Citrus Sinensis ID: 001279

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------1000------1010------1020------1030------1040------1050------1060------1070------1080------1090------1100------111
MFAKRLLQKAKHNSQHGSLTAADLNLRIAVHYGIPATASILAFDHIQRLLAIATLDGRIKVIGGDGIEGLLISPSQLPYKNLEFLQNQGFLISITNDNEIQVWSLESRSLACCLKWESNITAFSVISGSHFMYIGDENGLMSVIKYDADEGKLFQLPYNISADALSEKAGFPLLSHQPVVGVLPHPNSSGNRVLIAYENALVILWDVSEAQIIFVGGGKDLQLKDGVVDSPSEGDSTFLEGISEHQPEEKEISALCWASSSGSILAVGYIDGDILLWNTSTTASTKGQQTGSRNNVVKLELSSAERRLPVIVLHWSTNKESRSNIDGRLFVYGGDEIGSEEVLTVLSLEWSSGMENLRCVSRVDITLTGSFADMILLSSAGATVGNHKADLFVLTSPGQLHFYDNASLTTLLSQQEKKPSVCPVEFPGVIPISDPIMTVAEFMLLPFGGHSSKGLSEIATFTKLHSSHTQAGHIKWPLSGGVPSPVPITKCHSVDRVYLAGYHDGSVRIWDATYPVFKLICALDAEVQGIEVAGSRAPVSTLSFCFINSSLAVGNEFGLVYIYNLNGSLDAKNFLFVLETKSEVHALPEGKISLCRAVFSLVNSPVRALQFTSSGAKLAVGFECGRVAVLDMNLLSVLFFTDDISGSSSPIISMTWTEFKNTHSLAKNPNHSEREVPVNPAEEVIIVLFKDAKISIVGGSSENMISSSPWHLKKKVIAISMEVIAEPVCGFPIEKQAEQSAEENAAKNKPTPDTSSIETKSHETEHLFSSENACSGESSNDALVLLCCEDSVRLYSRKSVIQGNNKTVQKVKHKNRCCWASTIEKDEKVCGLLLLFQTGAVQIRSLPDLELVMESSLMSILRWNFKANMDKTISADNGQITLANGSEVAFVNLLAGENEFSILESSPCLHDKVLEAAAAAAFNVSSNQKKKQTTAAGILGGIVKGFRGEKMIHTLDDSIDPKSSFSQLGGIFSRPPFPDLSPAATNNEEIELNIDDIEIDEPPSMMATSSHEVTNTKKEKLSERERLLGVPDDAKPRLRTREEIIAKYRKAEDASSVAAHARDKLFERQDKLERISRCTEELQSGAEDFASLANELVKTMENRKWWKI
cccccccccccccccccccccccccEEEEEEEccccccEEEEEcccccEEEEEEcccEEEEEccccEEEEEEccccccEEEEEEEccccEEEEEEccccEEEEEcccccEEEEccccccEEEEEEcccccEEEEEEccccEEEEEEEccccEEEEEEcccccccccccccccccccccEEEEEEcccccccEEEEEEcccEEEEEEccccEEEEEcccccccccccccccccccccccccccccccccccEEEEEEEEcccccEEEEEEEcccEEEEEcccccccccccccccccccccccccccccccEEEEEEEccccccccccccEEEEccccccccccEEEEEEEccccccccEEEEcccccccccccEEEEEcccccccccccccEEEEccccEEEEEccccEEEEEccccccccccccccccccccccccccEEEEEEccccccccccccHHHHHcccccccccccccccccccccccccccccccccccEEEEEEcccEEEEEEcccccEEEEEEcccccccEEEccccccEEEEEEEccccEEEEEEcccEEEEEEEccccccccEEEEEccccEEEccccccccEEEEEEccccccEEEEEEcccccEEEEEEcccEEEEEEccccEEEEEEcccccccccEEEEEEcccccccccccccccccccccccccccEEEEEccccEEEEEEcccccEEEccccccccEEEEEEEEEEcccccccccccccHHHHHHHccccccccccccccccccccccccccccccccccccccEEEEEEcccEEEEEccccccccccEEEcccccccccEEEEEEEcccEEEEEEEEEcccEEEEccccccHHHHcccccHHHccccccccEEEEEcccEEEEEcccEEEEEEEEcccccEEcccccccccccccHHHHccccccccccccccccccccccccccccccccccccccccccccccHHccccccccccccccccccccccHHcccccccccccccccccccccccccccccHHHHHHHccccccccccccHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHcccccccc
cHHHHHHcccccccHHccccHHHccHHHHEHccccccccEEcccHHHEEEEEEccccEEEEEcccccEEEEEccccccEEEEEEEccccEEEEEEcccEEEEEEEcccccEEEEEcccEEEEEEEcccccEEEEEcccccEEEEEEccEEcccEEEEccHHHHcccHHcccccccccccEEEccccccccccEEEEEcccEEEEEEccccEEEEEEcccccccccccccccHHcccccHHHHHHHccccccEEEEEEEcccccEEEEEEccccEEEEEcccccccccccccccccccccccccccccccEEEEEEEEccccccccccccEEccccccccccEEEEEEcccEEEEEEEEEEEEEEEcccccEEEEEEEccccccccccccEEEEEEccccEEEEEcccHHHHHHccccccccccccccccccccccccEHHHHEEccccccccccHHHHHHHHHccccccccccccccccccccccccccccccccEEEEEEcccccEEEEccccHcHHHHEEEcccccccccccccccEEEEEEcccccEEEEEccccEEEEEEEcccccccEEEEEEccccccccccccccccEEEEEEcccccccEEEEccccEEccccccccEEEEEEccccEEEEEEEcccccccccEEcccEEEEcccccccccccccccccccccccEEEEEccccEEEEEEccccccccccccccccccEEEEEEEEcccccccccccccccccccccccccccccccEccccccccccccccccccccccccccEEEEEEcccEEEEEHHHHHcccccEEEEEccccccEEEEEEEcccccEEEEEEEEccEEEEEcccccHHHHHHcHHHHHcccccccccEEEEccccEEEEEcccEEEEEEEEcccccccccccccccccHHHHHHHHHHccccccHHHccccccccccEEEcccccccccccccccccccccHHHHHHHHccccccccccccccccccEcccccccccccccccccccccccccccccccHHHHccccccccccccccHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHcccccc
MFAKRLLQKakhnsqhgsltaaDLNLRIAVHYGIPATASILAFDHIQRLLAIATLDGrikviggdgiegllispsqlpyknleFLQNQGFLISITNDNEIQVWSLESRSLACCLKWESNITAFSvisgshfmyigdenGLMSVIKYdadegklfqlpynisadalsekagfpllshqpvvgvlphpnssgnrVLIAYENALVILWDVSEAQIIFvgggkdlqlkdgvvdspsegdstflegisehqpeeKEISALCWasssgsilavgyidgdillwntsttastkgqqtgsrnnVVKLELSSAERRLPVIVLHWstnkesrsnidgrlfvyggdeigsEEVLTVLSLEwssgmenlrcvsrvditltgSFADMILLSsagatvgnhkadlfvltspgqlhfydnaslTTLLsqqekkpsvcpvefpgvipisdpimTVAEFmllpfgghsskglsEIATFTKLhsshtqaghikwplsggvpspvpitkchsvdrvylagyhdgsvriwdaTYPVFKLICALDAEVqgievagsrapvstlsfcfinsslavgneFGLVYIYNLNGSLDAKNFLFVLETksevhalpegkISLCRAVFSLvnspvralqftssgaklavgfECGRVAVLDMNLLSVLFFtddisgssspiismtwtefknthslaknpnhserevpvnpaEEVIIVLFKDakisivggssenmissspwhLKKKVIAISMEViaepvcgfpieKQAEQSAEEnaaknkptpdtssietkshetehlfssenacsgessnDALVLLCCEdsvrlysrksviqgnNKTVQKVKhknrccwastieKDEKVCGLLLLFQTgavqirslpdLELVMESSLMSILRWNFKAnmdktisadngqitlanGSEVAFVNLLAGenefsilesspclhDKVLEAAAAAAFnvssnqkkkqttaagilggivkgfrgekmihtlddsidpkssfsqlggifsrppfpdlspaatnneeielniddieideppsmmatsshevtntkkekLSERErllgvpddakprlRTREEIIAKYRkaedassvaAHARDKLFERQDKLERISRCTEELQSGAEDFASLANELVKTMENRKWWKI
MFAKRLLqkakhnsqhgslTAADLNLRIAVHYGIPATASILAFDHIQRLLAIATLDGRIKVIGGDGIEGLLISPSQLPYKNLEFLQNQGFLISITNDNEIQVWSLESRSLACCLKWESNITAFSVISGSHFMYIGDENGLMSVIKYDADEGKLFQLPYNISADALSEKAGFPLLSHQPVVGVLPHPNSSGNRVLIAYENALVILWDVSEAQIIFVGGGKDLQLKDGVVDSPSEGDSTFLEGISEHQPEEKEISALCWASSSGSILAVGYIDGDILLWNTSTtastkgqqtgsrnnVVKLelssaerrlpVIVLhwstnkesrsnidGRLFVYGGDEIGSEEVLTVLSLEWSSGMENLRCVSRVDITLTGSFADMILLSSAGATVGNHKADLFVLTSPGQLHFYDNASLTTLLSQQEKKPSVCPVEFPGVIPISDPIMTVAEFMLLPFGGHSSKGLSEIATFTKLHSSHTQAGHIKWPLSGGVPSPVPITKCHSVDRVYLAGYHDGSVRIWDATYPVFKLICALDAEVQGIEVAGSRAPVSTLSFCFINSSLAVGNEFGLVYIYNLNGSLDAKNFLFVLETKSEVHALPEGKISLCRAVFSLVNSPVRALQFTSSGAKLAVGFECGRVAVLDMNLLSVLFFTDDISGSSSPIISMTWTEFKNTHSLAKnpnhserevpvNPAEEVIIVLFKDAKISIVGGssenmissspwHLKKKVIAISMEVIAEPVCGFPIEKQAEQSaeenaaknkptpdtssieTKSHETEHLFSSENACSGESSNDALVLLCCEDSVRLysrksviqgnnktvqkvkhknrcCWASTIEKDEKVCGLLLLFQTGAVQIRSLPDLELVMESSLMSILRWNFKANMDKTISADNGQITLANGSEVAFVNLLAGENEFSILESSPCLHDKVLEAAAAAAfnvssnqkkkqttaagilGGIVKGFRGEKMIHTLDDSIDPKSSFSQLGGIFSRPPFPDLSPAATNNEEIELNIDDIEIDEPPSMMatsshevtntkkeklsererllgvpddakprlrtREEIIAkyrkaedassvaahardklferqdkLERISRCTEELQSGAEDFASLANELVktmenrkwwki
MFAKRLLQKAKHNSQHGSLTAADLNLRIAVHYGIPATASILAFDHIQRLLAIATLDGRIKVIGGDGIEGLLISPSQLPYKNLEFLQNQGFLISITNDNEIQVWSLESRSLACCLKWESNITAFSVISGSHFMYIGDENGLMSVIKYDADEGKLFQLPYNISADALSEKAGFPLLSHQPVVGVLPHPNSSGNRVLIAYENALVILWDVSEAQIIFVGGGKDLQLKDGVVDSPSEGDSTFLEGISEHQPEEKEISALCWASSSGSILAVGYIDGDILLWNTSTTASTKGQQTGSRNNVVKLELSSAERRLPVIVLHWSTNKESRSNIDGRLFVYGGDEIGSEEVLTVLSLEWSSGMENLRCVSRVDITLTGSFADMILLSSAGATVGNHKADLFVLTSPGQLHFYDNASLTTLLSQQEKKPSVCPVEFPGVIPISDPIMTVAEFMLLPFGGHSSKGLSEIATFTKLHSSHTQAGHIKWPLSGGVPSPVPITKCHSVDRVYLAGYHDGSVRIWDATYPVFKLICALDAEVQGIEVAGSRAPVSTLSFCFINSSLAVGNEFGLVYIYNLNGSLDAKNFLFVLETKSEVHALPEGKISLCRAVFSLVNSPVRALQFTSSGAKLAVGFECGRVAVLDMNLLSVLFFTDDisgssspiisMTWTEFKNTHSLAKNPNHSEREVPVNPAEEVIIVLFKDAKISIVGGSSENMISSSPWHLKKKVIAISMEVIAEPVCGFPIEKQAEQSAEENAAKNKPTPDTSSIETKSHETEHLFSSENACSGESSNDALVLLCCEDSVRLYSRKSVIQGNNKTVQKVKHKNRCCWASTIEKDEKVCGLLLLFQTGAVQIRSLPDLELVMESSLMSILRWNFKANMDKTISADNGQITLANGSEVAFVNLLAGENEFSILESSPCLHDKVLEaaaaaaFNVSSNQKKKQTTAAGILGGIVKGFRGEKMIHTLDDSIDPKSSFSQLGGIFSRPPFPDLSPAATnneeielniddieidePPSMMATSSHEVTNTKKEKLSERERLLGVPDDAKPRLRTREEIIAKYRKAEDASSVAAHARDKLFERQDKLERISRCTEELQSGAEDFASLANELVKTMENRKWWKI
*******************TAADLNLRIAVHYGIPATASILAFDHIQRLLAIATLDGRIKVIGGDGIEGLLISPSQLPYKNLEFLQNQGFLISITNDNEIQVWSLESRSLACCLKWESNITAFSVISGSHFMYIGDENGLMSVIKYDADEGKLFQLPYNISADALSEKAGFPLLSHQPVVGVLPHPNSSGNRVLIAYENALVILWDVSEAQIIFVGGGKDLQLKD**************************ISALCWASSSGSILAVGYIDGDILLWNTS***********************AERRLPVIVLHWSTNKESRSNIDGRLFVYGGDEIGSEEVLTVLSLEWSSGMENLRCVSRVDITLTGSFADMILLSSAGATVGNHKADLFVLTSPGQLHFYDNASLTTLLSQQEKKPSVCPVEFPGVIPISDPIMTVAEFMLLPFGGHSSKGLSEIATFTKLHSSHTQAGHIKWPLSGGVPSPVPITKCHSVDRVYLAGYHDGSVRIWDATYPVFKLICALDAEVQGIEVAGSRAPVSTLSFCFINSSLAVGNEFGLVYIYNLNGSLDAKNFLFVLETKSEVHALPEGKISLCRAVFSLVNSPVRALQFTSSGAKLAVGFECGRVAVLDMNLLSVLFFTDDISGSSSPIISMTWTEFK********************AEEVIIVLFKDAKISIVGGSSENMISSSPWHLKKKVIAISMEVIAEPVCGFPI************************************************ALVLLCCEDSVRLYSRKSVIQGNNKTVQKVKHKNRCCWASTIEKDEKVCGLLLLFQTGAVQIRSLPDLELVMESSLMSILRWNFKANMDKTISADNGQITLANGSEVAFVNLLAGENEFSILESSPCLHDKVLEAAAAAAFNV*********TAAGILGGIVKGFRGEKMIHTL*********************************************************************************************************************************************************
***********************LNLRIAVHYGIPATASILAFDHIQRLLAIATLDGRIKVIGGDGIEGLLISPSQLPYKNLEFLQNQGFLISITNDNEIQVWSLESRSLACCLKWESNITAFSVISGSHFMYIGDENGLMSVIKYDADEGKLFQLPYNISADALSEKAGFPLLSHQPVVGVLPHPNSSGNRVLIAYENALVILWDVSEAQIIFVGGGKDLQLKDGVVDSPSEGDSTFLEGISEHQPEEKEISALCWASSSGSILAVGYIDGDILLWNTSTT********************SAERRLPVIVLHWSTNKESRSNIDGRLFVYGGDEIGSEEVLTVLSLEWSSGMENLRCVSRVDITLTGSFADMILLSSAGATVGNHKADLFVLTSPGQLHFYDNASLTTLLSQQEKKPSVCPVEFPGVIPISDPIMTVAEFMLLPFGGHSSKGLSEIATFTKLHSSHTQAGHIKWPLSGGVPSPVPITKCHSVDRVYLAGYHDGSVRIWDATYPVFKLICALDAEVQGIEVAGSRAPVSTLSFCFINSSLAVGNEFGLVYIYNLNGSLDAK***********VHALPEGKISLCRAVFSLVNSPVRALQFTSSGAKLAVGFECGRVAVLDMNLLSVLFFTDDISGSSSPIISMTW************************AEEVIIVLFKDAKISIVGGSSENMISSSPWHLKKKVIAISMEVIAEP**************************TSSI*************************LVLLCCEDSVRLYSRKSV**********VKHKNRCCWASTIEKDEKVCGLLLLFQTGAVQIRSLPDLELVME*********************DNGQITLANGSEVAFVNLLAGENEFSILESSPCLHDKVLEAA*************************************************************************************************************************************************************************************TMENRKWWKI
****************GSLTAADLNLRIAVHYGIPATASILAFDHIQRLLAIATLDGRIKVIGGDGIEGLLISPSQLPYKNLEFLQNQGFLISITNDNEIQVWSLESRSLACCLKWESNITAFSVISGSHFMYIGDENGLMSVIKYDADEGKLFQLPYNISADALSEKAGFPLLSHQPVVGVLPHPNSSGNRVLIAYENALVILWDVSEAQIIFVGGGKDLQLKDGVVDSPSEGDSTFLEGISEHQPEEKEISALCWASSSGSILAVGYIDGDILLWNTSTT**********RNNVVKLELSSAERRLPVIVLHWSTNKESRSNIDGRLFVYGGDEIGSEEVLTVLSLEWSSGMENLRCVSRVDITLTGSFADMILLSSAGATVGNHKADLFVLTSPGQLHFYDNASLTTL*********VCPVEFPGVIPISDPIMTVAEFMLLPFGGHSSKGLSEIATFTKLHSSHTQAGHIKWPLSGGVPSPVPITKCHSVDRVYLAGYHDGSVRIWDATYPVFKLICALDAEVQGIEVAGSRAPVSTLSFCFINSSLAVGNEFGLVYIYNLNGSLDAKNFLFVLETKSEVHALPEGKISLCRAVFSLVNSPVRALQFTSSGAKLAVGFECGRVAVLDMNLLSVLFFTDDISGSSSPIISMTWTEFKNTHSLAKNPNHSEREVPVNPAEEVIIVLFKDAKISIVGGSSENMISSSPWHLKKKVIAISMEVIAEPVCGFPIEKQA****************************************SSNDALVLLCCEDSVRLYSRKSVIQGNNKTVQKVKHKNRCCWASTIEKDEKVCGLLLLFQTGAVQIRSLPDLELVMESSLMSILRWNFKANMDKTISADNGQITLANGSEVAFVNLLAGENEFSILESSPCLHDKVLEAAAAAAFN**********TAAGILGGIVKGFRGEKMIHTLDDSIDPKSSFSQLGGIFSRPPFPDLSPAATNNEEIELNIDDIEIDEPPSMM****************ERERLLGVPDDAKPRLRTREEIIAKY***********HARDKLFERQDKLERISRCTEELQSGAEDFASLANELVKTMENRKWWKI
MFA*RLL****HNS*HGSLTAADLNLRIAVHYGIPATASILAFDHIQRLLAIATLDGRIKVIGGDGIEGLLISPSQLPYKNLEFLQNQGFLISITNDNEIQVWSLESRSLACCLKWESNITAFSVISGSHFMYIGDENGLMSVIKYDADEGKLFQLPYNISADALSEKAGFPLLSHQPVVGVLPHPNSSGNRVLIAYENALVILWDVSEAQIIFVGGGKDLQLKDGVVDSPSEGDSTFLEGISEHQPEEKEISALCWASSSGSILAVGYIDGDILLWNTSTTASTKGQQTGSRNNVVKLELSSAERRLPVIVLHWSTNKESRSNIDGRLFVYGGDEIGSEEVLTVLSLEWSSGMENLRCVSRVDITLTGSFADMILLSSAGATVGNHKADLFVLTSPGQLHFYDNASLTTLLSQQEKKPSVCPVEFPGVIPISDPIMTVAEFMLLPFGGHSSKGLSEIATFTKLHSS****************SPVP***CHSVDRVYLAGYHDGSVRIWDATYPVFKLICALDAEVQGIEVAGSRAPVSTLSFCFINSSLAVGNEFGLVYIYNLNGSLDAKNFLFVLETKSEVHALPEGKISLCRAVFSLVNSPVRALQFTSSGAKLAVGFECGRVAVLDMNLLSVLFFTDDISGSSSPIISMTWTEFKNT******************AEEVIIVLFKDAKISIVGGSSENMISSSPWHLKKKVIAISMEVIAEPV**************************************************SNDALVLLCCEDSVRLYSRKSVIQGNNKTVQKVKHKNRCCWASTIEKDEKVCGLLLLFQTGAVQIRSLPDLELVMESSLMSILRWNFKANMDKTISADNGQITLANGSEVAFVNLLAGENEFSILESSPCLHDKVLEAAAAAAFNVSSNQK*KQTTAAGIL***VKGFR************************FSRPPFPDLSP****NEEIELNIDDIEIDEPP***********************************RTREEIIAKYRKAEDASSVAAHARDKLFERQDKLERISRCTEELQSGAEDFASLANELVKTMENRKWWKI
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFAKRLLQKAKHNSQHGSLTAADLNLRIAVHYGIPATASILAFDHIQRLLAIATLDGRIKVIGGDGIEGLLISPSQLPYKNLEFLQNQGFLISITNDNEIQVWSLESRSLACCLKWESNITAFSVISGSHFMYIGDENGLMSVIKYDADEGKLFQLPYNISADALSEKAGFPLLSHQPVVGVLPHPNSSGNRVLIAYENALVILWDVSEAQIIFVGGGKDLQLKDGVVDSPSEGDSTFLEGISEHQPEEKEISALCWASSSGSILAVGYIDGDILLWNTSTTASTKGQQTGSRNNVVKLELSSAERRLPVIVLHWSTNKESRSNIDGRLFVYGGDEIGSEEVLTVLSLEWSSGMENLRCVSRVDITLTGSFADMILLSSAGATVGNHKADLFVLTSPGQLHFYDNASLTTLLSQQEKKPSVCPVEFPGVIPISDPIMTVAEFMLLPFGGHSSKGLSEIATFTKLHSSHTQAGHIKWPLSGGVPSPVPITKCHSVDRVYLAGYHDGSVRIWDATYPVFKLICALDAEVQGIEVAGSRAPVSTLSFCFINSSLAVGNEFGLVYIYNLNGSLDAKNFLFVLETKSEVHALPEGKISLCRAVFSLVNSPVRALQFTSSGAKLAVGFECGRVAVLDMNLLSVLFFTDDISGSSSPIISMTWTEFKNTHSLAKNPNHSEREVPVNPAEEVIIVLFKDAKISIVGGSSENMISSSPWHLKKKVIAISMEVIAEPVCGFPIEKQAEQSAEENAAKNKPTPDTSSIETKSHETEHLFSSENACSGESSNDALVLLCCEDSVRLYSRKSVIQGNNKTVQKVKHKNRCCWASTIEKDEKVCGLLLLFQTGAVQIRSLPDLELVMESSLMSILRWNFKANMDKTISADNGQITLANGSEVAFVNLLAGENEFSILESSPCLHDKVLEAAAAAAFNVSSNQKKKQTTAAGILGGIVKGFRGEKMIHTLDDSIDPKSSFSQLGGIFSRPPFPDLSPAATNNEEIELNIDDIEIDEPPSMMATSSHEVTNTKKEKLSERERLLGVPDDAKPRLRTREEIIAKYRKAEDASSVAAHARDKLFERQDKLERISRCTEELQSGAEDFASLANELVKTMENRKWWKI
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query1108 2.2.26 [Sep-21-2011]
Q9Y2K9 1186 Syntaxin-binding protein yes no 0.379 0.354 0.203 5e-16
Q5DQR4 1185 Syntaxin-binding protein yes no 0.379 0.355 0.203 1e-15
Q5T5C01151 Syntaxin-binding protein no no 0.374 0.360 0.220 4e-14
Q9WU701152 Syntaxin-binding protein no no 0.386 0.371 0.217 5e-14
Q8K4001152 Syntaxin-binding protein no no 0.387 0.372 0.217 6e-14
Q5SQE21159 Syntaxin-binding protein no no 0.380 0.364 0.198 2e-12
Q6P1M31020 Lethal(2) giant larvae pr no no 0.182 0.198 0.245 6e-10
Q5RCX21019 Lethal(2) giant larvae pr no no 0.182 0.198 0.245 6e-10
Q120381033 Lethal(2) giant larvae pr yes no 0.143 0.153 0.293 1e-09
P381631010 Lethal(2) giant larvae pr no no 0.148 0.162 0.279 4e-09
>sp|Q9Y2K9|STB5L_HUMAN Syntaxin-binding protein 5-like OS=Homo sapiens GN=STXBP5L PE=2 SV=2 Back     alignment and function desciption
 Score = 87.8 bits (216), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 106/522 (20%), Positives = 206/522 (39%), Gaps = 101/522 (19%)

Query: 18  SLTAADLNLRIAVHYGIPATASILAFDHIQRLLAIATLDGRIKVIGGDGIEGLLISPSQL 77
           +LT+    +   V +G P   + LAFD +Q++LAI T  G I+++G  G++      S  
Sbjct: 53  TLTSEYFQICKTVRHGFPHQPTALAFDPVQKILAIGTRTGAIRILGRPGVDCYCQHESGA 112

Query: 78  PYKNLEFLQNQGFLISITNDNEIQVWSLESRSLACCLKWESN---ITAFSVISGSHFMYI 134
               L+FL N+G L+S ++D+ + +W+L  +  A     + N   IT   +   S ++Y+
Sbjct: 113 AVLQLQFLINEGALVSASSDDTLHLWNLRQKRPAILHSLKFNRERITYCHLPFQSKWLYV 172

Query: 135 GDENGLMSVIKYDADEGKLFQLPYNISADALSEKAGFPLLSHQ-PVVGVLPHPNSSGNRV 193
           G E G   ++  ++     + + +N  A  LS K      +H  PVV +   P   G ++
Sbjct: 173 GTERGNTHIVNIESFILSGYVIMWN-KAIELSTK------THPGPVVHLSDSPRDEG-KL 224

Query: 194 LIAYENALVILWDVSEAQIIFVGGGKDLQLKDGVVDSPSEGDSTFLEGISEHQPEEKEIS 253
           LI YEN  V+ WD+   +        +L++                         ++ I 
Sbjct: 225 LIGYENGTVVFWDLKSKR-------AELRVY-----------------------YDEAIH 254

Query: 254 ALCWASSSGSILAVGYIDGDILLWN--------TSTTASTKGQQTGSRNN----VVKLEL 301
           ++ W    G      + DG + LWN         +T    K Q+ G ++     ++K+E 
Sbjct: 255 SIDW-HHEGKQFMCSHSDGSLTLWNLKSPSRPFQTTIPHGKSQREGRKSESCKPILKVEY 313

Query: 302 SSAERRLPVIVLHWSTNKESRSNIDGRLFVYGGDEIGSEEVLTVLSLEWSSGMENLRCVS 361
            + +   P I+     + +          ++G       + +TVL ++         C +
Sbjct: 314 KTCKNSEPFIIFSGGLSYDKACRRPSLTIMHG-------KAITVLEMDHPIVEFLTLCET 366

Query: 362 RVDITLTGSFADMILLSSAGATVGNHKADLFVLTSPGQLHFYDNASLTTLLSQQEKKPSV 421
                    +A ++LL      V   +++  +  +P  +  +++             P  
Sbjct: 367 PYPNEFQEPYAVVVLLEKDLIVVDLTQSNFPIFENPYPMDIHES-------------PVT 413

Query: 422 CPVEFPGVIPISDPIMTVAEFMLLPFGGHSSKGLSEIATFTKLHSSHTQAGHIKWPLSGG 481
           C   F    P  D I+ +    +     H  +G S                + +WP+SGG
Sbjct: 414 CTAYFADCPP--DLILVLYSIGV----KHKKQGYS----------------NKEWPISGG 451

Query: 482 VPSPVPITKCHSVDRVYLAGYHDGSVRIWDATYPVFKLICAL 523
             +        +   + + G+ DGS++ WDA+    +++  L
Sbjct: 452 AWN----LGAQTYPEIIITGHADGSIKFWDASAITLQMLYKL 489
May play a role in vesicle trafficking and exocytosis.
Homo sapiens (taxid: 9606)
>sp|Q5DQR4|STB5L_MOUSE Syntaxin-binding protein 5-like OS=Mus musculus GN=Stxbp5l PE=1 SV=1 Back     alignment and function description
>sp|Q5T5C0|STXB5_HUMAN Syntaxin-binding protein 5 OS=Homo sapiens GN=STXBP5 PE=1 SV=1 Back     alignment and function description
>sp|Q9WU70|STXB5_RAT Syntaxin-binding protein 5 OS=Rattus norvegicus GN=Stxbp5 PE=1 SV=1 Back     alignment and function description
>sp|Q8K400|STXB5_MOUSE Syntaxin-binding protein 5 OS=Mus musculus GN=Stxbp5 PE=1 SV=3 Back     alignment and function description
>sp|Q5SQE2|STB5L_DANRE Syntaxin-binding protein 5-like OS=Danio rerio GN=stxbp5l PE=3 SV=1 Back     alignment and function description
>sp|Q6P1M3|L2GL2_HUMAN Lethal(2) giant larvae protein homolog 2 OS=Homo sapiens GN=LLGL2 PE=1 SV=2 Back     alignment and function description
>sp|Q5RCX2|L2GL2_PONAB Lethal(2) giant larvae protein homolog 2 OS=Pongo abelii GN=LLGL2 PE=2 SV=1 Back     alignment and function description
>sp|Q12038|SRO7_YEAST Lethal(2) giant larvae protein homolog SRO7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SRO7 PE=1 SV=1 Back     alignment and function description
>sp|P38163|SRO77_YEAST Lethal(2) giant larvae protein homolog SRO77 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SRO77 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1108
2960831691127 unnamed protein product [Vitis vinifera] 0.995 0.978 0.643 0.0
2254394081176 PREDICTED: uncharacterized protein LOC10 0.984 0.927 0.652 0.0
2555826701096 nucleotide binding protein, putative [Ri 0.978 0.989 0.609 0.0
2241404331099 predicted protein [Populus trichocarpa] 0.969 0.977 0.611 0.0
3565681101115 PREDICTED: uncharacterized protein LOC10 0.994 0.988 0.577 0.0
3565233181118 PREDICTED: uncharacterized protein LOC10 0.993 0.984 0.569 0.0
4494402591085 PREDICTED: LOW QUALITY PROTEIN: uncharac 0.940 0.960 0.552 0.0
2254484591108 PREDICTED: uncharacterized protein LOC10 0.988 0.988 0.533 0.0
2977365951137 unnamed protein product [Vitis vinifera] 0.988 0.963 0.520 0.0
3071359251044 nucleotide binding protein [Cucumis melo 0.909 0.965 0.544 0.0
>gi|296083169|emb|CBI22805.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score = 1415 bits (3663), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 729/1132 (64%), Positives = 859/1132 (75%), Gaps = 29/1132 (2%)

Query: 1    MFAKRLLQKAKH-----------------NSQHGSLTAADLNLRIAVHYGIPATASILAF 43
            MFAKRL+QKA                   N QH S+   DL+LRIA+HYGIP+TASILAF
Sbjct: 1    MFAKRLIQKATQHHLHHHQHHQHQDHHQPNEQHSSVALTDLDLRIAIHYGIPSTASILAF 60

Query: 44   DHIQRLLAIATLDGRIKVIGGDGIEGLLISPSQLPYKNLEFLQNQGFLISITNDNEIQVW 103
            D IQRLLAI TLDGRIKVIGGD IEGL ISP QLPYK LEFLQNQGFL+SI+ND+EIQVW
Sbjct: 61   DPIQRLLAIGTLDGRIKVIGGDNIEGLFISPKQLPYKYLEFLQNQGFLVSISNDDEIQVW 120

Query: 104  SLESRSLACCLKWESNITAFSVISGSHFMYIGDENGLMSVIKYDADEGKLFQLPYNISAD 163
            +LE + ++CCL WESNITAFSVISGS+FMYIGDE G +SV+K +AD+GKL QLPYNI A 
Sbjct: 121  NLERQCISCCLHWESNITAFSVISGSNFMYIGDEYGSISVLKCEADDGKLLQLPYNIFAK 180

Query: 164  ALSEKAGFPLLSHQPVVGVLPHPNSSGNRVLIAYENALVILWDVSEAQIIFVGGGKDLQL 223
            ++SE  GF   +HQPV+GVLP P SSGNRVLIAYEN L+ILWDVSEAQII   G K+LQL
Sbjct: 181  SISEAGGFSFFNHQPVIGVLPQPCSSGNRVLIAYENGLIILWDVSEAQIIVAKGDKNLQL 240

Query: 224  KDGVVDSPSEGDSTFLEGISEHQPEEKEISALCWASSSGSILAVGYIDGDILLWNTSTTA 283
             D  VDSPSE DS   +  SE   EEKEISALCWASS GSILAVGYIDGDIL WN S+ A
Sbjct: 241  NDRAVDSPSEADSNLPDDASEQHLEEKEISALCWASSDGSILAVGYIDGDILFWNLSSAA 300

Query: 284  STKGQQTGSR-NNVVKLELSSAERRLPVIVLHWSTNKESRSNIDGRLFVYGGDEIGSEEV 342
            STKGQQTGS  NNVVKL+LSSAERRLP+IVLHWST+ +  ++ DG LF+YGGD IGSEEV
Sbjct: 301  STKGQQTGSLGNNVVKLQLSSAERRLPIIVLHWSTSNKPHNDRDGLLFIYGGDAIGSEEV 360

Query: 343  LTVLSLEWSSGMENLRCVSRVDITLTGSFADMILLSSAGATVGNHKADLFVLTSPGQLHF 402
            LT+LSLEWSSG+E LRC  RV++TL GSFADMILL +AGAT  N  A LFVLT+PGQLHF
Sbjct: 361  LTILSLEWSSGVETLRCAGRVELTLVGSFADMILLPTAGATGINQNASLFVLTNPGQLHF 420

Query: 403  YDNASLTTLLSQQEKKPSVCPVEFPGVIPISDPIMTVAEFMLLPFGGHSSKGLSEIATFT 462
            YD+ASL+ L+SQQE+K S+  VEFP  +P SDP MTVA+   L  GG+SSK LSEIA+  
Sbjct: 421  YDDASLSALISQQERKSSLSAVEFPAAVPTSDPYMTVAKLSFLHTGGNSSKALSEIASVM 480

Query: 463  KLHSSHTQAGHIKWPLSGGVPSPVPITKCHSVDRVYLAGYHDGSVRIWDATYPVFKLICA 522
            K  S+ T  G  KWPL+GGVPS +   +   V+RVY+AGY DGSVRIWDATYPV  LIC 
Sbjct: 481  KHVSTPTLTGRAKWPLTGGVPSQLSFAEGKRVERVYVAGYQDGSVRIWDATYPVLSLICV 540

Query: 523  LDAEVQGIEVAGSRAPVSTLSFCFINSSLAVGNEFGLVYIYNLNGSLDAKNFLFVLETKS 582
            L+ EVQGI+VAGS A VS L FC +  SLAVGN  GLV +Y+LN + D  +F FV E+  
Sbjct: 541  LEGEVQGIKVAGSSASVSKLDFCHLTLSLAVGNACGLVRVYDLNDNSDKTSFHFVTESNQ 600

Query: 583  EVHALPEGKISLCRAVFSLVNSPVRALQFTSSGAKLAVGFECGRVAVLDMNLLSVLFFTD 642
            EVH LP+ K   CRA F L+NSP++AL++T+ G KLAVGFECGRVAVLDMN LSVL   D
Sbjct: 601  EVHVLPQQKGPQCRAAFCLLNSPIQALKYTNKGGKLAVGFECGRVAVLDMNSLSVLLSMD 660

Query: 643  DISGSSSPIISMTWTEFKNTHSLAKNPNHSEREVPVNPAEEVIIVLFKDAKISIVGGSSE 702
             ISGSSSP+IS+ W    N H+L K+P HSE E+  +P +E++ +L KD+K+ ++ GS+ 
Sbjct: 661  CISGSSSPVISIIWKAITNNHTLVKSPKHSESEISNDPPKELMFILTKDSKVVVIDGSTG 720

Query: 703  NMISSSPWHLKKKVIAISMEVIAE--PVCGFPIEKQAEQSAEENAAKNKPTPDTSSIETK 760
            NMI+S P HLKK+  AISM VI +  PV G   EK   QS+ E   KN+P  DT  +   
Sbjct: 721  NMINSGPMHLKKESTAISMYVIEDNVPVSGSSNEKLL-QSSSEAPTKNEPVQDTVPVGIN 779

Query: 761  SHETEHLFSSENACSGESSNDALVLLCCEDSVRLYSRKSVIQGNNKTVQKVKHKNRCCWA 820
            S  +    SSE   SG    D+ VLLCCE+++RLY  KSVIQG+NK + KV+    CCW 
Sbjct: 780  SPGS----SSETMYSGARLLDSHVLLCCENALRLYPTKSVIQGDNKPICKVELAKPCCWT 835

Query: 821  STIEKDEKVCGLLLLFQTGAVQIRSLPDLELVMESSLMSILRWNFKANMDKTISAD-NGQ 879
            +  +KDEKV GL+LL+QTGA++IRSLPDLE+V ESSLMSILRW FKANMDKTIS+  +GQ
Sbjct: 836  TIFKKDEKVYGLMLLYQTGAIEIRSLPDLEVVSESSLMSILRWAFKANMDKTISSSHDGQ 895

Query: 880  ITLANGSEVAFVNLLAGENEFSILESSPCLHDKVLEAAAAAAFNVSSNQKKKQTTAAGIL 939
            I LANG E+AF++LL GEN F I ES PCLHDKVL AAA AA  +SSNQKKKQ TA G+L
Sbjct: 896  IALANGCELAFISLLGGENGFRIPESFPCLHDKVLAAAADAAIGLSSNQKKKQGTAPGVL 955

Query: 940  GGIVKGFRGEKMIHTLDDSIDPKSSFSQLGGIFSRPPFPDLSPAATNNEE-IELNIDDIE 998
             GIVKGF+G K+IH +D S   KS+F+ L  IF R PFPD SP AT+N+E +ELNID+IE
Sbjct: 956  SGIVKGFKGGKVIHNVDLSASAKSNFAHLEDIFLRSPFPDPSPTATDNQEVVELNIDEIE 1015

Query: 999  I-DEPPSMMATSSHEVTNTKKEKLSERERLL-GVPDDAKPRLRTREEIIAKYRKAEDASS 1056
            I DEP  + +TSS +V N KKEK +ERERL  G   D +PR+RTREEIIAKYRK  DASS
Sbjct: 1016 IDDEPLPVASTSSRQVKNHKKEKGTERERLFQGTTADIEPRMRTREEIIAKYRKTGDASS 1075

Query: 1057 VAAHARDKLFERQDKLERISRCTEELQSGAEDFASLANELVKTMENRKWWKI 1108
            VAAHARDKL ERQ+KLERIS+ TEELQSGAEDFASLANELVK ME RKW++I
Sbjct: 1076 VAAHARDKLVERQEKLERISKRTEELQSGAEDFASLANELVKAMEGRKWYQI 1127

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|225439408|ref|XP_002263824.1| PREDICTED: uncharacterized protein LOC100257563 [Vitis vinifera] Back     alignment and taxonomy information
>gi|255582670|ref|XP_002532114.1| nucleotide binding protein, putative [Ricinus communis] gi|223528217|gb|EEF30276.1| nucleotide binding protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|224140433|ref|XP_002323587.1| predicted protein [Populus trichocarpa] gi|222868217|gb|EEF05348.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356568110|ref|XP_003552256.1| PREDICTED: uncharacterized protein LOC100776508 [Glycine max] Back     alignment and taxonomy information
>gi|356523318|ref|XP_003530287.1| PREDICTED: uncharacterized protein LOC100779801 [Glycine max] Back     alignment and taxonomy information
>gi|449440259|ref|XP_004137902.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC101217343 [Cucumis sativus] Back     alignment and taxonomy information
>gi|225448459|ref|XP_002272182.1| PREDICTED: uncharacterized protein LOC100250143 [Vitis vinifera] Back     alignment and taxonomy information
>gi|297736595|emb|CBI25466.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|307135925|gb|ADN33787.1| nucleotide binding protein [Cucumis melo subsp. melo] gi|307136468|gb|ADN34272.1| nucleotide binding protein [Cucumis melo subsp. melo] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1108
TAIR|locus:21696721124 AT5G05570 "AT5G05570" [Arabido 0.977 0.963 0.436 3.3e-230
FB|FBgn0030412 1470 tomosyn "tomosyn" [Drosophila 0.164 0.123 0.268 4e-21
ZFIN|ZDB-GENE-041001-1611129 stxbp5a "syntaxin binding prot 0.165 0.162 0.305 3.7e-20
UNIPROTKB|Q5T5C01151 STXBP5 "Syntaxin-binding prote 0.164 0.158 0.293 1.2e-18
MGI|MGI:19260581152 Stxbp5 "syntaxin binding prote 0.165 0.158 0.295 1.9e-18
UNIPROTKB|E1BNK41152 STXBP5 "Uncharacterized protei 0.164 0.157 0.293 5.9e-18
UNIPROTKB|F1S7R81115 STXBP5 "Uncharacterized protei 0.164 0.163 0.298 9e-18
UNIPROTKB|E2R4F71152 STXBP5 "Uncharacterized protei 0.164 0.157 0.293 1.5e-17
UNIPROTKB|C9JQS31129 STXBP5L "Syntaxin-binding prot 0.165 0.162 0.300 3.1e-17
UNIPROTKB|E9PFI21162 STXBP5L "Syntaxin-binding prot 0.165 0.157 0.300 3.7e-17
TAIR|locus:2169672 AT5G05570 "AT5G05570" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 2221 (786.9 bits), Expect = 3.3e-230, P = 3.3e-230
 Identities = 502/1149 (43%), Positives = 694/1149 (60%)

Query:     1 MFAKRLLQKAKHNSQ---------HGSLTAADLNLRIAVHYGIPATASILAFDHIQRLLA 51
             MF ++ LQK+               G L A DL+  I  H GIP+TAS+LAFD IQ LLA
Sbjct:     1 MFVRKFLQKSSGGQNPPPPIAPPPRGCLMAEDLDPHIITHSGIPSTASLLAFDPIQCLLA 60

Query:    52 IATLDGRIKVIGGDGIEGLLISPSQLPYKNLEFLQNQGFLISITNDNEIQVWSLESRSLA 111
             + TLDGRIKVIGGD IE +L SP QLP+KNLEF+QNQGFL+SI+N+NEIQVW L+ R  A
Sbjct:    61 VGTLDGRIKVIGGDNIEAILASPKQLPFKNLEFMQNQGFLVSISNENEIQVWDLDLRQPA 120

Query:   112 CCLKWESNITAFSVISGSHFMYIGDENGLMSVIKYDADEGKLFQLPYNISADALSEKAGF 171
               LKWESNITAF+++ G+ +MY+GDE G++SV+ Y ADEGKL QLPY +  DALSE AG 
Sbjct:   121 SSLKWESNITAFAILHGTGYMYVGDEYGMVSVLNYSADEGKLLQLPYYVPTDALSEAAGL 180

Query:   172 PLLSHQPVVGVLPHPNSSGNRVLIAYENALVILWDVSEAQIIFVGGGKDLQLKDGVVDSP 231
                   PVVG+L  P S G R+LIA+ N L+ LWD SE  ++ V G KDL ++   V   
Sbjct:   181 SSPIDYPVVGLLSQPCSKGTRLLIAFSNGLLFLWDASEDHVVLVRGNKDLPVEGKTVADS 240

Query:   232 SEGDSTFLEGISEHQPEEKEISALCWASSSGSILAVGYIDGDILLWNTSTTASTKGQQTG 291
              E      + +S  + + KEIS+LCWAS+ GS+LAVGY+DGDIL W+ S      GQ+  
Sbjct:   241 LEASH---DELSNLELDGKEISSLCWASTDGSVLAVGYVDGDILFWDFSD-----GQKGK 292

Query:   292 SRNNVVKLELSSAERRLPVIVLHWSTNKESRSNIDGRLFVYGGDEIGSEEVLTVLSLEWS 351
               N+VVKL+LSSAE+RLPVIV+HW  +  SR +  G+LF+YGGD IGS+EVLT+L L+WS
Sbjct:   293 PSNHVVKLQLSSAEKRLPVIVMHWCLDV-SRKSSGGKLFIYGGDIIGSDEVLTMLGLDWS 351

Query:   352 SGMENLRCVSRVDITLTGSFADMILLSSAGATVGNHKADLFVLTSPGQLHFYDNASLTTL 411
             SGM  L+CV R D+TL+GSFADM+L   A +        LF+LT+PGQL  YD+ SL +L
Sbjct:   352 SGMGGLKCVGRADLTLSGSFADMVLSPIASSRQSG--VFLFLLTNPGQLQAYDDTSLASL 409

Query:   412 LSQQEKKPSVCPVEFPGVIPISDPIMTVAEFMLLPFGGHSSKGLSEIATFTKLHSSHTQA 471
             +SQ+E K SV P+ +P V+P  DP MTVA F  L     +S  LSEI    K  +  T +
Sbjct:   410 MSQKENKISVSPLPYPMVVPTMDPHMTVATFSALNVNDKTSLALSEIVLAAKARTPRTPS 469

Query:   472 GH-IKWPLSGGVPSPVPITKCHSVDRVYLAGYHDGSVRIWDATYPVFKLICALDAEVQGI 530
             G   +WPL+GGVPS V   K   ++R+Y+AGY DGS+RIWDATYP   LI  L+ +   I
Sbjct:   470 GESAQWPLTGGVPSHVDDYK---LERLYMAGYQDGSMRIWDATYPCLSLIYILEPKASVI 526

Query:   531 EVAGSRAPVSTLSFCFINSSLAVGNEFGLVYIYNL-----NGSLDA-----KNFLFVLET 580
             ++ G  A V+   FC   S LAVGNE G+V +Y L      G+L+      K  L ++ T
Sbjct:   527 DITGVDASVTAFCFCSKTSCLAVGNECGMVRLYKLVGHTSGGTLEVVTNTEKKGLAIVTT 586

Query:   581 KSE--VHALPE--GKISLCR-----------AVFSLVNSPVRALQFTSSGAKLAVGFECG 625
              +    +AL    G + +             A FS ++SPV  LQF  S  +LAVGF+CG
Sbjct:   587 LTLWICYALSHAVGSLLVAHHLHQEDGPQWLAAFSFLSSPVCTLQFVQSTRRLAVGFKCG 646

Query:   626 RVAVLDMNLLSVLFFTDDXXXXXXXXXXM-TWTEFKNTHSLAKNPNHSEREVPVNPAEEV 684
             +VAVLD+ + SVLF T+           +   +    T S +   +H+     +N  +++
Sbjct:   647 KVAVLDIGVPSVLFVTNSLSDSGSPIKSLYVKSSSAPTGSKSDPTDHNS----INSEDDL 702

Query:   685 II-VLFKDAKISIVGGSSENMISSSPWHLKKKVIAISMEVIAEPVCGF--PIEKQAEQSA 741
             ++  + KD +  ++ G++  +++S    LK    AI M +I      +  P EK AE  +
Sbjct:   703 LLCAMTKDGQTILLDGNTGKILASCLRPLKNPT-AICMHIIENCYENYETPSEKPAENPS 761

Query:   742 EENAAKNKPTPDTSSIETKSHETEHLFSSENACSGESSNDALVLLCCEDSVRLYSRKSVI 801
              ++  +NK     +S E+ S + E    +E     +   ++L L+C ED++RLY+ KS+ 
Sbjct:   762 GKDKHENKSHIIKAS-ESHSPDGEQNAVTETKLIDQIFANSLFLMCSEDALRLYTVKSLS 820

Query:   802 QGNNKTVQKVKHKNRCCWASTIEKDEKVCGLLLLFQTGAVQIRSLPDLELVMESSLMSIL 861
             QG+ +++ +V     CCW   ++KD + C +LL ++TG ++IRS P+LE+V ESSL+S+L
Sbjct:   821 QGSLESIMEVNLPRPCCWMGILKKDGRECAVLLFYRTGHIEIRSFPNLEVVGESSLLSLL 880

Query:   862 RWNFKANMDKTISADN-GQITLANGSEVAFVNLLAGENEFSILESSPCLHDKVLEXXXXX 920
             RWNFK NM+KT+ +D+ G + L NG EVA ++ LA  N F + ES P LHDKVL      
Sbjct:   881 RWNFKPNMEKTVCSDDFGHVVLVNGCEVAILSFLAHANGFRLPESLPLLHDKVLAAAADA 940

Query:   921 XFNVSSNQKKKQTTAAGILGGIVKGFRGEKMIHTLDDSIDPKSSFSQLGGIFSRPPFPDL 980
              F+  S  KK    A   L  I+KGFR      + +  +D    FS LG IFS PP+   
Sbjct:   941 TFSHISVHKKNHDGAPKFLSNIIKGFRS-----STEQKMDQVQDFSHLGNIFSNPPYLKP 995

Query:   981 SPAATXXXXXXXXXXXXXXXXPPSMMATSSHEVTNTKKEKLSERERLL-GVPDDAKPRLR 1039
             S                     P ++   + +    KK+K +++E+L  G   DA+P+ R
Sbjct:   996 SDTGGDDEKIVELNIDDIEIDEPVIILPLTEKDKKEKKDKRTDKEKLFDGASSDAQPKTR 1055

Query:  1040 TREEIIAKYRKAEDASSVAAHARDKLFERQDKLERISRCTEELQSGAEDFASLANELVKT 1099
             T +EI +KYRKA + S++A+ A+DKL ER +KLERIS+ T ELQ  AE+FAS+A+EL K 
Sbjct:  1056 TVDEIKSKYRKAGETSAIASQAKDKLHERGEKLERISQRTAELQDNAENFASMAHELAKQ 1115

Query:  1100 MENRKWWKI 1108
             ME RKWW I
Sbjct:  1116 MEKRKWWNI 1124
GO:0000166 "nucleotide binding" evidence=ISS
GO:0003676 "nucleic acid binding" evidence=IEA
GO:0005634 "nucleus" evidence=ISM
GO:0008168 "methyltransferase activity" evidence=IEA
GO:0016021 "integral to membrane" evidence=IEA
GO:0016192 "vesicle-mediated transport" evidence=IEA
GO:0032259 "methylation" evidence=IEA
GO:0005886 "plasma membrane" evidence=IDA
FB|FBgn0030412 tomosyn "tomosyn" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-041001-161 stxbp5a "syntaxin binding protein 5a (tomosyn)" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|Q5T5C0 STXBP5 "Syntaxin-binding protein 5" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:1926058 Stxbp5 "syntaxin binding protein 5 (tomosyn)" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|E1BNK4 STXBP5 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1S7R8 STXBP5 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|E2R4F7 STXBP5 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|C9JQS3 STXBP5L "Syntaxin-binding protein 5-like" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E9PFI2 STXBP5L "Syntaxin-binding protein 5-like" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1108
pfam0095789 pfam00957, Synaptobrevin, Synaptobrevin 2e-04
cd00200289 cd00200, WD40, WD40 domain, found in a number of e 7e-04
>gnl|CDD|201526 pfam00957, Synaptobrevin, Synaptobrevin Back     alignment and domain information 
 Score = 40.6 bits (96), Expect = 2e-04
 Identities = 19/45 (42%), Positives = 26/45 (57%), Gaps = 4/45 (8%)

Query: 1063 DKLFERQDKLERISRCTEELQSGAEDFASLANELVKTMENRKWWK 1107
            DK+ ER +KL+ +   TE LQS A+ F   A +L + M    WWK
Sbjct: 24   DKVLERGEKLDLLVDKTENLQSSAQQFRKQARKLKRKM----WWK 64

Length = 89
>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 1108
KOG0319775 consensus WD40-repeat-containing subunit of the 18 100.0
KOG0271480 consensus Notchless-like WD40 repeat-containing pr 100.0
KOG0319775 consensus WD40-repeat-containing subunit of the 18 100.0
KOG0271480 consensus Notchless-like WD40 repeat-containing pr 100.0
KOG0318603 consensus WD40 repeat stress protein/actin interac 100.0
KOG0291893 consensus WD40-repeat-containing subunit of the 18 100.0
KOG0306888 consensus WD40-repeat-containing subunit of the 18 100.0
KOG0291893 consensus WD40-repeat-containing subunit of the 18 100.0
KOG1983993 consensus Tomosyn and related SNARE-interacting pr 100.0
KOG0306888 consensus WD40-repeat-containing subunit of the 18 100.0
KOG0272459 consensus U4/U6 small nuclear ribonucleoprotein Pr 100.0
KOG0318603 consensus WD40 repeat stress protein/actin interac 100.0
KOG0272459 consensus U4/U6 small nuclear ribonucleoprotein Pr 100.0
KOG1408 1080 consensus WD40 repeat protein [Function unknown] 99.98
KOG1063764 consensus RNA polymerase II elongator complex, sub 99.97
KOG0296399 consensus Angio-associated migratory cell protein 99.97
KOG0273524 consensus Beta-transducin family (WD-40 repeat) pr 99.97
KOG0286343 consensus G-protein beta subunit [General function 99.97
KOG0286343 consensus G-protein beta subunit [General function 99.97
KOG0273524 consensus Beta-transducin family (WD-40 repeat) pr 99.97
KOG1539910 consensus WD repeat protein [General function pred 99.97
KOG2106626 consensus Uncharacterized conserved protein, conta 99.97
KOG0315311 consensus G-protein beta subunit-like protein (con 99.97
KOG0315311 consensus G-protein beta subunit-like protein (con 99.96
KOG0279315 consensus G protein beta subunit-like protein [Sig 99.96
KOG0276794 consensus Vesicle coat complex COPI, beta' subunit 99.96
KOG0296399 consensus Angio-associated migratory cell protein 99.96
KOG0295406 consensus WD40 repeat-containing protein [Function 99.96
KOG0263707 consensus Transcription initiation factor TFIID, s 99.96
KOG0292 1202 consensus Vesicle coat complex COPI, alpha subunit 99.96
KOG0263707 consensus Transcription initiation factor TFIID, s 99.96
KOG0279315 consensus G protein beta subunit-like protein [Sig 99.95
KOG0285460 consensus Pleiotropic regulator 1 [RNA processing 99.95
KOG2048691 consensus WD40 repeat protein [General function pr 99.95
KOG0645312 consensus WD40 repeat protein [General function pr 99.95
KOG0293519 consensus WD40 repeat-containing protein [Function 99.95
PLN00181793 protein SPA1-RELATED; Provisional 99.95
KOG1539910 consensus WD repeat protein [General function pred 99.95
KOG0276794 consensus Vesicle coat complex COPI, beta' subunit 99.95
KOG0292 1202 consensus Vesicle coat complex COPI, alpha subunit 99.95
KOG0284464 consensus Polyadenylation factor I complex, subuni 99.95
PLN00181793 protein SPA1-RELATED; Provisional 99.94
KOG0265338 consensus U5 snRNP-specific protein-like factor an 99.94
KOG0295406 consensus WD40 repeat-containing protein [Function 99.94
KOG0645312 consensus WD40 repeat protein [General function pr 99.94
KOG0266456 consensus WD40 repeat-containing protein [General 99.94
KOG0285460 consensus Pleiotropic regulator 1 [RNA processing 99.94
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 99.94
KOG0265338 consensus U5 snRNP-specific protein-like factor an 99.94
KOG1063764 consensus RNA polymerase II elongator complex, sub 99.94
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 99.94
KOG0284464 consensus Polyadenylation factor I complex, subuni 99.94
KOG0282503 consensus mRNA splicing factor [Function unknown] 99.93
KOG0266456 consensus WD40 repeat-containing protein [General 99.93
KOG14081080 consensus WD40 repeat protein [Function unknown] 99.93
KOG0281499 consensus Beta-TrCP (transducin repeats containing 99.93
KOG0282503 consensus mRNA splicing factor [Function unknown] 99.93
KOG0278334 consensus Serine/threonine kinase receptor-associa 99.93
KOG2106626 consensus Uncharacterized conserved protein, conta 99.92
KOG0293519 consensus WD40 repeat-containing protein [Function 99.92
KOG0281499 consensus Beta-TrCP (transducin repeats containing 99.92
KOG0310487 consensus Conserved WD40 repeat-containing protein 99.91
KOG0772641 consensus Uncharacterized conserved protein, conta 99.91
KOG0275508 consensus Conserved WD40 repeat-containing protein 99.91
KOG0313423 consensus Microtubule binding protein YTM1 (contai 99.91
KOG0313423 consensus Microtubule binding protein YTM1 (contai 99.9
KOG0268433 consensus Sof1-like rRNA processing protein (conta 99.9
KOG0275508 consensus Conserved WD40 repeat-containing protein 99.9
KOG0316307 consensus Conserved WD40 repeat-containing protein 99.9
KOG0772641 consensus Uncharacterized conserved protein, conta 99.89
KOG0316307 consensus Conserved WD40 repeat-containing protein 99.89
KOG0643327 consensus Translation initiation factor 3, subunit 99.89
KOG1407313 consensus WD40 repeat protein [Function unknown] 99.89
KOG0299479 consensus U3 snoRNP-associated protein (contains W 99.88
KOG0640430 consensus mRNA cleavage stimulating factor complex 99.88
KOG0643327 consensus Translation initiation factor 3, subunit 99.88
KOG0278334 consensus Serine/threonine kinase receptor-associa 99.88
KOG2048691 consensus WD40 repeat protein [General function pr 99.88
KOG0288459 consensus WD40 repeat protein TipD [General functi 99.87
KOG0299479 consensus U3 snoRNP-associated protein (contains W 99.87
KOG0277311 consensus Peroxisomal targeting signal type 2 rece 99.86
KOG0274537 consensus Cdc4 and related F-box and WD-40 protein 99.86
KOG0283712 consensus WD40 repeat-containing protein [Function 99.86
PTZ00421493 coronin; Provisional 99.86
KOG14451012 consensus Tumor-specific antigen (contains WD repe 99.86
KOG0305484 consensus Anaphase promoting complex, Cdc20, Cdh1, 99.86
KOG0274537 consensus Cdc4 and related F-box and WD-40 protein 99.86
KOG0277311 consensus Peroxisomal targeting signal type 2 rece 99.86
KOG1963792 consensus WD40 repeat protein [General function pr 99.86
KOG0288459 consensus WD40 repeat protein TipD [General functi 99.86
KOG0647347 consensus mRNA export protein (contains WD40 repea 99.86
KOG0973942 consensus Histone transcription regulator HIRA, WD 99.85
KOG0310487 consensus Conserved WD40 repeat-containing protein 99.85
KOG0973 942 consensus Histone transcription regulator HIRA, WD 99.85
KOG0640430 consensus mRNA cleavage stimulating factor complex 99.85
KOG0289506 consensus mRNA splicing factor [General function p 99.84
KOG1036323 consensus Mitotic spindle checkpoint protein BUB3, 99.84
KOG0283712 consensus WD40 repeat-containing protein [Function 99.84
PTZ00421493 coronin; Provisional 99.84
KOG2055514 consensus WD40 repeat protein [General function pr 99.84
KOG0308735 consensus Conserved WD40 repeat-containing protein 99.83
KOG2096420 consensus WD40 repeat protein [General function pr 99.83
KOG1446311 consensus Histone H3 (Lys4) methyltransferase comp 99.83
PTZ00420568 coronin; Provisional 99.83
KOG1446311 consensus Histone H3 (Lys4) methyltransferase comp 99.83
KOG0646476 consensus WD40 repeat protein [General function pr 99.83
KOG0294362 consensus WD40 repeat-containing protein [Function 99.83
KOG0308735 consensus Conserved WD40 repeat-containing protein 99.83
KOG0301745 consensus Phospholipase A2-activating protein (con 99.83
KOG0641350 consensus WD40 repeat protein [General function pr 99.83
PTZ00420568 coronin; Provisional 99.83
KOG0300481 consensus WD40 repeat-containing protein [Function 99.83
KOG0647347 consensus mRNA export protein (contains WD40 repea 99.83
KOG1407313 consensus WD40 repeat protein [Function unknown] 99.82
KOG1036323 consensus Mitotic spindle checkpoint protein BUB3, 99.82
KOG0305484 consensus Anaphase promoting complex, Cdc20, Cdh1, 99.82
KOG0300481 consensus WD40 repeat-containing protein [Function 99.82
KOG0641350 consensus WD40 repeat protein [General function pr 99.82
PF08596395 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; 99.81
KOG4283397 consensus Transcription-coupled repair protein CSA 99.81
KOG0289506 consensus mRNA splicing factor [General function p 99.81
KOG2055514 consensus WD40 repeat protein [General function pr 99.81
KOG1332299 consensus Vesicle coat complex COPII, subunit SEC1 99.81
KOG0294362 consensus WD40 repeat-containing protein [Function 99.8
KOG0268433 consensus Sof1-like rRNA processing protein (conta 99.8
KOG1332299 consensus Vesicle coat complex COPII, subunit SEC1 99.8
KOG0269839 consensus WD40 repeat-containing protein [Function 99.79
KOG0301745 consensus Phospholipase A2-activating protein (con 99.79
KOG0646476 consensus WD40 repeat protein [General function pr 99.79
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 99.78
KOG2096420 consensus WD40 repeat protein [General function pr 99.78
KOG0650733 consensus WD40 repeat nucleolar protein Bop1, invo 99.78
KOG1274933 consensus WD40 repeat protein [General function pr 99.77
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 99.77
KOG0639705 consensus Transducin-like enhancer of split protei 99.77
KOG0321720 consensus WD40 repeat-containing protein L2DTL [Fu 99.76
KOG2445361 consensus Nuclear pore complex component (sc Seh1) 99.76
KOG1273405 consensus WD40 repeat protein [General function pr 99.75
KOG0639705 consensus Transducin-like enhancer of split protei 99.75
KOG0321720 consensus WD40 repeat-containing protein L2DTL [Fu 99.73
KOG1274933 consensus WD40 repeat protein [General function pr 99.73
KOG0267 825 consensus Microtubule severing protein katanin p80 99.72
KOG4328498 consensus WD40 protein [Function unknown] 99.72
KOG4283397 consensus Transcription-coupled repair protein CSA 99.72
KOG0264422 consensus Nucleosome remodeling factor, subunit CA 99.71
KOG0264422 consensus Nucleosome remodeling factor, subunit CA 99.71
KOG1273405 consensus WD40 repeat protein [General function pr 99.71
KOG1188376 consensus WD40 repeat protein [General function pr 99.69
KOG0267825 consensus Microtubule severing protein katanin p80 99.68
COG2319466 FOG: WD40 repeat [General function prediction only 99.68
KOG0650733 consensus WD40 repeat nucleolar protein Bop1, invo 99.68
KOG15381081 consensus Uncharacterized conserved protein WDR10, 99.67
KOG4378673 consensus Nuclear protein COP1 [Signal transductio 99.67
KOG2445361 consensus Nuclear pore complex component (sc Seh1) 99.67
KOG14451012 consensus Tumor-specific antigen (contains WD repe 99.67
KOG0270463 consensus WD40 repeat-containing protein [Function 99.66
KOG0269839 consensus WD40 repeat-containing protein [Function 99.65
KOG0270463 consensus WD40 repeat-containing protein [Function 99.65
KOG0302440 consensus Ribosome Assembly protein [General funct 99.64
KOG1963792 consensus WD40 repeat protein [General function pr 99.62
KOG1034385 consensus Transcriptional repressor EED/ESC/FIE, r 99.62
KOG12401431 consensus Protein kinase containing WD40 repeats [ 99.62
KOG4227609 consensus WD40 repeat protein [General function pr 99.62
KOG4328498 consensus WD40 protein [Function unknown] 99.61
KOG0302440 consensus Ribosome Assembly protein [General funct 99.61
COG2319466 FOG: WD40 repeat [General function prediction only 99.59
KOG15171387 consensus Guanine nucleotide binding protein MIP1 99.58
KOG15381081 consensus Uncharacterized conserved protein WDR10, 99.58
KOG19121062 consensus WD40 repeat protein [General function pr 99.57
KOG1034385 consensus Transcriptional repressor EED/ESC/FIE, r 99.57
KOG0322323 consensus G-protein beta subunit-like protein GNB1 99.57
KOG0322323 consensus G-protein beta subunit-like protein GNB1 99.57
KOG15171387 consensus Guanine nucleotide binding protein MIP1 99.56
KOG2919406 consensus Guanine nucleotide-binding protein [Gene 99.56
KOG4378673 consensus Nuclear protein COP1 [Signal transductio 99.54
KOG1009434 consensus Chromatin assembly complex 1 subunit B/C 99.52
KOG0642577 consensus Cell-cycle nuclear protein, contains WD- 99.51
KOG2919406 consensus Guanine nucleotide-binding protein [Gene 99.51
KOG1587555 consensus Cytoplasmic dynein intermediate chain [C 99.51
KOG03071049 consensus Vesicle coat complex COPII, subunit SEC3 99.51
KOG1009434 consensus Chromatin assembly complex 1 subunit B/C 99.5
PRK11028330 6-phosphogluconolactonase; Provisional 99.5
KOG03071049 consensus Vesicle coat complex COPII, subunit SEC3 99.49
KOG4227609 consensus WD40 repeat protein [General function pr 99.48
KOG06441113 consensus Uncharacterized conserved protein, conta 99.47
KOG0771398 consensus Prolactin regulatory element-binding pro 99.46
KOG1007370 consensus WD repeat protein TSSC1, WD repeat super 99.44
KOG1007370 consensus WD repeat protein TSSC1, WD repeat super 99.44
KOG0642577 consensus Cell-cycle nuclear protein, contains WD- 99.43
KOG1523361 consensus Actin-related protein Arp2/3 complex, su 99.43
KOG0290364 consensus Conserved WD40 repeat-containing protein 99.42
KOG1587555 consensus Cytoplasmic dynein intermediate chain [C 99.42
KOG0303472 consensus Actin-binding protein Coronin, contains 99.4
KOG0290364 consensus Conserved WD40 repeat-containing protein 99.39
KOG4497447 consensus Uncharacterized conserved protein WDR8, 99.39
KOG0303472 consensus Actin-binding protein Coronin, contains 99.38
KOG2394636 consensus WD40 protein DMR-N9 [General function pr 99.38
KOG0649325 consensus WD40 repeat protein [General function pr 99.37
KOG0771398 consensus Prolactin regulatory element-binding pro 99.37
KOG4497447 consensus Uncharacterized conserved protein WDR8, 99.36
KOG1524737 consensus WD40 repeat-containing protein CHE-2 [Ge 99.36
KOG06441113 consensus Uncharacterized conserved protein, conta 99.35
PRK01742429 tolB translocation protein TolB; Provisional 99.35
KOG1310758 consensus WD40 repeat protein [General function pr 99.34
KOG1188376 consensus WD40 repeat protein [General function pr 99.33
KOG2110391 consensus Uncharacterized conserved protein, conta 99.33
PRK11028330 6-phosphogluconolactonase; Provisional 99.32
KOG2111346 consensus Uncharacterized conserved protein, conta 99.3
KOG12401431 consensus Protein kinase containing WD40 repeats [ 99.29
PRK01742429 tolB translocation protein TolB; Provisional 99.29
KOG2110391 consensus Uncharacterized conserved protein, conta 99.28
KOG0974967 consensus WD-repeat protein WDR6, WD repeat superf 99.23
KOG0649325 consensus WD40 repeat protein [General function pr 99.23
KOG1523361 consensus Actin-related protein Arp2/3 complex, su 99.23
KOG1334559 consensus WD40 repeat protein [General function pr 99.23
KOG2321703 consensus WD40 repeat protein [General function pr 99.22
KOG1334559 consensus WD40 repeat protein [General function pr 99.21
PRK03629429 tolB translocation protein TolB; Provisional 99.19
PF02239369 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO 99.18
PRK03629429 tolB translocation protein TolB; Provisional 99.16
KOG1272545 consensus WD40-repeat-containing subunit of the 18 99.14
KOG19121062 consensus WD40 repeat protein [General function pr 99.13
PF04762928 IKI3: IKI3 family; InterPro: IPR006849 Members of 99.13
PRK05137435 tolB translocation protein TolB; Provisional 99.12
PRK04922433 tolB translocation protein TolB; Provisional 99.11
KOG2139445 consensus WD40 repeat protein [General function pr 99.1
PRK05137435 tolB translocation protein TolB; Provisional 99.1
PRK02889427 tolB translocation protein TolB; Provisional 99.07
KOG2394636 consensus WD40 protein DMR-N9 [General function pr 99.05
KOG1524737 consensus WD40 repeat-containing protein CHE-2 [Ge 99.03
PRK02889427 tolB translocation protein TolB; Provisional 99.02
KOG2111346 consensus Uncharacterized conserved protein, conta 99.02
PF10282345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 98.99
PF02239369 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO 98.97
PF08662194 eIF2A: Eukaryotic translation initiation factor eI 98.96
KOG2139445 consensus WD40 repeat protein [General function pr 98.95
KOG1272545 consensus WD40-repeat-containing subunit of the 18 98.94
PF08662194 eIF2A: Eukaryotic translation initiation factor eI 98.93
PRK04922433 tolB translocation protein TolB; Provisional 98.93
KOG2321703 consensus WD40 repeat protein [General function pr 98.93
COG5354561 Uncharacterized protein, contains Trp-Asp (WD) rep 98.91
PF04762 928 IKI3: IKI3 family; InterPro: IPR006849 Members of 98.9
KOG2041 1189 consensus WD40 repeat protein [General function pr 98.9
TIGR02800417 propeller_TolB tol-pal system beta propeller repea 98.88
TIGR02800417 propeller_TolB tol-pal system beta propeller repea 98.88
KOG3881412 consensus Uncharacterized conserved protein [Funct 98.87
KOG1409404 consensus Uncharacterized conserved protein, conta 98.86
KOG2041 1189 consensus WD40 repeat protein [General function pr 98.82
PRK04792448 tolB translocation protein TolB; Provisional 98.8
KOG1310758 consensus WD40 repeat protein [General function pr 98.79
PRK00178430 tolB translocation protein TolB; Provisional 98.79
KOG0974967 consensus WD-repeat protein WDR6, WD repeat superf 98.77
PRK01029428 tolB translocation protein TolB; Provisional 98.77
PRK00178430 tolB translocation protein TolB; Provisional 98.77
KOG2315566 consensus Predicted translation initiation factor 98.74
KOG3881412 consensus Uncharacterized conserved protein [Funct 98.74
KOG2314698 consensus Translation initiation factor 3, subunit 98.73
TIGR03300377 assembly_YfgL outer membrane assembly lipoprotein 98.71
TIGR03300377 assembly_YfgL outer membrane assembly lipoprotein 98.7
PF10282345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 98.69
KOG1409404 consensus Uncharacterized conserved protein, conta 98.68
PRK04792448 tolB translocation protein TolB; Provisional 98.68
KOG4547541 consensus WD40 repeat-containing protein [General 98.64
KOG3914390 consensus WD repeat protein WDR4 [Function unknown 98.61
KOG1354433 consensus Serine/threonine protein phosphatase 2A, 98.57
TIGR02658352 TTQ_MADH_Hv methylamine dehydrogenase heavy chain. 98.55
KOG3914390 consensus WD repeat protein WDR4 [Function unknown 98.54
COG4946668 Uncharacterized protein related to the periplasmic 98.52
KOG10642439 consensus RAVE (regulator of V-ATPase assembly) co 98.51
COG4946668 Uncharacterized protein related to the periplasmic 98.5
KOG10642439 consensus RAVE (regulator of V-ATPase assembly) co 98.5
KOG1354433 consensus Serine/threonine protein phosphatase 2A, 98.49
COG2706346 3-carboxymuconate cyclase [Carbohydrate transport 98.49
KOG4547541 consensus WD40 repeat-containing protein [General 98.46
PLN029191057 haloacid dehalogenase-like hydrolase family protei 98.46
COG2706346 3-carboxymuconate cyclase [Carbohydrate transport 98.44
PLN029191057 haloacid dehalogenase-like hydrolase family protei 98.4
TIGR02658352 TTQ_MADH_Hv methylamine dehydrogenase heavy chain. 98.39
PF15492282 Nbas_N: Neuroblastoma-amplified sequence, N termin 98.35
KOG4714319 consensus Nucleoporin [Nuclear structure] 98.27
KOG2066846 consensus Vacuolar assembly/sorting protein VPS41 98.26
PRK04043419 tolB translocation protein TolB; Provisional 98.26
PF11768545 DUF3312: Protein of unknown function (DUF3312); In 98.24
COG5170460 CDC55 Serine/threonine protein phosphatase 2A, reg 98.22
KOG4714319 consensus Nucleoporin [Nuclear structure] 98.22
KOG4532344 consensus WD40-like repeat containing protein [Gen 98.2
PRK01029428 tolB translocation protein TolB; Provisional 98.18
PF0040039 WD40: WD domain, G-beta repeat; InterPro: IPR01978 98.18
KOG0280339 consensus Uncharacterized conserved protein [Amino 98.17
PRK11138394 outer membrane biogenesis protein BamB; Provisiona 98.16
PRK04043419 tolB translocation protein TolB; Provisional 98.14
KOG3621726 consensus WD40 repeat-containing protein [General 98.13
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 98.12
KOG2114933 consensus Vacuolar assembly/sorting protein PEP5/V 98.11
KOG0280339 consensus Uncharacterized conserved protein [Amino 98.08
KOG2315566 consensus Predicted translation initiation factor 98.06
PF0095789 Synaptobrevin: Synaptobrevin; InterPro: IPR001388 98.03
KOG0860116 consensus Synaptobrevin/VAMP-like protein [Intrace 98.01
KOG41901034 consensus Uncharacterized conserved protein [Funct 98.01
KOG4649354 consensus PQQ (pyrrolo-quinoline quinone) repeat p 97.98
PRK11138394 outer membrane biogenesis protein BamB; Provisiona 97.95
KOG2695425 consensus WD40 repeat protein [General function pr 97.95
KOG41901034 consensus Uncharacterized conserved protein [Funct 97.93
COG5354561 Uncharacterized protein, contains Trp-Asp (WD) rep 97.89
KOG2314698 consensus Translation initiation factor 3, subunit 97.87
KOG3621726 consensus WD40 repeat-containing protein [General 97.86
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 97.85
KOG1920 1265 consensus IkappaB kinase complex, IKAP component [ 97.8
KOG1645463 consensus RING-finger-containing E3 ubiquitin liga 97.8
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 97.77
PF11768545 DUF3312: Protein of unknown function (DUF3312); In 97.77
KOG4532344 consensus WD40-like repeat containing protein [Gen 97.76
PF15492282 Nbas_N: Neuroblastoma-amplified sequence, N termin 97.74
PF0040039 WD40: WD domain, G-beta repeat; InterPro: IPR01978 97.73
KOG2695425 consensus WD40 repeat protein [General function pr 97.72
COG5170460 CDC55 Serine/threonine protein phosphatase 2A, reg 97.69
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 97.67
KOG1645463 consensus RING-finger-containing E3 ubiquitin liga 97.66
PF03178321 CPSF_A: CPSF A subunit region; InterPro: IPR004871 97.65
KOG03091081 consensus Conserved WD40 repeat-containing protein 97.61
KOG4649354 consensus PQQ (pyrrolo-quinoline quinone) repeat p 97.57
KOG0882558 consensus Cyclophilin-related peptidyl-prolyl cis- 97.49
KOG03091081 consensus Conserved WD40 repeat-containing protein 97.46
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 97.43
KOG2066 846 consensus Vacuolar assembly/sorting protein VPS41 97.4
PF07433305 DUF1513: Protein of unknown function (DUF1513); In 97.32
KOG0882558 consensus Cyclophilin-related peptidyl-prolyl cis- 97.3
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 97.25
PF08596395 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; 97.24
KOG18321516 consensus HIV-1 Vpr-binding protein [Cell cycle co 97.22
PF00780275 CNH: CNH domain; InterPro: IPR001180 Based on sequ 97.13
PF06977248 SdiA-regulated: SdiA-regulated; InterPro: IPR00972 97.07
PRK02888635 nitrous-oxide reductase; Validated 97.05
PF14783111 BBS2_Mid: Ciliary BBSome complex subunit 2, middle 97.02
PF04841410 Vps16_N: Vps16, N-terminal region; InterPro: IPR00 96.99
KOG1920 1265 consensus IkappaB kinase complex, IKAP component [ 96.95
KOG12751118 consensus PAB-dependent poly(A) ribonuclease, subu 96.91
KOG4640665 consensus Anaphase-promoting complex (APC), subuni 96.86
PF00780275 CNH: CNH domain; InterPro: IPR001180 Based on sequ 96.86
PF00930353 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-termin 96.84
PF07433305 DUF1513: Protein of unknown function (DUF1513); In 96.84
KOG18971096 consensus Damage-specific DNA binding complex, sub 96.69
PF14783111 BBS2_Mid: Ciliary BBSome complex subunit 2, middle 96.68
KOG2079 1206 consensus Vacuolar assembly/sorting protein VPS8 [ 96.65
PF1289447 Apc4_WD40: Anaphase-promoting complex subunit 4 WD 96.62
smart0032040 WD40 WD40 repeats. Note that these repeats are per 96.62
KOG12751118 consensus PAB-dependent poly(A) ribonuclease, subu 96.62
PF06433342 Me-amine-dh_H: Methylamine dehydrogenase heavy cha 96.58
cd00216488 PQQ_DH Dehydrogenases with pyrrolo-quinoline quino 96.47
PF14727418 PHTB1_N: PTHB1 N-terminus 96.45
KOG0859217 consensus Synaptobrevin/VAMP-like protein [Intrace 96.43
KOG4640665 consensus Anaphase-promoting complex (APC), subuni 96.43
COG3204316 Uncharacterized protein conserved in bacteria [Fun 96.4
COG0823425 TolB Periplasmic component of the Tol biopolymer t 96.36
KOG20791206 consensus Vacuolar assembly/sorting protein VPS8 [ 96.35
PF06977248 SdiA-regulated: SdiA-regulated; InterPro: IPR00972 96.23
KOG18971096 consensus Damage-specific DNA binding complex, sub 96.21
KOG18321516 consensus HIV-1 Vpr-binding protein [Cell cycle co 96.13
cd00216488 PQQ_DH Dehydrogenases with pyrrolo-quinoline quino 96.08
KOG1008783 consensus Uncharacterized conserved protein, conta 95.99
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 95.86
KOG2114933 consensus Vacuolar assembly/sorting protein PEP5/V 95.74
PRK13616591 lipoprotein LpqB; Provisional 95.71
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 95.71
PF08553794 VID27: VID27 cytoplasmic protein; InterPro: IPR013 95.7
PF03178321 CPSF_A: CPSF A subunit region; InterPro: IPR004871 95.66
COG0823425 TolB Periplasmic component of the Tol biopolymer t 95.4
PF04841410 Vps16_N: Vps16, N-terminal region; InterPro: IPR00 95.23
PF1289447 Apc4_WD40: Anaphase-promoting complex subunit 4 WD 95.19
smart0032040 WD40 WD40 repeats. Note that these repeats are per 95.11
COG3386307 Gluconolactonase [Carbohydrate transport and metab 95.06
PF08553794 VID27: VID27 cytoplasmic protein; InterPro: IPR013 94.9
COG3391381 Uncharacterized conserved protein [Function unknow 94.87
KOG1008783 consensus Uncharacterized conserved protein, conta 94.68
PF05096264 Glu_cyclase_2: Glutamine cyclotransferase; InterPr 94.56
COG3391381 Uncharacterized conserved protein [Function unknow 94.3
KOG3630 1405 consensus Nuclear pore complex, Nup214/CAN compone 94.28
PF10647253 Gmad1: Lipoprotein LpqB beta-propeller domain; Int 94.24
PF10395 670 Utp8: Utp8 family; InterPro: IPR018843 Utp8 is an 94.2
PF06433342 Me-amine-dh_H: Methylamine dehydrogenase heavy cha 94.1
PRK13616591 lipoprotein LpqB; Provisional 93.95
KOG2444238 consensus WD40 repeat protein [General function pr 93.76
KOG2444238 consensus WD40 repeat protein [General function pr 93.67
PF02897414 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal 93.36
PF10647253 Gmad1: Lipoprotein LpqB beta-propeller domain; Int 93.24
PF14781136 BBS2_N: Ciliary BBSome complex subunit 2, N-termin 93.17
KOG4499310 consensus Ca2+-binding protein Regucalcin/SMP30 [I 92.99
PF14655415 RAB3GAP2_N: Rab3 GTPase-activating protein regulat 92.71
COG3490366 Uncharacterized protein conserved in bacteria [Fun 92.4
COG3204316 Uncharacterized protein conserved in bacteria [Fun 92.3
PF14761215 HPS3_N: Hermansky-Pudlak syndrome 3 92.24
PRK02888635 nitrous-oxide reductase; Validated 92.07
PF10168717 Nup88: Nuclear pore component; InterPro: IPR019321 91.85
PF10168717 Nup88: Nuclear pore component; InterPro: IPR019321 91.84
PF14870302 PSII_BNR: Photosynthesis system II assembly factor 91.73
KOG2395644 consensus Protein involved in vacuole import and d 91.63
COG3386307 Gluconolactonase [Carbohydrate transport and metab 91.31
TIGR03075527 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methan 91.24
PF14781136 BBS2_N: Ciliary BBSome complex subunit 2, N-termin 91.07
PF08728717 CRT10: CRT10; InterPro: IPR014839 CRT10 is a trans 90.71
PF1097943 DUF2786: Protein of unknown function (DUF2786); In 90.65
PF15390671 DUF4613: Domain of unknown function (DUF4613) 90.41
PF08728717 CRT10: CRT10; InterPro: IPR014839 CRT10 is a trans 89.02
KOG2395644 consensus Protein involved in vacuole import and d 88.9
PF14870302 PSII_BNR: Photosynthesis system II assembly factor 88.21
PF1031343 DUF2415: Uncharacterised protein domain (DUF2415); 87.51
COG3490366 Uncharacterized protein conserved in bacteria [Fun 87.1
PF07569219 Hira: TUP1-like enhancer of split; InterPro: IPR01 86.67
TIGR03074764 PQQ_membr_DH membrane-bound PQQ-dependent dehydrog 86.51
KOG18961366 consensus mRNA cleavage and polyadenylation factor 86.19
PHA02713557 hypothetical protein; Provisional 86.15
PF12234 631 Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR0 86.14
KOG3630 1405 consensus Nuclear pore complex, Nup214/CAN compone 86.13
PLN00033398 photosystem II stability/assembly factor; Provisio 86.04
TIGR02604367 Piru_Ver_Nterm putative membrane-bound dehydrogena 85.68
PF13449326 Phytase-like: Esterase-like activity of phytase 85.44
PF05096264 Glu_cyclase_2: Glutamine cyclotransferase; InterPr 84.86
PF08366105 LLGL: LLGL2; InterPro: IPR013577 This domain is fo 84.54
PRK13684334 Ycf48-like protein; Provisional 84.26
KOG1916 1283 consensus Nuclear protein, contains WD40 repeats [ 84.0
PF05694461 SBP56: 56kDa selenium binding protein (SBP56); Int 83.98
KOG2280 829 consensus Vacuolar assembly/sorting protein VPS16 83.93
PF14761215 HPS3_N: Hermansky-Pudlak syndrome 3 83.86
TIGR03075527 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methan 83.65
PF00930353 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-termin 83.39
KOG4499310 consensus Ca2+-binding protein Regucalcin/SMP30 [I 82.81
KOG2280 829 consensus Vacuolar assembly/sorting protein VPS16 82.63
PRK13684334 Ycf48-like protein; Provisional 82.17
PF11715547 Nup160: Nucleoporin Nup120/160; InterPro: IPR02171 82.08
PF12234631 Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR0 81.97
PF07569219 Hira: TUP1-like enhancer of split; InterPro: IPR01 81.8
PF12768281 Rax2: Cortical protein marker for cell polarity 81.61
PRK10115686 protease 2; Provisional 81.3
TIGR03118336 PEPCTERM_chp_1 conserved hypothetical protein TIGR 80.74
PF12657173 TFIIIC_delta: Transcription factor IIIC subunit de 80.36
PF12768281 Rax2: Cortical protein marker for cell polarity 80.24
PF14655415 RAB3GAP2_N: Rab3 GTPase-activating protein regulat 80.07
PF14583386 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C 80.06
>KOG0319 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information 
Probab=100.00  E-value=5.6e-41  Score=374.18  Aligned_cols=542  Identities=13%  Similarity=0.183  Sum_probs=380.0

Q ss_pred             CCCceEEEEcCCCCEEEEEECCCcEEEEecCCcceE-EeCC-CCCCEEEEEEeeCCCEEEEEeCCCcEEEEEcCCCeeee
Q 001279           35 PATASILAFDHIQRLLAIATLDGRIKVIGGDGIEGL-LISP-SQLPYKNLEFLQNQGFLISITNDNEIQVWSLESRSLAC  112 (1108)
Q Consensus        35 ~~~is~la~sp~~~~LA~Gs~dG~I~iw~~~~~~~~-~~~~-h~~~V~~l~fs~d~~~L~S~s~d~~I~vWd~~s~~~~~  112 (1108)
                      +..+++++++||+.+|.++...+.+++|.++...++ .+.. |++||--++|.|.+..|++++.|+.++|||+..+.+++
T Consensus        62 ~d~ita~~l~~d~~~L~~a~rs~llrv~~L~tgk~irswKa~He~Pvi~ma~~~~g~LlAtggaD~~v~VWdi~~~~~th  141 (775)
T KOG0319|consen   62 EDEITALALTPDEEVLVTASRSQLLRVWSLPTGKLIRSWKAIHEAPVITMAFDPTGTLLATGGADGRVKVWDIKNGYCTH  141 (775)
T ss_pred             hhhhheeeecCCccEEEEeeccceEEEEEcccchHhHhHhhccCCCeEEEEEcCCCceEEeccccceEEEEEeeCCEEEE
Confidence            456899999999999999999999999999877655 3444 99999999999999999999999999999999999998


Q ss_pred             ee-cCCCCeeEEEEecCCC--EEEEEeCCCcEEEEEEecCCCeeeeeceeecccccccccCCCCCCCCCeEEEecccCCC
Q 001279          113 CL-KWESNITAFSVISGSH--FMYIGDENGLMSVIKYDADEGKLFQLPYNISADALSEKAGFPLLSHQPVVGVLPHPNSS  189 (1108)
Q Consensus       113 ~~-~~~~~Itsl~~~~~~~--~l~vg~~dg~V~vw~~d~~~~~l~~~~~~i~~~~~~~~~~~~~~~~~~V~~v~f~P~~~  189 (1108)
                      .+ +|++.|.++.|.|+.+  .|++|..|+.|++|++......+    ..+..|.            ..|+++.|.+  +
T Consensus       142 ~fkG~gGvVssl~F~~~~~~~lL~sg~~D~~v~vwnl~~~~tcl----~~~~~H~------------S~vtsL~~~~--d  203 (775)
T KOG0319|consen  142 SFKGHGGVVSSLLFHPHWNRWLLASGATDGTVRVWNLNDKRTCL----HTMILHK------------SAVTSLAFSE--D  203 (775)
T ss_pred             EecCCCceEEEEEeCCccchhheeecCCCceEEEEEcccCchHH----HHHHhhh------------hheeeeeecc--C
Confidence            88 6899999999999864  58999999999999998533212    1244554            7899999987  5


Q ss_pred             CCEEEEEECCCeEEEEEccCCeEEEEeCCCcccccccccCCCCCCCCCcccCcCCCCCCCCceeEEEeecCC-----CCE
Q 001279          190 GNRVLIAYENALVILWDVSEAQIIFVGGGKDLQLKDGVVDSPSEGDSTFLEGISEHQPEEKEISALCWASSS-----GSI  264 (1108)
Q Consensus       190 ~~~ll~~~~dg~V~lWdl~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~Vtsl~w~spd-----g~~  264 (1108)
                      +..+++++.|..|.|||+.+-+......-                              ...+.++.+. ++     |.+
T Consensus       204 ~~~~ls~~RDkvi~vwd~~~~~~l~~lp~------------------------------ye~~E~vv~l-~~~~~~~~~~  252 (775)
T KOG0319|consen  204 SLELLSVGRDKVIIVWDLVQYKKLKTLPL------------------------------YESLESVVRL-REELGGKGEY  252 (775)
T ss_pred             CceEEEeccCcEEEEeehhhhhhhheech------------------------------hhheeeEEEe-chhcCCcceE
Confidence            77799999999999999966544322211                              2345555544 44     679


Q ss_pred             EEEEEccCcEEEEecCCCCCCCCccCCCCCceeeeecccccCCccEEEEEeecccccccCCCce-EEEEeCCCCCCcceE
Q 001279          265 LAVGYIDGDILLWNTSTTASTKGQQTGSRNNVVKLELSSAERRLPVIVLHWSTNKESRSNIDGR-LFVYGGDEIGSEEVL  343 (1108)
Q Consensus       265 l~sg~~DG~I~lWd~~~~~~~~~~~~~~~~~~~kl~~~~~~~~~~i~~~~~~~~~s~~~~~~~~-llv~gg~~~~~~~~l  343 (1108)
                      +++.+.+|.+++||.+++.....+......              .+..+       ......++ ++++..+.       
T Consensus       253 ~~TaG~~g~~~~~d~es~~~~~~~~~~~~~--------------e~~~~-------~~~~~~~~~l~vtaeQn-------  304 (775)
T KOG0319|consen  253 IITAGGSGVVQYWDSESGKCVYKQRQSDSE--------------EIDHL-------LAIESMSQLLLVTAEQN-------  304 (775)
T ss_pred             EEEecCCceEEEEecccchhhhhhccCCch--------------hhhcc-------eeccccCceEEEEccce-------
Confidence            999999999999999877533221111000              01100       00111222 23333222       


Q ss_pred             EEEeccccccccccceeeeeecCCCCccceEEEecCCCCCCCCCcceEEEEcCCCeEEEEeccceeeeccccCCCCCCCC
Q 001279          344 TVLSLEWSSGMENLRCVSRVDITLTGSFADMILLSSAGATVGNHKADLFVLTSPGQLHFYDNASLTTLLSQQEKKPSVCP  423 (1108)
Q Consensus       344 tvl~l~~~~~~~~~~~~~~~~l~~~~~v~~~~~~p~~~~~~~~~~~~l~vl~~~G~l~~~d~~~~~~~~~~~~~~~~~~~  423 (1108)
                       ++.++..+.     ...+.-.+.+..|.||.+.-.       +...+++.++.+++.+|+.....+.            
T Consensus       305 -l~l~d~~~l-----~i~k~ivG~ndEI~Dm~~lG~-------e~~~laVATNs~~lr~y~~~~~~c~------------  359 (775)
T KOG0319|consen  305 -LFLYDEDEL-----TIVKQIVGYNDEILDMKFLGP-------EESHLAVATNSPELRLYTLPTSYCQ------------  359 (775)
T ss_pred             -EEEEEcccc-----EEehhhcCCchhheeeeecCC-------ccceEEEEeCCCceEEEecCCCceE------------
Confidence             121111110     011233455668899988764       3457899999999999874333222            


Q ss_pred             ccCCccccCCCCcceEEEEEeccCCCCchhhhhHHHhhccccCCCCccCcccccccCCcccCCCccccCCCCcEEEEEec
Q 001279          424 VEFPGVIPISDPIMTVAEFMLLPFGGHSSKGLSEIATFTKLHSSHTQAGHIKWPLSGGVPSPVPITKCHSVDRVYLAGYH  503 (1108)
Q Consensus       424 ~~~~~~~~~~~~~it~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~wp~~gg~~~~~~~~~~s~~~~llatgs~  503 (1108)
                                                                            +..||...+..+.....+-+|+||+.
T Consensus       360 ------------------------------------------------------ii~GH~e~vlSL~~~~~g~llat~sK  385 (775)
T KOG0319|consen  360 ------------------------------------------------------IIPGHTEAVLSLDVWSSGDLLATGSK  385 (775)
T ss_pred             ------------------------------------------------------EEeCchhheeeeeecccCcEEEEecC
Confidence                                                                  22233333333344566679999999


Q ss_pred             CCcEEEEeCCCCceeeEeeeccccceeeccCCCCCeEEEEEEeCC-CeEEEEecCceEEEEEecCCCCCccccccccCcc
Q 001279          504 DGSVRIWDATYPVFKLICALDAEVQGIEVAGSRAPVSTLSFCFIN-SSLAVGNEFGLVYIYNLNGSLDAKNFLFVLETKS  582 (1108)
Q Consensus       504 DGtVriWd~~~~~l~~~~~l~~~~~~~~l~~h~~~Vt~lafs~d~-~~Lasg~~dG~V~lw~l~~~~~~~~~~~~~~~~~  582 (1108)
                      |.+|++|.++.+.......       ....+|...|.+++++..+ .+|++++.|+++++|.+...... .+        
T Consensus       386 D~svilWr~~~~~~~~~~~-------a~~~gH~~svgava~~~~~asffvsvS~D~tlK~W~l~~s~~~-~~--------  449 (775)
T KOG0319|consen  386 DKSVILWRLNNNCSKSLCV-------AQANGHTNSVGAVAGSKLGASFFVSVSQDCTLKLWDLPKSKET-AF--------  449 (775)
T ss_pred             CceEEEEEecCCcchhhhh-------hhhcccccccceeeecccCccEEEEecCCceEEEecCCCcccc-cc--------
Confidence            9999999885554331111       1246999999999998765 58999999999999999883211 10        


Q ss_pred             ceeecccCCcceEEEEEeecCcCEEEEEEcCCCCEEEEEeCCCeEEEEEccCceEEEEeecCCCCCCceEEEEeeecccC
Q 001279          583 EVHALPEGKISLCRAVFSLVNSPVRALQFTSSGAKLAVGFECGRVAVLDMNLLSVLFFTDDISGSSSPIISMTWTEFKNT  662 (1108)
Q Consensus       583 ~~~~~~~~~g~~~~~~~~~h~~~Vtslafspdg~~LavGs~dG~V~vwd~~~~~~~~~~~~~~~h~~~V~~l~fs~~~~~  662 (1108)
                             ...+.+..+-..|...|.||+++|+.+++|+|+.|.+.+||++++..++   ..++||..+|.++.|++    
T Consensus       450 -------~~~~~~~~t~~aHdKdIN~Vaia~ndkLiAT~SqDktaKiW~le~~~l~---~vLsGH~RGvw~V~Fs~----  515 (775)
T KOG0319|consen  450 -------PIVLTCRYTERAHDKDINCVAIAPNDKLIATGSQDKTAKIWDLEQLRLL---GVLSGHTRGVWCVSFSK----  515 (775)
T ss_pred             -------cceehhhHHHHhhcccccceEecCCCceEEecccccceeeecccCceEE---EEeeCCccceEEEEecc----
Confidence                   0001122234579999999999999999999999999999999988877   68899999999999994    


Q ss_pred             ccccCCCCCCCCCCCCCCCccEEEEEcCCccEEEEeCCCcceecCCCCcccccceeeEEEEecCCCCCCCccccccchhh
Q 001279          663 HSLAKNPNHSEREVPVNPAEEVIIVLFKDAKISIVGGSSENMISSSPWHLKKKVIAISMEVIAEPVCGFPIEKQAEQSAE  742 (1108)
Q Consensus       663 ~~~~~~p~~~~~~~~~~p~~~~L~s~s~Dg~v~v~d~~~g~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  742 (1108)
                                        ...+|++++.|.+|.+|..+++.++.+.                ++                
T Consensus       516 ------------------~dq~laT~SgD~TvKIW~is~fSClkT~----------------eG----------------  545 (775)
T KOG0319|consen  516 ------------------NDQLLATCSGDKTVKIWSISTFSCLKTF----------------EG----------------  545 (775)
T ss_pred             ------------------ccceeEeccCCceEEEEEeccceeeeee----------------cC----------------
Confidence                              4788999999999999999998887654                11                


Q ss_pred             hhccCCCCCCCCCCcccCCcccccccccccccCCCCCCCcEEEEEecC-eeEEEecccccccccceeeeecCCCcceeee
Q 001279          743 ENAAKNKPTPDTSSIETKSHETEHLFSSENACSGESSNDALVLLCCED-SVRLYSRKSVIQGNNKTVQKVKHKNRCCWAS  821 (1108)
Q Consensus       743 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~c~e~-~~~v~sl~~~~~g~~~~~~k~~~~~~~~~~~  821 (1108)
                                             |.+.|....|-..  +..++.|+.| -+++|.+++     +.|++-..--..-.|+-
T Consensus       546 -----------------------H~~aVlra~F~~~--~~qliS~~adGliKlWnikt-----~eC~~tlD~H~DrvWaL  595 (775)
T KOG0319|consen  546 -----------------------HTSAVLRASFIRN--GKQLISAGADGLIKLWNIKT-----NECEMTLDAHNDRVWAL  595 (775)
T ss_pred             -----------------------ccceeEeeeeeeC--CcEEEeccCCCcEEEEeccc-----hhhhhhhhhccceeEEE
Confidence                                   2223333333222  4467777766 999999988     45554433224456775


Q ss_pred             eeecCCceeEEEEEeecCcEEEe
Q 001279          822 TIEKDEKVCGLLLLFQTGAVQIR  844 (1108)
Q Consensus       822 ~~~~~~~~~~l~~~~~~G~i~i~  844 (1108)
                      ....  .....+.+-.||.|-.|
T Consensus       596 ~~~~--~~~~~~tgg~Dg~i~~w  616 (775)
T KOG0319|consen  596 SVSP--LLDMFVTGGGDGRIIFW  616 (775)
T ss_pred             eecC--ccceeEecCCCeEEEEe
Confidence            4433  23355555666666666

>KOG0271 consensus Notchless-like WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0319 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0271 consensus Notchless-like WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0318 consensus WD40 repeat stress protein/actin interacting protein [Cytoskeleton] Back     alignment and domain information
>KOG0291 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0306 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0291 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG1983 consensus Tomosyn and related SNARE-interacting proteins [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0306 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0272 consensus U4/U6 small nuclear ribonucleoprotein Prp4 (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0318 consensus WD40 repeat stress protein/actin interacting protein [Cytoskeleton] Back     alignment and domain information
>KOG0272 consensus U4/U6 small nuclear ribonucleoprotein Prp4 (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG1408 consensus WD40 repeat protein [Function unknown] Back     alignment and domain information
>KOG1063 consensus RNA polymerase II elongator complex, subunit ELP2, WD repeat superfamily [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>KOG0296 consensus Angio-associated migratory cell protein (contains WD40 repeats) [Function unknown] Back     alignment and domain information
>KOG0273 consensus Beta-transducin family (WD-40 repeat) protein [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0286 consensus G-protein beta subunit [General function prediction only] Back     alignment and domain information
>KOG0286 consensus G-protein beta subunit [General function prediction only] Back     alignment and domain information
>KOG0273 consensus Beta-transducin family (WD-40 repeat) protein [Chromatin structure and dynamics] Back     alignment and domain information
>KOG1539 consensus WD repeat protein [General function prediction only] Back     alignment and domain information
>KOG2106 consensus Uncharacterized conserved protein, contains HELP and WD40 domains [Function unknown] Back     alignment and domain information
>KOG0315 consensus G-protein beta subunit-like protein (contains WD40 repeats) [General function prediction only] Back     alignment and domain information
>KOG0315 consensus G-protein beta subunit-like protein (contains WD40 repeats) [General function prediction only] Back     alignment and domain information
>KOG0279 consensus G protein beta subunit-like protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG0276 consensus Vesicle coat complex COPI, beta' subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0296 consensus Angio-associated migratory cell protein (contains WD40 repeats) [Function unknown] Back     alignment and domain information
>KOG0295 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0263 consensus Transcription initiation factor TFIID, subunit TAF5 (also component of histone acetyltransferase SAGA) [Transcription] Back     alignment and domain information
>KOG0292 consensus Vesicle coat complex COPI, alpha subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0263 consensus Transcription initiation factor TFIID, subunit TAF5 (also component of histone acetyltransferase SAGA) [Transcription] Back     alignment and domain information
>KOG0279 consensus G protein beta subunit-like protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG0285 consensus Pleiotropic regulator 1 [RNA processing and modification] Back     alignment and domain information
>KOG2048 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0645 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0293 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>KOG1539 consensus WD repeat protein [General function prediction only] Back     alignment and domain information
>KOG0276 consensus Vesicle coat complex COPI, beta' subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0292 consensus Vesicle coat complex COPI, alpha subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0284 consensus Polyadenylation factor I complex, subunit PFS2 [RNA processing and modification] Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>KOG0265 consensus U5 snRNP-specific protein-like factor and related proteins [RNA processing and modification] Back     alignment and domain information
>KOG0295 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0645 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0266 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0285 consensus Pleiotropic regulator 1 [RNA processing and modification] Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>KOG0265 consensus U5 snRNP-specific protein-like factor and related proteins [RNA processing and modification] Back     alignment and domain information
>KOG1063 consensus RNA polymerase II elongator complex, subunit ELP2, WD repeat superfamily [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>KOG0284 consensus Polyadenylation factor I complex, subunit PFS2 [RNA processing and modification] Back     alignment and domain information
>KOG0282 consensus mRNA splicing factor [Function unknown] Back     alignment and domain information
>KOG0266 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1408 consensus WD40 repeat protein [Function unknown] Back     alignment and domain information
>KOG0281 consensus Beta-TrCP (transducin repeats containing)/Slimb proteins [Function unknown] Back     alignment and domain information
>KOG0282 consensus mRNA splicing factor [Function unknown] Back     alignment and domain information
>KOG0278 consensus Serine/threonine kinase receptor-associated protein [Lipid transport and metabolism] Back     alignment and domain information
>KOG2106 consensus Uncharacterized conserved protein, contains HELP and WD40 domains [Function unknown] Back     alignment and domain information
>KOG0293 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0281 consensus Beta-TrCP (transducin repeats containing)/Slimb proteins [Function unknown] Back     alignment and domain information
>KOG0310 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0772 consensus Uncharacterized conserved protein, contains WD40 repeat [Function unknown] Back     alignment and domain information
>KOG0275 consensus Conserved WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0313 consensus Microtubule binding protein YTM1 (contains WD40 repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0313 consensus Microtubule binding protein YTM1 (contains WD40 repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0268 consensus Sof1-like rRNA processing protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0275 consensus Conserved WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0316 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0772 consensus Uncharacterized conserved protein, contains WD40 repeat [Function unknown] Back     alignment and domain information
>KOG0316 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0643 consensus Translation initiation factor 3, subunit i (eIF-3i)/TGF-beta receptor-interacting protein (TRIP-1) [Translation, ribosomal structure and biogenesis; Signal transduction mechanisms] Back     alignment and domain information
>KOG1407 consensus WD40 repeat protein [Function unknown] Back     alignment and domain information
>KOG0299 consensus U3 snoRNP-associated protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0640 consensus mRNA cleavage stimulating factor complex; subunit 1 [RNA processing and modification] Back     alignment and domain information
>KOG0643 consensus Translation initiation factor 3, subunit i (eIF-3i)/TGF-beta receptor-interacting protein (TRIP-1) [Translation, ribosomal structure and biogenesis; Signal transduction mechanisms] Back     alignment and domain information
>KOG0278 consensus Serine/threonine kinase receptor-associated protein [Lipid transport and metabolism] Back     alignment and domain information
>KOG2048 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0288 consensus WD40 repeat protein TipD [General function prediction only] Back     alignment and domain information
>KOG0299 consensus U3 snoRNP-associated protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0277 consensus Peroxisomal targeting signal type 2 receptor [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0274 consensus Cdc4 and related F-box and WD-40 proteins [General function prediction only] Back     alignment and domain information
>KOG0283 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>KOG1445 consensus Tumor-specific antigen (contains WD repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0305 consensus Anaphase promoting complex, Cdc20, Cdh1, and Ama1 subunits [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0274 consensus Cdc4 and related F-box and WD-40 proteins [General function prediction only] Back     alignment and domain information
>KOG0277 consensus Peroxisomal targeting signal type 2 receptor [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1963 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0288 consensus WD40 repeat protein TipD [General function prediction only] Back     alignment and domain information
>KOG0647 consensus mRNA export protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0973 consensus Histone transcription regulator HIRA, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning; Transcription] Back     alignment and domain information
>KOG0310 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0973 consensus Histone transcription regulator HIRA, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning; Transcription] Back     alignment and domain information
>KOG0640 consensus mRNA cleavage stimulating factor complex; subunit 1 [RNA processing and modification] Back     alignment and domain information
>KOG0289 consensus mRNA splicing factor [General function prediction only] Back     alignment and domain information
>KOG1036 consensus Mitotic spindle checkpoint protein BUB3, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0283 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>KOG2055 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0308 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG2096 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1446 consensus Histone H3 (Lys4) methyltransferase complex and RNA cleavage factor II complex, subunit SWD2 [RNA processing and modification; Chromatin structure and dynamics; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PTZ00420 coronin; Provisional Back     alignment and domain information
>KOG1446 consensus Histone H3 (Lys4) methyltransferase complex and RNA cleavage factor II complex, subunit SWD2 [RNA processing and modification; Chromatin structure and dynamics; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0646 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0294 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0308 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0301 consensus Phospholipase A2-activating protein (contains WD40 repeats) [Lipid transport and metabolism] Back     alignment and domain information
>KOG0641 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PTZ00420 coronin; Provisional Back     alignment and domain information
>KOG0300 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0647 consensus mRNA export protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG1407 consensus WD40 repeat protein [Function unknown] Back     alignment and domain information
>KOG1036 consensus Mitotic spindle checkpoint protein BUB3, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0305 consensus Anaphase promoting complex, Cdc20, Cdh1, and Ama1 subunits [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0300 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0641 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF08596 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; InterPro: IPR013905 The Lethal giant larvae (Lgl) tumour suppressor protein is conserved from yeast to mammals Back     alignment and domain information
>KOG4283 consensus Transcription-coupled repair protein CSA, contains WD40 domain [Transcription; Replication, recombination and repair] Back     alignment and domain information
>KOG0289 consensus mRNA splicing factor [General function prediction only] Back     alignment and domain information
>KOG2055 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1332 consensus Vesicle coat complex COPII, subunit SEC13 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0294 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0268 consensus Sof1-like rRNA processing protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG1332 consensus Vesicle coat complex COPII, subunit SEC13 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0269 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0301 consensus Phospholipase A2-activating protein (contains WD40 repeats) [Lipid transport and metabolism] Back     alignment and domain information
>KOG0646 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>KOG2096 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0650 consensus WD40 repeat nucleolar protein Bop1, involved in ribosome biogenesis [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG1274 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>KOG0639 consensus Transducin-like enhancer of split protein (contains WD40 repeats) [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0321 consensus WD40 repeat-containing protein L2DTL [Function unknown] Back     alignment and domain information
>KOG2445 consensus Nuclear pore complex component (sc Seh1) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1273 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0639 consensus Transducin-like enhancer of split protein (contains WD40 repeats) [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0321 consensus WD40 repeat-containing protein L2DTL [Function unknown] Back     alignment and domain information
>KOG1274 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0267 consensus Microtubule severing protein katanin p80 subunit B (contains WD40 repeats) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG4328 consensus WD40 protein [Function unknown] Back     alignment and domain information
>KOG4283 consensus Transcription-coupled repair protein CSA, contains WD40 domain [Transcription; Replication, recombination and repair] Back     alignment and domain information
>KOG0264 consensus Nucleosome remodeling factor, subunit CAF1/NURF55/MSI1 [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0264 consensus Nucleosome remodeling factor, subunit CAF1/NURF55/MSI1 [Chromatin structure and dynamics] Back     alignment and domain information
>KOG1273 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1188 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0267 consensus Microtubule severing protein katanin p80 subunit B (contains WD40 repeats) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>COG2319 FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>KOG0650 consensus WD40 repeat nucleolar protein Bop1, involved in ribosome biogenesis [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>KOG4378 consensus Nuclear protein COP1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG2445 consensus Nuclear pore complex component (sc Seh1) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1445 consensus Tumor-specific antigen (contains WD repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0270 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0269 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0270 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0302 consensus Ribosome Assembly protein [General function prediction only] Back     alignment and domain information
>KOG1963 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1034 consensus Transcriptional repressor EED/ESC/FIE, required for transcriptional silencing, WD repeat superfamily [Transcription] Back     alignment and domain information
>KOG1240 consensus Protein kinase containing WD40 repeats [Signal transduction mechanisms] Back     alignment and domain information
>KOG4227 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG4328 consensus WD40 protein [Function unknown] Back     alignment and domain information
>KOG0302 consensus Ribosome Assembly protein [General function prediction only] Back     alignment and domain information
>COG2319 FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>KOG1517 consensus Guanine nucleotide binding protein MIP1 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>KOG1912 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1034 consensus Transcriptional repressor EED/ESC/FIE, required for transcriptional silencing, WD repeat superfamily [Transcription] Back     alignment and domain information
>KOG0322 consensus G-protein beta subunit-like protein GNB1L, contains WD repeats [General function prediction only] Back     alignment and domain information
>KOG0322 consensus G-protein beta subunit-like protein GNB1L, contains WD repeats [General function prediction only] Back     alignment and domain information
>KOG1517 consensus Guanine nucleotide binding protein MIP1 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG2919 consensus Guanine nucleotide-binding protein [General function prediction only] Back     alignment and domain information
>KOG4378 consensus Nuclear protein COP1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG1009 consensus Chromatin assembly complex 1 subunit B/CAC2 (contains WD40 repeats) [Chromatin structure and dynamics; Replication, recombination and repair] Back     alignment and domain information
>KOG0642 consensus Cell-cycle nuclear protein, contains WD-40 repeats [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG2919 consensus Guanine nucleotide-binding protein [General function prediction only] Back     alignment and domain information
>KOG1587 consensus Cytoplasmic dynein intermediate chain [Cytoskeleton] Back     alignment and domain information
>KOG0307 consensus Vesicle coat complex COPII, subunit SEC31 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1009 consensus Chromatin assembly complex 1 subunit B/CAC2 (contains WD40 repeats) [Chromatin structure and dynamics; Replication, recombination and repair] Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>KOG0307 consensus Vesicle coat complex COPII, subunit SEC31 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4227 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0644 consensus Uncharacterized conserved protein, contains WD40 repeat and BROMO domains [General function prediction only] Back     alignment and domain information
>KOG0771 consensus Prolactin regulatory element-binding protein/Protein transport protein SEC12p [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1007 consensus WD repeat protein TSSC1, WD repeat superfamily [Function unknown] Back     alignment and domain information
>KOG1007 consensus WD repeat protein TSSC1, WD repeat superfamily [Function unknown] Back     alignment and domain information
>KOG0642 consensus Cell-cycle nuclear protein, contains WD-40 repeats [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1523 consensus Actin-related protein Arp2/3 complex, subunit ARPC1/p41-ARC [Cytoskeleton] Back     alignment and domain information
>KOG0290 consensus Conserved WD40 repeat-containing protein AN11 [Function unknown] Back     alignment and domain information
>KOG1587 consensus Cytoplasmic dynein intermediate chain [Cytoskeleton] Back     alignment and domain information
>KOG0303 consensus Actin-binding protein Coronin, contains WD40 repeats [Cytoskeleton] Back     alignment and domain information
>KOG0290 consensus Conserved WD40 repeat-containing protein AN11 [Function unknown] Back     alignment and domain information
>KOG4497 consensus Uncharacterized conserved protein WDR8, contains WD repeats [General function prediction only] Back     alignment and domain information
>KOG0303 consensus Actin-binding protein Coronin, contains WD40 repeats [Cytoskeleton] Back     alignment and domain information
>KOG2394 consensus WD40 protein DMR-N9 [General function prediction only] Back     alignment and domain information
>KOG0649 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0771 consensus Prolactin regulatory element-binding protein/Protein transport protein SEC12p [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4497 consensus Uncharacterized conserved protein WDR8, contains WD repeats [General function prediction only] Back     alignment and domain information
>KOG1524 consensus WD40 repeat-containing protein CHE-2 [General function prediction only] Back     alignment and domain information
>KOG0644 consensus Uncharacterized conserved protein, contains WD40 repeat and BROMO domains [General function prediction only] Back     alignment and domain information
>PRK01742 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1310 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1188 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG2110 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>KOG2111 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] Back     alignment and domain information
>KOG1240 consensus Protein kinase containing WD40 repeats [Signal transduction mechanisms] Back     alignment and domain information
>PRK01742 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG2110 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] Back     alignment and domain information
>KOG0974 consensus WD-repeat protein WDR6, WD repeat superfamily [General function prediction only] Back     alignment and domain information
>KOG0649 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1523 consensus Actin-related protein Arp2/3 complex, subunit ARPC1/p41-ARC [Cytoskeleton] Back     alignment and domain information
>KOG1334 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG2321 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1334 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PRK03629 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A Back     alignment and domain information
>PRK03629 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1272 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG1912 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF04762 IKI3: IKI3 family; InterPro: IPR006849 Members of this family are components of the elongator multi-subunit component of a novel RNA polymerase II holoenzyme for transcriptional elongation [] Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG2139 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK02889 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG2394 consensus WD40 protein DMR-N9 [General function prediction only] Back     alignment and domain information
>KOG1524 consensus WD40 repeat-containing protein CHE-2 [General function prediction only] Back     alignment and domain information
>PRK02889 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG2111 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A Back     alignment and domain information
>PF08662 eIF2A: Eukaryotic translation initiation factor eIF2A; InterPro: IPR013979 This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins Back     alignment and domain information
>KOG2139 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1272 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>PF08662 eIF2A: Eukaryotic translation initiation factor eIF2A; InterPro: IPR013979 This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG2321 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>COG5354 Uncharacterized protein, contains Trp-Asp (WD) repeat [General function prediction only] Back     alignment and domain information
>PF04762 IKI3: IKI3 family; InterPro: IPR006849 Members of this family are components of the elongator multi-subunit component of a novel RNA polymerase II holoenzyme for transcriptional elongation [] Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>KOG3881 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1409 consensus Uncharacterized conserved protein, contains WD40 repeats and FYVE domains [Function unknown] Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1310 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG0974 consensus WD-repeat protein WDR6, WD repeat superfamily [General function prediction only] Back     alignment and domain information
>PRK01029 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG2315 consensus Predicted translation initiation factor related to eIF-3a [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG3881 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2314 consensus Translation initiation factor 3, subunit b (eIF-3b) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>KOG1409 consensus Uncharacterized conserved protein, contains WD40 repeats and FYVE domains [Function unknown] Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG4547 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG3914 consensus WD repeat protein WDR4 [Function unknown] Back     alignment and domain information
>KOG1354 consensus Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms] Back     alignment and domain information
>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain Back     alignment and domain information
>KOG3914 consensus WD repeat protein WDR4 [Function unknown] Back     alignment and domain information
>COG4946 Uncharacterized protein related to the periplasmic component of the Tol biopolymer transport system [Function unknown] Back     alignment and domain information
>KOG1064 consensus RAVE (regulator of V-ATPase assembly) complex subunit RAV1/DMX protein, WD repeat superfamily [General function prediction only] Back     alignment and domain information
>COG4946 Uncharacterized protein related to the periplasmic component of the Tol biopolymer transport system [Function unknown] Back     alignment and domain information
>KOG1064 consensus RAVE (regulator of V-ATPase assembly) complex subunit RAV1/DMX protein, WD repeat superfamily [General function prediction only] Back     alignment and domain information
>KOG1354 consensus Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms] Back     alignment and domain information
>COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG4547 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain Back     alignment and domain information
>PF15492 Nbas_N: Neuroblastoma-amplified sequence, N terminal Back     alignment and domain information
>KOG4714 consensus Nucleoporin [Nuclear structure] Back     alignment and domain information
>KOG2066 consensus Vacuolar assembly/sorting protein VPS41 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK04043 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF11768 DUF3312: Protein of unknown function (DUF3312); InterPro: IPR024511 This is a eukaryotic family of uncharacterised proteins that contain WD40 repeats Back     alignment and domain information
>COG5170 CDC55 Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms] Back     alignment and domain information
>KOG4714 consensus Nucleoporin [Nuclear structure] Back     alignment and domain information
>KOG4532 consensus WD40-like repeat containing protein [General function prediction only] Back     alignment and domain information
>PRK01029 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF00400 WD40: WD domain, G-beta repeat; InterPro: IPR019781 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide Back     alignment and domain information
>KOG0280 consensus Uncharacterized conserved protein [Amino acid transport and metabolism] Back     alignment and domain information
>PRK11138 outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>PRK04043 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG3621 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0280 consensus Uncharacterized conserved protein [Amino acid transport and metabolism] Back     alignment and domain information
>KOG2315 consensus Predicted translation initiation factor related to eIF-3a [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF00957 Synaptobrevin: Synaptobrevin; InterPro: IPR001388 Synaptobrevin is an intrinsic membrane protein of small synaptic vesicles [], specialised secretory organelles of neurons that actively accumulate neurotransmitters and participate in their calcium-dependent release by exocytosis Back     alignment and domain information
>KOG0860 consensus Synaptobrevin/VAMP-like protein [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4190 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4649 consensus PQQ (pyrrolo-quinoline quinone) repeat protein [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK11138 outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>KOG2695 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG4190 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG5354 Uncharacterized protein, contains Trp-Asp (WD) repeat [General function prediction only] Back     alignment and domain information
>KOG2314 consensus Translation initiation factor 3, subunit b (eIF-3b) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG3621 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information
>KOG1645 consensus RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>PF11768 DUF3312: Protein of unknown function (DUF3312); InterPro: IPR024511 This is a eukaryotic family of uncharacterised proteins that contain WD40 repeats Back     alignment and domain information
>KOG4532 consensus WD40-like repeat containing protein [General function prediction only] Back     alignment and domain information
>PF15492 Nbas_N: Neuroblastoma-amplified sequence, N terminal Back     alignment and domain information
>PF00400 WD40: WD domain, G-beta repeat; InterPro: IPR019781 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide Back     alignment and domain information
>KOG2695 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>COG5170 CDC55 Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms] Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>KOG1645 consensus RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF03178 CPSF_A: CPSF A subunit region; InterPro: IPR004871 This family includes a region that lies towards the C terminus of the cleavage and polyadenylation specificity factor (CPSF) A (160 kDa) subunit Back     alignment and domain information
>KOG0309 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG4649 consensus PQQ (pyrrolo-quinoline quinone) repeat protein [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>KOG0882 consensus Cyclophilin-related peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0309 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>KOG2066 consensus Vacuolar assembly/sorting protein VPS41 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF07433 DUF1513: Protein of unknown function (DUF1513); InterPro: IPR008311 There are currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>KOG0882 consensus Cyclophilin-related peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>PF08596 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; InterPro: IPR013905 The Lethal giant larvae (Lgl) tumour suppressor protein is conserved from yeast to mammals Back     alignment and domain information
>KOG1832 consensus HIV-1 Vpr-binding protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF00780 CNH: CNH domain; InterPro: IPR001180 Based on sequence similarities a domain of homology has been identified in the following proteins []: Citron and Citron kinase Back     alignment and domain information
>PF06977 SdiA-regulated: SdiA-regulated; InterPro: IPR009722 This entry represents a conserved region approximately 100 residues long within a number of hypothetical bacterial proteins that may be regulated by SdiA, a member of the LuxR family of transcriptional regulators [] Back     alignment and domain information
>PRK02888 nitrous-oxide reductase; Validated Back     alignment and domain information
>PF14783 BBS2_Mid: Ciliary BBSome complex subunit 2, middle region Back     alignment and domain information
>PF04841 Vps16_N: Vps16, N-terminal region; InterPro: IPR006926 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information
>KOG1275 consensus PAB-dependent poly(A) ribonuclease, subunit PAN2 [Replication, recombination and repair] Back     alignment and domain information
>KOG4640 consensus Anaphase-promoting complex (APC), subunit 4 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF00780 CNH: CNH domain; InterPro: IPR001180 Based on sequence similarities a domain of homology has been identified in the following proteins []: Citron and Citron kinase Back     alignment and domain information
>PF00930 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-terminal region; InterPro: IPR002469 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF07433 DUF1513: Protein of unknown function (DUF1513); InterPro: IPR008311 There are currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>KOG1897 consensus Damage-specific DNA binding complex, subunit DDB1 [Replication, recombination and repair] Back     alignment and domain information
>PF14783 BBS2_Mid: Ciliary BBSome complex subunit 2, middle region Back     alignment and domain information
>KOG2079 consensus Vacuolar assembly/sorting protein VPS8 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF12894 Apc4_WD40: Anaphase-promoting complex subunit 4 WD40 domain Back     alignment and domain information
>smart00320 WD40 WD40 repeats Back     alignment and domain information
>KOG1275 consensus PAB-dependent poly(A) ribonuclease, subunit PAN2 [Replication, recombination and repair] Back     alignment and domain information
>PF06433 Me-amine-dh_H: Methylamine dehydrogenase heavy chain (MADH); InterPro: IPR009451 Methylamine dehydrogenase (1 Back     alignment and domain information
>cd00216 PQQ_DH Dehydrogenases with pyrrolo-quinoline quinone (PQQ) as cofactor, like ethanol, methanol, and membrane bound glucose dehydrogenases Back     alignment and domain information
>PF14727 PHTB1_N: PTHB1 N-terminus Back     alignment and domain information
>KOG0859 consensus Synaptobrevin/VAMP-like protein [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4640 consensus Anaphase-promoting complex (APC), subunit 4 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG3204 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG0823 TolB Periplasmic component of the Tol biopolymer transport system [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG2079 consensus Vacuolar assembly/sorting protein VPS8 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF06977 SdiA-regulated: SdiA-regulated; InterPro: IPR009722 This entry represents a conserved region approximately 100 residues long within a number of hypothetical bacterial proteins that may be regulated by SdiA, a member of the LuxR family of transcriptional regulators [] Back     alignment and domain information
>KOG1897 consensus Damage-specific DNA binding complex, subunit DDB1 [Replication, recombination and repair] Back     alignment and domain information
>KOG1832 consensus HIV-1 Vpr-binding protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>cd00216 PQQ_DH Dehydrogenases with pyrrolo-quinoline quinone (PQQ) as cofactor, like ethanol, methanol, and membrane bound glucose dehydrogenases Back     alignment and domain information
>KOG1008 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK13616 lipoprotein LpqB; Provisional Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF08553 VID27: VID27 cytoplasmic protein; InterPro: IPR013863 This entry represents fungal and plant proteins and contains many hypothetical proteins Back     alignment and domain information
>PF03178 CPSF_A: CPSF A subunit region; InterPro: IPR004871 This family includes a region that lies towards the C terminus of the cleavage and polyadenylation specificity factor (CPSF) A (160 kDa) subunit Back     alignment and domain information
>COG0823 TolB Periplasmic component of the Tol biopolymer transport system [Intracellular trafficking and secretion] Back     alignment and domain information
>PF04841 Vps16_N: Vps16, N-terminal region; InterPro: IPR006926 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>PF12894 Apc4_WD40: Anaphase-promoting complex subunit 4 WD40 domain Back     alignment and domain information
>smart00320 WD40 WD40 repeats Back     alignment and domain information
>COG3386 Gluconolactonase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF08553 VID27: VID27 cytoplasmic protein; InterPro: IPR013863 This entry represents fungal and plant proteins and contains many hypothetical proteins Back     alignment and domain information
>COG3391 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1008 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] Back     alignment and domain information
>PF05096 Glu_cyclase_2: Glutamine cyclotransferase; InterPro: IPR007788 This family of enzymes 2 Back     alignment and domain information
>COG3391 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3630 consensus Nuclear pore complex, Nup214/CAN component [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF10647 Gmad1: Lipoprotein LpqB beta-propeller domain; InterPro: IPR018910 The Gmad1 domain is found associated with IPR019606 from INTERPRO, in bacterial spore formation Back     alignment and domain information
>PF10395 Utp8: Utp8 family; InterPro: IPR018843 Utp8 is an essential component of the nuclear tRNA export machinery in Saccharomyces cerevisiae (Baker's yeast) Back     alignment and domain information
>PF06433 Me-amine-dh_H: Methylamine dehydrogenase heavy chain (MADH); InterPro: IPR009451 Methylamine dehydrogenase (1 Back     alignment and domain information
>PRK13616 lipoprotein LpqB; Provisional Back     alignment and domain information
>KOG2444 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG2444 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF02897 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal beta-propeller domain; InterPro: IPR004106 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF10647 Gmad1: Lipoprotein LpqB beta-propeller domain; InterPro: IPR018910 The Gmad1 domain is found associated with IPR019606 from INTERPRO, in bacterial spore formation Back     alignment and domain information
>PF14781 BBS2_N: Ciliary BBSome complex subunit 2, N-terminal Back     alignment and domain information
>KOG4499 consensus Ca2+-binding protein Regucalcin/SMP30 [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>PF14655 RAB3GAP2_N: Rab3 GTPase-activating protein regulatory subunit N-terminus Back     alignment and domain information
>COG3490 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG3204 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF14761 HPS3_N: Hermansky-Pudlak syndrome 3 Back     alignment and domain information
>PRK02888 nitrous-oxide reductase; Validated Back     alignment and domain information
>PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs Back     alignment and domain information
>PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs Back     alignment and domain information
>PF14870 PSII_BNR: Photosynthesis system II assembly factor YCF48; PDB: 2XBG_A Back     alignment and domain information
>KOG2395 consensus Protein involved in vacuole import and degradation [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG3386 Gluconolactonase [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR03075 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methanol/ethanol family Back     alignment and domain information
>PF14781 BBS2_N: Ciliary BBSome complex subunit 2, N-terminal Back     alignment and domain information
>PF08728 CRT10: CRT10; InterPro: IPR014839 CRT10 is a transcriptional regulator of ribonucleotide reductase (RNR) genes [] Back     alignment and domain information
>PF10979 DUF2786: Protein of unknown function (DUF2786); InterPro: IPR024498 This domain is found in proteins that have no known function Back     alignment and domain information
>PF15390 DUF4613: Domain of unknown function (DUF4613) Back     alignment and domain information
>PF08728 CRT10: CRT10; InterPro: IPR014839 CRT10 is a transcriptional regulator of ribonucleotide reductase (RNR) genes [] Back     alignment and domain information
>KOG2395 consensus Protein involved in vacuole import and degradation [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF14870 PSII_BNR: Photosynthesis system II assembly factor YCF48; PDB: 2XBG_A Back     alignment and domain information
>PF10313 DUF2415: Uncharacterised protein domain (DUF2415); InterPro: IPR019417 This entry represents a short (30 residues) domain of unknown function found in a family of fungal proteins Back     alignment and domain information
>COG3490 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF07569 Hira: TUP1-like enhancer of split; InterPro: IPR011494 The Hira proteins are found in a range of eukaryotes and are implicated in the assembly of repressive chromatin Back     alignment and domain information
>TIGR03074 PQQ_membr_DH membrane-bound PQQ-dependent dehydrogenase, glucose/quinate/shikimate family Back     alignment and domain information
>KOG1896 consensus mRNA cleavage and polyadenylation factor II complex, subunit CFT1 (CPSF subunit) [RNA processing and modification] Back     alignment and domain information
>PHA02713 hypothetical protein; Provisional Back     alignment and domain information
>PF12234 Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR022033 This domain family is found in eukaryotes, and is typically between 621 and 644 amino acids in length Back     alignment and domain information
>KOG3630 consensus Nuclear pore complex, Nup214/CAN component [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PLN00033 photosystem II stability/assembly factor; Provisional Back     alignment and domain information
>TIGR02604 Piru_Ver_Nterm putative membrane-bound dehydrogenase domain Back     alignment and domain information
>PF13449 Phytase-like: Esterase-like activity of phytase Back     alignment and domain information
>PF05096 Glu_cyclase_2: Glutamine cyclotransferase; InterPro: IPR007788 This family of enzymes 2 Back     alignment and domain information
>PF08366 LLGL: LLGL2; InterPro: IPR013577 This domain is found in lethal giant larvae homologue 2 (LLGL2) proteins and syntaxin-binding proteins like tomosyn [] Back     alignment and domain information
>PRK13684 Ycf48-like protein; Provisional Back     alignment and domain information
>KOG1916 consensus Nuclear protein, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>PF05694 SBP56: 56kDa selenium binding protein (SBP56); InterPro: IPR008826 This family consists of several eukaryotic selenium binding proteins as well as three sequences from archaea Back     alignment and domain information
>KOG2280 consensus Vacuolar assembly/sorting protein VPS16 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF14761 HPS3_N: Hermansky-Pudlak syndrome 3 Back     alignment and domain information
>TIGR03075 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methanol/ethanol family Back     alignment and domain information
>PF00930 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-terminal region; InterPro: IPR002469 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>KOG4499 consensus Ca2+-binding protein Regucalcin/SMP30 [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>KOG2280 consensus Vacuolar assembly/sorting protein VPS16 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK13684 Ycf48-like protein; Provisional Back     alignment and domain information
>PF11715 Nup160: Nucleoporin Nup120/160; InterPro: IPR021717 Nup120 is conserved from fungi to plants to humans, and is homologous with the Nup160 of vertebrates Back     alignment and domain information
>PF12234 Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR022033 This domain family is found in eukaryotes, and is typically between 621 and 644 amino acids in length Back     alignment and domain information
>PF07569 Hira: TUP1-like enhancer of split; InterPro: IPR011494 The Hira proteins are found in a range of eukaryotes and are implicated in the assembly of repressive chromatin Back     alignment and domain information
>PF12768 Rax2: Cortical protein marker for cell polarity Back     alignment and domain information
>PRK10115 protease 2; Provisional Back     alignment and domain information
>TIGR03118 PEPCTERM_chp_1 conserved hypothetical protein TIGR03118 Back     alignment and domain information
>PF12657 TFIIIC_delta: Transcription factor IIIC subunit delta N-term; InterPro: IPR024761 This entry represents a domain found towards the N terminus of the 90 kDa subunit of transcription factor IIIC (also known as subunit 9 in yeast []) Back     alignment and domain information
>PF12768 Rax2: Cortical protein marker for cell polarity Back     alignment and domain information
>PF14655 RAB3GAP2_N: Rab3 GTPase-activating protein regulatory subunit N-terminus Back     alignment and domain information
>PF14583 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C5M_C 3PE7_A Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1108
2oaj_A902 Crystal Structure Of Sro7 From S. Cerevisiae Length 1e-10
>pdb|2OAJ|A Chain A, Crystal Structure Of Sro7 From S. Cerevisiae Length = 902 Back     alignment and structure 
Iteration: 1

 Score = 65.9 bits (159), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 49/167 (29%), Positives = 80/167 (47%), Gaps = 8/167 (4%)
Query: 32  YGIPATASILAFDHIQRLLAIATLDGRIKVIGGDGIEGLLISPSQLPYKNLEFLQNQGFL 91
           YG+ +     AFD  Q LLAIAT+ G + + G   +E ++    +   K + F++   +L
Sbjct: 14  YGMSSKPIAAAFDFTQNLLAIATVTGEVHIYGQQQVEVVIKLEDRSAIKEMRFVKGI-YL 72
Query: 92  ISITNDNEIQVWSLESRSLACCLKWESNITAFSVISGSHFMYIGDENGLMSVIKYDADEG 151
           + I   + + V SL S+ +   +     IT+    +   +M IG +NG M V   D D+ 
Sbjct: 73  VVINAKDTVYVLSLYSQKVLTTVFVPGKITSIDTDASLDWMLIGLQNGSMIVYDIDRDQL 132
Query: 152 KLFQLPYNISADALSEKAGFPLLSHQPVVGVLPHPNSSGNRVLIAYE 198
             F+L      D L + + FP     P+V +  +P   G  VLI+YE
Sbjct: 133 SSFKL------DNLQKSSFFPAARLSPIVSIQWNPRDIGT-VLISYE 172

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query1108
2oaj_A902 Protein SNI1; WD40 repeat, beta propeller, endocyt 100.0
2ymu_A577 WD-40 repeat protein; unknown function, two domain 100.0
2ymu_A577 WD-40 repeat protein; unknown function, two domain 100.0
1nr0_A611 Actin interacting protein 1; beta propeller, WD40 100.0
3sfz_A1249 APAF-1, apoptotic peptidase activating factor 1; a 100.0
1nr0_A611 Actin interacting protein 1; beta propeller, WD40 100.0
1pgu_A615 Actin interacting protein 1; WD repeat, seven-blad 100.0
3sfz_A1249 APAF-1, apoptotic peptidase activating factor 1; a 100.0
1pgu_A615 Actin interacting protein 1; WD repeat, seven-blad 100.0
2oaj_A902 Protein SNI1; WD40 repeat, beta propeller, endocyt 100.0
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 100.0
1vyh_C410 Platelet-activating factor acetylhydrolase IB alph 100.0
3ow8_A321 WD repeat-containing protein 61; structural genomi 100.0
1vyh_C410 Platelet-activating factor acetylhydrolase IB alph 100.0
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 100.0
3fm0_A345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 100.0
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 100.0
3ow8_A321 WD repeat-containing protein 61; structural genomi 100.0
2ynn_A304 Coatomer subunit beta'; protein transport, peptide 100.0
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 100.0
3iz6_a380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 100.0
4g56_B357 MGC81050 protein; protein arginine methyltransfera 100.0
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 100.0
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 100.0
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 100.0
3fm0_A345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 100.0
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 100.0
2ynn_A304 Coatomer subunit beta'; protein transport, peptide 100.0
2pm9_A416 Protein WEB1, protein transport protein SEC31; bet 100.0
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 100.0
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 100.0
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 100.0
3frx_A319 Guanine nucleotide-binding protein subunit beta- l 100.0
4g56_B357 MGC81050 protein; protein arginine methyltransfera 100.0
2pm9_A416 Protein WEB1, protein transport protein SEC31; bet 100.0
3vl1_A420 26S proteasome regulatory subunit RPN14; beta-prop 100.0
1erj_A393 Transcriptional repressor TUP1; beta-propeller, tr 100.0
3frx_A319 Guanine nucleotide-binding protein subunit beta- l 100.0
3vl1_A420 26S proteasome regulatory subunit RPN14; beta-prop 100.0
2xzm_R343 RACK1; ribosome, translation; 3.93A {Tetrahymena t 100.0
4ery_A312 WD repeat-containing protein 5; WD40, WIN motif, b 100.0
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 100.0
3iz6_a380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 100.0
1erj_A393 Transcriptional repressor TUP1; beta-propeller, tr 100.0
2hes_X330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 100.0
2hes_X330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 100.0
2xzm_R343 RACK1; ribosome, translation; 3.93A {Tetrahymena t 100.0
4ery_A312 WD repeat-containing protein 5; WD40, WIN motif, b 99.98
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 99.98
2j04_B524 YDR362CP, TAU91; beta propeller, type 2 promoters, 99.98
3gre_A437 Serine/threonine-protein kinase VPS15; seven-blade 99.97
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 99.97
2ovr_B445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 99.97
3zwl_B369 Eukaryotic translation initiation factor 3 subuni; 99.97
1k8k_C372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 99.97
3ei3_B383 DNA damage-binding protein 2; UV-damage, DDB, nucl 99.97
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 99.97
4a11_B408 DNA excision repair protein ERCC-8; DNA binding pr 99.97
3i2n_A357 WD repeat-containing protein 92; WD40 repeats, str 99.97
2ovr_B445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 99.97
3k26_A366 Polycomb protein EED; WD40, structural genomics, N 99.97
2j04_B524 YDR362CP, TAU91; beta propeller, type 2 promoters, 99.97
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 99.97
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 99.97
4h5i_A365 Guanine nucleotide-exchange factor SEC12; copii ve 99.97
1k8k_C372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 99.97
4e54_B435 DNA damage-binding protein 2; beta barrel, double 99.97
3zwl_B369 Eukaryotic translation initiation factor 3 subuni; 99.97
3odt_A313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 99.97
3dm0_A694 Maltose-binding periplasmic protein fused with RAC 99.97
3ei3_B383 DNA damage-binding protein 2; UV-damage, DDB, nucl 99.97
3k26_A366 Polycomb protein EED; WD40, structural genomics, N 99.97
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 99.96
3i2n_A357 WD repeat-containing protein 92; WD40 repeats, str 99.96
3gre_A437 Serine/threonine-protein kinase VPS15; seven-blade 99.96
4a11_B408 DNA excision repair protein ERCC-8; DNA binding pr 99.96
3dm0_A694 Maltose-binding periplasmic protein fused with RAC 99.96
4gga_A420 P55CDC, cell division cycle protein 20 homolog; ce 99.96
4e54_B435 DNA damage-binding protein 2; beta barrel, double 99.96
3dwl_C377 Actin-related protein 2/3 complex subunit 1; prope 99.96
3dwl_C377 Actin-related protein 2/3 complex subunit 1; prope 99.96
2j04_A588 TAU60, YPL007P, hypothetical protein YPL007C; beta 99.96
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 99.96
3odt_A313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 99.96
2pm7_B297 Protein transport protein SEC13, protein transport 99.96
4ggc_A318 P55CDC, cell division cycle protein 20 homolog; ce 99.96
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 99.96
1yfq_A342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 99.95
4h5i_A365 Guanine nucleotide-exchange factor SEC12; copii ve 99.95
3bg1_A316 Protein SEC13 homolog; NPC, transport, WD repeat, 99.95
1p22_A435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 99.95
3dw8_B447 Serine/threonine-protein phosphatase 2A 55 kDa RE 99.95
2pm7_B297 Protein transport protein SEC13, protein transport 99.95
4ggc_A318 P55CDC, cell division cycle protein 20 homolog; ce 99.95
1yfq_A342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 99.95
3f3f_A351 Nucleoporin SEH1; structural protein, protein comp 99.95
3mmy_A368 MRNA export factor; mRNA export, nuclear protein; 99.95
3f3f_A351 Nucleoporin SEH1; structural protein, protein comp 99.95
3mmy_A368 MRNA export factor; mRNA export, nuclear protein; 99.95
3dw8_B447 Serine/threonine-protein phosphatase 2A 55 kDa RE 99.95
1p22_A435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 99.95
4gga_A420 P55CDC, cell division cycle protein 20 homolog; ce 99.94
2aq5_A402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 99.94
3jrp_A379 Fusion protein of protein transport protein SEC13 99.94
1k32_A 1045 Tricorn protease; protein degradation, substrate g 99.94
3jrp_A379 Fusion protein of protein transport protein SEC13 99.93
3bg1_A316 Protein SEC13 homolog; NPC, transport, WD repeat, 99.93
3vu4_A355 KMHSV2; beta-propeller fold, protein transport; 2. 99.93
2j04_A588 TAU60, YPL007P, hypothetical protein YPL007C; beta 99.93
2xyi_A430 Probable histone-binding protein CAF1; transcripti 99.93
2vdu_B450 TRNA (guanine-N(7)-)-methyltransferase- associated 99.93
1k32_A1045 Tricorn protease; protein degradation, substrate g 99.92
3vu4_A355 KMHSV2; beta-propeller fold, protein transport; 2. 99.92
2xyi_A430 Probable histone-binding protein CAF1; transcripti 99.92
4gq1_A393 NUP37; propeller, transport protein; 2.40A {Schizo 99.92
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 99.92
3jro_A753 Fusion protein of protein transport protein SEC13 99.92
1l0q_A391 Surface layer protein; SLP, S-layer, 7-bladed beta 99.91
2aq5_A402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 99.91
2vdu_B450 TRNA (guanine-N(7)-)-methyltransferase- associated 99.91
4gq1_A393 NUP37; propeller, transport protein; 2.40A {Schizo 99.91
1l0q_A391 Surface layer protein; SLP, S-layer, 7-bladed beta 99.91
3jro_A753 Fusion protein of protein transport protein SEC13 99.91
3lrv_A343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 99.9
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 99.89
1nir_A543 Nitrite reductase; hemoprotein, denitrification, d 99.89
3lrv_A343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 99.89
2w18_A356 PALB2, fancn, partner and localizer of BRCA2; fanc 99.88
2w18_A356 PALB2, fancn, partner and localizer of BRCA2; fanc 99.88
1nir_A543 Nitrite reductase; hemoprotein, denitrification, d 99.88
2ecf_A741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 99.85
2hqs_A415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 99.83
2hqs_A415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 99.83
2z3z_A706 Dipeptidyl aminopeptidase IV; peptidase family S9, 99.83
2ecf_A741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 99.81
1ri6_A343 Putative isomerase YBHE; 7-bladed propeller, enzym 99.79
1xfd_A723 DIP, dipeptidyl aminopeptidase-like protein 6, dip 99.78
1ri6_A343 Putative isomerase YBHE; 7-bladed propeller, enzym 99.78
2z3z_A706 Dipeptidyl aminopeptidase IV; peptidase family S9, 99.77
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 99.76
1pby_B337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 99.75
3u4y_A331 Uncharacterized protein; structural genomics, PSI- 99.73
3hfq_A347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 99.73
1xfd_A723 DIP, dipeptidyl aminopeptidase-like protein 6, dip 99.71
1z68_A719 Fibroblast activation protein, alpha subunit; sepr 99.71
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 99.71
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 99.7
3u4y_A331 Uncharacterized protein; structural genomics, PSI- 99.7
3o4h_A582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 99.7
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 99.69
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 99.66
3hfq_A347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 99.66
1jmx_B349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 99.66
3o4h_A582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 99.66
2oit_A434 Nucleoporin 214KDA; NH2 terminal domain of NUP214/ 99.65
1z68_A719 Fibroblast activation protein, alpha subunit; sepr 99.63
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 99.63
1jof_A365 Carboxy-CIS,CIS-muconate cyclase; beta-propeller, 99.59
1jof_A365 Carboxy-CIS,CIS-muconate cyclase; beta-propeller, 99.58
1jmx_B349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 99.58
4a5s_A740 Dipeptidyl peptidase 4 soluble form; hydrolase, ty 99.56
1pby_B337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 99.56
2oit_A434 Nucleoporin 214KDA; NH2 terminal domain of NUP214/ 99.55
3pe7_A388 Oligogalacturonate lyase; seven-bladed beta-propel 99.51
3pe7_A388 Oligogalacturonate lyase; seven-bladed beta-propel 99.49
3azo_A662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 99.46
1urq_A63 M-tomosyn isoform; transport protein, tomosyn-snar 99.46
3azo_A662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 99.45
3c5m_A396 Oligogalacturonate lyase; blade-shaped beta-propel 99.44
4a5s_A740 Dipeptidyl peptidase 4 soluble form; hydrolase, ty 99.43
2oiz_A361 Aromatic amine dehydrogenase, large subunit; oxido 99.43
2oiz_A361 Aromatic amine dehydrogenase, large subunit; oxido 99.41
1qks_A567 Cytochrome CD1 nitrite reductase; enzyme, oxidored 99.36
1qks_A567 Cytochrome CD1 nitrite reductase; enzyme, oxidored 99.34
2gop_A347 Trilobed protease; beta propeller, open velcro, hy 99.33
3c5m_A396 Oligogalacturonate lyase; blade-shaped beta-propel 99.24
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 99.23
2gop_A347 Trilobed protease; beta propeller, open velcro, hy 99.23
2dg1_A333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 99.16
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 99.16
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 99.15
2xdw_A710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 99.14
2bkl_A695 Prolyl endopeptidase; mechanistic study, celiac sp 99.14
3e5z_A296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 99.11
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 99.1
1xip_A388 Nucleoporin NUP159; beta-propeller, transport prot 99.1
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 99.09
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 99.07
2dg1_A333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 99.05
1yr2_A741 Prolyl oligopeptidase; prolyl endopeptidase, mecha 99.02
2xdw_A710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 98.99
3no2_A276 Uncharacterized protein; six-bladed beta-propeller 98.97
3e5z_A296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 98.96
3sjl_D386 Methylamine dehydrogenase heavy chain; MAUG, C-hem 98.95
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 98.94
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 98.92
1pjx_A314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 98.89
2mad_H373 Methylamine dehydrogenase (heavy subunit); oxidore 98.89
2bkl_A695 Prolyl endopeptidase; mechanistic study, celiac sp 98.88
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 98.87
1yr2_A741 Prolyl oligopeptidase; prolyl endopeptidase, mecha 98.85
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 98.84
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 98.79
3sjl_D386 Methylamine dehydrogenase heavy chain; MAUG, C-hem 98.78
3hrp_A409 Uncharacterized protein; NP_812590.1, structural g 98.77
1xip_A388 Nucleoporin NUP159; beta-propeller, transport prot 98.77
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 98.75
3q7m_A376 Lipoprotein YFGL, BAMB; beta-propeller, BAM comple 98.72
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 98.7
2mad_H373 Methylamine dehydrogenase (heavy subunit); oxidore 98.7
3no2_A276 Uncharacterized protein; six-bladed beta-propeller 98.67
4a2l_A795 BT_4663, two-component system sensor histidine kin 98.65
3hrp_A409 Uncharacterized protein; NP_812590.1, structural g 98.65
3c75_H426 MADH, methylamine dehydrogenase heavy chain; coppe 98.64
4a2l_A795 BT_4663, two-component system sensor histidine kin 98.62
1pjx_A314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 98.61
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 98.6
2ghs_A326 AGR_C_1268P; regucalcin, structural genomics, join 98.54
1kb0_A677 Quinohemoprotein alcohol dehydrogenase; beta-prope 98.52
2ghs_A326 AGR_C_1268P; regucalcin, structural genomics, join 98.52
3q7m_A376 Lipoprotein YFGL, BAMB; beta-propeller, BAM comple 98.51
3dr2_A305 Exported gluconolactonase; gluconolactonase SMP-30 98.46
3iuj_A693 Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas 98.44
2qe8_A343 Uncharacterized protein; structural genomics, join 98.41
3iuj_A693 Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas 98.41
1yiq_A689 Quinohemoprotein alcohol dehydrogenase; electron t 98.37
3v9f_A781 Two-component system sensor histidine kinase/RESP 98.35
3c75_H426 MADH, methylamine dehydrogenase heavy chain; coppe 98.34
1l4a_A80 Synaptobrevin; snare, snare complex, membrane fusi 98.33
3dr2_A305 Exported gluconolactonase; gluconolactonase SMP-30 98.33
1kb0_A677 Quinohemoprotein alcohol dehydrogenase; beta-prope 98.29
1yiq_A689 Quinohemoprotein alcohol dehydrogenase; electron t 98.23
1n7s_A63 Vesicle-associated membrane protein 2; neuronal sn 98.18
3v9f_A781 Two-component system sensor histidine kinase/RESP 98.18
1sfc_A96 VAMP 2, protein (synaptobrevin 2); membrane fusion 98.16
2hz6_A369 Endoplasmic reticulum to nucleus signalling 1 isof 98.13
2qe8_A343 Uncharacterized protein; structural genomics, join 98.12
2iwa_A266 Glutamine cyclotransferase; pyroglutamate, acyltra 98.12
1mda_H368 Methylamine dehydrogenase (heavy subunit); electro 98.06
3ei3_A1158 DNA damage-binding protein 1; UV-damage, DDB, nucl 98.05
3hd7_A91 Vesicle-associated membrane protein 2; membrane pr 98.01
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 98.01
2ece_A462 462AA long hypothetical selenium-binding protein; 97.99
3s94_A619 LRP-6, low-density lipoprotein receptor-related pr 97.96
1npe_A267 Nidogen, entactin; glycoprotein, basement membrane 97.95
2nps_A74 VAMP-4, vesicle-associated membrane protein 4; ves 97.91
3mbr_X243 Glutamine cyclotransferase; beta-propeller; 1.44A 97.91
1mda_H368 Methylamine dehydrogenase (heavy subunit); electro 97.89
3ei3_A1158 DNA damage-binding protein 1; UV-damage, DDB, nucl 97.82
2hz6_A369 Endoplasmic reticulum to nucleus signalling 1 isof 97.8
3hxj_A330 Pyrrolo-quinoline quinone; all beta protein. incom 97.8
2ece_A462 462AA long hypothetical selenium-binding protein; 97.79
2kog_A119 Vesicle-associated membrane protein 2; synaptobrev 97.78
2fp8_A322 Strictosidine synthase; six bladed beta propeller 97.74
1kv9_A668 Type II quinohemoprotein alcohol dehydrogenase; el 97.73
3b5n_A61 Synaptobrevin homolog 1; snare complex, syntaxin, 97.72
1kv9_A668 Type II quinohemoprotein alcohol dehydrogenase; el 97.72
1w6s_A599 Methanol dehydrogenase subunit 1; anisotropic, ele 97.71
3nok_A268 Glutaminyl cyclase; beta-propeller, cyclotransfera 97.65
1fwx_A595 Nitrous oxide reductase; beta-propeller domain, cu 97.65
4a0p_A628 LRP6, LRP-6, low-density lipoprotein receptor-rela 97.64
2ad6_A571 Methanol dehydrogenase subunit 1; PQQ configuratio 97.62
3qqz_A255 Putative uncharacterized protein YJIK; MCSG, PSI-2 97.61
1flg_A582 Protein (quinoprotein ethanol dehydrogenase); supe 97.58
1fwx_A595 Nitrous oxide reductase; beta-propeller domain, cu 97.54
2ad6_A571 Methanol dehydrogenase subunit 1; PQQ configuratio 97.42
1gl2_A65 Endobrevin; membrane protein, membrane fusion prot 97.35
1npe_A267 Nidogen, entactin; glycoprotein, basement membrane 97.32
2xe4_A751 Oligopeptidase B; hydrolase-inhibitor complex, hyd 97.32
2fp8_A322 Strictosidine synthase; six bladed beta propeller 97.3
2p4o_A306 Hypothetical protein; putative lactonase, structur 97.23
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 97.2
3nok_A268 Glutaminyl cyclase; beta-propeller, cyclotransfera 97.16
2iwa_A266 Glutamine cyclotransferase; pyroglutamate, acyltra 97.15
3mbr_X243 Glutamine cyclotransferase; beta-propeller; 1.44A 97.09
1ijq_A316 LDL receptor, low-density lipoprotein receptor; be 97.03
1k3i_A656 Galactose oxidase precursor; blade beta propeller, 97.02
3hxj_A330 Pyrrolo-quinoline quinone; all beta protein. incom 96.88
3amr_A355 3-phytase; beta-propeller, phytate, MYO-inositol h 96.87
3v64_C349 Agrin; beta propeller, laminin-G, signaling, prote 96.86
3v65_B386 Low-density lipoprotein receptor-related protein; 96.86
3amr_A355 3-phytase; beta-propeller, phytate, MYO-inositol h 96.82
3tc9_A430 Hypothetical hydrolase; 6-bladed beta-propeller, i 96.77
1k3i_A656 Galactose oxidase precursor; blade beta propeller, 96.75
3p5b_L400 Low density lipoprotein receptor variant; B-propel 96.71
2p4o_A306 Hypothetical protein; putative lactonase, structur 96.68
3sov_A318 LRP-6, low-density lipoprotein receptor-related pr 96.65
4hw6_A433 Hypothetical protein, IPT/TIG domain protein; puta 96.56
3v64_C349 Agrin; beta propeller, laminin-G, signaling, prote 96.5
3qqz_A255 Putative uncharacterized protein YJIK; MCSG, PSI-2 96.45
3m0c_C791 LDL receptor, low-density lipoprotein receptor; pr 96.36
3pbp_A452 Nucleoporin NUP82; beta-propeller, mRNA export, mR 96.24
3v65_B386 Low-density lipoprotein receptor-related protein; 96.21
3tc9_A430 Hypothetical hydrolase; 6-bladed beta-propeller, i 96.14
2p9w_A334 MAL S 1 allergenic protein; beta propeller; 1.35A 96.11
2xbg_A327 YCF48-like protein; photosynthesis, photosystem II 96.06
1flg_A582 Protein (quinoprotein ethanol dehydrogenase); supe 96.03
1w6s_A599 Methanol dehydrogenase subunit 1; anisotropic, ele 95.78
2nut_C196 Vesicle-trafficking protein SEC22B; human copii SE 95.76
3kya_A496 Putative phosphatase; structural genomics, joint c 95.6
1ijq_A316 LDL receptor, low-density lipoprotein receptor; be 95.59
2xe4_A751 Oligopeptidase B; hydrolase-inhibitor complex, hyd 95.46
4b93_A189 Vesicle-associated membrane protein 7; endocytosis 95.42
1n7d_A699 LDL receptor, low-density lipoprotein receptor; fa 94.93
3kya_A496 Putative phosphatase; structural genomics, joint c 94.78
3p5b_L400 Low density lipoprotein receptor variant; B-propel 94.78
3m0c_C791 LDL receptor, low-density lipoprotein receptor; pr 94.35
3sov_A318 LRP-6, low-density lipoprotein receptor-related pr 94.11
2xbg_A327 YCF48-like protein; photosynthesis, photosystem II 94.05
4hw6_A433 Hypothetical protein, IPT/TIG domain protein; puta 93.99
3pbp_A452 Nucleoporin NUP82; beta-propeller, mRNA export, mR 93.9
2xzh_A365 Clathrin heavy chain 1; endocytosis, endocytosis i 93.87
2p9w_A334 MAL S 1 allergenic protein; beta propeller; 1.35A 93.69
4a0p_A628 LRP6, LRP-6, low-density lipoprotein receptor-rela 93.1
3sre_A355 PON1, serum paraoxonase; directed evolution, 6-bla 92.98
2ism_A352 Putative oxidoreductase; BL41XU spring-8, bladed b 92.02
3a9g_A354 Putative uncharacterized protein; PQQ dependent de 91.87
1bpo_A494 Protein (clathrin); clathrin endocytosis beta-prop 91.45
2g8s_A353 Glucose/sorbosone dehydrogenases; bladed beta-prop 90.08
3kyq_A199 YKT6, synaptobrevin homolog YKT6; V-snare homolog, 89.77
1n7d_A699 LDL receptor, low-density lipoprotein receptor; fa 89.49
3s94_A619 LRP-6, low-density lipoprotein receptor-related pr 88.79
3uc1_A327 DNA gyrase subunit A; DNA binding protein, topoiso 88.41
1cru_A454 Protein (soluble quinoprotein glucose dehydrogena; 87.06
3ott_A758 Two-component system sensor histidine kinase; beta 85.88
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 85.77
1tl2_A236 L10, protein (tachylectin-2); animal lectin, horse 85.6
2ism_A352 Putative oxidoreductase; BL41XU spring-8, bladed b 85.49
3sre_A355 PON1, serum paraoxonase; directed evolution, 6-bla 85.2
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 85.19
3ott_A758 Two-component system sensor histidine kinase; beta 84.61
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 84.54
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 83.82
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 83.69
1cru_A454 Protein (soluble quinoprotein glucose dehydrogena; 83.45
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 83.41
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 83.14
3s25_A302 Hypothetical 7-bladed beta-propeller-like protein; 82.97
2be1_A339 Serine/threonine-protein kinase/endoribonuclease; 82.68
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 81.28
3a9g_A354 Putative uncharacterized protein; PQQ dependent de 81.26
2g8s_A353 Glucose/sorbosone dehydrogenases; bladed beta-prop 80.16
>2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
Probab=100.00  E-value=3.5e-64  Score=645.42  Aligned_cols=778  Identities=15%  Similarity=0.176  Sum_probs=534.8

Q ss_pred             cccccceeeeeeCCCCCceEEEEcCCCCEEEEEECCCcEEEEecCCcceEEeCCCCCCEEEEEEeeCCCEEEEEeCCCcE
Q 001279           21 AADLNLRIAVHYGIPATASILAFDHIQRLLAIATLDGRIKVIGGDGIEGLLISPSQLPYKNLEFLQNQGFLISITNDNEI  100 (1108)
Q Consensus        21 ~~~~~~~~~~~~G~~~~is~la~sp~~~~LA~Gs~dG~I~iw~~~~~~~~~~~~h~~~V~~l~fs~d~~~L~S~s~d~~I  100 (1108)
                      ++.++++...++||++.|++++|+|++++||+|+.||.|+||+....+......|..+|.+|+|+| +.+|++++.|++|
T Consensus         3 ~~~~~~~~~~~~gh~~~V~~lafspdg~~lAsgs~Dg~I~lw~~~~~~~~~~~~~~~~V~~l~fsp-g~~L~S~s~D~~v   81 (902)
T 2oaj_A            3 NKIFSLAETNKYGMSSKPIAAAFDFTQNLLAIATVTGEVHIYGQQQVEVVIKLEDRSAIKEMRFVK-GIYLVVINAKDTV   81 (902)
T ss_dssp             CTTEEEEEEEEEECSSCEEEEEEETTTTEEEEEETTSEEEEECSTTCEEEEECSSCCCEEEEEEET-TTEEEEEETTCEE
T ss_pred             hheeeeccccccCCCCCcEEEEECCCCCEEEEEeCCCEEEEEeCCCcEEEEEcCCCCCEEEEEEcC-CCEEEEEECcCeE
Confidence            567899999999999999999999999999999999999999999888887788999999999999 6799999999999


Q ss_pred             EEEEcCCCeeeeeecCCCCeeEEEEecCCCEEEEEeCCCcEEEEEEecCCCeeeeeceeecccccccccCCCCCCCCCeE
Q 001279          101 QVWSLESRSLACCLKWESNITAFSVISGSHFMYIGDENGLMSVIKYDADEGKLFQLPYNISADALSEKAGFPLLSHQPVV  180 (1108)
Q Consensus       101 ~vWd~~s~~~~~~~~~~~~Itsl~~~~~~~~l~vg~~dg~V~vw~~d~~~~~l~~~~~~i~~~~~~~~~~~~~~~~~~V~  180 (1108)
                      +|||+.+++.+..+.+...|++++|+|+++++++|+.||.|++|+++.  +.+.  +|.++...  ........+.++|+
T Consensus        82 ~lWd~~~~~~~~~~~~~~~V~~v~~sp~g~~l~sgs~dg~V~lwd~~~--~~~~--~~~i~~~~--~~~~~~~~h~~~V~  155 (902)
T 2oaj_A           82 YVLSLYSQKVLTTVFVPGKITSIDTDASLDWMLIGLQNGSMIVYDIDR--DQLS--SFKLDNLQ--KSSFFPAARLSPIV  155 (902)
T ss_dssp             EEEETTTCSEEEEEECSSCEEEEECCTTCSEEEEEETTSCEEEEETTT--TEEE--EEEECCHH--HHHTCSSSCCCCCC
T ss_pred             EEEECCCCcEEEEEcCCCCEEEEEECCCCCEEEEEcCCCcEEEEECCC--Cccc--cceecccc--ccccccccCCCCeE
Confidence            999999999988888889999999999999999999999999999874  3442  34442110  00011233447899


Q ss_pred             EEecccCCCCCEEEEEECCCeEEEEEccCCeEEEEeCCCcccccccccCCCCCCCCCcccCcCCCCCCCCceeEEEeecC
Q 001279          181 GVLPHPNSSGNRVLIAYENALVILWDVSEAQIIFVGGGKDLQLKDGVVDSPSEGDSTFLEGISEHQPEEKEISALCWASS  260 (1108)
Q Consensus       181 ~v~f~P~~~~~~ll~~~~dg~V~lWdl~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~Vtsl~w~sp  260 (1108)
                      +++|+|. ++..|++|+.||.| +||+++++.+..+...       .   +.+.+...... .....+...|++++|. |
T Consensus       156 sl~~sp~-~~~~l~~g~~dg~v-lWd~~~~~~~~~~~~~-------~---~~g~~~~~~~~-~~~~~h~~~V~~v~fs-p  221 (902)
T 2oaj_A          156 SIQWNPR-DIGTVLISYEYVTL-TYSLVENEIKQSFIYE-------L---PPFAPGGDFSE-KTNEKRTPKVIQSLYH-P  221 (902)
T ss_dssp             EEEEETT-EEEEEEEECSSCEE-EEETTTTEEEEEECCC-------B---CTTCCCSTTCC-CTTSCBCCCEEEEEEC-T
T ss_pred             EEEEccC-CCCEEEEEeCCCcE-EEECCCCceEEEEecc-------c---CCcCCCccccc-ccccccCCCeEEEEEc-C
Confidence            9999995 34569999999999 9999999876654320       0   01111110000 1111235679999986 9


Q ss_pred             CCCEEEEEEccCcEEEEecCCCCCCCC--ccC-CCCCceeeeecccc--cCCccEEEEEeecccccccCCCceEEEEeCC
Q 001279          261 SGSILAVGYIDGDILLWNTSTTASTKG--QQT-GSRNNVVKLELSSA--ERRLPVIVLHWSTNKESRSNIDGRLFVYGGD  335 (1108)
Q Consensus       261 dg~~l~sg~~DG~I~lWd~~~~~~~~~--~~~-~~~~~~~kl~~~~~--~~~~~i~~~~~~~~~s~~~~~~~~llv~gg~  335 (1108)
                      +|.+|++|+.||+|++||+.+++....  ... ....+..  ....+  ....+|..+.|+...   .+.++.++++|+.
T Consensus       222 dg~~lasgs~Dg~i~lWd~~~g~~~~~r~l~~~~~~~~~~--~~~~~~~~~~~~V~~v~w~~~~---~pd~~~ll~sg~~  296 (902)
T 2oaj_A          222 NSLHIITIHEDNSLVFWDANSGHMIMARTVFETEINVPQP--DYIRDSSTNAAKISKVYWMCEN---NPEYTSLLISHKS  296 (902)
T ss_dssp             TSSEEEEEETTCCEEEEETTTCCEEEEECSSCSCTTSCCT--TCCCCCSSCCCEEEEEEEEECS---STTEEEEEEEEEC
T ss_pred             CCCEEEEEECCCeEEEEECCCCcEEEEEeecccccCCCCC--cCCCCCccccCCeeEEEEEecC---CCCCCEEEEeCCC
Confidence            999999999999999999987642210  000 0000000  00000  123467788786632   2333577888866


Q ss_pred             CCCC-cceEEEEecccccc------------ccccceeeeeecCCCCccceEEEecCCCC--CCCCCcceEEEEcCCCeE
Q 001279          336 EIGS-EEVLTVLSLEWSSG------------MENLRCVSRVDITLTGSFADMILLSSAGA--TVGNHKADLFVLTSPGQL  400 (1108)
Q Consensus       336 ~~~~-~~~ltvl~l~~~~~------------~~~~~~~~~~~l~~~~~v~~~~~~p~~~~--~~~~~~~~l~vl~~~G~l  400 (1108)
                      +... ..++.++.+..+..            .....+...+.+.....+.++.+.++..+  .+.+++..+++++.+|.+
T Consensus       297 ~~~~~~~~v~~~~~~~~~~~~~~s~~~~~~~~~~~~~~~~~~~~~~~~v~~~~~~~~~sp~~~g~~d~~~l~~~s~dg~l  376 (902)
T 2oaj_A          297 ISRGDNQSLTMIDLGYTPRYSITSYEGMKNYYANPKQMKIFPLPTNVPIVNILPIPRQSPYFAGCHNPGLILLILGNGEI  376 (902)
T ss_dssp             STTSSCCCEEEEEEEECCCGGGCCHHHHHHHHHSCSEEEEECCSSSSCEEEEEECCSSCSHHHHTBSCSEEEEEETTSCE
T ss_pred             CCCCCCceEEEEecCCCCCccccchhhhhhhhcCccceEEEecCCCCceEEEEECCCCCCCcCCCCCceeEEEEcCCCcE
Confidence            5322 13444444321100            00111222233345678899999885333  244566678888899999


Q ss_pred             EEEeccceeeeccccCCCCCCCCccCCccccCCCCcceEEEEEeccCCCCchhhhhHHHhhccccCCCCccCcccccccC
Q 001279          401 HFYDNASLTTLLSQQEKKPSVCPVEFPGVIPISDPIMTVAEFMLLPFGGHSSKGLSEIATFTKLHSSHTQAGHIKWPLSG  480 (1108)
Q Consensus       401 ~~~d~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~it~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~wp~~g  480 (1108)
                      .+|+.....         ........+..+..+.+.++++.+.....     ..|.......         ....|++.|
T Consensus       377 ~~~~~~~g~---------~~~~~~~~~~~l~~~~~~v~~~~~s~~~~-----~~w~~~~~~~---------~~~~~~l~G  433 (902)
T 2oaj_A          377 ETMLYPSGI---------FTDKASLFPQNLSWLRPLATTSMAASVPN-----KLWLGALSAA---------QNKDYLLKG  433 (902)
T ss_dssp             EEEETTTCC---------EECCGGGSCGGGTTBTTBEEEEEEEEEEH-----HHHHHHHHTT---------BCCCCSCCC
T ss_pred             EEEECCCCC---------cccccccCCCcccccCCCeeEEEEEEcCH-----HHHHHHHhcc---------cCCCCcccC
Confidence            999853211         11112233556667888999988865432     3565544332         123467777


Q ss_pred             CcccCCCccccCCCCcEEEEEecCCcEEEEeCCCCceeeEeeeccccceeec-----cCCCCCeEEEEEEeCCCeEEEEe
Q 001279          481 GVPSPVPITKCHSVDRVYLAGYHDGSVRIWDATYPVFKLICALDAEVQGIEV-----AGSRAPVSTLSFCFINSSLAVGN  555 (1108)
Q Consensus       481 g~~~~~~~~~~s~~~~llatgs~DGtVriWd~~~~~l~~~~~l~~~~~~~~l-----~~h~~~Vt~lafs~d~~~Lasg~  555 (1108)
                      +.... ..++++|++++|+||+.||+||+||+.++.+...     ......+     .+|...|++|+|+||+++||+|+
T Consensus       434 ~~~~v-~sv~~spdg~~laSgs~DgtVrlWd~~~g~~~~~-----~~~~~~l~~~~~~~h~~~V~svafspdg~~LAsgs  507 (902)
T 2oaj_A          434 GVRTK-RQKLPAEYGTAFITGHSNGSVRIYDASHGDIQDN-----ASFEVNLSRTLNKAKELAVDKISFAAETLELAVSI  507 (902)
T ss_dssp             SBCCC-CCCCCCSEEEEEEEEETTSEEEEEESSCCTTTTT-----BCEEEEHHHHTTCSSSCCEEEEEEETTTTEEEEEE
T ss_pred             CcCCC-CcccccccCcEEEEecCCCcEEEEECCCccccCC-----ceEEeechhhcCCCCCCceeEEEecCCCCeEEEEe
Confidence            66544 3458999999999999999999999998764210     1111112     28999999999999999999999


Q ss_pred             cCceEEEEEecCCCC----------Cccccc----cccCccceeec------ccCCcceEEEEEeecCcCEEEEEEcCCC
Q 001279          556 EFGLVYIYNLNGSLD----------AKNFLF----VLETKSEVHAL------PEGKISLCRAVFSLVNSPVRALQFTSSG  615 (1108)
Q Consensus       556 ~dG~V~lw~l~~~~~----------~~~~~~----~~~~~~~~~~~------~~~~g~~~~~~~~~h~~~Vtslafspdg  615 (1108)
                      .||+|+||++.....          +.+..|    +.........+      ....+++++..+.+|.+.|++|+|||||
T Consensus       508 ~DgtV~lwd~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~l~~h~~~V~svafSpdG  587 (902)
T 2oaj_A          508 ETGDVVLFKYEVNQFYSVENRPESGDLEMNFRRFSLNNTNGVLVDVRDRAPTGVRQGFMPSTAVHANKGKTSAINNSNIG  587 (902)
T ss_dssp             TTSCEEEEEEEECCC---------------CCSCCGGGSSCSEEECGGGCCTTCSEEEEEEEEECCCSCSEEEEEECBTS
T ss_pred             cCcEEEEEEecCccccCccccCCCcccceeeeeccccCCccccccccccCCCCCCCccceeEEEEcCCCcEEEEEecCCc
Confidence            999999999986532          100111    11111111110      1133678899999999999999999999


Q ss_pred             CEEEEEeCCCeEEEEEccCceEEEEe--ecCC-CCCCceEEEEeeecccCccccCCCCCCCCCCCCCCCccEEEEEcCCc
Q 001279          616 AKLAVGFECGRVAVLDMNLLSVLFFT--DDIS-GSSSPIISMTWTEFKNTHSLAKNPNHSEREVPVNPAEEVIIVLFKDA  692 (1108)
Q Consensus       616 ~~LavGs~dG~V~vwd~~~~~~~~~~--~~~~-~h~~~V~~l~fs~~~~~~~~~~~p~~~~~~~~~~p~~~~L~s~s~Dg  692 (1108)
                       +||+|+.||+|+|||+.++.+++..  ..+. +|.+.|++++|+-....              +.++++.+|++|+.|+
T Consensus       588 -~lAsgs~D~tv~lwd~~~~~~~~~~~~~~~~~gh~~~V~sv~Fs~~~~~--------------~Dg~~~~~l~sgs~D~  652 (902)
T 2oaj_A          588 -FVGIAYAAGSLMLIDRRGPAIIYMENIREISGAQSACVTCIEFVIMEYG--------------DDGYSSILMVCGTDMG  652 (902)
T ss_dssp             -EEEEEETTSEEEEEETTTTEEEEEEEGGGTCSSCCCCEEEEEEEEEECT--------------TSSSEEEEEEEEETTS
T ss_pred             -EEEEEeCCCcEEEEECCCCeEEEEeehhHhccccccceEEEEEEEEecC--------------CCCCcceEEEEEecCC
Confidence             9999999999999999999887643  3454 89999999999932221              0012358999999999


Q ss_pred             cEEEEeC---CCcceecCCC--CcccccceeeEEEEecCCCCCCCccccccchhhhhccCCCCCCCCCCcccCCcccccc
Q 001279          693 KISIVGG---SSENMISSSP--WHLKKKVIAISMEVIAEPVCGFPIEKQAEQSAEENAAKNKPTPDTSSIETKSHETEHL  767 (1108)
Q Consensus       693 ~v~v~d~---~~g~~l~~~~--~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  767 (1108)
                      +|++||.   .+|+.+....  ...++...++.+..++.... .+....     +                         
T Consensus       653 tv~~wd~~p~~~g~~~~~~~~~~~~~~~~~v~~i~~~~~~~~-~~~~a~-----~-------------------------  701 (902)
T 2oaj_A          653 EVITYKILPASGGKFDVQLMDITNVTSKGPIHKIDAFSKETK-SSCLAT-----I-------------------------  701 (902)
T ss_dssp             EEEEEEEEECGGGCEEEEEEEEEECCSSCCCCEEEEEETTTC-CBCBCB-----H-------------------------
T ss_pred             cEEEEEEecCCCCcEEEEecCceecCCCCceEEEEeEecCCC-CcccCC-----H-------------------------
Confidence            9999998   7888654331  11222344555555542211 000000     0                         


Q ss_pred             cccccccCCCCCCCcEEEEEecCeeEEEecccccccccceeeeecCCCcceeeee--ee------cCCceeEEEEEeecC
Q 001279          768 FSSENACSGESSNDALVLLCCEDSVRLYSRKSVIQGNNKTVQKVKHKNRCCWAST--IE------KDEKVCGLLLLFQTG  839 (1108)
Q Consensus       768 ~~~~~~~~~~~~~~~~~~~c~e~~~~v~sl~~~~~g~~~~~~k~~~~~~~~~~~~--~~------~~~~~~~l~~~~~~G  839 (1108)
                      ...+ ....+...+.++|+|+|+.+|||++++     .++++|. +..+||++.+  |.      ..+++++|+++++||
T Consensus       702 ~~~~-~l~~~~~~~~~~l~~~~~~ir~~~~~~-----~k~~~k~-~~~~~~~~~v~~~~~~~~~~~~~~~~~l~~~~~~g  774 (902)
T 2oaj_A          702 PKMQ-NLSKGLCIPGIVLITGFDDIRLITLGK-----SKSTHKG-FKYPLAATGLSYISTVEKNNDRKNLTVIITLEING  774 (902)
T ss_dssp             HHHH-GGGGTCCCCEEEEEECSSEEEEECTTC-----CCEEEEE-CSSCEEEEEEEEEEEECSSSCEEEEEEEEEEETTS
T ss_pred             HHHh-ccCCCCCCCeEEEEEeccceEEEeCcc-----ccceeeE-cccceeeeEEEEEEeccccccccCceEEEEEeCCC
Confidence            0000 000111237799999999999999998     5788887 7777999888  55      346799999999999


Q ss_pred             cEEEeecCCccccccccccceeeceecCccccccccC-CCcEE-EEcCceeEEEEeecCCCceeccCCCCcchhh
Q 001279          840 AVQIRSLPDLELVMESSLMSILRWNFKANMDKTISAD-NGQIT-LANGSEVAFVNLLAGENEFSILESSPCLHDK  912 (1108)
Q Consensus       840 ~i~i~slp~l~~~~~~~~~~~~~~~~~~~~~~~~~~s-~Gq~~-l~~~~e~~~~~~~~~~~~~~~~~~~~~l~~~  912 (1108)
                      +|+|||||+|+.+...++..+++.+    .+...||+ +|+++ ++++.|+++++++.++..++-+  ...||.+
T Consensus       775 ~i~~~s~p~l~~~~~~~~~~~~~~~----~~~~~~~~~~G~~~~~~~~~e~~~~~~~~~~~~~~~~--~~~l~~~  843 (902)
T 2oaj_A          775 HLRVFTIPDFKEQMSEHIPFPIAAK----YITESSVLRNGDIAIRVSEFQASLFSTVKEQDTLAPV--SDTLYIN  843 (902)
T ss_dssp             EEEEEETTTCCEEEEEECSSCCCHH----HHTTCEECTTSCEEEECSSSEEEEEEEESCCCCCCCC--CCBCCCT
T ss_pred             cEEEEECcchHHHhhccCCcccccc----cccceEEcCCCCEEEEeChhheEEEEEEcCCCCCCCC--CceeeCC
Confidence            9999999999999988765533332    35667899 99955 4666999999999887777644  4788987
>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} Back     alignment and structure
>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} Back     alignment and structure
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>2j04_B YDR362CP, TAU91; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>2j04_B YDR362CP, TAU91; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>2j04_A TAU60, YPL007P, hypothetical protein YPL007C; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Back     alignment and structure
>4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A Back     alignment and structure
>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Back     alignment and structure
>4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A Back     alignment and structure
>3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A Back     alignment and structure
>2j04_A TAU60, YPL007P, hypothetical protein YPL007C; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Back     alignment and structure
>3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Back     alignment and structure
>4gq1_A NUP37; propeller, transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4gq2_P 4fhl_A 4fhm_A 4fhn_A Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4gq1_A NUP37; propeller, transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4gq2_P 4fhl_A 4fhm_A 4fhn_A Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2w18_A PALB2, fancn, partner and localizer of BRCA2; fanconi anemia, homologous recomination, polymorphism, phosphoprotein, beta-propeller, WD40, nucleus; 1.90A {Homo sapiens} PDB: 3eu7_A Back     alignment and structure
>2w18_A PALB2, fancn, partner and localizer of BRCA2; fanconi anemia, homologous recomination, polymorphism, phosphoprotein, beta-propeller, WD40, nucleus; 1.90A {Homo sapiens} PDB: 3eu7_A Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 Back     alignment and structure
>1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens} Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>2oit_A Nucleoporin 214KDA; NH2 terminal domain of NUP214/CAN, X-RAY crystallography, beta-propeller, structure, mRNA export, NPC assembly, leukemia; HET: MES; 1.65A {Homo sapiens} PDB: 3fmo_A* 3fmp_A* 3fhc_A Back     alignment and structure
>1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens} Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>1jof_A Carboxy-CIS,CIS-muconate cyclase; beta-propeller, homotetramer, seMet-protein, isomerase; HET: PIN; 2.50A {Neurospora crassa} SCOP: b.69.10.1 Back     alignment and structure
>1jof_A Carboxy-CIS,CIS-muconate cyclase; beta-propeller, homotetramer, seMet-protein, isomerase; HET: PIN; 2.50A {Neurospora crassa} SCOP: b.69.10.1 Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ... Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>2oit_A Nucleoporin 214KDA; NH2 terminal domain of NUP214/CAN, X-RAY crystallography, beta-propeller, structure, mRNA export, NPC assembly, leukemia; HET: MES; 1.65A {Homo sapiens} PDB: 3fmo_A* 3fmp_A* 3fhc_A Back     alignment and structure
>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} Back     alignment and structure
>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>1urq_A M-tomosyn isoform; transport protein, tomosyn-snare complex, exocytosis, four helical bundle, coiled coil; 2.0A {Rattus norvegicus} SCOP: h.1.15.1 Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ... Back     alignment and structure
>2oiz_A Aromatic amine dehydrogenase, large subunit; oxidoreductase, tryptophan tryptophyl quinone, H-tunneling; HET: TRQ TSR PG4; 1.05A {Alcaligenes faecalis} PDB: 2agw_A* 2agx_A* 2agl_A* 2agz_A* 2ah0_A* 2ah1_A* 2hj4_A* 2hjb_A* 2i0t_A* 2iup_A* 2iuq_A* 2iur_A* 2iuv_A* 2agy_A* 2ok4_A* 2ok6_A* 2iaa_A* 2h47_A* 2h3x_A* 2hkr_A* ... Back     alignment and structure
>2oiz_A Aromatic amine dehydrogenase, large subunit; oxidoreductase, tryptophan tryptophyl quinone, H-tunneling; HET: TRQ TSR PG4; 1.05A {Alcaligenes faecalis} PDB: 2agw_A* 2agx_A* 2agl_A* 2agz_A* 2ah0_A* 2ah1_A* 2hj4_A* 2hjb_A* 2i0t_A* 2iup_A* 2iuq_A* 2iur_A* 2iuv_A* 2agy_A* 2ok4_A* 2ok6_A* 2iaa_A* 2h47_A* 2h3x_A* 2hkr_A* ... Back     alignment and structure
>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* Back     alignment and structure
>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* Back     alignment and structure
>2gop_A Trilobed protease; beta propeller, open velcro, hydrolase; 2.00A {Pyrococcus furiosus} Back     alignment and structure
>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>2gop_A Trilobed protease; beta propeller, open velcro, hydrolase; 2.00A {Pyrococcus furiosus} Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>1xip_A Nucleoporin NUP159; beta-propeller, transport protein; 2.50A {Saccharomyces cerevisiae} SCOP: b.69.14.1 PDB: 3pez_C* 3rrm_C* Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>3sjl_D Methylamine dehydrogenase heavy chain; MAUG, C-heme, quinone cofactor, oxidoreductase-electron transport complex; HET: 0AF HEC MES; 1.63A {Paracoccus denitrificans} PDB: 2gc7_A* 2j55_H* 2j56_H* 2j57_G* 3l4m_D* 3l4o_D* 3orv_D* 3pxs_D* 3pxt_D* 3rlm_D* 2gc4_A* 3rn0_D* 3rn1_D* 3rmz_D* 3svw_D* 3sws_D* 3sxt_D* 3pxw_D* 3sle_D* 1mg2_A* ... Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H* Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>3sjl_D Methylamine dehydrogenase heavy chain; MAUG, C-heme, quinone cofactor, oxidoreductase-electron transport complex; HET: 0AF HEC MES; 1.63A {Paracoccus denitrificans} PDB: 2gc7_A* 2j55_H* 2j56_H* 2j57_G* 3l4m_D* 3l4o_D* 3orv_D* 3pxs_D* 3pxt_D* 3rlm_D* 2gc4_A* 3rn0_D* 3rn1_D* 3rmz_D* 3svw_D* 3sws_D* 3sxt_D* 3pxw_D* 3sle_D* 1mg2_A* ... Back     alignment and structure
>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>1xip_A Nucleoporin NUP159; beta-propeller, transport protein; 2.50A {Saccharomyces cerevisiae} SCOP: b.69.14.1 PDB: 3pez_C* 3rrm_C* Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H* Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>4a2l_A BT_4663, two-component system sensor histidine kinase/RESP; transcription, beta-propeller; HET: PGE PG4 MES 2PE; 2.60A {Bacteroides thetaiotaomicron} PDB: 4a2m_A* Back     alignment and structure
>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>3c75_H MADH, methylamine dehydrogenase heavy chain; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus} Back     alignment and structure
>4a2l_A BT_4663, two-component system sensor histidine kinase/RESP; transcription, beta-propeller; HET: PGE PG4 MES 2PE; 2.60A {Bacteroides thetaiotaomicron} PDB: 4a2m_A* Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 Back     alignment and structure
>1kb0_A Quinohemoprotein alcohol dehydrogenase; beta-propeller fold, cytochrome C, oxidoreductase; HET: TRO HEC PQQ; 1.44A {Comamonas testosteroni} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 Back     alignment and structure
>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A Back     alignment and structure
>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} Back     alignment and structure
>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* Back     alignment and structure
>2qe8_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL PG4; 1.35A {Anabaena variabilis atcc 29413} Back     alignment and structure
>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* Back     alignment and structure
>1yiq_A Quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM; 2.20A {Pseudomonas putida} Back     alignment and structure
>3v9f_A Two-component system sensor histidine kinase/RESP regulator, hybrid (ONE-component...; beta-propeller, beta-sandwich; 3.30A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3c75_H MADH, methylamine dehydrogenase heavy chain; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus} Back     alignment and structure
>1l4a_A Synaptobrevin; snare, snare complex, membrane fusion, neurotransmission, endocytosis/exocytosis complex; 2.95A {Loligo pealei} SCOP: h.1.15.1 Back     alignment and structure
>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} Back     alignment and structure
>1kb0_A Quinohemoprotein alcohol dehydrogenase; beta-propeller fold, cytochrome C, oxidoreductase; HET: TRO HEC PQQ; 1.44A {Comamonas testosteroni} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>1yiq_A Quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM; 2.20A {Pseudomonas putida} Back     alignment and structure
>1n7s_A Vesicle-associated membrane protein 2; neuronal snare protein complex, four helix bundle, transport protein; 1.45A {Rattus norvegicus} SCOP: h.1.15.1 PDB: 1kil_A 3rk2_A 3rk3_A 3rl0_A 3fii_B 3g94_B Back     alignment and structure
>3v9f_A Two-component system sensor histidine kinase/RESP regulator, hybrid (ONE-component...; beta-propeller, beta-sandwich; 3.30A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1sfc_A VAMP 2, protein (synaptobrevin 2); membrane fusion protein complex, transport protein; 2.40A {Rattus norvegicus} SCOP: h.1.15.1 Back     alignment and structure
>2hz6_A Endoplasmic reticulum to nucleus signalling 1 isoform 1 variant; triangular beta-sheet cluster, signaling protein; 3.10A {Homo sapiens} Back     alignment and structure
>2qe8_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL PG4; 1.35A {Anabaena variabilis atcc 29413} Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>1mda_H Methylamine dehydrogenase (heavy subunit); electron transport; HET: TRQ; 2.50A {Paracoccus denitrificans} SCOP: b.69.2.1 Back     alignment and structure
>3ei3_A DNA damage-binding protein 1; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Homo sapiens} PDB: 3ei1_A* 3ei2_A* 3ei4_A* 4a0l_A* 3e0c_A* 3i7k_A* 3i7h_A* 3i7l_A* 3i7n_A* 3i7o_A* 3i7p_A* 3i89_A* 3i8c_A* 3i8e_A* 2b5l_A 2b5m_A 2hye_A* 4a11_A* 4a0k_C* 4a0a_A* ... Back     alignment and structure
>3hd7_A Vesicle-associated membrane protein 2; membrane protein, coiled-coil, 4-helical bundle, cell juncti cytoplasmic vesicle, membrane, phosphoprotein; HET: GGG; 3.40A {Rattus norvegicus} PDB: 3hd9_A 3ipd_A Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>2ece_A 462AA long hypothetical selenium-binding protein; beta propeller, structural genomics, unknown function; 2.00A {Sulfolobus tokodaii} Back     alignment and structure
>3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} PDB: 4dg6_A* Back     alignment and structure
>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Back     alignment and structure
>2nps_A VAMP-4, vesicle-associated membrane protein 4; vesicle fusion, snare complex, early endosomal snare complex, VTI1A, VAMP4, transport protein; 2.50A {Mus musculus} Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>1mda_H Methylamine dehydrogenase (heavy subunit); electron transport; HET: TRQ; 2.50A {Paracoccus denitrificans} SCOP: b.69.2.1 Back     alignment and structure
>3ei3_A DNA damage-binding protein 1; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Homo sapiens} PDB: 3ei1_A* 3ei2_A* 3ei4_A* 4a0l_A* 3e0c_A* 3i7k_A* 3i7h_A* 3i7l_A* 3i7n_A* 3i7o_A* 3i7p_A* 3i89_A* 3i8c_A* 3i8e_A* 2b5l_A 2b5m_A 2hye_A* 4a11_A* 4a0k_C* 4a0a_A* ... Back     alignment and structure
>2hz6_A Endoplasmic reticulum to nucleus signalling 1 isoform 1 variant; triangular beta-sheet cluster, signaling protein; 3.10A {Homo sapiens} Back     alignment and structure
>3hxj_A Pyrrolo-quinoline quinone; all beta protein. incomplete 8-blade beta-propeller., struct genomics, PSI-2, protein structure initiative; 2.00A {Methanococcus maripaludis} Back     alignment and structure
>2ece_A 462AA long hypothetical selenium-binding protein; beta propeller, structural genomics, unknown function; 2.00A {Sulfolobus tokodaii} Back     alignment and structure
>2kog_A Vesicle-associated membrane protein 2; synaptobrevin, VAMP2, DPC micelle, snare, coiled coil, membrane fusion, transmembrane; NMR {Rattus norvegicus} Back     alignment and structure
>2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A* Back     alignment and structure
>1kv9_A Type II quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM EPE; 1.90A {Pseudomonas putida} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>3b5n_A Synaptobrevin homolog 1; snare complex, syntaxin, synaptobrevin, SNAP-25, SSO1P, SNC1P, SEC9P, SSO1, SNC1, coiled coil; 1.60A {Saccharomyces cerevisiae} SCOP: h.1.15.1 Back     alignment and structure
>1kv9_A Type II quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM EPE; 1.90A {Pseudomonas putida} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>1w6s_A Methanol dehydrogenase subunit 1; anisotropic, electron transfer, oxidoreductase, calcium- binding, methanol utilization, PQQ; HET: PQQ; 1.2A {Methylobacterium extorquens} SCOP: b.70.1.1 PDB: 1h4i_A* 1h4j_A* 2d0v_A* 1lrw_A* Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>1fwx_A Nitrous oxide reductase; beta-propeller domain, cupredoxin domain, CUZ site, CUA site oxidoreductase; 1.60A {Paracoccus denitrificans} SCOP: b.6.1.4 b.69.3.1 PDB: 2iwk_A 2iwf_A Back     alignment and structure
>4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* Back     alignment and structure
>2ad6_A Methanol dehydrogenase subunit 1; PQQ configuration, native, oxidoredu; HET: PQQ; 1.50A {Methylophilus methylotrophus} SCOP: b.70.1.1 PDB: 2ad7_A* 2ad8_A* 4aah_A* 1g72_A* Back     alignment and structure
>3qqz_A Putative uncharacterized protein YJIK; MCSG, PSI-2, structural genomics, midwest center for structu genomics, TOLB-like, Ca binding; 2.55A {Escherichia coli} Back     alignment and structure
>1flg_A Protein (quinoprotein ethanol dehydrogenase); superbarrel, oxidoreductase; HET: PQQ; 2.60A {Pseudomonas aeruginosa} SCOP: b.70.1.1 Back     alignment and structure
>1fwx_A Nitrous oxide reductase; beta-propeller domain, cupredoxin domain, CUZ site, CUA site oxidoreductase; 1.60A {Paracoccus denitrificans} SCOP: b.6.1.4 b.69.3.1 PDB: 2iwk_A 2iwf_A Back     alignment and structure
>2ad6_A Methanol dehydrogenase subunit 1; PQQ configuration, native, oxidoredu; HET: PQQ; 1.50A {Methylophilus methylotrophus} SCOP: b.70.1.1 PDB: 2ad7_A* 2ad8_A* 4aah_A* 1g72_A* Back     alignment and structure
>1gl2_A Endobrevin; membrane protein, membrane fusion protein complex, coiled coil, transmembrane; 1.9A {Rattus norvegicus} SCOP: h.1.15.1 Back     alignment and structure
>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Back     alignment and structure
>2xe4_A Oligopeptidase B; hydrolase-inhibitor complex, hydrolase, protease inhibitor trypanosomes, CLAN SC; HET: FC0 RGL; 1.65A {Leishmania major} Back     alignment and structure
>2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A* Back     alignment and structure
>2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3 Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Back     alignment and structure
>3hxj_A Pyrrolo-quinoline quinone; all beta protein. incomplete 8-blade beta-propeller., struct genomics, PSI-2, protein structure initiative; 2.00A {Methanococcus maripaludis} Back     alignment and structure
>3amr_A 3-phytase; beta-propeller, phytate, MYO-inositol hexasulfate, hydrolase-hydrolase inhibitor complex; HET: IHS; 1.25A {Bacillus subtilis} PDB: 3ams_A* 2poo_A 1poo_A 1qlg_A 1h6l_A 1cvm_A Back     alignment and structure
>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>3amr_A 3-phytase; beta-propeller, phytate, MYO-inositol hexasulfate, hydrolase-hydrolase inhibitor complex; HET: IHS; 1.25A {Bacillus subtilis} PDB: 3ams_A* 2poo_A 1poo_A 1qlg_A 1h6l_A 1cvm_A Back     alignment and structure
>3tc9_A Hypothetical hydrolase; 6-bladed beta-propeller, immunoglobulin-like, structural GEN joint center for structural genomics, JCSG; 2.23A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3 Back     alignment and structure
>3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B Back     alignment and structure
>4hw6_A Hypothetical protein, IPT/TIG domain protein; putative carbohydrate bindning two domains protein, IPT/TIG (PF01833), 6-beta-propeller; HET: MSE; 1.70A {Bacteroides ovatus} Back     alignment and structure
>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Back     alignment and structure
>3qqz_A Putative uncharacterized protein YJIK; MCSG, PSI-2, structural genomics, midwest center for structu genomics, TOLB-like, Ca binding; 2.55A {Escherichia coli} Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>3pbp_A Nucleoporin NUP82; beta-propeller, mRNA export, mRNP remodelling, nucleocytoplasmic transport, protein transport; HET: PGE; 2.60A {Saccharomyces cerevisiae} PDB: 3tkn_A Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>3tc9_A Hypothetical hydrolase; 6-bladed beta-propeller, immunoglobulin-like, structural GEN joint center for structural genomics, JCSG; 2.23A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2p9w_A MAL S 1 allergenic protein; beta propeller; 1.35A {Malassezia sympodialis} Back     alignment and structure
>2xbg_A YCF48-like protein; photosynthesis, photosystem II, beta-propeller, assembly FAC; 1.50A {Thermosynechococcus elongatus} Back     alignment and structure
>1flg_A Protein (quinoprotein ethanol dehydrogenase); superbarrel, oxidoreductase; HET: PQQ; 2.60A {Pseudomonas aeruginosa} SCOP: b.70.1.1 Back     alignment and structure
>1w6s_A Methanol dehydrogenase subunit 1; anisotropic, electron transfer, oxidoreductase, calcium- binding, methanol utilization, PQQ; HET: PQQ; 1.2A {Methylobacterium extorquens} SCOP: b.70.1.1 PDB: 1h4i_A* 1h4j_A* 2d0v_A* 1lrw_A* Back     alignment and structure
>2nut_C Vesicle-trafficking protein SEC22B; human copii SEC23/24 complexed with SEC22, protein transport; 2.30A {Homo sapiens} PDB: 2nup_C 3egd_C 3egx_C 1ifq_A Back     alignment and structure
>3kya_A Putative phosphatase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.77A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 Back     alignment and structure
>2xe4_A Oligopeptidase B; hydrolase-inhibitor complex, hydrolase, protease inhibitor trypanosomes, CLAN SC; HET: FC0 RGL; 1.65A {Leishmania major} Back     alignment and structure
>4b93_A Vesicle-associated membrane protein 7; endocytosis, exocytosis, snare; 2.00A {Mus musculus} PDB: 2dmw_A Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>3kya_A Putative phosphatase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.77A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B Back     alignment and structure
>2xbg_A YCF48-like protein; photosynthesis, photosystem II, beta-propeller, assembly FAC; 1.50A {Thermosynechococcus elongatus} Back     alignment and structure
>4hw6_A Hypothetical protein, IPT/TIG domain protein; putative carbohydrate bindning two domains protein, IPT/TIG (PF01833), 6-beta-propeller; HET: MSE; 1.70A {Bacteroides ovatus} Back     alignment and structure
>3pbp_A Nucleoporin NUP82; beta-propeller, mRNA export, mRNP remodelling, nucleocytoplasmic transport, protein transport; HET: PGE; 2.60A {Saccharomyces cerevisiae} PDB: 3tkn_A Back     alignment and structure
>2p9w_A MAL S 1 allergenic protein; beta propeller; 1.35A {Malassezia sympodialis} Back     alignment and structure
>4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* Back     alignment and structure
>3sre_A PON1, serum paraoxonase; directed evolution, 6-blades-propeller fold, hydrolase; HET: LMT; 1.99A {Artificial gene} PDB: 1v04_A* 3srg_A* Back     alignment and structure
>2ism_A Putative oxidoreductase; BL41XU spring-8, bladed beta-propellor, glucose dehydrogenas structural genomics, NPPSFA; 1.90A {Thermus thermophilus} Back     alignment and structure
>3a9g_A Putative uncharacterized protein; PQQ dependent dehydrogenase, aldose sugar dehydrogenase, BET propeller fold, oxidoreductase; HET: TRE; 2.39A {Pyrobaculum aerophilum} PDB: 3a9h_A* Back     alignment and structure
>1bpo_A Protein (clathrin); clathrin endocytosis beta-propeller coated-PITS, membrane PR; 2.60A {Rattus norvegicus} SCOP: a.118.1.4 b.69.6.1 Back     alignment and structure
>2g8s_A Glucose/sorbosone dehydrogenases; bladed beta-propellor, pyrolloquinoline quinone (PQQ), quinoprotein, sugar binding protein; HET: MSE; 1.50A {Escherichia coli K12} Back     alignment and structure
>3kyq_A YKT6, synaptobrevin homolog YKT6; V-snare homolog, lipid binding, cytoplasmic vesicle, ER-GOLG transport, golgi apparatus, lipoprotein; HET: DPV; 2.44A {Rattus norvegicus} Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} PDB: 4dg6_A* Back     alignment and structure
>3uc1_A DNA gyrase subunit A; DNA binding protein, topoisomerase, isomerase; HET: DNA; 1.65A {Mycobacterium tuberculosis} Back     alignment and structure
>1cru_A Protein (soluble quinoprotein glucose dehydrogena; beta-propeller, superbarrel; HET: PQQ; 1.50A {Acinetobacter calcoaceticus} SCOP: b.68.2.1 PDB: 1c9u_A* 1cq1_A* 1qbi_A Back     alignment and structure
>3ott_A Two-component system sensor histidine kinase; beta-propeller, beta-sandwich, transcription; HET: TBR; 2.30A {Bacteroides thetaiotaomicron} PDB: 3va6_A Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Back     alignment and structure
>1tl2_A L10, protein (tachylectin-2); animal lectin, horseshoe CRAB, N-acetylglucosamine, beta- propeller, sugar binding protein; HET: NDG; 2.00A {Tachypleus tridentatus} SCOP: b.67.1.1 PDB: 3kif_A* 3kih_A* Back     alignment and structure
>2ism_A Putative oxidoreductase; BL41XU spring-8, bladed beta-propellor, glucose dehydrogenas structural genomics, NPPSFA; 1.90A {Thermus thermophilus} Back     alignment and structure
>3sre_A PON1, serum paraoxonase; directed evolution, 6-blades-propeller fold, hydrolase; HET: LMT; 1.99A {Artificial gene} PDB: 1v04_A* 3srg_A* Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Back     alignment and structure
>3ott_A Two-component system sensor histidine kinase; beta-propeller, beta-sandwich, transcription; HET: TBR; 2.30A {Bacteroides thetaiotaomicron} PDB: 3va6_A Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Back     alignment and structure
>1cru_A Protein (soluble quinoprotein glucose dehydrogena; beta-propeller, superbarrel; HET: PQQ; 1.50A {Acinetobacter calcoaceticus} SCOP: b.68.2.1 PDB: 1c9u_A* 1cq1_A* 1qbi_A Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Back     alignment and structure
>3s25_A Hypothetical 7-bladed beta-propeller-like protein; structural genomics, joint center F structural genomics, JCSG; 1.88A {Eubacterium rectale} Back     alignment and structure
>2be1_A Serine/threonine-protein kinase/endoribonuclease; transcription; 2.98A {Saccharomyces cerevisiae} Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Back     alignment and structure
>3a9g_A Putative uncharacterized protein; PQQ dependent dehydrogenase, aldose sugar dehydrogenase, BET propeller fold, oxidoreductase; HET: TRE; 2.39A {Pyrobaculum aerophilum} PDB: 3a9h_A* Back     alignment and structure
>2g8s_A Glucose/sorbosone dehydrogenases; bladed beta-propellor, pyrolloquinoline quinone (PQQ), quinoprotein, sugar binding protein; HET: MSE; 1.50A {Escherichia coli K12} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 1108
d1vyhc1317 b.69.4.1 (C:92-408) Platelet-activating factor ace 3e-04
d1tbga_340 b.69.4.1 (A:) beta1-subunit of the signal-transduc 9e-04
d1nr0a2299 b.69.4.1 (A:313-611) Actin interacting protein 1 { 0.001
d1gxra_337 b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Hum 0.003
d1k8kc_371 b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 0.004
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure

class: All beta proteins
fold: 7-bladed beta-propeller
superfamily: WD40 repeat-like
family: WD40-repeat
domain: Platelet-activating factor acetylhydrolase IB subunit alpha
species: Mouse (Mus musculus) [TaxId: 10090]

 Score = 41.7 bits (96), Expect = 3e-04
 Identities = 39/319 (12%), Positives = 91/319 (28%), Gaps = 23/319 (7%)

Query: 249 EKEISALCWASSSGSILAVGYIDGDILLWNTSTTASTKGQQTGSRNNVVKLELSSAERRL 308
              ++ + +     S++     D  I +W+  T    +    G  ++V  +    + + L
Sbjct: 17  RSPVTRVIF-HPVFSVMVSASEDATIKVWDYET-GDFERTLKGHTDSVQDISFDHSGKLL 74

Query: 309 PVIVLHWSTNKESRSNIDGRLFVYGGDEIGSEEVL----TVLSLEWSSGMENLRCVSRVD 364
                  +         +    ++G D   S   +      +          +  V    
Sbjct: 75  ASCSADMTIKLWDFQGFECIRTMHGHDHNVSSVSIMPNGDHIVSASRDKTIKMWEVQTGY 134

Query: 365 ITLTGSFADMILLSSAGATVGNHKADLFVLTSPGQLHFYDNASLTTLLSQQEKKPSVCPV 424
              T +     +        G     +   ++   +  +  A+       +E +  V  +
Sbjct: 135 CVKTFTGHREWVRMVRPNQDGTL---IASCSNDQTVRVWVVATKECKAELREHRHVVECI 191

Query: 425 EFPGVIPISDPIMTVAEFMLLPFGGHSSKGLSEIATFTKLHSSHTQAGHIKWPLSGGVPS 484
            +      S   ++ A        G     L   +    +       G     L G   +
Sbjct: 192 SWA--PESSYSSISEATGSETKKSGKPGPFLLSGSRDKTIKMWDVSTGMCLMTLVGH-DN 248

Query: 485 PVPITKCHSVDRVYLAGYHDGSVRIWDATYPVFKLICALDAEVQGIEVAGSRAPVSTLSF 544
            V     HS  +  L+   D ++R+WD  Y   + +  L+              V++L F
Sbjct: 249 WVRGVLFHSGGKFILSCADDKTLRVWD--YKNKRCMKTLN---------AHEHFVTSLDF 297

Query: 545 CFINSSLAVGNEFGLVYIY 563
                 +  G+    V ++
Sbjct: 298 HKTAPYVVTGSVDQTVKVW 316
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Length = 340 Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 299 Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Length = 371 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query1108
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 100.0
d1vyhc1317 Platelet-activating factor acetylhydrolase IB subu 100.0
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 100.0
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 100.0
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 99.97
d1k8kc_371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 99.97
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 99.97
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 99.97
d1vyhc1317 Platelet-activating factor acetylhydrolase IB subu 99.97
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 99.97
d1tbga_340 beta1-subunit of the signal-transducing G protein 99.97
d1tbga_340 beta1-subunit of the signal-transducing G protein 99.96
d1k8kc_371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 99.96
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 99.96
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 99.96
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 99.96
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 99.96
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 99.95
d1k32a3360 Tricorn protease domain 2 {Archaeon Thermoplasma a 99.93
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 99.92
d1sq9a_393 Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac 99.92
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 99.92
d1p22a2293 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 99.92
d1yfqa_342 Cell cycle arrest protein BUB3 {Baker's yeast (Sac 99.92
d1p22a2293 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 99.92
d1yfqa_342 Cell cycle arrest protein BUB3 {Baker's yeast (Sac 99.92
d1pgua2287 Actin interacting protein 1 {Baker's yeast (Saccha 99.91
d1pgua2287 Actin interacting protein 1 {Baker's yeast (Saccha 99.91
d1sq9a_393 Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac 99.9
d1k32a3360 Tricorn protease domain 2 {Archaeon Thermoplasma a 99.86
d1qksa2432 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.86
d1hzua2426 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.84
d1qksa2432 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.83
d1hzua2426 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.81
d1jmxb_346 Quinohemoprotein amine dehydrogenase B chain {Pseu 99.77
d1pbyb_337 Quinohemoprotein amine dehydrogenase B chain {Para 99.75
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 99.71
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 99.66
d1jmxb_346 Quinohemoprotein amine dehydrogenase B chain {Pseu 99.63
d1pbyb_337 Quinohemoprotein amine dehydrogenase B chain {Para 99.62
d2madh_373 Methylamine dehydrogenase, H-chain {Gram negative 99.6
d2madh_373 Methylamine dehydrogenase, H-chain {Gram negative 99.59
d1ri6a_333 Putative isomerase YbhE {Escherichia coli [TaxId: 99.57
d1ri6a_333 Putative isomerase YbhE {Escherichia coli [TaxId: 99.52
d2bbkh_355 Methylamine dehydrogenase, H-chain {Paracoccus den 99.45
d2bbkh_355 Methylamine dehydrogenase, H-chain {Paracoccus den 99.37
d2bgra1470 Dipeptidyl peptidase IV/CD26, N-terminal domain {P 99.15
d2bgra1470 Dipeptidyl peptidase IV/CD26, N-terminal domain {P 98.99
d1mdah_368 Methylamine dehydrogenase, H-chain {Paracoccus den 98.98
d1qnia2441 Nitrous oxide reductase, N-terminal domain {Pseudo 98.92
d1mdah_368 Methylamine dehydrogenase, H-chain {Paracoccus den 98.71
d1jofa_365 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu 98.58
d1qnia2441 Nitrous oxide reductase, N-terminal domain {Pseudo 98.54
d2p4oa1302 Hypothetical protein All0351 homologue {Nostoc pun 98.3
d2p4oa1302 Hypothetical protein All0351 homologue {Nostoc pun 98.24
d2hqsa1269 TolB, C-terminal domain {Escherichia coli [TaxId: 98.24
d1jofa_365 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu 98.1
d1rwia_260 Serine/threonine-protein kinase PknD {Mycobacteriu 98.01
d2hqsa1269 TolB, C-terminal domain {Escherichia coli [TaxId: 97.85
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 97.85
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 97.83
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 97.83
d1rwia_260 Serine/threonine-protein kinase PknD {Mycobacteriu 97.75
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 97.64
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 97.57
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 97.48
d1xfda1465 Dipeptidyl aminopeptidase-like protein 6, DPP6, N- 97.46
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 97.37
d1xfda1465 Dipeptidyl aminopeptidase-like protein 6, DPP6, N- 97.05
d1k32a2281 Tricorn protease N-terminal domain {Archaeon Therm 96.96
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 96.84
d1npea_263 Nidogen {Mouse (Mus musculus) [TaxId: 10090]} 95.91
d2ad6a1571 Methanol dehydrogenase, heavy chain {Methylophilus 95.54
d1k3ia3387 Galactose oxidase, central domain {Fungi (Fusarium 95.02
d1fwxa2459 Nitrous oxide reductase, N-terminal domain {Paraco 93.79
d1utca2327 Clathrin heavy-chain terminal domain {Rat (Rattus 93.76
d1npea_263 Nidogen {Mouse (Mus musculus) [TaxId: 10090]} 93.32
d1fwxa2459 Nitrous oxide reductase, N-terminal domain {Paraco 93.17
d1k32a2281 Tricorn protease N-terminal domain {Archaeon Therm 93.14
d1kb0a2573 Quinoprotein alcohol dehydrogenase, N-terminal dom 92.3
d1w6sa_596 Methanol dehydrogenase, heavy chain {Methylobacter 92.29
d1ijqa1266 Low density lipoprotein (LDL) receptor {Human (Hom 91.95
d1ijqa1266 Low density lipoprotein (LDL) receptor {Human (Hom 90.68
d1xipa_381 Nucleoporin NUP159 {Baker's yeast (Saccharomyces c 90.56
d1k3ia3387 Galactose oxidase, central domain {Fungi (Fusarium 88.16
d1h6la_353 Thermostable phytase (3-phytase) {Bacillus amyloli 83.84
d1qfma1430 Prolyl oligopeptidase, N-terminal domain {Pig (Sus 83.1
d1flga_582 Ethanol dehydrogenase {Pseudomonas aeruginosa [Tax 82.01
d1h6la_353 Thermostable phytase (3-phytase) {Bacillus amyloli 81.28
d1v04a_340 Serum paraoxonase/arylesterase 1, PON1 {Rabit (Ory 80.17
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All beta proteins
fold: 7-bladed beta-propeller
superfamily: WD40 repeat-like
family: WD40-repeat
domain: Groucho/tle1, C-terminal domain
species: Human (Homo sapiens) [TaxId: 9606]

Probab=100.00  E-value=1.5e-31  Score=301.84  Aligned_cols=314  Identities=11%  Similarity=0.135  Sum_probs=238.7

Q ss_pred             EEEEcCCCCEEEEEECCCcEEEEecC-CcceEEeCCCCCCEEEEEEeeCCCEEEEEeCCCcEEEEEcCCCeee---e---
Q 001279           40 ILAFDHIQRLLAIATLDGRIKVIGGD-GIEGLLISPSQLPYKNLEFLQNQGFLISITNDNEIQVWSLESRSLA---C---  112 (1108)
Q Consensus        40 ~la~sp~~~~LA~Gs~dG~I~iw~~~-~~~~~~~~~h~~~V~~l~fs~d~~~L~S~s~d~~I~vWd~~s~~~~---~---  112 (1108)
                      .+.+++++++..+......+..-..+ ..+.+....|..+|++++|+|++.+|++++ |+.|+|||+.+....   .   
T Consensus        14 ~~~~~~~~~~~~~~~~~~~~~~~~~p~~~~~~~~~~H~~~V~~v~fs~~g~~latg~-dg~V~iWd~~~~~~~~~~~~~~   92 (337)
T d1gxra_          14 SFHVTADGQMQPVPFPPDALIGPGIPRHARQINTLNHGEVVCAVTISNPTRHVYTGG-KGCVKVWDISHPGNKSPVSQLD   92 (337)
T ss_dssp             EEEECSSSCEEECCCCTTSSSSTTCCSEEEEEEEECCSSCCCEEEECSSSSEEEEEC-BSEEEEEETTSTTCCSCSEEEE
T ss_pred             cccCCCCCCEEeeccCCcceecCCCCCCceEEEECCCCCcEEEEEECCCCCEEEEEE-CCEEEEEEccCCcccceeEEee
Confidence            35566666665554433322101111 123344458999999999999999999987 889999999775322   2   


Q ss_pred             eecCCCCeeEEEEecCCCEEEEEeCCCcEEEEEEecCCCeeeeeceeecccccccccCCCCCCCCCeEEEecccCCCCCE
Q 001279          113 CLKWESNITAFSVISGSHFMYIGDENGLMSVIKYDADEGKLFQLPYNISADALSEKAGFPLLSHQPVVGVLPHPNSSGNR  192 (1108)
Q Consensus       113 ~~~~~~~Itsl~~~~~~~~l~vg~~dg~V~vw~~d~~~~~l~~~~~~i~~~~~~~~~~~~~~~~~~V~~v~f~P~~~~~~  192 (1108)
                      ...|.+.|++++|+|++++|++|+.||.|++|++......+.   ..+..|.            ..|.++.|+|  ++..
T Consensus        93 ~~~h~~~I~~v~~s~dg~~l~s~~~dg~i~iwd~~~~~~~~~---~~~~~~~------------~~v~~~~~~~--~~~~  155 (337)
T d1gxra_          93 CLNRDNYIRSCKLLPDGCTLIVGGEASTLSIWDLAAPTPRIK---AELTSSA------------PACYALAISP--DSKV  155 (337)
T ss_dssp             CSCTTSBEEEEEECTTSSEEEEEESSSEEEEEECCCC--EEE---EEEECSS------------SCEEEEEECT--TSSE
T ss_pred             ecCCCCcEEEEEEcCCCCEEEEeecccccccccccccccccc---ccccccc------------cccccccccc--cccc
Confidence            225778899999999999999999999999999876554444   2355554            6799999988  6888


Q ss_pred             EEEEECCCeEEEEEccCCeEEEE-eCCCcccccccccCCCCCCCCCcccCcCCCCCCCCceeEEEeecCCCCEEEEEEcc
Q 001279          193 VLIAYENALVILWDVSEAQIIFV-GGGKDLQLKDGVVDSPSEGDSTFLEGISEHQPEEKEISALCWASSSGSILAVGYID  271 (1108)
Q Consensus       193 ll~~~~dg~V~lWdl~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~Vtsl~w~spdg~~l~sg~~D  271 (1108)
                      +++++.++.|++||+.+++.... .+|                              ...|++++|. +++..+++++.|
T Consensus       156 l~s~~~d~~i~~~~~~~~~~~~~~~~~------------------------------~~~v~~l~~s-~~~~~~~~~~~d  204 (337)
T d1gxra_         156 CFSCCSDGNIAVWDLHNQTLVRQFQGH------------------------------TDGASCIDIS-NDGTKLWTGGLD  204 (337)
T ss_dssp             EEEEETTSCEEEEETTTTEEEEEECCC------------------------------SSCEEEEEEC-TTSSEEEEEETT
T ss_pred             ccccccccccccccccccccccccccc------------------------------cccccccccc-cccccccccccc
Confidence            99999999999999999877544 334                              6789999985 999999999999


Q ss_pred             CcEEEEecCCCCCCCCccCCCCCceeeeecccccCCccEEEEEeecccccccCCCceEEEEeCCCCCCcceEEEEecccc
Q 001279          272 GDILLWNTSTTASTKGQQTGSRNNVVKLELSSAERRLPVIVLHWSTNKESRSNIDGRLFVYGGDEIGSEEVLTVLSLEWS  351 (1108)
Q Consensus       272 G~I~lWd~~~~~~~~~~~~~~~~~~~kl~~~~~~~~~~i~~~~~~~~~s~~~~~~~~llv~gg~~~~~~~~ltvl~l~~~  351 (1108)
                      |.+++||+.++..           +              ...                                 .    
T Consensus       205 ~~v~i~d~~~~~~-----------~--------------~~~---------------------------------~----  222 (337)
T d1gxra_         205 NTVRSWDLREGRQ-----------L--------------QQH---------------------------------D----  222 (337)
T ss_dssp             SEEEEEETTTTEE-----------E--------------EEE---------------------------------E----
T ss_pred             cccccccccccee-----------e--------------ccc---------------------------------c----
Confidence            9999999864310           0              000                                 0    


Q ss_pred             ccccccceeeeeecCCCCccceEEEecCCCCCCCCCcceEEEEcCCCeEEEEeccceeeeccccCCCCCCCCccCCcccc
Q 001279          352 SGMENLRCVSRVDITLTGSFADMILLSSAGATVGNHKADLFVLTSPGQLHFYDNASLTTLLSQQEKKPSVCPVEFPGVIP  431 (1108)
Q Consensus       352 ~~~~~~~~~~~~~l~~~~~v~~~~~~p~~~~~~~~~~~~l~vl~~~G~l~~~d~~~~~~~~~~~~~~~~~~~~~~~~~~~  431 (1108)
                                                                                                      
T Consensus       223 --------------------------------------------------------------------------------  222 (337)
T d1gxra_         223 --------------------------------------------------------------------------------  222 (337)
T ss_dssp             --------------------------------------------------------------------------------
T ss_pred             --------------------------------------------------------------------------------
Confidence                                                                                            


Q ss_pred             CCCCcceEEEEEeccCCCCchhhhhHHHhhccccCCCCccCcccccccCCcccCCCccccCCCCcEEEEEecCCcEEEEe
Q 001279          432 ISDPIMTVAEFMLLPFGGHSSKGLSEIATFTKLHSSHTQAGHIKWPLSGGVPSPVPITKCHSVDRVYLAGYHDGSVRIWD  511 (1108)
Q Consensus       432 ~~~~~it~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~wp~~gg~~~~~~~~~~s~~~~llatgs~DGtVriWd  511 (1108)
                       +...|                                                 ..++++++++++++|+.||.|++||
T Consensus       223 -~~~~i-------------------------------------------------~~l~~~~~~~~l~~~~~d~~i~i~d  252 (337)
T d1gxra_         223 -FTSQI-------------------------------------------------FSLGYCPTGEWLAVGMESSNVEVLH  252 (337)
T ss_dssp             -CSSCE-------------------------------------------------EEEEECTTSSEEEEEETTSCEEEEE
T ss_pred             -cccce-------------------------------------------------EEEEEcccccccceecccccccccc
Confidence             00000                                                 0113556677999999999999999


Q ss_pred             CCCCceeeEeeeccccceeeccCCCCCeEEEEEEeCCCeEEEEecCceEEEEEecCCCCCccccccccCccceeecccCC
Q 001279          512 ATYPVFKLICALDAEVQGIEVAGSRAPVSTLSFCFINSSLAVGNEFGLVYIYNLNGSLDAKNFLFVLETKSEVHALPEGK  591 (1108)
Q Consensus       512 ~~~~~l~~~~~l~~~~~~~~l~~h~~~Vt~lafs~d~~~Lasg~~dG~V~lw~l~~~~~~~~~~~~~~~~~~~~~~~~~~  591 (1108)
                      +..+...            ....|...|++++|+|++++|++|+.||.|++|++....                      
T Consensus       253 ~~~~~~~------------~~~~~~~~i~~v~~s~~g~~l~s~s~Dg~i~iwd~~~~~----------------------  298 (337)
T d1gxra_         253 VNKPDKY------------QLHLHESCVLSLKFAYCGKWFVSTGKDNLLNAWRTPYGA----------------------  298 (337)
T ss_dssp             TTSSCEE------------EECCCSSCEEEEEECTTSSEEEEEETTSEEEEEETTTCC----------------------
T ss_pred             ccccccc------------cccccccccceEEECCCCCEEEEEeCCCeEEEEECCCCC----------------------
Confidence            9877643            245788999999999999999999999999999987651                      


Q ss_pred             cceEEEEEeecCcCEEEEEEcCCCCEEEEEeCCCeEEEEEc
Q 001279          592 ISLCRAVFSLVNSPVRALQFTSSGAKLAVGFECGRVAVLDM  632 (1108)
Q Consensus       592 g~~~~~~~~~h~~~Vtslafspdg~~LavGs~dG~V~vwd~  632 (1108)
                         ++.. ..|...|++++|+|++++||+|+.||+|+|||+
T Consensus       299 ---~~~~-~~~~~~v~~~~~s~d~~~l~t~s~D~~I~vWdl  335 (337)
T d1gxra_         299 ---SIFQ-SKESSSVLSCDISVDDKYIVTGSGDKKATVYEV  335 (337)
T ss_dssp             ---EEEE-EECSSCEEEEEECTTSCEEEEEETTSCEEEEEE
T ss_pred             ---EEEE-ccCCCCEEEEEEeCCCCEEEEEeCCCeEEEEEE
Confidence               2232 468899999999999999999999999999997
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2bgra1 b.70.3.1 (A:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2bgra1 b.70.3.1 (A:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]} Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]} Back     information, alignment and structure
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d2hqsa1 b.68.4.1 (A:163-431) TolB, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2hqsa1 b.68.4.1 (A:163-431) TolB, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1xfda1 b.70.3.1 (A:127-591) Dipeptidyl aminopeptidase-like protein 6, DPP6, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1xfda1 b.70.3.1 (A:127-591) Dipeptidyl aminopeptidase-like protein 6, DPP6, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k32a2 b.68.7.1 (A:39-319) Tricorn protease N-terminal domain {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1npea_ b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ad6a1 b.70.1.1 (A:1-571) Methanol dehydrogenase, heavy chain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Back     information, alignment and structure
>d1fwxa2 b.69.3.1 (A:8-451) Nitrous oxide reductase, N-terminal domain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1utca2 b.69.6.1 (A:4-330) Clathrin heavy-chain terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1npea_ b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fwxa2 b.69.3.1 (A:8-451) Nitrous oxide reductase, N-terminal domain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1k32a2 b.68.7.1 (A:39-319) Tricorn protease N-terminal domain {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1kb0a2 b.70.1.1 (A:1-573) Quinoprotein alcohol dehydrogenase, N-terminal domain {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1w6sa_ b.70.1.1 (A:) Methanol dehydrogenase, heavy chain {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1ijqa1 b.68.5.1 (A:377-642) Low density lipoprotein (LDL) receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ijqa1 b.68.5.1 (A:377-642) Low density lipoprotein (LDL) receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xipa_ b.69.14.1 (A:) Nucleoporin NUP159 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Back     information, alignment and structure
>d1h6la_ b.68.3.1 (A:) Thermostable phytase (3-phytase) {Bacillus amyloliquefaciens [TaxId: 1390]} Back     information, alignment and structure
>d1qfma1 b.69.7.1 (A:1-430) Prolyl oligopeptidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1flga_ b.70.1.1 (A:) Ethanol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1h6la_ b.68.3.1 (A:) Thermostable phytase (3-phytase) {Bacillus amyloliquefaciens [TaxId: 1390]} Back     information, alignment and structure
>d1v04a_ b.68.6.2 (A:) Serum paraoxonase/arylesterase 1, PON1 {Rabit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure