.|| ..||.|++...|+.+..--. .+.
T Consensus 963 eG~~~~~~c~l~~~~~~flp~dDaa~sp~~~~~~a~s~~s~edi~p~~~~~~v~l~e~~~ls~lS~l~~~q------~~p 1036 (1096)
T KOG1859|consen 963 EGLVVMSNCKLYLMEAFFLPHDDAAKSPYQVVSVAVSRLSAEDILPWKLWGGVVLLEHDMLSTLSLLNYLQ------QIP 1036 (1096)
T ss_pred cCchhhhhhhhhhhHhhcccccccccCcccccchhhhhhhhhhcCCcCCCCceEEEeccccchHHHHHHHh------hCC
Confidence 99 9999999999999999875 45789998 7999999999 99999999988887432211 011
Q ss_pred ccccccccchhhhcccccccceeeeEEEeeccchhhHHHHHHHHHh-hccCCCCcccceec
Q 001271 1051 AASGVTACKKVAAIRTKRTYIGSLKWKFKWFSEEDLFNFVALVKAM-HAETTASPLQIRCV 1110 (1111)
Q Consensus 1051 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~ 1110 (1111)
. ..| .+.++ .+.+++||++=..-++.-+||+++..| |+..+.=|.-||.|
T Consensus 1037 l-~~q--------~~~~~-~vs~l~s~~w~l~~vc~~~l~al~~wi~~p~~~~F~~~lr~i 1087 (1096)
T KOG1859|consen 1037 L-PFQ--------SKLNH-QVSSLLSHQWELIAVCMPSLIALCNWICDPEKSSFPPSLRLI 1087 (1096)
T ss_pred c-hhh--------hhhcc-cchHHHHHHHHHHHHHHHhHHHHHhhccCchhccCchHHhhh
Confidence 1 234 67778 888999999888899999999999999 88888888877764
|
|
| >KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
| >PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
| >KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG0472 consensus Leucine-rich repeat protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0472 consensus Leucine-rich repeat protein [Function unknown] | Back alignment and domain information |
|---|
| >PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional | Back alignment and domain information |
|---|
| >PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional | Back alignment and domain information |
|---|
| >PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional | Back alignment and domain information |
|---|
| >KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional | Back alignment and domain information |
|---|
| >PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A | Back alignment and domain information |
|---|
| >PLN03210 Resistant to P | Back alignment and domain information |
|---|
| >KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily | Back alignment and domain information |
|---|
| >cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily | Back alignment and domain information |
|---|
| >PLN03210 Resistant to P | Back alignment and domain information |
|---|
| >KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A | Back alignment and domain information |
|---|
| >KOG2982 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >COG4886 Leucine-rich repeat (LRR) protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] | Back alignment and domain information |
|---|
| >COG4886 Leucine-rich repeat (LRR) protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] | Back alignment and domain information |
|---|
| >PLN03150 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PLN03150 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A | Back alignment and domain information |
|---|
| >PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A | Back alignment and domain information |
|---|
| >COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG2123 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG2982 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] | Back alignment and domain information |
|---|
| >PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B | Back alignment and domain information |
|---|
| >KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] | Back alignment and domain information |
|---|
| >KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B | Back alignment and domain information |
|---|
| >KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] | Back alignment and domain information |
|---|
| >PRK15386 type III secretion protein GogB; Provisional | Back alignment and domain information |
|---|
| >PRK15386 type III secretion protein GogB; Provisional | Back alignment and domain information |
|---|
| >KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG2123 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] | Back alignment and domain information |
|---|
| >PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A | Back alignment and domain information |
|---|
| >KOG3763 consensus mRNA export factor TAP/MEX67 [RNA processing and modification] | Back alignment and domain information |
|---|
| >PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A | Back alignment and domain information |
|---|
| >KOG4308 consensus LRR-containing protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG4308 consensus LRR-containing protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] | Back alignment and domain information |
|---|
| >PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] | Back alignment and domain information |
|---|
| >KOG4341 consensus F-box protein containing LRR [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0473 consensus Leucine-rich repeat protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG4341 consensus F-box protein containing LRR [General function prediction only] | Back alignment and domain information |
|---|
| >PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST
Original result of BLAST against Protein Data Bank
| ID | Alignment Graph | Length |
Definition |
E-value | |
| Query | 1111 | ||||
| 1ds9_A | 198 | Solution Structure Of Chlamydomonas Outer Arm Dynei | 4e-10 | ||
| 1m9l_A | 199 | Relaxation-Based Refined Structure Of Chlamydomonas | 4e-10 | ||
| 1ltx_A | 567 | Structure Of Rab Escort Protein-1 In Complex With R | 9e-05 | ||
| 1dce_A | 567 | Crystal Structure Of Rab Geranylgeranyltransferase | 9e-05 | ||
| 2z80_A | 353 | Crystal Structure Of The Tlr1-Tlr2 Heterodimer Indu | 2e-04 | ||
| 2z7x_A | 549 | Crystal Structure Of The Tlr1-Tlr2 Heterodimer Indu | 4e-04 |
| >pdb|1DS9|A Chain A, Solution Structure Of Chlamydomonas Outer Arm Dynein Light Chain 1 Length = 198 | Back alignment and structure |
|
| >pdb|1M9L|A Chain A, Relaxation-Based Refined Structure Of Chlamydomonas Outer Arm Dynein Light Chain 1 Length = 199 | Back alignment and structure |
| >pdb|1LTX|A Chain A, Structure Of Rab Escort Protein-1 In Complex With Rab Geranylgeranyl Transferase And Isoprenoid Length = 567 | Back alignment and structure |
| >pdb|1DCE|A Chain A, Crystal Structure Of Rab Geranylgeranyltransferase From Rat Brain Length = 567 | Back alignment and structure |
| >pdb|2Z80|A Chain A, Crystal Structure Of The Tlr1-Tlr2 Heterodimer Induced By Binding Of A Tri-Acylated Lipopeptide Length = 353 | Back alignment and structure |
| >pdb|2Z7X|A Chain A, Crystal Structure Of The Tlr1-Tlr2 Heterodimer Induced By Binding Of A Tri-Acylated Lipopeptide Length = 549 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST
Original result of RPS-BLAST against PDB70 database
| >1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 | Back alignment and structure |
|---|
Score = 141 bits (357), Expect = 2e-38
Identities = 55/179 (30%), Positives = 82/179 (45%), Gaps = 11/179 (6%)
Query: 157 RIVEIKDSPQWNRLSFVS--CSCNRLVIMDESLQLLPAVETLDLSRNKFAKVDNLRKCVN 214
RI E + S V + MD +L L A + L LS N K+ +L N
Sbjct: 12 RIFEERKSVVATEAEKVELHGMIPPIEKMDATLSTLKACKHLALSTNNIEKISSLSGMEN 71
Query: 215 LKHLDLGFNNLRSIAAFSEVSCHIVKLVLRNNALTTLRGIENLKSLEGLDISYNIISTFS 274
L+ L LG N ++ I V+ + +L + N + +L GIE L +L L +S N I+ +
Sbjct: 72 LRILSLGRNLIKKIENLDAVADTLEELWISYNQIASLSGIEKLVNLRVLYMSNNKITNWG 131
Query: 275 ELEFLASLPYLLNLWLEGNPLC-------CSRWYRAQVFSYFAHPAKLKVDGKEISTRE 326
E++ LA+L L +L L GNPL + YR +V + KL DG + E
Sbjct: 132 EIDKLAALDKLEDLLLAGNPLYNDYKENNATSEYRIEVVKRLPNLKKL--DGMPVDVDE 188
|
| >1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 | Back alignment and structure |
|---|
| >1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 | Back alignment and structure |
|---|
| >1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 | Back alignment and structure |
|---|
| >1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 | Back alignment and structure |
|---|
| >1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 | Back alignment and structure |
|---|
| >1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 | Back alignment and structure |
|---|
| >1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 | Back alignment and structure |
|---|
| >1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 | Back alignment and structure |
|---|
| >1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 | Back alignment and structure |
|---|
| >1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 | Back alignment and structure |
|---|
| >2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 | Back alignment and structure |
|---|
| >2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 | Back alignment and structure |
|---|
| >1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 | Back alignment and structure |
|---|
| >1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 | Back alignment and structure |
|---|
| >1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 | Back alignment and structure |
|---|
| >1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 | Back alignment and structure |
|---|
| >1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 | Back alignment and structure |
|---|
| >1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 | Back alignment and structure |
|---|
| >1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 | Back alignment and structure |
|---|
| >2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 | Back alignment and structure |
|---|
| >2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 | Back alignment and structure |
|---|
| >3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 | Back alignment and structure |
|---|
| >3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 | Back alignment and structure |
|---|
| >3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 | Back alignment and structure |
|---|
| >2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 | Back alignment and structure |
|---|
| >2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 | Back alignment and structure |
|---|
| >2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 | Back alignment and structure |
|---|
| >3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Length = 267 | Back alignment and structure |
|---|
| >1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 | Back alignment and structure |
|---|
| >1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 | Back alignment and structure |
|---|
| >3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 | Back alignment and structure |
|---|
| >3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 | Back alignment and structure |
|---|
| >3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 | Back alignment and structure |
|---|
| >3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 | Back alignment and structure |
|---|
| >3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 | Back alignment and structure |
|---|
| >3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 | Back alignment and structure |
|---|
| >1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 | Back alignment and structure |
|---|
| >1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 | Back alignment and structure |
|---|
| >1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 | Back alignment and structure |
|---|
| >2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 | Back alignment and structure |
|---|
| >2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 | Back alignment and structure |
|---|
| >2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 | Back alignment and structure |
|---|
| >2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 | Back alignment and structure |
|---|
| >2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 | Back alignment and structure |
|---|
| >2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 | Back alignment and structure |
|---|
| >2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 | Back alignment and structure |
|---|
| >2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 | Back alignment and structure |
|---|
| >2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 | Back alignment and structure |
|---|
| >2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 | Back alignment and structure |
|---|
| >2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 | Back alignment and structure |
|---|
| >2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 | Back alignment and structure |
|---|
| >2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 | Back alignment and structure |
|---|
| >2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 | Back alignment and structure |
|---|
| >1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 | Back alignment and structure |
|---|
| >1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 | Back alignment and structure |
|---|
| >2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 | Back alignment and structure |
|---|
| >2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 | Back alignment and structure |
|---|
| >2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 | Back alignment and structure |
|---|
| >3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 | Back alignment and structure |
|---|
| >3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 | Back alignment and structure |
|---|
| >3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 | Back alignment and structure |
|---|
| >2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 | Back alignment and structure |
|---|
| >1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 | Back alignment and structure |
|---|
| >1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 | Back alignment and structure |
|---|
| >1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 | Back alignment and structure |
|---|
| >1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 | Back alignment and structure |
|---|
| >2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 | Back alignment and structure |
|---|
| >2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 | Back alignment and structure |
|---|
| >2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 | Back alignment and structure |
|---|
| >3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 | Back alignment and structure |
|---|
| >3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 | Back alignment and structure |
|---|
| >3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 | Back alignment and structure |
|---|
| >3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 | Back alignment and structure |
|---|
| >4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 | Back alignment and structure |
|---|
| >4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 | Back alignment and structure |
|---|
| >3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 | Back alignment and structure |
|---|
| >3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 | Back alignment and structure |
|---|
| >3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 | Back alignment and structure |
|---|
| >3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 | Back alignment and structure |
|---|
| >1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 | Back alignment and structure |
|---|
| >3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 | Back alignment and structure |
|---|
| >1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 | Back alignment and structure |
|---|
| >1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 | Back alignment and structure |
|---|
| >2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 | Back alignment and structure |
|---|
| >2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 | Back alignment and structure |
|---|
| >2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 | Back alignment and structure |
|---|
| >2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 | Back alignment and structure |
|---|
| >2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 | Back alignment and structure |
|---|
| >3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 | Back alignment and structure |
|---|
| >1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Length = 185 | Back alignment and structure |
|---|
| >3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch
Original result of HHsearch against PDB70 database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 1111 | |||
| 3o6n_A | 390 | APL1; leucine-rich repeat, protein binding; HET: N | 99.91 | |
| 3v47_A | 455 | TOLL-like receptor 5B and variable lymphocyte REC | 99.91 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 99.91 | |
| 2id5_A | 477 | Lingo-1, leucine rich repeat neuronal 6A; CNS-spec | 99.91 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 99.91 | |
| 3zyi_A | 452 | Leucine-rich repeat-containing protein 4; cell adh | 99.9 | |
| 3zyj_A | 440 | Leucine-rich repeat-containing protein 4C; cell ad | 99.9 | |
| 2id5_A | 477 | Lingo-1, leucine rich repeat neuronal 6A; CNS-spec | 99.9 | |
| 1xku_A | 330 | Decorin; proteoglycan, leucine-rich repeat, struct | 99.9 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 99.9 | |
| 3v47_A | 455 | TOLL-like receptor 5B and variable lymphocyte REC | 99.89 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 99.89 | |
| 3o6n_A | 390 | APL1; leucine-rich repeat, protein binding; HET: N | 99.89 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 99.89 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 99.89 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 99.89 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 99.89 | |
| 2ft3_A | 332 | Biglycan; proteoglycan, dimer interface, structura | 99.89 | |
| 1ogq_A | 313 | PGIP-2, polygalacturonase inhibiting protein; inhi | 99.88 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 99.88 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 99.88 | |
| 1xku_A | 330 | Decorin; proteoglycan, leucine-rich repeat, struct | 99.88 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 99.88 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 99.88 | |
| 2z7x_B | 520 | TOLL-like receptor 1, variable lymphocyte recepto; | 99.88 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 99.88 | |
| 3zyi_A | 452 | Leucine-rich repeat-containing protein 4; cell adh | 99.88 | |
| 3zyj_A | 440 | Leucine-rich repeat-containing protein 4C; cell ad | 99.88 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 99.88 | |
| 1ogq_A | 313 | PGIP-2, polygalacturonase inhibiting protein; inhi | 99.87 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 99.87 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 99.87 | |
| 1ozn_A | 285 | Reticulon 4 receptor; NOGO receptor, MAD, myelinat | 99.87 | |
| 2z66_A | 306 | Variable lymphocyte receptor B, TOLL-like recepto; | 99.87 | |
| 3o53_A | 317 | Protein LRIM1, AGAP006348-PA; leucine-rich repeat, | 99.87 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 99.87 | |
| 2ft3_A | 332 | Biglycan; proteoglycan, dimer interface, structura | 99.87 | |
| 3a79_B | 562 | TLR6, VLRB.59, TOLL-like receptor 6, variable lymp | 99.87 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 99.86 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 99.86 | |
| 2z80_A | 353 | TOLL-like receptor 2, variable lymphocyte recepto; | 99.86 | |
| 2z66_A | 306 | Variable lymphocyte receptor B, TOLL-like recepto; | 99.86 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 99.86 | |
| 2z7x_B | 520 | TOLL-like receptor 1, variable lymphocyte recepto; | 99.86 | |
| 1wwl_A | 312 | Monocyte differentiation antigen CD14; LPS, immune | 99.86 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 99.85 | |
| 1p9a_G | 290 | Platelet glycoprotein IB alpha chain precursor; pl | 99.85 | |
| 3o53_A | 317 | Protein LRIM1, AGAP006348-PA; leucine-rich repeat, | 99.85 | |
| 1ozn_A | 285 | Reticulon 4 receptor; NOGO receptor, MAD, myelinat | 99.85 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 99.85 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 99.85 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 99.85 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 99.84 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 99.84 | |
| 1h6u_A | 308 | Internalin H; cell adhesion, leucine rich repeat, | 99.84 | |
| 2z80_A | 353 | TOLL-like receptor 2, variable lymphocyte recepto; | 99.84 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 99.84 | |
| 2o6q_A | 270 | Variable lymphocyte receptor A; leucine-rich repea | 99.84 | |
| 2z62_A | 276 | TOLL-like receptor 4, variable lymphocyte recepto; | 99.83 | |
| 4g8a_A | 635 | TOLL-like receptor 4; leucine rich repeat MD-2 rel | 99.83 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 99.83 | |
| 3bz5_A | 457 | Internalin-J, INLJ; leucine rich repeat (LRR), cys | 99.82 | |
| 3a79_B | 562 | TLR6, VLRB.59, TOLL-like receptor 6, variable lymp | 99.82 | |
| 3g06_A | 622 | SSPH2 (leucine-rich repeat protein); E3 ubiquitin | 99.82 | |
| 1wwl_A | 312 | Monocyte differentiation antigen CD14; LPS, immune | 99.82 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 99.82 | |
| 3bz5_A | 457 | Internalin-J, INLJ; leucine rich repeat (LRR), cys | 99.82 | |
| 2ca6_A | 386 | RAN GTPase-activating protein 1; GAP, GTPase activ | 99.81 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 99.81 | |
| 4g8a_A | 635 | TOLL-like receptor 4; leucine rich repeat MD-2 rel | 99.8 | |
| 3g06_A | 622 | SSPH2 (leucine-rich repeat protein); E3 ubiquitin | 99.79 | |
| 2z62_A | 276 | TOLL-like receptor 4, variable lymphocyte recepto; | 99.79 | |
| 2xwt_C | 239 | Thyrotropin receptor; signaling protein-immune sys | 99.79 | |
| 4glp_A | 310 | Monocyte differentiation antigen CD14; alpha beta | 99.78 | |
| 1h6t_A | 291 | Internalin B; cell adhesion, leucine rich repeat, | 99.78 | |
| 3m19_A | 251 | Variable lymphocyte receptor A diversity region; a | 99.77 | |
| 1h6u_A | 308 | Internalin H; cell adhesion, leucine rich repeat, | 99.77 | |
| 2ca6_A | 386 | RAN GTPase-activating protein 1; GAP, GTPase activ | 99.76 | |
| 1p9a_G | 290 | Platelet glycoprotein IB alpha chain precursor; pl | 99.76 | |
| 3rfs_A | 272 | Internalin B, repeat modules, variable lymphocyte | 99.76 | |
| 2o6q_A | 270 | Variable lymphocyte receptor A; leucine-rich repea | 99.76 | |
| 1z7x_W | 461 | Ribonuclease inhibitor; leucine-rich repeat, enzym | 99.75 | |
| 1z7x_W | 461 | Ribonuclease inhibitor; leucine-rich repeat, enzym | 99.75 | |
| 4glp_A | 310 | Monocyte differentiation antigen CD14; alpha beta | 99.75 | |
| 3goz_A | 362 | Leucine-rich repeat-containing protein; LEGL7, NES | 99.74 | |
| 1m9s_A | 605 | Internalin B; cell invasion, GW domains, SH3 domai | 99.73 | |
| 2xwt_C | 239 | Thyrotropin receptor; signaling protein-immune sys | 99.72 | |
| 3goz_A | 362 | Leucine-rich repeat-containing protein; LEGL7, NES | 99.72 | |
| 3cvr_A | 571 | Invasion plasmid antigen; leucine rich repeat and | 99.72 | |
| 3m19_A | 251 | Variable lymphocyte receptor A diversity region; a | 99.7 | |
| 1dce_A | 567 | Protein (RAB geranylgeranyltransferase alpha subun | 99.7 | |
| 1xeu_A | 263 | Internalin C; cellular invasion, leucine-rich repe | 99.7 | |
| 3rfs_A | 272 | Internalin B, repeat modules, variable lymphocyte | 99.69 | |
| 2ast_B | 336 | S-phase kinase-associated protein 2; SCF-substrate | 99.68 | |
| 1h6t_A | 291 | Internalin B; cell adhesion, leucine rich repeat, | 99.68 | |
| 2xot_A | 361 | Amphoterin-induced protein 1; cell adhesion, neuro | 99.67 | |
| 4ay9_X | 350 | Follicle-stimulating hormone receptor; hormone-rec | 99.66 | |
| 1xeu_A | 263 | Internalin C; cellular invasion, leucine-rich repe | 99.65 | |
| 3e6j_A | 229 | Variable lymphocyte receptor diversity region; var | 99.64 | |
| 4ay9_X | 350 | Follicle-stimulating hormone receptor; hormone-rec | 99.63 | |
| 2v9t_B | 220 | SLIT homolog 2 protein N-product; structural prote | 99.63 | |
| 3cvr_A | 571 | Invasion plasmid antigen; leucine rich repeat and | 99.63 | |
| 1m9s_A | 605 | Internalin B; cell invasion, GW domains, SH3 domai | 99.62 | |
| 2ast_B | 336 | S-phase kinase-associated protein 2; SCF-substrate | 99.61 | |
| 4ezg_A | 197 | Putative uncharacterized protein; internalin-A, le | 99.61 | |
| 2v70_A | 220 | SLIT-2, SLIT homolog 2 protein N-product; neurogen | 99.6 | |
| 4ezg_A | 197 | Putative uncharacterized protein; internalin-A, le | 99.59 | |
| 1dce_A | 567 | Protein (RAB geranylgeranyltransferase alpha subun | 99.58 | |
| 3e6j_A | 229 | Variable lymphocyte receptor diversity region; var | 99.58 | |
| 2v9t_B | 220 | SLIT homolog 2 protein N-product; structural prote | 99.56 | |
| 2o6s_A | 208 | Variable lymphocyte receptor B; leucine-rich repea | 99.56 | |
| 2xot_A | 361 | Amphoterin-induced protein 1; cell adhesion, neuro | 99.56 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 99.54 | |
| 2v70_A | 220 | SLIT-2, SLIT homolog 2 protein N-product; neurogen | 99.53 | |
| 2o6s_A | 208 | Variable lymphocyte receptor B; leucine-rich repea | 99.53 | |
| 1ds9_A | 198 | Outer arm dynein; leucine-rich repeat, beta-BETA-a | 99.52 | |
| 2ell_A | 168 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 99.5 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 99.5 | |
| 4b8c_D | 727 | Glucose-repressible alcohol dehydrogenase transcr | 99.49 | |
| 2wfh_A | 193 | SLIT homolog 2 protein C-product; developmental pr | 99.49 | |
| 1w8a_A | 192 | SLIT protein; signaling protein, secreted protein, | 99.48 | |
| 1a9n_A | 176 | U2A', U2A'; complex (nuclear protein/RNA), RNA, sn | 99.47 | |
| 2je0_A | 149 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 99.45 | |
| 1a9n_A | 176 | U2A', U2A'; complex (nuclear protein/RNA), RNA, sn | 99.42 | |
| 2o6r_A | 177 | Variable lymphocyte receptor B; leucine-rich repea | 99.42 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 99.42 | |
| 2ell_A | 168 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 99.41 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 99.39 | |
| 2je0_A | 149 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 99.35 | |
| 1ds9_A | 198 | Outer arm dynein; leucine-rich repeat, beta-BETA-a | 99.34 | |
| 4b8c_D | 727 | Glucose-repressible alcohol dehydrogenase transcr | 99.32 | |
| 2wfh_A | 193 | SLIT homolog 2 protein C-product; developmental pr | 99.28 | |
| 1w8a_A | 192 | SLIT protein; signaling protein, secreted protein, | 99.28 | |
| 3sb4_A | 329 | Hypothetical leucine rich repeat protein; LRR, rig | 99.24 | |
| 2o6r_A | 177 | Variable lymphocyte receptor B; leucine-rich repea | 99.23 | |
| 3g39_A | 170 | Variable lymphocyte receptor VLRB.2D; antibody, X- | 99.21 | |
| 3sb4_A | 329 | Hypothetical leucine rich repeat protein; LRR, rig | 99.15 | |
| 2r9u_A | 174 | Variable lymphocyte receptor; adaptive immunity, V | 99.14 | |
| 2r9u_A | 174 | Variable lymphocyte receptor; adaptive immunity, V | 99.08 | |
| 3un9_A | 372 | NLR family member X1; leucine rich repeat (LRR), a | 99.03 | |
| 3g39_A | 170 | Variable lymphocyte receptor VLRB.2D; antibody, X- | 99.02 | |
| 3un9_A | 372 | NLR family member X1; leucine rich repeat (LRR), a | 99.0 | |
| 2ifg_A | 347 | High affinity nerve growth factor receptor; TRK, T | 98.96 | |
| 4fdw_A | 401 | Leucine rich hypothetical protein; putative cell s | 98.96 | |
| 2ifg_A | 347 | High affinity nerve growth factor receptor; TRK, T | 98.95 | |
| 4fdw_A | 401 | Leucine rich hypothetical protein; putative cell s | 98.88 | |
| 2ra8_A | 362 | Uncharacterized protein Q64V53_bacfr; WGR domain, | 98.39 | |
| 3rw6_A | 267 | Nuclear RNA export factor 1; retroviral constituti | 98.32 | |
| 2ra8_A | 362 | Uncharacterized protein Q64V53_bacfr; WGR domain, | 98.3 | |
| 1io0_A | 185 | Tropomodulin; LRR protein, right-handed super-heli | 98.26 | |
| 1io0_A | 185 | Tropomodulin; LRR protein, right-handed super-heli | 98.1 | |
| 4fs7_A | 394 | Uncharacterized protein; leucine-rich repeats, pro | 97.93 | |
| 4gt6_A | 394 | Cell surface protein; leucine rich repeats, putati | 97.85 | |
| 4fs7_A | 394 | Uncharacterized protein; leucine-rich repeats, pro | 97.76 | |
| 3rw6_A | 267 | Nuclear RNA export factor 1; retroviral constituti | 97.66 | |
| 4gt6_A | 394 | Cell surface protein; leucine rich repeats, putati | 97.59 | |
| 4h09_A | 379 | Hypothetical leucine rich repeat protein; two LRR_ | 97.09 | |
| 1pgv_A | 197 | TMD-1, tropomodulin TMD-1; structural genomics, PS | 97.09 | |
| 3e4g_A | 176 | ATP synthase subunit S, mitochondrial; leucine-ric | 96.77 | |
| 3rfe_A | 130 | Platelet glycoprotein IB beta chain; platelet surf | 96.77 | |
| 3e4g_A | 176 | ATP synthase subunit S, mitochondrial; leucine-ric | 96.68 | |
| 4h09_A | 379 | Hypothetical leucine rich repeat protein; two LRR_ | 96.65 | |
| 1pgv_A | 197 | TMD-1, tropomodulin TMD-1; structural genomics, PS | 96.55 | |
| 3rfe_A | 130 | Platelet glycoprotein IB beta chain; platelet surf | 95.57 |
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} | Back alignment and structure |
|---|
Probab=99.91 E-value=4e-24 Score=242.14 Aligned_cols=292 Identities=14% Similarity=0.135 Sum_probs=222.9
Q ss_pred ccCCcEEEecCCCccchHHhh-hhcccchhhccCC-Cccc---------cccccccCCCCCcchhHHHHhcCCCCCcEEE
Q 001271 25 IEGSIVLKLNPAGLHYVQSRL-EALRELERLLAGA-PLDY---------LRAYVSDLGDHRALEQLRRILKLLTSLKVVS 93 (1111)
Q Consensus 25 L~~lk~L~Ls~~~L~~Lp~~L-~~L~~Le~L~~~~-~l~~---------Lrl~vLdLs~n~~L~~Lp~~L~~L~nLk~Ld 93 (1111)
+.+++.|++..+.+..+|..+ ..+++|+.+.... .+.. -.+..+++++|......|..+.++++|++|+
T Consensus 44 l~~l~~l~l~~~~l~~l~~~~~~~l~~L~~L~L~~n~i~~~~~~~~~~l~~L~~L~L~~n~l~~~~~~~~~~l~~L~~L~ 123 (390)
T 3o6n_A 44 LNNQKIVTFKNSTMRKLPAALLDSFRQVELLNLNDLQIEEIDTYAFAYAHTIQKLYMGFNAIRYLPPHVFQNVPLLTVLV 123 (390)
T ss_dssp GCCCSEEEEESCEESEECTHHHHHCCCCSEEECTTSCCCEECTTTTTTCTTCCEEECCSSCCCCCCTTTTTTCTTCCEEE
T ss_pred cCCceEEEecCCchhhCChhHhcccccCcEEECCCCcccccChhhccCCCCcCEEECCCCCCCcCCHHHhcCCCCCCEEE
Confidence 577899999999999998764 6666666554321 1111 1234567777776555566788888888888
Q ss_pred ccCCCCCCCCCccCCCCCCCCEEEeeCCCCCccchhhHhhhhhhhhhhhccCCCccchhhhcccccc-------ccCCCC
Q 001271 94 ALPPPARDPTPLSLLPFCRLKVLELRGCDLSTSAAKGLLELRHTLEKIICHNSTNALRHVFASRIVE-------IKDSPQ 166 (1111)
Q Consensus 94 Ls~N~Is~~iP~sLs~L~nL~~LdLS~N~Ls~~~P~~L~~L~~LleLlLs~N~L~sL~~l~~~~I~~-------L~~l~~ 166 (1111)
|++|.+....+..|..+++|++|+|++|.+++..|..+..+++|..+.+.+|.+..+.......+.. +..+..
T Consensus 124 L~~n~l~~l~~~~~~~l~~L~~L~L~~n~l~~~~~~~~~~l~~L~~L~l~~n~l~~~~~~~l~~L~~L~l~~n~l~~~~~ 203 (390)
T 3o6n_A 124 LERNDLSSLPRGIFHNTPKLTTLSMSNNNLERIEDDTFQATTSLQNLQLSSNRLTHVDLSLIPSLFHANVSYNLLSTLAI 203 (390)
T ss_dssp CCSSCCCCCCTTTTTTCTTCCEEECCSSCCCBCCTTTTSSCTTCCEEECCSSCCSBCCGGGCTTCSEEECCSSCCSEEEC
T ss_pred CCCCccCcCCHHHhcCCCCCcEEECCCCccCccChhhccCCCCCCEEECCCCcCCccccccccccceeecccccccccCC
Confidence 8888888554455688888888888888888877777888888888888888776553211111110 111123
Q ss_pred CCCccEEEccCCccccchhhhcCCCCCcEEEccCCCCCCCCCcCCCCCCcEEECCCCCCCCccc-cccccccceEeeccC
Q 001271 167 WNRLSFVSCSCNRLVIMDESLQLLPAVETLDLSRNKFAKVDNLRKCVNLKHLDLGFNNLRSIAA-FSEVSCHIVKLVLRN 245 (1111)
Q Consensus 167 L~~L~~L~Ls~N~LssLP~~L~~L~nL~~LdLS~N~Ls~L~~L~~L~sL~~LdLS~N~Lt~L~~-l~~~L~sL~~L~LS~ 245 (1111)
..+|+.|++++|.++.+|.. .+++|+.|+|++|.++.++.+..+++|+.|+|++|.|+.+.+ ....+++|+.|+|++
T Consensus 204 ~~~L~~L~l~~n~l~~~~~~--~~~~L~~L~l~~n~l~~~~~l~~l~~L~~L~Ls~n~l~~~~~~~~~~l~~L~~L~L~~ 281 (390)
T 3o6n_A 204 PIAVEELDASHNSINVVRGP--VNVELTILKLQHNNLTDTAWLLNYPGLVEVDLSYNELEKIMYHPFVKMQRLERLYISN 281 (390)
T ss_dssp CSSCSEEECCSSCCCEEECC--CCSSCCEEECCSSCCCCCGGGGGCTTCSEEECCSSCCCEEESGGGTTCSSCCEEECCS
T ss_pred CCcceEEECCCCeeeecccc--ccccccEEECCCCCCcccHHHcCCCCccEEECCCCcCCCcChhHccccccCCEEECCC
Confidence 45688888888888877653 357899999999999999889999999999999999998754 455689999999999
Q ss_pred CccCCcc-cCCCCCCCCEEEccCCCCCCCchhhhhcCCCCCcEEEecCCCCCCCccchhhHhhhcCCCCeeecCCCcCCh
Q 001271 246 NALTTLR-GIENLKSLEGLDISYNIISTFSELEFLASLPYLLNLWLEGNPLCCSRWYRAQVFSYFAHPAKLKVDGKEIST 324 (1111)
Q Consensus 246 N~Lt~L~-~L~~L~sL~~LdLS~N~Is~l~~l~~L~~L~~L~~L~LsgNpLs~~~~~r~~if~~l~~L~~L~LdgN~It~ 324 (1111)
|+++.++ .+..+++|+.|+|++|.|+.++ ..+..+++|+.|+|++|++...+ +..++.|+.++|.+|++.+
T Consensus 282 n~l~~~~~~~~~l~~L~~L~L~~n~l~~~~--~~~~~l~~L~~L~L~~N~i~~~~------~~~~~~L~~L~l~~N~~~~ 353 (390)
T 3o6n_A 282 NRLVALNLYGQPIPTLKVLDLSHNHLLHVE--RNQPQFDRLENLYLDHNSIVTLK------LSTHHTLKNLTLSHNDWDC 353 (390)
T ss_dssp SCCCEEECSSSCCTTCCEEECCSSCCCCCG--GGHHHHTTCSEEECCSSCCCCCC------CCTTCCCSEEECCSSCEEH
T ss_pred CcCcccCcccCCCCCCCEEECCCCcceecC--ccccccCcCCEEECCCCccceeC------chhhccCCEEEcCCCCccc
Confidence 9999985 5678999999999999999987 45778899999999999997553 4567889999999999988
Q ss_pred hH
Q 001271 325 RE 326 (1111)
Q Consensus 325 ~E 326 (1111)
..
T Consensus 354 ~~ 355 (390)
T 3o6n_A 354 NS 355 (390)
T ss_dssp HH
T ss_pred hh
Confidence 64
|
| >3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} | Back alignment and structure |
|---|
| >3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} | Back alignment and structure |
|---|
| >1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* | Back alignment and structure |
|---|
| >1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* | Back alignment and structure |
|---|
| >1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* | Back alignment and structure |
|---|
| >2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} | Back alignment and structure |
|---|
| >3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* | Back alignment and structure |
|---|
| >2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* | Back alignment and structure |
|---|
| >2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} | Back alignment and structure |
|---|
| >1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 | Back alignment and structure |
|---|
| >2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* | Back alignment and structure |
|---|
| >4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A | Back alignment and structure |
|---|
| >4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* | Back alignment and structure |
|---|
| >2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* | Back alignment and structure |
|---|
| >4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A | Back alignment and structure |
|---|
| >3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A | Back alignment and structure |
|---|
| >1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 | Back alignment and structure |
|---|
| >2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A | Back alignment and structure |
|---|
| >1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A | Back alignment and structure |
|---|
| >3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A | Back alignment and structure |
|---|
| >2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I | Back alignment and structure |
|---|
| >1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I | Back alignment and structure |
|---|
| >4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A | Back alignment and structure |
|---|
| >2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* | Back alignment and structure |
|---|
| >3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} | Back alignment and structure |
|---|
| >3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A | Back alignment and structure |
|---|
| >1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* | Back alignment and structure |
|---|
| >1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A | Back alignment and structure |
|---|
| >2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A | Back alignment and structure |
|---|
| >1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A | Back alignment and structure |
|---|
| >2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* | Back alignment and structure |
|---|
| >1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} | Back alignment and structure |
|---|
| >4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* | Back alignment and structure |
|---|
| >2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A | Back alignment and structure |
|---|
| >3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} | Back alignment and structure |
|---|
| >1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A | Back alignment and structure |
|---|
| >2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* | Back alignment and structure |
|---|
| >3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} | Back alignment and structure |
|---|
| >2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A | Back alignment and structure |
|---|
| >2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* | Back alignment and structure |
|---|
| >2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} | Back alignment and structure |
|---|
| >2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A | Back alignment and structure |
|---|
| >2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* | Back alignment and structure |
|---|
| >4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} | Back alignment and structure |
|---|
| >2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 | Back alignment and structure |
|---|
| >1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 | Back alignment and structure |
|---|
| >2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A | Back alignment and structure |
|---|
| >1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 | Back alignment and structure |
|---|
| >2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* | Back alignment and structure |
|---|
| >2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* | Back alignment and structure |
|---|
| >2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A | Back alignment and structure |
|---|
| >1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A | Back alignment and structure |
|---|
| >4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} | Back alignment and structure |
|---|
| >2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 | Back alignment and structure |
|---|
| >3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D | Back alignment and structure |
|---|
| >3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} | Back alignment and structure |
|---|
| >2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} | Back alignment and structure |
|---|
| >3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} | Back alignment and structure |
|---|
| >3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D | Back alignment and structure |
|---|
| >3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} | Back alignment and structure |
|---|
| >2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 | Back alignment and structure |
|---|
| >4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A | Back alignment and structure |
|---|
| >2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 | Back alignment and structure |
|---|
| >4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A | Back alignment and structure |
|---|
| >2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A | Back alignment and structure |
|---|
| >2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 | Back alignment and structure |
|---|
| >1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 | Back alignment and structure |
|---|
| >4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} | Back alignment and structure |
|---|
| >4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} | Back alignment and structure |
|---|
| >4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} | Back alignment and structure |
|---|
| >3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A | Back alignment and structure |
|---|
| >4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} | Back alignment and structure |
|---|
| >4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} | Back alignment and structure |
|---|
| >1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 | Back alignment and structure |
|---|
| >3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A | Back alignment and structure |
|---|
| >3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* | Back alignment and structure |
|---|
| >3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A | Back alignment and structure |
|---|
| >4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} | Back alignment and structure |
|---|
| >1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 | Back alignment and structure |
|---|
| >3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST
Original result of RPS-BLAST against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
E-value |
| 1111 | ||||
| d1dcea3 | 124 | c.10.2.2 (A:444-567) Rab geranylgeranyltransferase | 2e-15 | |
| d1dcea3 | 124 | c.10.2.2 (A:444-567) Rab geranylgeranyltransferase | 2e-04 | |
| d2omza2 | 384 | c.10.2.1 (A:33-416) Internalin A {Listeria monocyt | 2e-13 | |
| d2omza2 | 384 | c.10.2.1 (A:33-416) Internalin A {Listeria monocyt | 7e-12 | |
| d2omza2 | 384 | c.10.2.1 (A:33-416) Internalin A {Listeria monocyt | 3e-10 | |
| d2omza2 | 384 | c.10.2.1 (A:33-416) Internalin A {Listeria monocyt | 3e-08 | |
| d2omza2 | 384 | c.10.2.1 (A:33-416) Internalin A {Listeria monocyt | 9e-07 | |
| d2omza2 | 384 | c.10.2.1 (A:33-416) Internalin A {Listeria monocyt | 1e-04 | |
| d1koha1 | 162 | c.10.2.3 (A:201-362) mRNA export factor tap {Human | 1e-12 | |
| d1a9na_ | 162 | c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom | 8e-09 | |
| d1m9la_ | 198 | c.10.3.1 (A:) Outer arm dynein light chain 1 {Gree | 5e-07 | |
| d1jl5a_ | 353 | c.10.2.6 (A:) Leucine rich effector protein YopM { | 2e-06 | |
| d1jl5a_ | 353 | c.10.2.6 (A:) Leucine rich effector protein YopM { | 2e-04 | |
| d1jl5a_ | 353 | c.10.2.6 (A:) Leucine rich effector protein YopM { | 0.002 | |
| d1xkua_ | 305 | c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 | 2e-06 | |
| d1h6ua2 | 227 | c.10.2.1 (A:36-262) Internalin H {Listeria monocyt | 3e-06 | |
| d1h6ua2 | 227 | c.10.2.1 (A:36-262) Internalin H {Listeria monocyt | 1e-04 | |
| d1h6ua2 | 227 | c.10.2.1 (A:36-262) Internalin H {Listeria monocyt | 2e-04 | |
| d1h6ua2 | 227 | c.10.2.1 (A:36-262) Internalin H {Listeria monocyt | 3e-04 | |
| d1h6ta2 | 210 | c.10.2.1 (A:31-240) Internalin B {Listeria monocyt | 3e-05 | |
| d1h6ta2 | 210 | c.10.2.1 (A:31-240) Internalin B {Listeria monocyt | 0.002 | |
| d1h6ta2 | 210 | c.10.2.1 (A:31-240) Internalin B {Listeria monocyt | 0.003 | |
| d2omxa2 | 199 | c.10.2.1 (A:37-235) Internalin B {Listeria monocyt | 6e-05 | |
| d2omxa2 | 199 | c.10.2.1 (A:37-235) Internalin B {Listeria monocyt | 5e-04 | |
| d1z7xw1 | 460 | c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( | 1e-04 | |
| d1z7xw1 | 460 | c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( | 4e-04 | |
| d1z7xw1 | 460 | c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( | 6e-04 | |
| d1ogqa_ | 313 | c.10.2.8 (A:) Polygalacturonase inhibiting protein | 7e-04 | |
| d2astb2 | 284 | c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 | 0.004 |
| >d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) superfamily: L domain-like family: Rab geranylgeranyltransferase alpha-subunit, C-terminal domain domain: Rab geranylgeranyltransferase alpha-subunit, C-terminal domain species: Rat (Rattus norvegicus) [TaxId: 10116]
Score = 71.7 bits (175), Expect = 2e-15
Identities = 30/121 (24%), Positives = 55/121 (45%)
Query: 195 TLDLSRNKFAKVDNLRKCVNLKHLDLGFNNLRSIAAFSEVSCHIVKLVLRNNALTTLRGI 254
L L+ + +L + + + HLDL N LR++ + L +NAL + G+
Sbjct: 2 VLHLAHKDLTVLCHLEQLLLVTHLDLSHNRLRALPPALAALRCLEVLQASDNALENVDGV 61
Query: 255 ENLKSLEGLDISYNIISTFSELEFLASLPYLLNLWLEGNPLCCSRWYRAQVFSYFAHPAK 314
NL L+ L + N + + ++ L S P L+ L L+GN LC + ++ +
Sbjct: 62 ANLPRLQELLLCNNRLQQSAAIQPLVSCPRLVLLNLQGNSLCQEEGIQERLAEMLPSVSS 121
Query: 315 L 315
+
Sbjct: 122 I 122
|
| >d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 | Back information, alignment and structure |
|---|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 | Back information, alignment and structure |
|---|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 | Back information, alignment and structure |
|---|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 | Back information, alignment and structure |
|---|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 | Back information, alignment and structure |
|---|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 | Back information, alignment and structure |
|---|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 | Back information, alignment and structure |
|---|
| >d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 | Back information, alignment and structure |
|---|
| >d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 | Back information, alignment and structure |
|---|
| >d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Length = 198 | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 | Back information, alignment and structure |
|---|
| >d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 | Back information, alignment and structure |
|---|
| >d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 | Back information, alignment and structure |
|---|
| >d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 | Back information, alignment and structure |
|---|
| >d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 | Back information, alignment and structure |
|---|
| >d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 | Back information, alignment and structure |
|---|
| >d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 | Back information, alignment and structure |
|---|
| >d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 | Back information, alignment and structure |
|---|
| >d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 | Back information, alignment and structure |
|---|
| >d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 199 | Back information, alignment and structure |
|---|
| >d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 199 | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 | Back information, alignment and structure |
|---|
| >d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 | Back information, alignment and structure |
|---|
| >d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch
Original result of HHsearch against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 1111 | |||
| d2omza2 | 384 | Internalin A {Listeria monocytogenes [TaxId: 1639] | 99.84 | |
| d1p9ag_ | 266 | von Willebrand factor binding domain of glycoprote | 99.83 | |
| d1ozna_ | 284 | Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma | 99.8 | |
| d1xkua_ | 305 | Decorin {Cow (Bos taurus) [TaxId: 9913]} | 99.79 | |
| d1xkua_ | 305 | Decorin {Cow (Bos taurus) [TaxId: 9913]} | 99.79 | |
| d2omza2 | 384 | Internalin A {Listeria monocytogenes [TaxId: 1639] | 99.79 | |
| d1ogqa_ | 313 | Polygalacturonase inhibiting protein PGIP {Kidney | 99.78 | |
| d1ogqa_ | 313 | Polygalacturonase inhibiting protein PGIP {Kidney | 99.76 | |
| d1ozna_ | 284 | Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma | 99.72 | |
| d1p9ag_ | 266 | von Willebrand factor binding domain of glycoprote | 99.71 | |
| d1h6ua2 | 227 | Internalin H {Listeria monocytogenes [TaxId: 1639] | 99.7 | |
| d1h6ta2 | 210 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 99.68 | |
| d2omxa2 | 199 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 99.68 | |
| d1a9na_ | 162 | Splicesomal U2A' protein {Human (Homo sapiens) [Ta | 99.64 | |
| d1h6ua2 | 227 | Internalin H {Listeria monocytogenes [TaxId: 1639] | 99.63 | |
| d2omxa2 | 199 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 99.62 | |
| d1h6ta2 | 210 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 99.6 | |
| d1dcea3 | 124 | Rab geranylgeranyltransferase alpha-subunit, C-ter | 99.59 | |
| d1m9la_ | 198 | Outer arm dynein light chain 1 {Green algae (Chlam | 99.59 | |
| d1jl5a_ | 353 | Leucine rich effector protein YopM {Yersinia pesti | 99.59 | |
| d1xwdc1 | 242 | Follicle-stimulating hormone receptor {Human (Homo | 99.53 | |
| d1w8aa_ | 192 | Slit {Fruit fly (Drosophila melanogaster) [TaxId: | 99.51 | |
| d1jl5a_ | 353 | Leucine rich effector protein YopM {Yersinia pesti | 99.47 | |
| d1w8aa_ | 192 | Slit {Fruit fly (Drosophila melanogaster) [TaxId: | 99.44 | |
| d1xwdc1 | 242 | Follicle-stimulating hormone receptor {Human (Homo | 99.42 | |
| d1dcea3 | 124 | Rab geranylgeranyltransferase alpha-subunit, C-ter | 99.34 | |
| d1a9na_ | 162 | Splicesomal U2A' protein {Human (Homo sapiens) [Ta | 99.3 | |
| d2ca6a1 | 344 | Rna1p (RanGAP1), N-terminal domain {Fission yeast | 99.28 | |
| d1z7xw1 | 460 | Ribonuclease inhibitor {Human (Homo sapiens) [TaxI | 99.22 | |
| d2ca6a1 | 344 | Rna1p (RanGAP1), N-terminal domain {Fission yeast | 99.22 | |
| d2astb2 | 284 | Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa | 99.11 | |
| d1m9la_ | 198 | Outer arm dynein light chain 1 {Green algae (Chlam | 99.07 | |
| d2ifga3 | 156 | High affinity nerve growth factor receptor, N-term | 99.01 | |
| d2astb2 | 284 | Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa | 98.97 | |
| d1z7xw1 | 460 | Ribonuclease inhibitor {Human (Homo sapiens) [TaxI | 98.96 | |
| d2ifga3 | 156 | High affinity nerve growth factor receptor, N-term | 98.73 | |
| d1koha1 | 162 | mRNA export factor tap {Human (Homo sapiens) [TaxI | 98.6 | |
| d1koha1 | 162 | mRNA export factor tap {Human (Homo sapiens) [TaxI | 97.93 | |
| d1pgva_ | 167 | Tropomodulin C-terminal domain {nematode (Caenorha | 97.43 | |
| d1pgva_ | 167 | Tropomodulin C-terminal domain {nematode (Caenorha | 97.35 | |
| d1io0a_ | 166 | Tropomodulin C-terminal domain {Chicken (Gallus ga | 96.86 | |
| d1io0a_ | 166 | Tropomodulin C-terminal domain {Chicken (Gallus ga | 96.39 |
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) superfamily: L domain-like family: Internalin LRR domain domain: Internalin A species: Listeria monocytogenes [TaxId: 1639]
Probab=99.84 E-value=3.6e-20 Score=203.74 Aligned_cols=269 Identities=22% Similarity=0.283 Sum_probs=169.7
Q ss_pred ccCCcEEEecCCCccchHHhhhhcccchhhccCCCccccccccccCCCCCcchhHHHHhcCCCCCcEEEccCCCCCCCCC
Q 001271 25 IEGSIVLKLNPAGLHYVQSRLEALRELERLLAGAPLDYLRAYVSDLGDHRALEQLRRILKLLTSLKVVSALPPPARDPTP 104 (1111)
Q Consensus 25 L~~lk~L~Ls~~~L~~Lp~~L~~L~~Le~L~~~~~l~~Lrl~vLdLs~n~~L~~Lp~~L~~L~nLk~LdLs~N~Is~~iP 104 (1111)
+.+++.|+++.+++..+ +.+..+++|+. +++++|+ +..++. +.++++|++|+|++|++.+..
T Consensus 43 l~~l~~L~l~~~~I~~l-~gl~~L~nL~~--------------L~Ls~N~-l~~l~~-l~~L~~L~~L~L~~n~i~~i~- 104 (384)
T d2omza2 43 LDQVTTLQADRLGIKSI-DGVEYLNNLTQ--------------INFSNNQ-LTDITP-LKNLTKLVDILMNNNQIADIT- 104 (384)
T ss_dssp HTTCCEEECCSSCCCCC-TTGGGCTTCCE--------------EECCSSC-CCCCGG-GTTCTTCCEEECCSSCCCCCG-
T ss_pred hCCCCEEECCCCCCCCc-cccccCCCCCE--------------EeCcCCc-CCCCcc-ccCCccccccccccccccccc-
Confidence 56789999999999886 34555555443 5566665 444554 889999999999999998643
Q ss_pred ccCCCCCCCCEEEeeCCCCCccchhhHhhhhhhhhhhhccCCCccc----------------------------------
Q 001271 105 LSLLPFCRLKVLELRGCDLSTSAAKGLLELRHTLEKIICHNSTNAL---------------------------------- 150 (1111)
Q Consensus 105 ~sLs~L~nL~~LdLS~N~Ls~~~P~~L~~L~~LleLlLs~N~L~sL---------------------------------- 150 (1111)
.++.+++|+.|++++|.+++..+.. ....+.......|.+..+
T Consensus 105 -~l~~l~~L~~L~~~~~~~~~~~~~~--~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 181 (384)
T d2omza2 105 -PLANLTNLTGLTLFNNQITDIDPLK--NLTNLNRLELSSNTISDISALSGLTSLQQLSFGNQVTDLKPLANLTTLERLD 181 (384)
T ss_dssp -GGTTCTTCCEEECCSSCCCCCGGGT--TCTTCSEEEEEEEEECCCGGGTTCTTCSEEEEEESCCCCGGGTTCTTCCEEE
T ss_pred -ccccccccccccccccccccccccc--ccccccccccccccccccccccccccccccccccccchhhhhcccccccccc
Confidence 3889999999999999887533221 111111111111100000
Q ss_pred ---------hh-----------hhccccccccCCCCCCCccEEEccCCccccchhhhcCCCCCcEEEccCCCCCCCCCcC
Q 001271 151 ---------RH-----------VFASRIVEIKDSPQWNRLSFVSCSCNRLVIMDESLQLLPAVETLDLSRNKFAKVDNLR 210 (1111)
Q Consensus 151 ---------~~-----------l~~~~I~~L~~l~~L~~L~~L~Ls~N~LssLP~~L~~L~nL~~LdLS~N~Ls~L~~L~ 210 (1111)
.. +..+.+..+.....+++|+.|++++|.++.+| .+..+++|+.|++++|.++.++.+.
T Consensus 182 ~~~~~~~~~~~~~~l~~~~~l~l~~n~i~~~~~~~~~~~L~~L~l~~n~l~~~~-~l~~l~~L~~L~l~~n~l~~~~~~~ 260 (384)
T d2omza2 182 ISSNKVSDISVLAKLTNLESLIATNNQISDITPLGILTNLDELSLNGNQLKDIG-TLASLTNLTDLDLANNQISNLAPLS 260 (384)
T ss_dssp CCSSCCCCCGGGGGCTTCSEEECCSSCCCCCGGGGGCTTCCEEECCSSCCCCCG-GGGGCTTCSEEECCSSCCCCCGGGT
T ss_pred ccccccccccccccccccceeeccCCccCCCCcccccCCCCEEECCCCCCCCcc-hhhcccccchhccccCccCCCCccc
Confidence 00 00011122222334568888888888888774 5677888999999999888888888
Q ss_pred CCCCCcEEECCCCCCCCccccccccccceEeeccCCccCCcccCCCCCCCCEEEccCCCCCCCchhhhhcCCCCCcEEEe
Q 001271 211 KCVNLKHLDLGFNNLRSIAAFSEVSCHIVKLVLRNNALTTLRGIENLKSLEGLDISYNIISTFSELEFLASLPYLLNLWL 290 (1111)
Q Consensus 211 ~L~sL~~LdLS~N~Lt~L~~l~~~L~sL~~L~LS~N~Lt~L~~L~~L~sL~~LdLS~N~Is~l~~l~~L~~L~~L~~L~L 290 (1111)
.+++|+.|++++|.++.+++.. .++.++.+.+..|.++.++.+..+++++.|++++|+|+++++ +..+++|+.|+|
T Consensus 261 ~~~~L~~L~l~~~~l~~~~~~~-~~~~l~~l~~~~n~l~~~~~~~~~~~l~~L~ls~n~l~~l~~---l~~l~~L~~L~L 336 (384)
T d2omza2 261 GLTKLTELKLGANQISNISPLA-GLTALTNLELNENQLEDISPISNLKNLTYLTLYFNNISDISP---VSSLTKLQRLFF 336 (384)
T ss_dssp TCTTCSEEECCSSCCCCCGGGT-TCTTCSEEECCSSCCSCCGGGGGCTTCSEEECCSSCCSCCGG---GGGCTTCCEEEC
T ss_pred ccccCCEeeccCcccCCCCccc-cccccccccccccccccccccchhcccCeEECCCCCCCCCcc---cccCCCCCEEEC
Confidence 8888899998888888776533 235566666666666655555555666666666666655542 445556666666
Q ss_pred cCCCCCCCccchhhHhhhcCCCCeeecCCCcCCh
Q 001271 291 EGNPLCCSRWYRAQVFSYFAHPAKLKVDGKEIST 324 (1111)
Q Consensus 291 sgNpLs~~~~~r~~if~~l~~L~~L~LdgN~It~ 324 (1111)
++|+|+..+ .+..++.|+.++|++|.++.
T Consensus 337 ~~n~l~~l~-----~l~~l~~L~~L~l~~N~l~~ 365 (384)
T d2omza2 337 ANNKVSDVS-----SLANLTNINWLSAGHNQISD 365 (384)
T ss_dssp CSSCCCCCG-----GGGGCTTCCEEECCSSCCCB
T ss_pred CCCCCCCCh-----hHcCCCCCCEEECCCCcCCC
Confidence 666655322 13445556666666665553
|
| >d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} | Back information, alignment and structure |
|---|
| >d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} | Back information, alignment and structure |
|---|
| >d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} | Back information, alignment and structure |
|---|
| >d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} | Back information, alignment and structure |
|---|
| >d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} | Back information, alignment and structure |
|---|
| >d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|