Citrus Sinensis ID: 001301
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
|
|
Close Homologs for Annotation Transfer
Close Homologs in SWISS-PROT Database Detected by BLAST 
Original result of BLAST against SWISS-PROT Database
| ID | Alignment graph | Length |
Definition |
RBH(Q2H) |
RBH(H2Q) |
Q cover |
H cover |
Identity |
E-value |
| Query | 1104 | 2.2.26 [Sep-21-2011] | |||||||
| P93028 | 1080 | Ubiquitin-activating enzy | yes | no | 0.921 | 0.941 | 0.805 | 0.0 | |
| P92974 | 1077 | Ubiquitin-activating enzy | no | no | 0.931 | 0.954 | 0.778 | 0.0 | |
| P20973 | 1051 | Ubiquitin-activating enzy | N/A | no | 0.922 | 0.968 | 0.785 | 0.0 | |
| P31251 | 1051 | Ubiquitin-activating enzy | N/A | no | 0.922 | 0.968 | 0.784 | 0.0 | |
| P31252 | 1053 | Ubiquitin-activating enzy | N/A | no | 0.934 | 0.980 | 0.744 | 0.0 | |
| P22314 | 1058 | Ubiquitin-like modifier-a | yes | no | 0.898 | 0.937 | 0.449 | 0.0 | |
| A3KMV5 | 1058 | Ubiquitin-like modifier-a | yes | no | 0.899 | 0.938 | 0.447 | 0.0 | |
| Q29504 | 1058 | Ubiquitin-like modifier-a | yes | no | 0.899 | 0.938 | 0.447 | 0.0 | |
| Q5U300 | 1058 | Ubiquitin-like modifier-a | yes | no | 0.899 | 0.938 | 0.441 | 0.0 | |
| P31254 | 1058 | Ubiquitin-like modifier-a | yes | no | 0.894 | 0.933 | 0.449 | 0.0 |
| >sp|P93028|UBE11_ARATH Ubiquitin-activating enzyme E1 1 OS=Arabidopsis thaliana GN=UBA1 PE=1 SV=1 | Back alignment and function desciption |
|---|
Score = 1743 bits (4515), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 819/1017 (80%), Positives = 915/1017 (89%)
Query: 87 MGLGNGNPSDIDEDLHSRQLAVYGRETMRRLFASNILISGMQGLGAEIAKNLILAGVKSV 146
M GN N +IDEDLHSRQLAVYGRETMRRLFASN+LISGM GLGAEIAKNLILAGVKSV
Sbjct: 63 MAFGNSNRQEIDEDLHSRQLAVYGRETMRRLFASNVLISGMHGLGAEIAKNLILAGVKSV 122
Query: 147 TLHDEGVVELWDLSSNFIFSEDDVGKNRALASIQKLQELNNAVAISALTTELTKEKLSDF 206
TLHDE VVELWDLSSNF+FSEDDVGKNRA AS+QKLQ+LNNAV +S+LT L KE LS F
Sbjct: 123 TLHDERVVELWDLSSNFVFSEDDVGKNRADASVQKLQDLNNAVVVSSLTKSLNKEDLSGF 182
Query: 207 QAVVFTDISLEKAVEFDDYCHNHQPPIAFIKSEVRGLFGNIFCDFGPEFTVFDVDGEEPH 266
Q VVF+DIS+E+A+EFDDYCH+HQPPIAF+K++VRGLFG++FCDFGPEF V DVDGEEPH
Sbjct: 183 QVVVFSDISMERAIEFDDYCHSHQPPIAFVKADVRGLFGSVFCDFGPEFAVLDVDGEEPH 242
Query: 267 TGIIASISNDNPPLISCVDDERIEFQDGDLVVFSEVHGMTELNDGKPRKVKNARPYSFSI 326
TGIIASISN+N ISCVDDER+EF+DGDLVVFSEV GMTELNDGKPRK+K+ RPYSF++
Sbjct: 243 TGIIASISNENQAFISCVDDERLEFEDGDLVVFSEVEGMTELNDGKPRKIKSTRPYSFTL 302
Query: 327 DEDTTNYSAYEKGGIVTQVKQPKIINFKPLREALKDPGDFLLSDFSKFDRPPVLHLAFQA 386
DEDTTNY Y KGGIVTQVKQPK++NFKPLREALKDPGDFL SDFSKFDRPP+LHLAFQA
Sbjct: 303 DEDTTNYGTYVKGGIVTQVKQPKLLNFKPLREALKDPGDFLFSDFSKFDRPPLLHLAFQA 362
Query: 387 LDKFIQELGRFPVAGSEEDAQKIISLFTNINDNLADERVEEIDHKLLCHFAFGARAVLNP 446
LD F E GRFPVAGSEEDAQK+IS+ T IN D +VE +D KLL HF+FGA+AVLNP
Sbjct: 363 LDHFKAEAGRFPVAGSEEDAQKLISIATAINTGQGDLKVENVDQKLLRHFSFGAKAVLNP 422
Query: 447 MAAMFGGIVGQEVVKACSGKFHPLLQFFYFDSVESLPSEPLDPRDLQPLNSRYDAQISVF 506
MAAMFGGIVGQEVVKACSGKFHPL QFFYFDSVESLPSEP+D D P NSRYDAQISVF
Sbjct: 423 MAAMFGGIVGQEVVKACSGKFHPLFQFFYFDSVESLPSEPVDSSDFAPRNSRYDAQISVF 482
Query: 507 GSKLQKKLEEAKVFVVGSGALGCEFLKNLALMGVSCGNQGKLTITDDDVIEKSNLSRQFL 566
G+K QKKLE+AKVF VGSGALGCEFLKNLALMGVSCG+QGKLT+TDDD+IEKSNLSRQFL
Sbjct: 483 GAKFQKKLEDAKVFTVGSGALGCEFLKNLALMGVSCGSQGKLTVTDDDIIEKSNLSRQFL 542
Query: 567 FRDWNIGQAKSTVAASAAALINPHLNTEALQIRANPETENVFNDTFWENLNVVVNALDNV 626
FRDWNIGQAKSTVAASAAA+INP N EALQ R ETENVF+D FWENL VVVNALDNV
Sbjct: 543 FRDWNIGQAKSTVAASAAAVINPRFNIEALQNRVGAETENVFDDAFWENLTVVVNALDNV 602
Query: 627 NARLYIDQRCLYFQKPLLESGTLGAKCNTQMVIPHLTENYGASRDPPEKQAPMCTVHSFP 686
NARLY+D RCLYFQKPLLESGTLG KCNTQ VIPHLTENYGASRDPPEKQAPMCTVHSFP
Sbjct: 603 NARLYVDSRCLYFQKPLLESGTLGTKCNTQSVIPHLTENYGASRDPPEKQAPMCTVHSFP 662
Query: 687 HNIDHCLTWARSEFEGLLEKTPAEVNAYLTSPTEYASAMKNAGDAQARDNLDRVLECLDK 746
HNIDHCLTWARSEFEGLLEKTPAEVNAYL+SP EY ++M +AGDAQARD L+R++ECL+K
Sbjct: 663 HNIDHCLTWARSEFEGLLEKTPAEVNAYLSSPVEYTNSMMSAGDAQARDTLERIVECLEK 722
Query: 747 ERCETFQDCITWARLRFEDYFADRVKQLTFTFPENATTSNGTPFWSAPKRFPRPLQFSVD 806
E+CETFQDC+TWARLRFEDYF +RVKQL +TFPE+A TS G PFWSAPKRFPRPLQ+S
Sbjct: 723 EKCETFQDCLTWARLRFEDYFVNRVKQLIYTFPEDAATSTGAPFWSAPKRFPRPLQYSSS 782
Query: 807 DLSHLQFLMAASILRAETYGIPIPDWVKSPVKLADAVNKVIVPDFQPKENVKIETDEKAT 866
D S L F+ A +ILRAET+GIPIP+W K+P + A+AV++VIVPDF+P+++ KI TDEKAT
Sbjct: 783 DPSLLNFITATAILRAETFGIPIPEWTKNPKEAAEAVDRVIVPDFEPRQDAKIVTDEKAT 842
Query: 867 SMSTGSIDDAVVINELLQKLEKCQKQLPTGYKMNPIQFEKDDDTNFHMDLIAGLANMRAR 926
+++T S+DDA VI++L+ K+++C+ L ++M PIQFEKDDDTN+HMD+IAGLANMRAR
Sbjct: 843 TLTTASVDDAAVIDDLIAKIDQCRHNLSPDFRMKPIQFEKDDDTNYHMDVIAGLANMRAR 902
Query: 927 NYGIPEVDKLKAKFIAGRIIPAIATSTAMATGLVCLELYKVLDGGHKLEDYRNTFANLAL 986
NY IPEVDKLKAKFIAGRIIPAIATSTAMATGLVCLELYKVLDGGHK+E YRNTFANLAL
Sbjct: 903 NYSIPEVDKLKAKFIAGRIIPAIATSTAMATGLVCLELYKVLDGGHKVEAYRNTFANLAL 962
Query: 987 PLFSMAEPVPPKVFKHQDMSWTVWDRWILRDNPTLRQLLQWLQDKGLNAYSISYGSCLLF 1046
PLFSMAEP+PPKV KH+DM+WTVWDRW+L+ NPTLR++LQWL+DKGL+AYSIS GSCLLF
Sbjct: 963 PLFSMAEPLPPKVVKHRDMAWTVWDRWVLKGNPTLREVLQWLEDKGLSAYSISCGSCLLF 1022
Query: 1047 NSMFPRHKERMDKKVVDLVRDVAKAELPPYRQHFDVVVACVDEDDNDIDIPQISIYF 1103
NSMF RHKERMDKKVVDL RDVAK ELPPYR H DVVVAC DEDDND+DIP +SIYF
Sbjct: 1023 NSMFTRHKERMDKKVVDLARDVAKVELPPYRNHLDVVVACEDEDDNDVDIPLVSIYF 1079
|
Activates ubiquitin by first adenylating its C-terminal glycine residue with ATP, and thereafter linking this residue to the side chain of a cysteine residue in E1, yielding an ubiquitin-E1 thioester and free AMP. Arabidopsis thaliana (taxid: 3702) |
| >sp|P92974|UBE12_ARATH Ubiquitin-activating enzyme E1 2 OS=Arabidopsis thaliana GN=UBA2 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|P20973|UBE11_WHEAT Ubiquitin-activating enzyme E1 1 OS=Triticum aestivum GN=UBA1 PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|P31251|UBE12_WHEAT Ubiquitin-activating enzyme E1 2 OS=Triticum aestivum GN=UBA2 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|P31252|UBE13_WHEAT Ubiquitin-activating enzyme E1 3 OS=Triticum aestivum GN=UBA3 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|P22314|UBA1_HUMAN Ubiquitin-like modifier-activating enzyme 1 OS=Homo sapiens GN=UBA1 PE=1 SV=3 | Back alignment and function description |
|---|
| >sp|A3KMV5|UBA1_BOVIN Ubiquitin-like modifier-activating enzyme 1 OS=Bos taurus GN=UBA1 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q29504|UBA1_RABIT Ubiquitin-like modifier-activating enzyme 1 OS=Oryctolagus cuniculus GN=UBA1 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q5U300|UBA1_RAT Ubiquitin-like modifier-activating enzyme 1 OS=Rattus norvegicus GN=Uba1 PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|P31254|UBA1Y_MOUSE Ubiquitin-like modifier-activating enzyme 1 Y OS=Mus musculus GN=Ube1ay PE=2 SV=2 | Back alignment and function description |
|---|
Close Homologs in the Non-Redundant Database Detected by BLAST
Original result of BLAST against Nonredundant Database
| GI | Alignment Graph | Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 1104 | ||||||
| 341657646 | 1094 | ubiquitin activating enzyme E1 [Camellia | 0.989 | 0.998 | 0.830 | 0.0 | |
| 359481277 | 1111 | PREDICTED: ubiquitin-activating enzyme E | 0.996 | 0.990 | 0.827 | 0.0 | |
| 359478703 | 1100 | PREDICTED: ubiquitin-activating enzyme E | 0.982 | 0.986 | 0.824 | 0.0 | |
| 38142361 | 1080 | ubiquitin activating enzyme 2 [Nicotiana | 0.975 | 0.997 | 0.819 | 0.0 | |
| 255571425 | 1100 | ubiquitin-activating enzyme E1, putative | 0.988 | 0.991 | 0.829 | 0.0 | |
| 38142359 | 1080 | ubiquitin activating enzyme 1 [Nicotiana | 0.945 | 0.966 | 0.838 | 0.0 | |
| 297735630 | 1066 | unnamed protein product [Vitis vinifera] | 0.922 | 0.954 | 0.872 | 0.0 | |
| 224059848 | 1018 | predicted protein [Populus trichocarpa] | 0.922 | 1.0 | 0.830 | 0.0 | |
| 356498972 | 1106 | PREDICTED: ubiquitin-activating enzyme E | 0.985 | 0.983 | 0.806 | 0.0 | |
| 357491029 | 1180 | Ubiquitin-activating enzyme E1 [Medicago | 0.972 | 0.910 | 0.796 | 0.0 |
| >gi|341657646|gb|AEK86562.1| ubiquitin activating enzyme E1 [Camellia sinensis] | Back alignment and taxonomy information |
|---|
Score = 1912 bits (4953), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 908/1093 (83%), Positives = 1004/1093 (91%), Gaps = 1/1093 (0%)
Query: 12 MLPCKRAGGGEAVVLEVAGPIRSPEASIKKHKITDLPPIASATTATTAANTGNVRSAEKS 71
M P KRA GGE V + G + E+ KK +I L +AT++++ + +A +
Sbjct: 1 MRPGKRAAGGEVVEADTEGDNQKIESLSKKQRIDCLISSVTATSSSSGGGSEATATATAA 60
Query: 72 AASNSNNSNG-ADSSIMGLGNGNPSDIDEDLHSRQLAVYGRETMRRLFASNILISGMQGL 130
N S+G + +M LG G DIDEDLHSRQLAVYGRETMRRLFASN+LISG+ GL
Sbjct: 61 MVGKVNGSSGNGKAPMMDLGEGKSPDIDEDLHSRQLAVYGRETMRRLFASNVLISGINGL 120
Query: 131 GAEIAKNLILAGVKSVTLHDEGVVELWDLSSNFIFSEDDVGKNRALASIQKLQELNNAVA 190
GAEIAKNL+LAGVKSVTLHDEG+VELWDLSSNFIFSEDDVGKNRALAS+QKLQELNN+V
Sbjct: 121 GAEIAKNLVLAGVKSVTLHDEGIVELWDLSSNFIFSEDDVGKNRALASVQKLQELNNSVV 180
Query: 191 ISALTTELTKEKLSDFQAVVFTDISLEKAVEFDDYCHNHQPPIAFIKSEVRGLFGNIFCD 250
IS LTTELTKE+LSDFQAVVFTDISLEKA+EF+DYCH+HQPPI+FIK+EVRGLFG++FCD
Sbjct: 181 ISTLTTELTKEQLSDFQAVVFTDISLEKAIEFNDYCHSHQPPISFIKTEVRGLFGSVFCD 240
Query: 251 FGPEFTVFDVDGEEPHTGIIASISNDNPPLISCVDDERIEFQDGDLVVFSEVHGMTELND 310
FGPEFTVFDVDG +PHTGIIASISNDNP +++CVDDER+EF+DGDLVVFSEVHGM ELND
Sbjct: 241 FGPEFTVFDVDGNDPHTGIIASISNDNPAIVACVDDERLEFEDGDLVVFSEVHGMPELND 300
Query: 311 GKPRKVKNARPYSFSIDEDTTNYSAYEKGGIVTQVKQPKIINFKPLREALKDPGDFLLSD 370
GKPRKVKNARPYSF+I+EDTTNY+AYEKGGIVTQVKQPK +NFKPLREALKDPGDFLLSD
Sbjct: 301 GKPRKVKNARPYSFTIEEDTTNYAAYEKGGIVTQVKQPKALNFKPLREALKDPGDFLLSD 360
Query: 371 FSKFDRPPVLHLAFQALDKFIQELGRFPVAGSEEDAQKIISLFTNINDNLADERVEEIDH 430
FSKFDRPP+LHLAFQALD +I ELGRFP+AGSEEDAQK+ISL TNIN++ A ++EEID
Sbjct: 361 FSKFDRPPLLHLAFQALDMYISELGRFPIAGSEEDAQKLISLATNINNSSASGKLEEIDP 420
Query: 431 KLLCHFAFGARAVLNPMAAMFGGIVGQEVVKACSGKFHPLLQFFYFDSVESLPSEPLDPR 490
KLL +F FGA+AVLNPMAAMFGGIVGQEVVKACSGKFHPL QFFYFDS+ESLP EPLDP
Sbjct: 421 KLLRNFVFGAKAVLNPMAAMFGGIVGQEVVKACSGKFHPLFQFFYFDSIESLPPEPLDPS 480
Query: 491 DLQPLNSRYDAQISVFGSKLQKKLEEAKVFVVGSGALGCEFLKNLALMGVSCGNQGKLTI 550
DL+PLNSRYDAQISVFG+KLQKKLE+AKVF+VGSGALGCEFLKN+ALMGV CGNQGKLTI
Sbjct: 481 DLKPLNSRYDAQISVFGAKLQKKLEDAKVFIVGSGALGCEFLKNVALMGVCCGNQGKLTI 540
Query: 551 TDDDVIEKSNLSRQFLFRDWNIGQAKSTVAASAAALINPHLNTEALQIRANPETENVFND 610
TDDDVIEKSNL+RQFLFRDWNIGQAKSTVAASAA+LINPHL+ +ALQ RA+PETENVF+D
Sbjct: 541 TDDDVIEKSNLTRQFLFRDWNIGQAKSTVAASAASLINPHLHIDALQNRASPETENVFHD 600
Query: 611 TFWENLNVVVNALDNVNARLYIDQRCLYFQKPLLESGTLGAKCNTQMVIPHLTENYGASR 670
TFWENLNVV+NALDNV+ARLYIDQRCLYFQKPLLESGTLGAKCNTQMVIPHLTENYGASR
Sbjct: 601 TFWENLNVVINALDNVSARLYIDQRCLYFQKPLLESGTLGAKCNTQMVIPHLTENYGASR 660
Query: 671 DPPEKQAPMCTVHSFPHNIDHCLTWARSEFEGLLEKTPAEVNAYLTSPTEYASAMKNAGD 730
DPPEKQAPMCTVHSFPHNIDHCLTWARSEFEGLLEKTPAEVNAYLTSP EY SAMKNAGD
Sbjct: 661 DPPEKQAPMCTVHSFPHNIDHCLTWARSEFEGLLEKTPAEVNAYLTSPNEYTSAMKNAGD 720
Query: 731 AQARDNLDRVLECLDKERCETFQDCITWARLRFEDYFADRVKQLTFTFPENATTSNGTPF 790
AQARDNL+RV+ECLDKE+CETFQDCITWARL+FEDYFA+RVKQLTFTFPE+A TS+GTPF
Sbjct: 721 AQARDNLERVIECLDKEKCETFQDCITWARLKFEDYFANRVKQLTFTFPEDAVTSSGTPF 780
Query: 791 WSAPKRFPRPLQFSVDDLSHLQFLMAASILRAETYGIPIPDWVKSPVKLADAVNKVIVPD 850
WSAPKRFPRPLQFSVDD SHL F+ AASILRAET+GIPIPDWVKS KLADAVN+VIVPD
Sbjct: 781 WSAPKRFPRPLQFSVDDTSHLHFVTAASILRAETFGIPIPDWVKSSKKLADAVNRVIVPD 840
Query: 851 FQPKENVKIETDEKATSMSTGSIDDAVVINELLQKLEKCQKQLPTGYKMNPIQFEKDDDT 910
FQPK++VKI TDEKATS+ST S+DDAVVINEL+ KLE C K+L G+KMNPIQFEKDDDT
Sbjct: 841 FQPKKDVKIVTDEKATSLSTASMDDAVVINELVMKLEICHKKLMPGFKMNPIQFEKDDDT 900
Query: 911 NFHMDLIAGLANMRARNYGIPEVDKLKAKFIAGRIIPAIATSTAMATGLVCLELYKVLDG 970
N+HMDLIAGLANMRARNY IPEVDKLKAKFIAGRIIPAIATSTAMATGLVCLELYK LDG
Sbjct: 901 NYHMDLIAGLANMRARNYSIPEVDKLKAKFIAGRIIPAIATSTAMATGLVCLELYKALDG 960
Query: 971 GHKLEDYRNTFANLALPLFSMAEPVPPKVFKHQDMSWTVWDRWILRDNPTLRQLLQWLQD 1030
GHKLEDYRNTFANLALPLFSMAEP+PPKV KHQDMSWTVWDRWI+ DNPTLR+LLQWL+D
Sbjct: 961 GHKLEDYRNTFANLALPLFSMAEPLPPKVIKHQDMSWTVWDRWIVGDNPTLRELLQWLKD 1020
Query: 1031 KGLNAYSISYGSCLLFNSMFPRHKERMDKKVVDLVRDVAKAELPPYRQHFDVVVACVDED 1090
K LNAYSIS+GSCLL+NSMFPRH+ERMD+K+VDL R+VAKAELPPYR+HFDVVVAC D++
Sbjct: 1021 KALNAYSISFGSCLLYNSMFPRHRERMDRKMVDLAREVAKAELPPYRRHFDVVVACEDDE 1080
Query: 1091 DNDIDIPQISIYF 1103
DND+DIPQ+SIYF
Sbjct: 1081 DNDVDIPQVSIYF 1093
|
Source: Camellia sinensis Species: Camellia sinensis Genus: Camellia Family: Theaceae Order: Ericales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|359481277|ref|XP_002267395.2| PREDICTED: ubiquitin-activating enzyme E1 1-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|359478703|ref|XP_002275617.2| PREDICTED: ubiquitin-activating enzyme E1 1 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|38142361|dbj|BAD00984.1| ubiquitin activating enzyme 2 [Nicotiana tabacum] | Back alignment and taxonomy information |
|---|
| >gi|255571425|ref|XP_002526660.1| ubiquitin-activating enzyme E1, putative [Ricinus communis] gi|223533960|gb|EEF35682.1| ubiquitin-activating enzyme E1, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|38142359|dbj|BAD00983.1| ubiquitin activating enzyme 1 [Nicotiana tabacum] | Back alignment and taxonomy information |
|---|
| >gi|297735630|emb|CBI18124.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|224059848|ref|XP_002300000.1| predicted protein [Populus trichocarpa] gi|222847258|gb|EEE84805.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|356498972|ref|XP_003518319.1| PREDICTED: ubiquitin-activating enzyme E1 2-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|357491029|ref|XP_003615802.1| Ubiquitin-activating enzyme E1 [Medicago truncatula] gi|355517137|gb|AES98760.1| Ubiquitin-activating enzyme E1 [Medicago truncatula] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST
Original result of BLAST against Gene Ontology (AMIGO)
| ID |
Alignment graph |
Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 1104 | ||||||
| TAIR|locus:2060854 | 1080 | UBA1 "ubiquitin-activating enz | 0.921 | 0.941 | 0.782 | 0.0 | |
| TAIR|locus:2164270 | 1077 | UBA 2 "ubiquitin activating en | 0.921 | 0.944 | 0.764 | 0.0 | |
| UNIPROTKB|P22314 | 1058 | UBA1 "Ubiquitin-like modifier- | 0.902 | 0.941 | 0.439 | 6.6e-232 | |
| UNIPROTKB|A3KMV5 | 1058 | UBA1 "Ubiquitin-like modifier- | 0.903 | 0.942 | 0.437 | 2.2e-231 | |
| UNIPROTKB|F1RWX8 | 1058 | UBA1 "Uncharacterized protein" | 0.903 | 0.943 | 0.434 | 1.8e-229 | |
| ZFIN|ZDB-GENE-040426-2009 | 1058 | uba1 "ubiquitin-like modifier | 0.900 | 0.939 | 0.437 | 4.3e-228 | |
| RGD|1359327 | 1058 | Uba1 "ubiquitin-like modifier | 0.903 | 0.942 | 0.431 | 1.1e-227 | |
| MGI|MGI:98891 | 1058 | Uba1y "ubiquitin-activating en | 0.898 | 0.937 | 0.435 | 1.7e-226 | |
| MGI|MGI:98890 | 1058 | Uba1 "ubiquitin-like modifier | 0.903 | 0.942 | 0.429 | 2.1e-226 | |
| CGD|CAL0005518 | 1021 | UBA1 [Candida albicans (taxid: | 0.903 | 0.976 | 0.433 | 5.1e-225 |
| TAIR|locus:2060854 UBA1 "ubiquitin-activating enzyme 1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 4294 (1516.6 bits), Expect = 0., P = 0.
Identities = 796/1017 (78%), Positives = 886/1017 (87%)
Query: 87 MGLGNGNPSDIDEDLHSRQLAVYGRETMRRLFASNILISGMQGLGAEIAKNLILAGVKSV 146
M GN N +IDEDLHSRQLAVYGRETMRRLFASN+LISGM GLGAEIAKNLILAGVKSV
Sbjct: 63 MAFGNSNRQEIDEDLHSRQLAVYGRETMRRLFASNVLISGMHGLGAEIAKNLILAGVKSV 122
Query: 147 TLHDEGVVELWDLSSNFIFSEDDVGKNRALASIQKLQELNNAVAISALTTELTKEKLSDF 206
TLHDE VVELWDLSSNF+FSEDDVGKNRA AS+QKLQ+LNNAV +S+LT L KE LS F
Sbjct: 123 TLHDERVVELWDLSSNFVFSEDDVGKNRADASVQKLQDLNNAVVVSSLTKSLNKEDLSGF 182
Query: 207 QAVVFTDISLEKAVEFDDYCHNHQPPIAFIKSEVRGLFGNIFCDFGPEFTVFDVDGEEPH 266
Q VVF+DIS+E+A+EFDDYCH+HQPPIAF+K++VRGLFG++FCDFGPEF V DVDGEEPH
Sbjct: 183 QVVVFSDISMERAIEFDDYCHSHQPPIAFVKADVRGLFGSVFCDFGPEFAVLDVDGEEPH 242
Query: 267 TGIIASISNDNPPLISCVDDERIEFQDGDLVVFSEVHGMTELNDGKPRKVKNARPYSFSI 326
TGIIASISN+N ISCVDDER+EF+DGDLVVFSEV GMTELNDGKPRK+K+ RPYSF++
Sbjct: 243 TGIIASISNENQAFISCVDDERLEFEDGDLVVFSEVEGMTELNDGKPRKIKSTRPYSFTL 302
Query: 327 DEDTTNYSAYEKGGIVTQVKQPKIINFKPLREALKDPGDFLLSDFSKFDRPPVLHLAFQA 386
DEDTTNY Y KGGIVTQVKQPK++NFKPLREALKDPGDFL SDFSKFDRPP+LHLAFQA
Sbjct: 303 DEDTTNYGTYVKGGIVTQVKQPKLLNFKPLREALKDPGDFLFSDFSKFDRPPLLHLAFQA 362
Query: 387 LDKFIQELGRFPVAGSEEDAQKIISLFTNINDNLADERVEEIDHKLLCHFAFGARAVLNP 446
LD F E GRFPVAGSEEDAQK+IS+ T IN D +VE +D KLL HF+FGA+AVLNP
Sbjct: 363 LDHFKAEAGRFPVAGSEEDAQKLISIATAINTGQGDLKVENVDQKLLRHFSFGAKAVLNP 422
Query: 447 MAAMFGGIVGQEVVKACSGKFHPLLQFFYFDSVESLPSEPLDPRDLQPLNSRYDAQISVF 506
MAAMFGGIVGQEVVKACSGKFHPL QFFYFDSVESLPSEP+D D P NSRYDAQISVF
Sbjct: 423 MAAMFGGIVGQEVVKACSGKFHPLFQFFYFDSVESLPSEPVDSSDFAPRNSRYDAQISVF 482
Query: 507 GSKLQKKLEEAKVFVVGSGALGCEFLKNLALMGVSCGNQGKLTITDDDVIEKSNLSRQFL 566
G+K QKKLE+AKVF VGSGALGCEFLKNLALMGVSCG+QGKLT+TDDD+IEKSNLSRQFL
Sbjct: 483 GAKFQKKLEDAKVFTVGSGALGCEFLKNLALMGVSCGSQGKLTVTDDDIIEKSNLSRQFL 542
Query: 567 FRDWNIGQAKSTVXXXXXXLINPHLNTEALQIRANPETENVFNDTFWEXXXXXXXXXXXX 626
FRDWNIGQAKSTV +INP N EALQ R ETENVF+D FWE
Sbjct: 543 FRDWNIGQAKSTVAASAAAVINPRFNIEALQNRVGAETENVFDDAFWENLTVVVNALDNV 602
Query: 627 XXRLYIDQRCLYFQKPLLESGTLGAKCNTQMVIPHLTENYGASRDPPEKQAPMCTVHSFP 686
RLY+D RCLYFQKPLLESGTLG KCNTQ VIPHLTENYGASRDPPEKQAPMCTVHSFP
Sbjct: 603 NARLYVDSRCLYFQKPLLESGTLGTKCNTQSVIPHLTENYGASRDPPEKQAPMCTVHSFP 662
Query: 687 HNIDHCLTWARSEFEGLLEKTPAEVNAYLTSPTEYASAMKNAGDAQARDNLDRVLECLDK 746
HNIDHCLTWARSEFEGLLEKTPAEVNAYL+SP EY ++M +AGDAQARD L+R++ECL+K
Sbjct: 663 HNIDHCLTWARSEFEGLLEKTPAEVNAYLSSPVEYTNSMMSAGDAQARDTLERIVECLEK 722
Query: 747 ERCETFQDCITWARLRFEDYFADRVKQLTFTFPENATTSNGTPFWSAPKRFPRPLQFSVD 806
E+CETFQDC+TWARLRFEDYF +RVKQL +TFPE+A TS G PFWSAPKRFPRPLQ+S
Sbjct: 723 EKCETFQDCLTWARLRFEDYFVNRVKQLIYTFPEDAATSTGAPFWSAPKRFPRPLQYSSS 782
Query: 807 DLSHLQFLMAASILRAETYGIPIPDWVKSPVKLADAVNKVIVPDFQPKENVKIETDEKAT 866
D S L F+ A +ILRAET+GIPIP+W K+P + A+AV++VIVPDF+P+++ KI TDEKAT
Sbjct: 783 DPSLLNFITATAILRAETFGIPIPEWTKNPKEAAEAVDRVIVPDFEPRQDAKIVTDEKAT 842
Query: 867 SMSTGSIDDAVVINXXXXXXXXXXXXXPTGYKMNPIQFEKDDDTNFHMDLIAGLANMRAR 926
+++T S+DDA VI+ ++M PIQFEKDDDTN+HMD+IAGLANMRAR
Sbjct: 843 TLTTASVDDAAVIDDLIAKIDQCRHNLSPDFRMKPIQFEKDDDTNYHMDVIAGLANMRAR 902
Query: 927 NYGIPEVDKLKAKFIAGRIIPAIATSTAMATGLVCLELYKVLDGGHKLEDYRNTFANLAL 986
NY IPEVDKLKAKFIAGRIIPAIATSTAMATGLVCLELYKVLDGGHK+E YRNTFANLAL
Sbjct: 903 NYSIPEVDKLKAKFIAGRIIPAIATSTAMATGLVCLELYKVLDGGHKVEAYRNTFANLAL 962
Query: 987 PLFSMAEPVPPKVFKHQDMSWTVWDRWILRDNPTLRQLLQWLQDKGLNAYSISYGSCLLF 1046
PLFSMAEP+PPKV KH+DM+WTVWDRW+L+ NPTLR++LQWL+DKGL+AYSIS GSCLLF
Sbjct: 963 PLFSMAEPLPPKVVKHRDMAWTVWDRWVLKGNPTLREVLQWLEDKGLSAYSISCGSCLLF 1022
Query: 1047 NSMFPRHKERMDKKVVDLVRDVAKAELPPYRQHFDVVVACVDEDDNDIDIPQISIYF 1103
NSMF RHKERMDKKVVDL RDVAK ELPPYR H DVVVAC DEDDND+DIP +SIYF
Sbjct: 1023 NSMFTRHKERMDKKVVDLARDVAKVELPPYRNHLDVVVACEDEDDNDVDIPLVSIYF 1079
|
|
| TAIR|locus:2164270 UBA 2 "ubiquitin activating enzyme 2" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P22314 UBA1 "Ubiquitin-like modifier-activating enzyme 1" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|A3KMV5 UBA1 "Ubiquitin-like modifier-activating enzyme 1" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1RWX8 UBA1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-040426-2009 uba1 "ubiquitin-like modifier activating enzyme 1" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| RGD|1359327 Uba1 "ubiquitin-like modifier activating enzyme 1" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:98891 Uba1y "ubiquitin-activating enzyme, Chr Y" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:98890 Uba1 "ubiquitin-like modifier activating enzyme 1" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| CGD|CAL0005518 UBA1 [Candida albicans (taxid:5476)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Annotation Transfer from SWISS-PROT Entries
Original result of BLAST against SWISS-PROT
| ID | Name | Annotated EC number | Identity | Query coverage | Hit coverage | RBH(Q2H) | RBH(H2Q) |
| P93028 | UBE11_ARATH | No assigned EC number | 0.8053 | 0.9211 | 0.9416 | yes | no |
| P31254 | UBA1Y_MOUSE | No assigned EC number | 0.4491 | 0.8949 | 0.9338 | yes | no |
| P31252 | UBE13_WHEAT | No assigned EC number | 0.7449 | 0.9347 | 0.9800 | N/A | no |
| P22314 | UBA1_HUMAN | No assigned EC number | 0.4498 | 0.8985 | 0.9376 | yes | no |
| P20973 | UBE11_WHEAT | No assigned EC number | 0.7859 | 0.9221 | 0.9686 | N/A | no |
| Q55C16 | UBA1_DICDI | No assigned EC number | 0.4434 | 0.8940 | 0.9705 | yes | no |
| O94609 | UBA1_SCHPO | No assigned EC number | 0.4379 | 0.9012 | 0.9832 | yes | no |
| P31251 | UBE12_WHEAT | No assigned EC number | 0.7849 | 0.9221 | 0.9686 | N/A | no |
| A3KMV5 | UBA1_BOVIN | No assigned EC number | 0.4473 | 0.8994 | 0.9385 | yes | no |
| Q29504 | UBA1_RABIT | No assigned EC number | 0.4473 | 0.8994 | 0.9385 | yes | no |
| P92974 | UBE12_ARATH | No assigned EC number | 0.7783 | 0.9311 | 0.9545 | no | no |
| P22515 | UBA1_YEAST | No assigned EC number | 0.4483 | 0.9003 | 0.9707 | yes | no |
| Q5U300 | UBA1_RAT | No assigned EC number | 0.4415 | 0.8994 | 0.9385 | yes | no |
EC Number Prediction by Ezypred Server
Original result from Ezypred Server
Fail to connect to Ezypred Server
EC Number Prediction by EFICAz Software
No EC number assignment, probably not an enzyme!
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST
Original result of RPS-BLAST against CDD database part I
| ID | Alignment Graph | Length |
Definition |
E-value |
| Query | 1104 | |||
| TIGR01408 | 1008 | TIGR01408, Ube1, ubiquitin-activating enzyme E1 | 0.0 | |
| cd01490 | 435 | cd01490, Ube1_repeat2, Ubiquitin activating enzyme | 1e-166 | |
| cd01491 | 286 | cd01491, Ube1_repeat1, Ubiquitin activating enzyme | 1e-132 | |
| cd01490 | 435 | cd01490, Ube1_repeat2, Ubiquitin activating enzyme | 2e-74 | |
| cd01484 | 234 | cd01484, E1-2_like, Ubiquitin activating enzyme (E | 9e-63 | |
| pfam09358 | 124 | pfam09358, UBA_e1_C, Ubiquitin-activating enzyme e | 3e-51 | |
| cd01489 | 312 | cd01489, Uba2_SUMO, Ubiquitin activating enzyme (E | 3e-43 | |
| smart00985 | 128 | smart00985, UBA_e1_C, Ubiquitin-activating enzyme | 4e-42 | |
| pfam00899 | 134 | pfam00899, ThiF, ThiF family | 3e-39 | |
| cd01492 | 197 | cd01492, Aos1_SUMO, Ubiquitin activating enzyme (E | 4e-36 | |
| cd00757 | 228 | cd00757, ThiF_MoeB_HesA_family, ThiF_MoeB_HesA | 1e-34 | |
| COG0476 | 254 | COG0476, ThiF, Dinucleotide-utilizing enzymes invo | 4e-34 | |
| cd01485 | 198 | cd01485, E1-1_like, Ubiquitin activating enzyme (E | 1e-33 | |
| cd01488 | 291 | cd01488, Uba3_RUB, Ubiquitin activating enzyme (E1 | 7e-33 | |
| cd01483 | 143 | cd01483, E1_enzyme_family, Superfamily of activati | 6e-31 | |
| COG0476 | 254 | COG0476, ThiF, Dinucleotide-utilizing enzymes invo | 3e-28 | |
| pfam02134 | 66 | pfam02134, UBACT, Repeat in ubiquitin-activating ( | 2e-24 | |
| TIGR02356 | 202 | TIGR02356, adenyl_thiF, thiazole biosynthesis aden | 3e-24 | |
| PRK05690 | 245 | PRK05690, PRK05690, molybdopterin biosynthesis pro | 3e-23 | |
| TIGR02355 | 240 | TIGR02355, moeB, molybdopterin synthase sulfurylas | 9e-22 | |
| cd01493 | 425 | cd01493, APPBP1_RUB, Ubiquitin activating enzyme ( | 1e-21 | |
| PRK08762 | 376 | PRK08762, PRK08762, molybdopterin biosynthesis pro | 5e-21 | |
| cd01491 | 286 | cd01491, Ube1_repeat1, Ubiquitin activating enzyme | 1e-19 | |
| pfam10585 | 44 | pfam10585, UBA_e1_thiolCys, Ubiquitin-activating e | 4e-18 | |
| PRK08644 | 212 | PRK08644, PRK08644, thiamine biosynthesis protein | 1e-16 | |
| TIGR02356 | 202 | TIGR02356, adenyl_thiF, thiazole biosynthesis aden | 3e-16 | |
| pfam00899 | 134 | pfam00899, ThiF, ThiF family | 7e-16 | |
| cd01492 | 197 | cd01492, Aos1_SUMO, Ubiquitin activating enzyme (E | 1e-15 | |
| cd00757 | 228 | cd00757, ThiF_MoeB_HesA_family, ThiF_MoeB_HesA | 2e-15 | |
| cd00755 | 231 | cd00755, YgdL_like, Family of activating enzymes ( | 2e-15 | |
| PRK12475 | 338 | PRK12475, PRK12475, thiamine/molybdopterin biosynt | 1e-14 | |
| PRK05597 | 355 | PRK05597, PRK05597, molybdopterin biosynthesis pro | 2e-14 | |
| PRK08328 | 231 | PRK08328, PRK08328, hypothetical protein; Provisio | 3e-14 | |
| PRK08328 | 231 | PRK08328, PRK08328, hypothetical protein; Provisio | 5e-14 | |
| PRK07688 | 339 | PRK07688, PRK07688, thiamine/molybdopterin biosynt | 7e-14 | |
| PRK05600 | 370 | PRK05600, PRK05600, thiamine biosynthesis protein | 7e-14 | |
| cd01489 | 312 | cd01489, Uba2_SUMO, Ubiquitin activating enzyme (E | 2e-13 | |
| cd01483 | 143 | cd01483, E1_enzyme_family, Superfamily of activati | 2e-13 | |
| COG1179 | 263 | COG1179, COG1179, Dinucleotide-utilizing enzymes i | 2e-13 | |
| PRK07878 | 392 | PRK07878, PRK07878, molybdopterin biosynthesis-lik | 5e-13 | |
| cd01484 | 234 | cd01484, E1-2_like, Ubiquitin activating enzyme (E | 8e-13 | |
| cd01493 | 425 | cd01493, APPBP1_RUB, Ubiquitin activating enzyme ( | 1e-12 | |
| PTZ00245 | 287 | PTZ00245, PTZ00245, ubiquitin activating enzyme; P | 3e-12 | |
| TIGR02354 | 200 | TIGR02354, thiF_fam2, thiamine biosynthesis protei | 7e-12 | |
| cd01485 | 198 | cd01485, E1-1_like, Ubiquitin activating enzyme (E | 1e-11 | |
| cd01491 | 286 | cd01491, Ube1_repeat1, Ubiquitin activating enzyme | 2e-11 | |
| PRK07411 | 390 | PRK07411, PRK07411, hypothetical protein; Validate | 8e-11 | |
| cd01487 | 174 | cd01487, E1_ThiF_like, E1_ThiF_like | 3e-10 | |
| PRK07688 | 339 | PRK07688, PRK07688, thiamine/molybdopterin biosynt | 8e-10 | |
| PRK05600 | 370 | PRK05600, PRK05600, thiamine biosynthesis protein | 8e-10 | |
| PRK08223 | 287 | PRK08223, PRK08223, hypothetical protein; Validate | 2e-09 | |
| TIGR02355 | 240 | TIGR02355, moeB, molybdopterin synthase sulfurylas | 6e-08 | |
| PRK05597 | 355 | PRK05597, PRK05597, molybdopterin biosynthesis pro | 8e-08 | |
| cd01487 | 174 | cd01487, E1_ThiF_like, E1_ThiF_like | 2e-07 | |
| PRK14852 | 989 | PRK14852, PRK14852, hypothetical protein; Provisio | 2e-07 | |
| PRK14851 | 679 | PRK14851, PRK14851, hypothetical protein; Provisio | 2e-07 | |
| PRK05690 | 245 | PRK05690, PRK05690, molybdopterin biosynthesis pro | 7e-07 | |
| PRK08762 | 376 | PRK08762, PRK08762, molybdopterin biosynthesis pro | 7e-07 | |
| cd01485 | 198 | cd01485, E1-1_like, Ubiquitin activating enzyme (E | 9e-07 | |
| pfam02134 | 66 | pfam02134, UBACT, Repeat in ubiquitin-activating ( | 1e-06 | |
| PRK12475 | 338 | PRK12475, PRK12475, thiamine/molybdopterin biosynt | 1e-06 | |
| cd01488 | 291 | cd01488, Uba3_RUB, Ubiquitin activating enzyme (E1 | 2e-06 | |
| cd01489 | 312 | cd01489, Uba2_SUMO, Ubiquitin activating enzyme (E | 7e-06 | |
| PRK08644 | 212 | PRK08644, PRK08644, thiamine biosynthesis protein | 7e-06 | |
| COG1179 | 263 | COG1179, COG1179, Dinucleotide-utilizing enzymes i | 1e-05 | |
| TIGR02354 | 200 | TIGR02354, thiF_fam2, thiamine biosynthesis protei | 1e-05 | |
| TIGR03736 | 244 | TIGR03736, PRTRC_ThiF, PRTRC system ThiF family pr | 1e-05 | |
| cd00755 | 231 | cd00755, YgdL_like, Family of activating enzymes ( | 3e-05 | |
| PRK15116 | 268 | PRK15116, PRK15116, sulfur acceptor protein CsdL; | 7e-05 | |
| cd01492 | 197 | cd01492, Aos1_SUMO, Ubiquitin activating enzyme (E | 1e-04 | |
| cd01484 | 234 | cd01484, E1-2_like, Ubiquitin activating enzyme (E | 3e-04 | |
| cd01486 | 307 | cd01486, Apg7, Apg7 is an E1-like protein, that ac | 3e-04 | |
| cd01488 | 291 | cd01488, Uba3_RUB, Ubiquitin activating enzyme (E1 | 9e-04 | |
| cd01490 | 435 | cd01490, Ube1_repeat2, Ubiquitin activating enzyme | 0.003 |
| >gnl|CDD|130475 TIGR01408, Ube1, ubiquitin-activating enzyme E1 | Back alignment and domain information |
|---|
Score = 1560 bits (4041), Expect = 0.0
Identities = 513/1012 (50%), Positives = 682/1012 (67%), Gaps = 7/1012 (0%)
Query: 96 DIDEDLHSRQLAVYGRETMRRLFASNILISGMQGLGAEIAKNLILAGVKSVTLHDEGVVE 155
+IDE L+SRQL V G E M+++ SN+LISGM GLG EIAKNL+LAGVKSVTLHD +
Sbjct: 1 EIDEALYSRQLYVLGDEAMQKMAKSNVLISGMGGLGLEIAKNLVLAGVKSVTLHDTEKCQ 60
Query: 156 LWDLSSNFIFSEDDVGKNRALASIQKLQELNNAVAISALTTELTKEKLSDFQAVVFTDIS 215
WDLSSNF SEDDVG+NRA A ++KL ELN V +S+ + +E L FQ VV T++S
Sbjct: 61 AWDLSSNFFLSEDDVGRNRAEAVVKKLAELNPYVHVSSSSVPFNEEFLDKFQCVVLTEMS 120
Query: 216 LEKAVEFDDYCHNHQPPIAFIKSEVRGLFGNIFCDFGPEFTVFDVDGEEPHTGIIASISN 275
L E +D+CH+ PPIAFI ++VRGLFG++FCDFG EF V D DGEEP TG IASI+
Sbjct: 121 LPLQKEINDFCHSQCPPIAFISADVRGLFGSLFCDFGDEFEVLDTDGEEPKTGFIASITQ 180
Query: 276 DNPPLISCVDDERIEFQDGDLVVFSEVHGMTELNDGKPRKVKNARPYSFSIDEDTTNYSA 335
NP +++C+++ R + + GD V F EV+GMT LNDG PRK+ PYSFSI + T
Sbjct: 181 ANPGIVTCLENHRHKLETGDFVTFREVNGMTGLNDGSPRKITVISPYSFSIGDTTE-LGP 239
Query: 336 YEKGGIVTQVKQPKIINFKPLREALKDPGDFLLSDFSKFDRPPVLHLAFQALDKFIQELG 395
Y GGI TQVK PK + FK LRE LKDP L+ DFSK +RPP +H AFQALD+F ++
Sbjct: 240 YLHGGIATQVKTPKTVFFKSLREQLKDP-KCLIVDFSKPERPPEIHTAFQALDQFQEKYS 298
Query: 396 RFPVAGSEEDAQKIISLFTNINDNLADERVEEIDHKLLCHFAFGARAVLNPMAAMFGGIV 455
R P G ++DA++++ L T+I++ L +E+V ++D KL+ ++ A+ L+PMAA GG+V
Sbjct: 299 RKPNVGCQQDAEELLKLATSISETL-EEKVPDVDAKLVHWLSWTAQGFLSPMAAAVGGVV 357
Query: 456 GQEVVKACSGKFHPLLQFFYFDSVESLPSE-PLDPRDLQPLNSRYDAQISVFGSKLQKKL 514
QEV+KA +GKF PL Q+FYFDS ESLPS + + P RYDAQI+VFG Q+KL
Sbjct: 358 SQEVLKAVTGKFSPLCQWFYFDSAESLPSLGKPECEEFLPRGDRYDAQIAVFGDTFQQKL 417
Query: 515 EEAKVFVVGSGALGCEFLKNLALMGVSCGNQGKLTITDDDVIEKSNLSRQFLFRDWNIGQ 574
+ +F+VG GA+GCE LKN ALMGV G +G +T+TD D+IEKSNL+RQFLFR +IG+
Sbjct: 418 QNLNIFLVGCGAIGCEMLKNFALMGVGTGKKGMITVTDPDLIEKSNLNRQFLFRPHHIGK 477
Query: 575 AKSTVAASAAALINPHLNTEALQIRANPETENVFNDTFWENLNVVVNALDNVNARLYIDQ 634
KS AA A INP + +A Q R PETE +FND F+E L+VV+NALDNV AR Y+D
Sbjct: 478 PKSYTAADATLKINPQIKIDAHQNRVGPETETIFNDEFYEKLDVVINALDNVEARRYVDS 537
Query: 635 RCLYFQKPLLESGTLGAKCNTQMVIPHLTENYGASRDPPEKQAPMCTVHSFPHNIDHCLT 694
RCL F KPLLESGTLG K NTQ+V+PHLTE+YG+SRDPPEK+ P CT+ SFP I+H +
Sbjct: 538 RCLAFLKPLLESGTLGTKGNTQVVVPHLTESYGSSRDPPEKEIPFCTLKSFPAAIEHTIQ 597
Query: 695 WARSEFEGLLEKTPAEVNAYLTSPTEYASAMKNAGDAQARDNLDRVLECLDKERCETFQD 754
WAR +FEGL P+ VN YL+SP+ ++ +R+ L+++++ L KE+ F
Sbjct: 598 WARDKFEGLFSHKPSLVNKYLSSPSSAEEVLQKIQSGHSREGLEQIIKLLSKEKPRNFSQ 657
Query: 755 CITWARLRFEDYFADRVKQLTFTFPENATTSNGTPFWSAPKRFPRPLQFSVDDLSHLQFL 814
C+ WARL+FE YF ++ QL FP + TS G+PFWS+PKR P PL+F +++ HL F+
Sbjct: 658 CVEWARLKFEKYFNNKALQLLHCFPLDIRTSTGSPFWSSPKRPPSPLKFDLNEPLHLSFI 717
Query: 815 MAASILRAETYGIPIPDWVKSPVKLADAVNKVIVPDFQPKENVKIETDEKATSMSTGSID 874
AA+ L A YGIP + S L + +++V +P+F+P+ N KI+TDE A T D
Sbjct: 718 QAAAKLYATVYGIPFAEEDLSADALLNILSEVKIPEFKPRSNKKIQTDETARKPDTAPED 777
Query: 875 DAVVINELLQKLEKCQKQLPTGYKMNPIQFEKDDDTNFHMDLIAGLANMRARNYGIPEVD 934
D I +L + + + + ++M P+ FEKDDD N H+D I +N+RA+NY I D
Sbjct: 778 DRNAIFQLEKAILSNEATK-SDFRMAPLSFEKDDDHNGHIDFITAASNLRAKNYSIEPAD 836
Query: 935 KLKAKFIAGRIIPAIATSTAMATGLVCLELYKVLDGGHKLEDYRNTFANLALPLFSMAEP 994
+ K KFIAG+IIPAIATSTA +GLVCLEL KV DGG+K E Y+N F NLA+PLF EP
Sbjct: 837 RFKTKFIAGKIIPAIATSTATVSGLVCLELIKVTDGGYKFEVYKNCFLNLAIPLFVFTEP 896
Query: 995 VPPKVFKHQDMSW-TVWDRWILRDNPTLRQLLQWLQ-DKGLNAYSISYGSCLLFNSMFPR 1052
+ K ++ T+WDRW L + TL + + ++ GL +S G LL+ + P
Sbjct: 897 TEVRKTKIRNGISFTIWDRWTLHGDFTLLEFINAVKEKYGLEPTMVSQGVKLLYVPVMPG 956
Query: 1053 HKERMDKKVVDLVRDVAKAELPPYRQHFDVVVACVDEDDNDIDIPQISIYFS 1104
H ER+ K+ LV+ K +LPPYR H V AC D+ D D+ P + IYFS
Sbjct: 957 HAERLKLKMHKLVKPTTKKKLPPYRVHLTVSFACDDDGDEDVPGPPVRIYFS 1008
|
This model represents the full length, over a thousand amino acids, of a multicopy family of eukaryotic proteins, many of which are designated ubiquitin-activating enzyme E1. Members have two copies of the ThiF family domain (pfam00899), a repeat found in ubiquitin-activating proteins (pfam02134), and other regions. Length = 1008 |
| >gnl|CDD|238767 cd01490, Ube1_repeat2, Ubiquitin activating enzyme (E1), repeat 2 | Back alignment and domain information |
|---|
| >gnl|CDD|238768 cd01491, Ube1_repeat1, Ubiquitin activating enzyme (E1), repeat 1 | Back alignment and domain information |
|---|
| >gnl|CDD|238767 cd01490, Ube1_repeat2, Ubiquitin activating enzyme (E1), repeat 2 | Back alignment and domain information |
|---|
| >gnl|CDD|238761 cd01484, E1-2_like, Ubiquitin activating enzyme (E1), repeat 2-like | Back alignment and domain information |
|---|
| >gnl|CDD|220201 pfam09358, UBA_e1_C, Ubiquitin-activating enzyme e1 C-terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|238766 cd01489, Uba2_SUMO, Ubiquitin activating enzyme (E1) subunit UBA2 | Back alignment and domain information |
|---|
| >gnl|CDD|214955 smart00985, UBA_e1_C, Ubiquitin-activating enzyme e1 C-terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|216180 pfam00899, ThiF, ThiF family | Back alignment and domain information |
|---|
| >gnl|CDD|238769 cd01492, Aos1_SUMO, Ubiquitin activating enzyme (E1) subunit Aos1 | Back alignment and domain information |
|---|
| >gnl|CDD|238386 cd00757, ThiF_MoeB_HesA_family, ThiF_MoeB_HesA | Back alignment and domain information |
|---|
| >gnl|CDD|223552 COG0476, ThiF, Dinucleotide-utilizing enzymes involved in molybdopterin and thiamine biosynthesis family 2 [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|238762 cd01485, E1-1_like, Ubiquitin activating enzyme (E1), repeat 1-like | Back alignment and domain information |
|---|
| >gnl|CDD|238765 cd01488, Uba3_RUB, Ubiquitin activating enzyme (E1) subunit UBA3 | Back alignment and domain information |
|---|
| >gnl|CDD|238760 cd01483, E1_enzyme_family, Superfamily of activating enzymes (E1) of the ubiquitin-like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|223552 COG0476, ThiF, Dinucleotide-utilizing enzymes involved in molybdopterin and thiamine biosynthesis family 2 [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|202124 pfam02134, UBACT, Repeat in ubiquitin-activating (UBA) protein | Back alignment and domain information |
|---|
| >gnl|CDD|162820 TIGR02356, adenyl_thiF, thiazole biosynthesis adenylyltransferase ThiF, E | Back alignment and domain information |
|---|
| >gnl|CDD|180204 PRK05690, PRK05690, molybdopterin biosynthesis protein MoeB; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|131408 TIGR02355, moeB, molybdopterin synthase sulfurylase MoeB | Back alignment and domain information |
|---|
| >gnl|CDD|238770 cd01493, APPBP1_RUB, Ubiquitin activating enzyme (E1) subunit APPBP1 | Back alignment and domain information |
|---|
| >gnl|CDD|236337 PRK08762, PRK08762, molybdopterin biosynthesis protein MoeB; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|238768 cd01491, Ube1_repeat1, Ubiquitin activating enzyme (E1), repeat 1 | Back alignment and domain information |
|---|
| >gnl|CDD|192635 pfam10585, UBA_e1_thiolCys, Ubiquitin-activating enzyme active site | Back alignment and domain information |
|---|
| >gnl|CDD|236320 PRK08644, PRK08644, thiamine biosynthesis protein ThiF; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|162820 TIGR02356, adenyl_thiF, thiazole biosynthesis adenylyltransferase ThiF, E | Back alignment and domain information |
|---|
| >gnl|CDD|216180 pfam00899, ThiF, ThiF family | Back alignment and domain information |
|---|
| >gnl|CDD|238769 cd01492, Aos1_SUMO, Ubiquitin activating enzyme (E1) subunit Aos1 | Back alignment and domain information |
|---|
| >gnl|CDD|238386 cd00757, ThiF_MoeB_HesA_family, ThiF_MoeB_HesA | Back alignment and domain information |
|---|
| >gnl|CDD|238384 cd00755, YgdL_like, Family of activating enzymes (E1) of ubiquitin-like proteins related to the E | Back alignment and domain information |
|---|
| >gnl|CDD|183547 PRK12475, PRK12475, thiamine/molybdopterin biosynthesis MoeB-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235526 PRK05597, PRK05597, molybdopterin biosynthesis protein MoeB; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|169382 PRK08328, PRK08328, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|169382 PRK08328, PRK08328, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|181084 PRK07688, PRK07688, thiamine/molybdopterin biosynthesis ThiF/MoeB-like protein; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|235528 PRK05600, PRK05600, thiamine biosynthesis protein ThiF; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|238766 cd01489, Uba2_SUMO, Ubiquitin activating enzyme (E1) subunit UBA2 | Back alignment and domain information |
|---|
| >gnl|CDD|238760 cd01483, E1_enzyme_family, Superfamily of activating enzymes (E1) of the ubiquitin-like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|224100 COG1179, COG1179, Dinucleotide-utilizing enzymes involved in molybdopterin and thiamine biosynthesis family 1 [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|181156 PRK07878, PRK07878, molybdopterin biosynthesis-like protein MoeZ; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|238761 cd01484, E1-2_like, Ubiquitin activating enzyme (E1), repeat 2-like | Back alignment and domain information |
|---|
| >gnl|CDD|238770 cd01493, APPBP1_RUB, Ubiquitin activating enzyme (E1) subunit APPBP1 | Back alignment and domain information |
|---|
| >gnl|CDD|140272 PTZ00245, PTZ00245, ubiquitin activating enzyme; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|162819 TIGR02354, thiF_fam2, thiamine biosynthesis protein ThiF, family 2 | Back alignment and domain information |
|---|
| >gnl|CDD|238762 cd01485, E1-1_like, Ubiquitin activating enzyme (E1), repeat 1-like | Back alignment and domain information |
|---|
| >gnl|CDD|238768 cd01491, Ube1_repeat1, Ubiquitin activating enzyme (E1), repeat 1 | Back alignment and domain information |
|---|
| >gnl|CDD|180967 PRK07411, PRK07411, hypothetical protein; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|238764 cd01487, E1_ThiF_like, E1_ThiF_like | Back alignment and domain information |
|---|
| >gnl|CDD|181084 PRK07688, PRK07688, thiamine/molybdopterin biosynthesis ThiF/MoeB-like protein; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|235528 PRK05600, PRK05600, thiamine biosynthesis protein ThiF; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|181302 PRK08223, PRK08223, hypothetical protein; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|131408 TIGR02355, moeB, molybdopterin synthase sulfurylase MoeB | Back alignment and domain information |
|---|
| >gnl|CDD|235526 PRK05597, PRK05597, molybdopterin biosynthesis protein MoeB; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|238764 cd01487, E1_ThiF_like, E1_ThiF_like | Back alignment and domain information |
|---|
| >gnl|CDD|184854 PRK14852, PRK14852, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184853 PRK14851, PRK14851, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|180204 PRK05690, PRK05690, molybdopterin biosynthesis protein MoeB; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236337 PRK08762, PRK08762, molybdopterin biosynthesis protein MoeB; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|238762 cd01485, E1-1_like, Ubiquitin activating enzyme (E1), repeat 1-like | Back alignment and domain information |
|---|
| >gnl|CDD|202124 pfam02134, UBACT, Repeat in ubiquitin-activating (UBA) protein | Back alignment and domain information |
|---|
| >gnl|CDD|183547 PRK12475, PRK12475, thiamine/molybdopterin biosynthesis MoeB-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|238765 cd01488, Uba3_RUB, Ubiquitin activating enzyme (E1) subunit UBA3 | Back alignment and domain information |
|---|
| >gnl|CDD|238766 cd01489, Uba2_SUMO, Ubiquitin activating enzyme (E1) subunit UBA2 | Back alignment and domain information |
|---|
| >gnl|CDD|236320 PRK08644, PRK08644, thiamine biosynthesis protein ThiF; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|224100 COG1179, COG1179, Dinucleotide-utilizing enzymes involved in molybdopterin and thiamine biosynthesis family 1 [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|162819 TIGR02354, thiF_fam2, thiamine biosynthesis protein ThiF, family 2 | Back alignment and domain information |
|---|
| >gnl|CDD|163448 TIGR03736, PRTRC_ThiF, PRTRC system ThiF family protein | Back alignment and domain information |
|---|
| >gnl|CDD|238384 cd00755, YgdL_like, Family of activating enzymes (E1) of ubiquitin-like proteins related to the E | Back alignment and domain information |
|---|
| >gnl|CDD|185071 PRK15116, PRK15116, sulfur acceptor protein CsdL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|238769 cd01492, Aos1_SUMO, Ubiquitin activating enzyme (E1) subunit Aos1 | Back alignment and domain information |
|---|
| >gnl|CDD|238761 cd01484, E1-2_like, Ubiquitin activating enzyme (E1), repeat 2-like | Back alignment and domain information |
|---|
| >gnl|CDD|238763 cd01486, Apg7, Apg7 is an E1-like protein, that activates two different ubiquitin-like proteins, Apg12 and Apg8, and assigns them to specific E2 enzymes, Apg10 and Apg3, respectively | Back alignment and domain information |
|---|
| >gnl|CDD|238765 cd01488, Uba3_RUB, Ubiquitin activating enzyme (E1) subunit UBA3 | Back alignment and domain information |
|---|
| >gnl|CDD|238767 cd01490, Ube1_repeat2, Ubiquitin activating enzyme (E1), repeat 2 | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch
Original result of HHsearch against CDD database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 1104 | |||
| KOG2012 | 1013 | consensus Ubiquitin activating enzyme UBA1 [Posttr | 100.0 | |
| TIGR01408 | 1008 | Ube1 ubiquitin-activating enzyme E1. This model re | 100.0 | |
| cd01490 | 435 | Ube1_repeat2 Ubiquitin activating enzyme (E1), rep | 100.0 | |
| KOG2013 | 603 | consensus SMT3/SUMO-activating complex, catalytic | 100.0 | |
| cd01489 | 312 | Uba2_SUMO Ubiquitin activating enzyme (E1) subunit | 100.0 | |
| cd01491 | 286 | Ube1_repeat1 Ubiquitin activating enzyme (E1), rep | 100.0 | |
| cd01484 | 234 | E1-2_like Ubiquitin activating enzyme (E1), repeat | 100.0 | |
| KOG2015 | 422 | consensus NEDD8-activating complex, catalytic comp | 100.0 | |
| cd01488 | 291 | Uba3_RUB Ubiquitin activating enzyme (E1) subunit | 100.0 | |
| cd01493 | 425 | APPBP1_RUB Ubiquitin activating enzyme (E1) subuni | 100.0 | |
| KOG2014 | 331 | consensus SMT3/SUMO-activating complex, AOS1/RAD31 | 100.0 | |
| KOG2016 | 523 | consensus NEDD8-activating complex, APP-BP1/UBA5 c | 100.0 | |
| cd01492 | 197 | Aos1_SUMO Ubiquitin activating enzyme (E1) subunit | 100.0 | |
| cd01485 | 198 | E1-1_like Ubiquitin activating enzyme (E1), repeat | 100.0 | |
| PRK08223 | 287 | hypothetical protein; Validated | 100.0 | |
| TIGR02356 | 202 | adenyl_thiF thiazole biosynthesis adenylyltransfer | 100.0 | |
| cd00757 | 228 | ThiF_MoeB_HesA_family ThiF_MoeB_HesA. Family of E1 | 100.0 | |
| PRK05690 | 245 | molybdopterin biosynthesis protein MoeB; Provision | 100.0 | |
| PRK07411 | 390 | hypothetical protein; Validated | 100.0 | |
| PRK08328 | 231 | hypothetical protein; Provisional | 100.0 | |
| PRK05597 | 355 | molybdopterin biosynthesis protein MoeB; Validated | 100.0 | |
| TIGR02355 | 240 | moeB molybdopterin synthase sulfurylase MoeB. This | 100.0 | |
| cd01492 | 197 | Aos1_SUMO Ubiquitin activating enzyme (E1) subunit | 100.0 | |
| cd01493 | 425 | APPBP1_RUB Ubiquitin activating enzyme (E1) subuni | 100.0 | |
| PRK07878 | 392 | molybdopterin biosynthesis-like protein MoeZ; Vali | 100.0 | |
| PRK07878 | 392 | molybdopterin biosynthesis-like protein MoeZ; Vali | 100.0 | |
| PRK05600 | 370 | thiamine biosynthesis protein ThiF; Validated | 100.0 | |
| cd01489 | 312 | Uba2_SUMO Ubiquitin activating enzyme (E1) subunit | 100.0 | |
| cd01491 | 286 | Ube1_repeat1 Ubiquitin activating enzyme (E1), rep | 100.0 | |
| cd01485 | 198 | E1-1_like Ubiquitin activating enzyme (E1), repeat | 100.0 | |
| PRK05597 | 355 | molybdopterin biosynthesis protein MoeB; Validated | 100.0 | |
| PRK12475 | 338 | thiamine/molybdopterin biosynthesis MoeB-like prot | 100.0 | |
| PRK07688 | 339 | thiamine/molybdopterin biosynthesis ThiF/MoeB-like | 99.98 | |
| PRK08223 | 287 | hypothetical protein; Validated | 99.97 | |
| PRK05690 | 245 | molybdopterin biosynthesis protein MoeB; Provision | 99.97 | |
| TIGR02356 | 202 | adenyl_thiF thiazole biosynthesis adenylyltransfer | 99.97 | |
| PRK08762 | 376 | molybdopterin biosynthesis protein MoeB; Validated | 99.97 | |
| KOG2017 | 427 | consensus Molybdopterin synthase sulfurylase [Coen | 99.97 | |
| COG0476 | 254 | ThiF Dinucleotide-utilizing enzymes involved in mo | 99.97 | |
| PRK07411 | 390 | hypothetical protein; Validated | 99.97 | |
| cd00757 | 228 | ThiF_MoeB_HesA_family ThiF_MoeB_HesA. Family of E1 | 99.97 | |
| PF09358 | 125 | UBA_e1_C: Ubiquitin-activating enzyme e1 C-termina | 99.97 | |
| cd01488 | 291 | Uba3_RUB Ubiquitin activating enzyme (E1) subunit | 99.97 | |
| PRK08328 | 231 | hypothetical protein; Provisional | 99.97 | |
| PRK14851 | 679 | hypothetical protein; Provisional | 99.97 | |
| TIGR03736 | 244 | PRTRC_ThiF PRTRC system ThiF family protein. A nov | 99.97 | |
| PRK05600 | 370 | thiamine biosynthesis protein ThiF; Validated | 99.97 | |
| TIGR02355 | 240 | moeB molybdopterin synthase sulfurylase MoeB. This | 99.97 | |
| PRK14852 | 989 | hypothetical protein; Provisional | 99.97 | |
| KOG2013 | 603 | consensus SMT3/SUMO-activating complex, catalytic | 99.96 | |
| PRK15116 | 268 | sulfur acceptor protein CsdL; Provisional | 99.96 | |
| cd01484 | 234 | E1-2_like Ubiquitin activating enzyme (E1), repeat | 99.96 | |
| PRK07688 | 339 | thiamine/molybdopterin biosynthesis ThiF/MoeB-like | 99.96 | |
| PRK12475 | 338 | thiamine/molybdopterin biosynthesis MoeB-like prot | 99.95 | |
| cd00755 | 231 | YgdL_like Family of activating enzymes (E1) of ubi | 99.95 | |
| PRK07877 | 722 | hypothetical protein; Provisional | 99.95 | |
| PRK08644 | 212 | thiamine biosynthesis protein ThiF; Provisional | 99.95 | |
| TIGR01408 | 1008 | Ube1 ubiquitin-activating enzyme E1. This model re | 99.95 | |
| COG0476 | 254 | ThiF Dinucleotide-utilizing enzymes involved in mo | 99.95 | |
| PF00899 | 135 | ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-a | 99.95 | |
| KOG2017 | 427 | consensus Molybdopterin synthase sulfurylase [Coen | 99.95 | |
| PRK15116 | 268 | sulfur acceptor protein CsdL; Provisional | 99.95 | |
| COG1179 | 263 | Dinucleotide-utilizing enzymes involved in molybdo | 99.95 | |
| KOG2015 | 422 | consensus NEDD8-activating complex, catalytic comp | 99.94 | |
| PRK08762 | 376 | molybdopterin biosynthesis protein MoeB; Validated | 99.94 | |
| PRK14852 | 989 | hypothetical protein; Provisional | 99.94 | |
| PTZ00245 | 287 | ubiquitin activating enzyme; Provisional | 99.94 | |
| cd01490 | 435 | Ube1_repeat2 Ubiquitin activating enzyme (E1), rep | 99.94 | |
| TIGR01381 | 664 | E1_like_apg7 E1-like protein-activating enzyme Gsa | 99.94 | |
| PRK14851 | 679 | hypothetical protein; Provisional | 99.94 | |
| cd01483 | 143 | E1_enzyme_family Superfamily of activating enzymes | 99.94 | |
| TIGR03603 | 318 | cyclo_dehy_ocin bacteriocin biosynthesis cyclodehy | 99.93 | |
| PF00899 | 135 | ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-a | 99.93 | |
| cd01486 | 307 | Apg7 Apg7 is an E1-like protein, that activates tw | 99.93 | |
| cd00755 | 231 | YgdL_like Family of activating enzymes (E1) of ubi | 99.92 | |
| cd01487 | 174 | E1_ThiF_like E1_ThiF_like. Member of superfamily o | 99.92 | |
| PRK08644 | 212 | thiamine biosynthesis protein ThiF; Provisional | 99.92 | |
| cd01483 | 143 | E1_enzyme_family Superfamily of activating enzymes | 99.92 | |
| TIGR02354 | 200 | thiF_fam2 thiamine biosynthesis protein ThiF, fami | 99.91 | |
| COG1179 | 263 | Dinucleotide-utilizing enzymes involved in molybdo | 99.91 | |
| PTZ00245 | 287 | ubiquitin activating enzyme; Provisional | 99.91 | |
| PRK07877 | 722 | hypothetical protein; Provisional | 99.9 | |
| TIGR01381 | 664 | E1_like_apg7 E1-like protein-activating enzyme Gsa | 99.9 | |
| PRK06153 | 393 | hypothetical protein; Provisional | 99.89 | |
| KOG2014 | 331 | consensus SMT3/SUMO-activating complex, AOS1/RAD31 | 99.88 | |
| cd01486 | 307 | Apg7 Apg7 is an E1-like protein, that activates tw | 99.88 | |
| TIGR03603 | 318 | cyclo_dehy_ocin bacteriocin biosynthesis cyclodehy | 99.87 | |
| KOG2016 | 523 | consensus NEDD8-activating complex, APP-BP1/UBA5 c | 99.87 | |
| cd01487 | 174 | E1_ThiF_like E1_ThiF_like. Member of superfamily o | 99.87 | |
| KOG2336 | 422 | consensus Molybdopterin biosynthesis-related prote | 99.86 | |
| TIGR02354 | 200 | thiF_fam2 thiamine biosynthesis protein ThiF, fami | 99.86 | |
| PF02134 | 67 | UBACT: Repeat in ubiquitin-activating (UBA) protei | 99.84 | |
| KOG2018 | 430 | consensus Predicted dinucleotide-utilizing enzyme | 99.82 | |
| KOG2012 | 1013 | consensus Ubiquitin activating enzyme UBA1 [Posttr | 99.81 | |
| PRK06153 | 393 | hypothetical protein; Provisional | 99.8 | |
| KOG2018 | 430 | consensus Predicted dinucleotide-utilizing enzyme | 99.8 | |
| TIGR03736 | 244 | PRTRC_ThiF PRTRC system ThiF family protein. A nov | 99.76 | |
| KOG2336 | 422 | consensus Molybdopterin biosynthesis-related prote | 99.59 | |
| PF10585 | 45 | UBA_e1_thiolCys: Ubiquitin-activating enzyme activ | 99.51 | |
| TIGR03693 | 637 | ocin_ThiF_like putative thiazole-containing bacter | 99.43 | |
| KOG2337 | 669 | consensus Ubiquitin activating E1 enzyme-like prot | 99.39 | |
| KOG2337 | 669 | consensus Ubiquitin activating E1 enzyme-like prot | 99.3 | |
| TIGR03693 | 637 | ocin_ThiF_like putative thiazole-containing bacter | 99.14 | |
| COG4015 | 217 | Predicted dinucleotide-utilizing enzyme of the Thi | 98.28 | |
| PF02134 | 67 | UBACT: Repeat in ubiquitin-activating (UBA) protei | 98.25 | |
| PF08825 | 84 | E2_bind: E2 binding domain; InterPro: IPR014929 E1 | 97.67 | |
| PRK06718 | 202 | precorrin-2 dehydrogenase; Reviewed | 97.46 | |
| TIGR01470 | 205 | cysG_Nterm siroheme synthase, N-terminal domain. T | 97.39 | |
| PF01488 | 135 | Shikimate_DH: Shikimate / quinate 5-dehydrogenase; | 97.23 | |
| TIGR03882 | 193 | cyclo_dehyd_2 bacteriocin biosynthesis cyclodehydr | 97.21 | |
| COG1748 | 389 | LYS9 Saccharopine dehydrogenase and related protei | 97.15 | |
| COG1748 | 389 | LYS9 Saccharopine dehydrogenase and related protei | 97.07 | |
| PRK12549 | 284 | shikimate 5-dehydrogenase; Reviewed | 97.04 | |
| PF13241 | 103 | NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_ | 96.99 | |
| PRK06719 | 157 | precorrin-2 dehydrogenase; Validated | 96.96 | |
| PRK12549 | 284 | shikimate 5-dehydrogenase; Reviewed | 96.94 | |
| COG4015 | 217 | Predicted dinucleotide-utilizing enzyme of the Thi | 96.93 | |
| PRK05562 | 223 | precorrin-2 dehydrogenase; Provisional | 96.84 | |
| PRK06718 | 202 | precorrin-2 dehydrogenase; Reviewed | 96.59 | |
| PF01488 | 135 | Shikimate_DH: Shikimate / quinate 5-dehydrogenase; | 96.58 | |
| PF13241 | 103 | NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_ | 96.16 | |
| TIGR01470 | 205 | cysG_Nterm siroheme synthase, N-terminal domain. T | 96.09 | |
| PRK06719 | 157 | precorrin-2 dehydrogenase; Validated | 95.99 | |
| PRK14027 | 283 | quinate/shikimate dehydrogenase; Provisional | 95.81 | |
| COG1648 | 210 | CysG Siroheme synthase (precorrin-2 oxidase/ferroc | 95.8 | |
| PRK10637 | 457 | cysG siroheme synthase; Provisional | 95.78 | |
| PF03435 | 386 | Saccharop_dh: Saccharopine dehydrogenase ; InterPr | 95.38 | |
| PF00056 | 141 | Ldh_1_N: lactate/malate dehydrogenase, NAD binding | 95.22 | |
| PRK05562 | 223 | precorrin-2 dehydrogenase; Provisional | 95.21 | |
| PRK14106 | 450 | murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn | 94.88 | |
| PRK12548 | 289 | shikimate 5-dehydrogenase; Provisional | 94.86 | |
| TIGR01809 | 282 | Shik-DH-AROM shikimate-5-dehydrogenase, fungal ARO | 94.85 | |
| PRK14027 | 283 | quinate/shikimate dehydrogenase; Provisional | 94.7 | |
| PF03435 | 386 | Saccharop_dh: Saccharopine dehydrogenase ; InterPr | 94.67 | |
| COG0373 | 414 | HemA Glutamyl-tRNA reductase [Coenzyme metabolism] | 94.67 | |
| COG0169 | 283 | AroE Shikimate 5-dehydrogenase [Amino acid transpo | 94.6 | |
| PRK00258 | 278 | aroE shikimate 5-dehydrogenase; Reviewed | 94.54 | |
| PRK12548 | 289 | shikimate 5-dehydrogenase; Provisional | 94.47 | |
| cd05291 | 306 | HicDH_like L-2-hydroxyisocapronate dehydrogenases | 94.33 | |
| TIGR01809 | 282 | Shik-DH-AROM shikimate-5-dehydrogenase, fungal ARO | 94.29 | |
| PRK13940 | 414 | glutamyl-tRNA reductase; Provisional | 94.27 | |
| KOG4169 | 261 | consensus 15-hydroxyprostaglandin dehydrogenase an | 94.2 | |
| PRK12749 | 288 | quinate/shikimate dehydrogenase; Reviewed | 94.11 | |
| PRK07819 | 286 | 3-hydroxybutyryl-CoA dehydrogenase; Validated | 94.07 | |
| PRK04148 | 134 | hypothetical protein; Provisional | 93.99 | |
| COG0373 | 414 | HemA Glutamyl-tRNA reductase [Coenzyme metabolism] | 93.91 | |
| TIGR03882 | 193 | cyclo_dehyd_2 bacteriocin biosynthesis cyclodehydr | 93.88 | |
| PRK00258 | 278 | aroE shikimate 5-dehydrogenase; Reviewed | 93.87 | |
| PF05237 | 84 | MoeZ_MoeB: MoeZ/MoeB domain; InterPro: IPR007901 T | 93.8 | |
| COG0569 | 225 | TrkA K+ transport systems, NAD-binding component [ | 93.79 | |
| PRK14106 | 450 | murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn | 93.77 | |
| PRK13940 | 414 | glutamyl-tRNA reductase; Provisional | 93.58 | |
| PF00070 | 80 | Pyr_redox: Pyridine nucleotide-disulphide oxidored | 93.52 | |
| PF03446 | 163 | NAD_binding_2: NAD binding domain of 6-phosphogluc | 93.51 | |
| COG1648 | 210 | CysG Siroheme synthase (precorrin-2 oxidase/ferroc | 93.43 | |
| cd01065 | 155 | NAD_bind_Shikimate_DH NAD(P) binding domain of Shi | 93.3 | |
| PF14732 | 87 | UAE_UbL: Ubiquitin/SUMO-activating enzyme ubiquiti | 93.29 | |
| PF01113 | 124 | DapB_N: Dihydrodipicolinate reductase, N-terminus; | 93.23 | |
| PRK12749 | 288 | quinate/shikimate dehydrogenase; Reviewed | 93.14 | |
| PF02826 | 178 | 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehy | 93.07 | |
| PRK00066 | 315 | ldh L-lactate dehydrogenase; Reviewed | 93.07 | |
| cd05213 | 311 | NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain | 93.03 | |
| PLN00203 | 519 | glutamyl-tRNA reductase | 92.89 | |
| PRK05808 | 282 | 3-hydroxybutyryl-CoA dehydrogenase; Validated | 92.88 | |
| cd05290 | 307 | LDH_3 A subgroup of L-lactate dehydrogenases. L-la | 92.71 | |
| KOG4169 | 261 | consensus 15-hydroxyprostaglandin dehydrogenase an | 92.71 | |
| TIGR01035 | 417 | hemA glutamyl-tRNA reductase. This enzyme, togethe | 92.59 | |
| PF02254 | 116 | TrkA_N: TrkA-N domain; InterPro: IPR003148 The reg | 92.53 | |
| PRK07066 | 321 | 3-hydroxybutyryl-CoA dehydrogenase; Validated | 92.45 | |
| PF10585 | 45 | UBA_e1_thiolCys: Ubiquitin-activating enzyme activ | 92.36 | |
| PLN02602 | 350 | lactate dehydrogenase | 92.36 | |
| cd05293 | 312 | LDH_1 A subgroup of L-lactate dehydrogenases. L-la | 92.36 | |
| PF01118 | 121 | Semialdhyde_dh: Semialdehyde dehydrogenase, NAD bi | 92.31 | |
| cd00300 | 300 | LDH_like L-lactate dehydrogenase-like enzymes. Mem | 92.26 | |
| COG0169 | 283 | AroE Shikimate 5-dehydrogenase [Amino acid transpo | 92.14 | |
| PRK09260 | 288 | 3-hydroxybutyryl-CoA dehydrogenase; Validated | 91.94 | |
| PRK10637 | 457 | cysG siroheme synthase; Provisional | 91.9 | |
| cd01080 | 168 | NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of | 91.85 | |
| COG0569 | 225 | TrkA K+ transport systems, NAD-binding component [ | 91.81 | |
| cd05291 | 306 | HicDH_like L-2-hydroxyisocapronate dehydrogenases | 91.49 | |
| PRK00141 | 473 | murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn | 91.47 | |
| PRK05708 | 305 | 2-dehydropantoate 2-reductase; Provisional | 91.42 | |
| PLN00203 | 519 | glutamyl-tRNA reductase | 91.37 | |
| cd05311 | 226 | NAD_bind_2_malic_enz NAD(P) binding domain of mali | 91.31 | |
| cd05311 | 226 | NAD_bind_2_malic_enz NAD(P) binding domain of mali | 91.27 | |
| PRK06130 | 311 | 3-hydroxybutyryl-CoA dehydrogenase; Validated | 91.13 | |
| PRK05476 | 425 | S-adenosyl-L-homocysteine hydrolase; Provisional | 90.91 | |
| cd01078 | 194 | NAD_bind_H4MPT_DH NADP binding domain of methylene | 90.79 | |
| PF00056 | 141 | Ldh_1_N: lactate/malate dehydrogenase, NAD binding | 90.7 | |
| cd05213 | 311 | NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain | 90.69 | |
| PRK01438 | 480 | murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn | 90.69 | |
| PRK01710 | 458 | murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn | 90.66 | |
| PRK04148 | 134 | hypothetical protein; Provisional | 90.63 | |
| PRK08293 | 287 | 3-hydroxybutyryl-CoA dehydrogenase; Validated | 90.61 | |
| PTZ00117 | 319 | malate dehydrogenase; Provisional | 90.59 | |
| PRK00066 | 315 | ldh L-lactate dehydrogenase; Reviewed | 90.53 | |
| COG0111 | 324 | SerA Phosphoglycerate dehydrogenase and related de | 90.39 | |
| PRK00045 | 423 | hemA glutamyl-tRNA reductase; Reviewed | 90.39 | |
| cd05290 | 307 | LDH_3 A subgroup of L-lactate dehydrogenases. L-la | 90.37 | |
| PF03807 | 96 | F420_oxidored: NADP oxidoreductase coenzyme F420-d | 90.28 | |
| PF03446 | 163 | NAD_binding_2: NAD binding domain of 6-phosphogluc | 90.27 | |
| PTZ00082 | 321 | L-lactate dehydrogenase; Provisional | 90.06 | |
| PLN02206 | 442 | UDP-glucuronate decarboxylase | 89.92 | |
| PTZ00082 | 321 | L-lactate dehydrogenase; Provisional | 89.91 | |
| PRK06197 | 306 | short chain dehydrogenase; Provisional | 89.77 | |
| PRK07063 | 260 | short chain dehydrogenase; Provisional | 89.71 | |
| PRK09599 | 301 | 6-phosphogluconate dehydrogenase-like protein; Rev | 89.65 | |
| cd01075 | 200 | NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of l | 89.59 | |
| PRK06197 | 306 | short chain dehydrogenase; Provisional | 89.49 | |
| PRK15469 | 312 | ghrA bifunctional glyoxylate/hydroxypyruvate reduc | 89.47 | |
| PRK05854 | 313 | short chain dehydrogenase; Provisional | 89.45 | |
| cd01080 | 168 | NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of | 89.29 | |
| cd05293 | 312 | LDH_1 A subgroup of L-lactate dehydrogenases. L-la | 89.22 | |
| COG1086 | 588 | Predicted nucleoside-diphosphate sugar epimerases | 89.18 | |
| PLN02819 | 1042 | lysine-ketoglutarate reductase/saccharopine dehydr | 89.13 | |
| PRK14192 | 283 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 89.05 | |
| COG0300 | 265 | DltE Short-chain dehydrogenases of various substra | 89.04 | |
| TIGR00872 | 298 | gnd_rel 6-phosphogluconate dehydrogenase (decarbox | 89.0 | |
| PRK08410 | 311 | 2-hydroxyacid dehydrogenase; Provisional | 88.95 | |
| PRK13243 | 333 | glyoxylate reductase; Reviewed | 88.9 | |
| TIGR02992 | 326 | ectoine_eutC ectoine utilization protein EutC. Mem | 88.86 | |
| PRK06130 | 311 | 3-hydroxybutyryl-CoA dehydrogenase; Validated | 88.86 | |
| TIGR01759 | 323 | MalateDH-SF1 malate dehydrogenase. This model repr | 88.82 | |
| PRK05808 | 282 | 3-hydroxybutyryl-CoA dehydrogenase; Validated | 88.65 | |
| PLN02166 | 436 | dTDP-glucose 4,6-dehydratase | 88.65 | |
| cd01078 | 194 | NAD_bind_H4MPT_DH NADP binding domain of methylene | 88.62 | |
| PRK07819 | 286 | 3-hydroxybutyryl-CoA dehydrogenase; Validated | 88.5 | |
| PRK06487 | 317 | glycerate dehydrogenase; Provisional | 88.44 | |
| PF13460 | 183 | NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X | 88.44 | |
| cd05296 | 419 | GH4_P_beta_glucosidase Glycoside Hydrolases Family | 88.4 | |
| TIGR00507 | 270 | aroE shikimate 5-dehydrogenase. This model finds p | 88.34 | |
| PF02737 | 180 | 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD bind | 88.25 | |
| PLN02819 | 1042 | lysine-ketoglutarate reductase/saccharopine dehydr | 88.18 | |
| PRK05476 | 425 | S-adenosyl-L-homocysteine hydrolase; Provisional | 88.15 | |
| PF01118 | 121 | Semialdhyde_dh: Semialdehyde dehydrogenase, NAD bi | 88.14 | |
| PRK02705 | 459 | murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn | 88.13 | |
| PRK07574 | 385 | formate dehydrogenase; Provisional | 88.09 | |
| cd00401 | 413 | AdoHcyase S-adenosyl-L-homocysteine hydrolase (Ado | 88.07 | |
| PRK06932 | 314 | glycerate dehydrogenase; Provisional | 88.05 | |
| COG0039 | 313 | Mdh Malate/lactate dehydrogenases [Energy producti | 87.97 | |
| PTZ00325 | 321 | malate dehydrogenase; Provisional | 87.94 | |
| PF01113 | 124 | DapB_N: Dihydrodipicolinate reductase, N-terminus; | 87.92 | |
| TIGR00507 | 270 | aroE shikimate 5-dehydrogenase. This model finds p | 87.84 | |
| PLN02602 | 350 | lactate dehydrogenase | 87.82 | |
| PRK06141 | 314 | ornithine cyclodeaminase; Validated | 87.74 | |
| PRK07831 | 262 | short chain dehydrogenase; Provisional | 87.72 | |
| PRK09496 | 453 | trkA potassium transporter peripheral membrane com | 87.67 | |
| cd00401 | 413 | AdoHcyase S-adenosyl-L-homocysteine hydrolase (Ado | 87.63 | |
| PRK07062 | 265 | short chain dehydrogenase; Provisional | 87.63 | |
| PRK04308 | 445 | murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn | 87.61 | |
| COG1086 | 588 | Predicted nucleoside-diphosphate sugar epimerases | 87.61 | |
| PRK15438 | 378 | erythronate-4-phosphate dehydrogenase PdxB; Provis | 87.56 | |
| PRK07634 | 245 | pyrroline-5-carboxylate reductase; Reviewed | 87.51 | |
| PF01210 | 157 | NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate | 87.42 | |
| COG0771 | 448 | MurD UDP-N-acetylmuramoylalanine-D-glutamate ligas | 87.41 | |
| PRK09242 | 257 | tropinone reductase; Provisional | 87.35 | |
| PRK08618 | 325 | ornithine cyclodeaminase; Validated | 87.35 | |
| PRK07530 | 292 | 3-hydroxybutyryl-CoA dehydrogenase; Validated | 87.33 | |
| TIGR00936 | 406 | ahcY adenosylhomocysteinase. This enzyme hydrolyze | 87.31 | |
| PRK06436 | 303 | glycerate dehydrogenase; Provisional | 87.3 | |
| PRK11880 | 267 | pyrroline-5-carboxylate reductase; Reviewed | 87.18 | |
| cd05191 | 86 | NAD_bind_amino_acid_DH NAD(P) binding domain of am | 87.15 | |
| PRK00048 | 257 | dihydrodipicolinate reductase; Provisional | 87.08 | |
| PRK07066 | 321 | 3-hydroxybutyryl-CoA dehydrogenase; Validated | 86.96 | |
| PLN03139 | 386 | formate dehydrogenase; Provisional | 86.95 | |
| PRK14619 | 308 | NAD(P)H-dependent glycerol-3-phosphate dehydrogena | 86.93 | |
| TIGR01757 | 387 | Malate-DH_plant malate dehydrogenase, NADP-depende | 86.9 | |
| PRK08251 | 248 | short chain dehydrogenase; Provisional | 86.8 | |
| cd05191 | 86 | NAD_bind_amino_acid_DH NAD(P) binding domain of am | 86.77 | |
| PRK12490 | 299 | 6-phosphogluconate dehydrogenase-like protein; Rev | 86.74 | |
| PF02254 | 116 | TrkA_N: TrkA-N domain; InterPro: IPR003148 The reg | 86.71 | |
| PF03807 | 96 | F420_oxidored: NADP oxidoreductase coenzyme F420-d | 86.6 | |
| cd00300 | 300 | LDH_like L-lactate dehydrogenase-like enzymes. Mem | 86.53 | |
| PRK00257 | 381 | erythronate-4-phosphate dehydrogenase; Validated | 86.47 | |
| PLN02427 | 386 | UDP-apiose/xylose synthase | 86.4 | |
| PLN03209 | 576 | translocon at the inner envelope of chloroplast su | 86.39 | |
| PRK07340 | 304 | ornithine cyclodeaminase; Validated | 86.39 | |
| PRK09496 | 453 | trkA potassium transporter peripheral membrane com | 86.22 | |
| PF00070 | 80 | Pyr_redox: Pyridine nucleotide-disulphide oxidored | 86.21 | |
| PLN02545 | 295 | 3-hydroxybutyryl-CoA dehydrogenase | 86.2 | |
| cd01075 | 200 | NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of l | 86.07 | |
| PRK03562 | 621 | glutathione-regulated potassium-efflux system prot | 86.07 | |
| PRK08618 | 325 | ornithine cyclodeaminase; Validated | 85.99 | |
| cd01065 | 155 | NAD_bind_Shikimate_DH NAD(P) binding domain of Shi | 85.91 | |
| cd01338 | 322 | MDH_choloroplast_like Chloroplast-like malate dehy | 85.76 | |
| PRK07502 | 307 | cyclohexadienyl dehydrogenase; Validated | 85.76 | |
| TIGR01915 | 219 | npdG NADPH-dependent F420 reductase. This model re | 85.71 | |
| PF01210 | 157 | NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate | 85.68 | |
| PRK09242 | 257 | tropinone reductase; Provisional | 85.63 | |
| PRK02472 | 447 | murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn | 85.57 | |
| TIGR00518 | 370 | alaDH alanine dehydrogenase. The family of known L | 85.56 | |
| PRK11908 | 347 | NAD-dependent epimerase/dehydratase family protein | 85.51 | |
| PRK04663 | 438 | murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn | 85.49 | |
| cd05292 | 308 | LDH_2 A subgroup of L-lactate dehydrogenases. L-la | 85.48 | |
| PRK06035 | 291 | 3-hydroxyacyl-CoA dehydrogenase; Validated | 85.45 | |
| TIGR00465 | 314 | ilvC ketol-acid reductoisomerase. This is the seco | 85.32 | |
| PRK06522 | 304 | 2-dehydropantoate 2-reductase; Reviewed | 85.3 | |
| PRK04690 | 468 | murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn | 85.28 | |
| PRK08293 | 287 | 3-hydroxybutyryl-CoA dehydrogenase; Validated | 85.22 | |
| PLN02350 | 493 | phosphogluconate dehydrogenase (decarboxylating) | 85.18 | |
| PRK06223 | 307 | malate dehydrogenase; Reviewed | 85.13 | |
| PRK02006 | 498 | murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn | 85.07 | |
| PF10727 | 127 | Rossmann-like: Rossmann-like domain; InterPro: IPR | 85.06 | |
| PF02826 | 178 | 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehy | 85.03 | |
| PRK03659 | 601 | glutathione-regulated potassium-efflux system prot | 85.02 | |
| PLN00016 | 378 | RNA-binding protein; Provisional | 85.0 | |
| PRK12826 | 251 | 3-ketoacyl-(acyl-carrier-protein) reductase; Revie | 84.97 | |
| PRK05854 | 313 | short chain dehydrogenase; Provisional | 84.94 | |
| PF02558 | 151 | ApbA: Ketopantoate reductase PanE/ApbA; InterPro: | 84.85 | |
| PRK07576 | 264 | short chain dehydrogenase; Provisional | 84.82 | |
| PRK07531 | 495 | bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioe | 84.68 | |
| PRK06249 | 313 | 2-dehydropantoate 2-reductase; Provisional | 84.64 | |
| PRK05867 | 253 | short chain dehydrogenase; Provisional | 84.6 | |
| PF00106 | 167 | adh_short: short chain dehydrogenase alcohol dehyd | 84.52 | |
| PRK14175 | 286 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 84.52 | |
| PRK05708 | 305 | 2-dehydropantoate 2-reductase; Provisional | 84.5 | |
| PF10727 | 127 | Rossmann-like: Rossmann-like domain; InterPro: IPR | 84.36 | |
| PRK03369 | 488 | murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn | 84.35 | |
| PRK11880 | 267 | pyrroline-5-carboxylate reductase; Reviewed | 84.27 | |
| PRK03803 | 448 | murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn | 84.26 | |
| PLN02206 | 442 | UDP-glucuronate decarboxylase | 84.25 | |
| PTZ00142 | 470 | 6-phosphogluconate dehydrogenase; Provisional | 84.24 | |
| COG1893 | 307 | ApbA Ketopantoate reductase [Coenzyme metabolism] | 84.21 | |
| PRK08217 | 253 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; | 84.19 | |
| PRK10537 | 393 | voltage-gated potassium channel; Provisional | 84.18 | |
| PRK07063 | 260 | short chain dehydrogenase; Provisional | 84.12 | |
| PF02719 | 293 | Polysacc_synt_2: Polysaccharide biosynthesis prote | 84.09 | |
| PLN02240 | 352 | UDP-glucose 4-epimerase | 84.09 | |
| PLN02780 | 320 | ketoreductase/ oxidoreductase | 84.04 | |
| TIGR01771 | 299 | L-LDH-NAD L-lactate dehydrogenase. This model repr | 83.95 | |
| PRK00094 | 325 | gpsA NAD(P)H-dependent glycerol-3-phosphate dehydr | 83.9 | |
| PRK07523 | 255 | gluconate 5-dehydrogenase; Provisional | 83.86 | |
| PRK07680 | 273 | late competence protein ComER; Validated | 83.76 | |
| cd01337 | 310 | MDH_glyoxysomal_mitochondrial Glyoxysomal and mito | 83.76 | |
| PRK15469 | 312 | ghrA bifunctional glyoxylate/hydroxypyruvate reduc | 83.72 | |
| PRK12921 | 305 | 2-dehydropantoate 2-reductase; Provisional | 83.52 | |
| PRK09186 | 256 | flagellin modification protein A; Provisional | 83.5 | |
| PRK03562 | 621 | glutathione-regulated potassium-efflux system prot | 83.48 | |
| PRK07062 | 265 | short chain dehydrogenase; Provisional | 83.48 | |
| TIGR00872 | 298 | gnd_rel 6-phosphogluconate dehydrogenase (decarbox | 83.44 | |
| cd01339 | 300 | LDH-like_MDH L-lactate dehydrogenase-like malate d | 83.44 | |
| PRK14619 | 308 | NAD(P)H-dependent glycerol-3-phosphate dehydrogena | 83.43 | |
| PF02737 | 180 | 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD bind | 83.41 | |
| PRK08291 | 330 | ectoine utilization protein EutC; Validated | 83.41 | |
| PRK07478 | 254 | short chain dehydrogenase; Provisional | 83.32 | |
| PRK05442 | 326 | malate dehydrogenase; Provisional | 83.32 | |
| PRK11790 | 409 | D-3-phosphoglycerate dehydrogenase; Provisional | 83.32 | |
| cd00650 | 263 | LDH_MDH_like NAD-dependent, lactate dehydrogenase- | 83.29 | |
| COG1063 | 350 | Tdh Threonine dehydrogenase and related Zn-depende | 83.17 | |
| PTZ00431 | 260 | pyrroline carboxylate reductase; Provisional | 83.15 | |
| PF00106 | 167 | adh_short: short chain dehydrogenase alcohol dehyd | 83.14 | |
| KOG0069 | 336 | consensus Glyoxylate/hydroxypyruvate reductase (D- | 83.12 | |
| PRK09599 | 301 | 6-phosphogluconate dehydrogenase-like protein; Rev | 83.08 | |
| PRK06223 | 307 | malate dehydrogenase; Reviewed | 83.08 | |
| TIGR00873 | 467 | gnd 6-phosphogluconate dehydrogenase, decarboxylat | 83.05 | |
| PRK09260 | 288 | 3-hydroxybutyryl-CoA dehydrogenase; Validated | 82.98 | |
| PRK07679 | 279 | pyrroline-5-carboxylate reductase; Reviewed | 82.95 | |
| PRK05479 | 330 | ketol-acid reductoisomerase; Provisional | 82.91 | |
| PLN03209 | 576 | translocon at the inner envelope of chloroplast su | 82.9 | |
| PRK07531 | 495 | bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioe | 82.83 | |
| PTZ00431 | 260 | pyrroline carboxylate reductase; Provisional | 82.76 | |
| PRK07417 | 279 | arogenate dehydrogenase; Reviewed | 82.76 | |
| PLN02253 | 280 | xanthoxin dehydrogenase | 82.74 | |
| PF04321 | 286 | RmlD_sub_bind: RmlD substrate binding domain; Inte | 82.74 | |
| PRK11908 | 347 | NAD-dependent epimerase/dehydratase family protein | 82.74 | |
| PLN02306 | 386 | hydroxypyruvate reductase | 82.69 | |
| cd05197 | 425 | GH4_glycoside_hydrolases Glycoside Hydrases Family | 82.63 | |
| KOG0024 | 354 | consensus Sorbitol dehydrogenase [Secondary metabo | 82.59 | |
| PRK05335 | 436 | tRNA (uracil-5-)-methyltransferase Gid; Reviewed | 82.52 | |
| PRK08339 | 263 | short chain dehydrogenase; Provisional | 82.42 | |
| PRK06928 | 277 | pyrroline-5-carboxylate reductase; Reviewed | 82.25 | |
| PRK12384 | 259 | sorbitol-6-phosphate dehydrogenase; Provisional | 82.17 | |
| PRK06523 | 260 | short chain dehydrogenase; Provisional | 82.03 | |
| TIGR01035 | 417 | hemA glutamyl-tRNA reductase. This enzyme, togethe | 82.01 | |
| PRK00048 | 257 | dihydrodipicolinate reductase; Provisional | 81.86 | |
| PRK07831 | 262 | short chain dehydrogenase; Provisional | 81.82 | |
| KOG0069 | 336 | consensus Glyoxylate/hydroxypyruvate reductase (D- | 81.61 | |
| PRK06476 | 258 | pyrroline-5-carboxylate reductase; Reviewed | 81.61 | |
| PRK07576 | 264 | short chain dehydrogenase; Provisional | 81.59 | |
| PRK00421 | 461 | murC UDP-N-acetylmuramate--L-alanine ligase; Provi | 81.52 | |
| COG1063 | 350 | Tdh Threonine dehydrogenase and related Zn-depende | 81.48 | |
| TIGR01772 | 312 | MDH_euk_gproteo malate dehydrogenase, NAD-dependen | 81.48 | |
| PTZ00117 | 319 | malate dehydrogenase; Provisional | 81.47 | |
| cd00704 | 323 | MDH Malate dehydrogenase. Malate dehydrogenase (MD | 81.47 | |
| cd01076 | 227 | NAD_bind_1_Glu_DH NAD(P) binding domain of glutama | 81.42 | |
| PRK14620 | 326 | NAD(P)H-dependent glycerol-3-phosphate dehydrogena | 81.41 | |
| cd05211 | 217 | NAD_bind_Glu_Leu_Phe_Val NAD(P) binding domain of | 81.41 | |
| PRK15409 | 323 | bifunctional glyoxylate/hydroxypyruvate reductase | 81.33 | |
| PRK13403 | 335 | ketol-acid reductoisomerase; Provisional | 81.18 | |
| PF02558 | 151 | ApbA: Ketopantoate reductase PanE/ApbA; InterPro: | 81.13 | |
| PRK07792 | 306 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; | 81.01 | |
| PLN00106 | 323 | malate dehydrogenase | 81.0 | |
| COG1250 | 307 | FadB 3-hydroxyacyl-CoA dehydrogenase [Lipid metabo | 80.96 | |
| TIGR00065 | 349 | ftsZ cell division protein FtsZ. This family consi | 80.95 | |
| TIGR03589 | 324 | PseB UDP-N-acetylglucosamine 4,6-dehydratase. This | 80.8 | |
| PRK14618 | 328 | NAD(P)H-dependent glycerol-3-phosphate dehydrogena | 80.8 | |
| cd05211 | 217 | NAD_bind_Glu_Leu_Phe_Val NAD(P) binding domain of | 80.7 | |
| TIGR01763 | 305 | MalateDH_bact malate dehydrogenase, NAD-dependent. | 80.65 | |
| PRK07231 | 251 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; | 80.58 | |
| TIGR00936 | 406 | ahcY adenosylhomocysteinase. This enzyme hydrolyze | 80.52 | |
| COG1091 | 281 | RfbD dTDP-4-dehydrorhamnose reductase [Cell envelo | 80.52 | |
| TIGR02992 | 326 | ectoine_eutC ectoine utilization protein EutC. Mem | 80.51 | |
| PRK12939 | 250 | short chain dehydrogenase; Provisional | 80.45 | |
| PRK03806 | 438 | murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn | 80.35 | |
| cd05298 | 437 | GH4_GlvA_pagL_like Glycoside Hydrolases Family 4; | 80.33 | |
| PRK15181 | 348 | Vi polysaccharide biosynthesis protein TviC; Provi | 80.3 | |
| PRK06522 | 304 | 2-dehydropantoate 2-reductase; Reviewed | 80.19 | |
| PLN02427 | 386 | UDP-apiose/xylose synthase | 80.16 | |
| PRK06125 | 259 | short chain dehydrogenase; Provisional | 80.15 | |
| PRK14982 | 340 | acyl-ACP reductase; Provisional | 80.11 | |
| COG1893 | 307 | ApbA Ketopantoate reductase [Coenzyme metabolism] | 80.11 | |
| PRK12550 | 272 | shikimate 5-dehydrogenase; Reviewed | 80.09 | |
| PLN03129 | 581 | NADP-dependent malic enzyme; Provisional | 80.09 |
| >KOG2012 consensus Ubiquitin activating enzyme UBA1 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
Probab=100.00 E-value=4.3e-264 Score=2256.39 Aligned_cols=1005 Identities=58% Similarity=0.999 Sum_probs=974.9
Q ss_pred cCCCCCCCCchhHHHHhhhhhccCHHHHHHhhcCeEEEEcCChhhHHHHHHHHHhCCceEEEEeCCccCcccCccccccC
Q 001301 87 MGLGNGNPSDIDEDLHSRQLAVYGRETMRRLFASNILISGMQGLGAEIAKNLILAGVKSVTLHDEGVVELWDLSSNFIFS 166 (1104)
Q Consensus 87 ~~~~~~~~~~~d~~~Y~RQi~l~G~e~q~kL~~s~VlIiG~gglGseiaKnLvlaGVg~itLvD~d~V~~sdL~rqf~~~ 166 (1104)
|..++++..++|+++||||+|++|.++|+||..++|||+||+|||.||||||+|+||+++||+|...+.++||++|||++
T Consensus 5 ~~~~~~a~~~IDE~LYSRQLYVlG~eAM~~m~~S~VLisGl~GLGvEIAKNliLaGVksvTlhD~~~~~~~DLssqf~L~ 84 (1013)
T KOG2012|consen 5 MMDGNSASQEIDESLYSRQLYVLGHEAMRRMQGSNVLISGLQGLGVEIAKNLILAGVKSVTLHDPRPVQLSDLSSQFYLS 84 (1013)
T ss_pred ccccCcchhhhhhhhhhhhhhhccHHHHHHHhhCcEEEecCCcccHHHHhhHhhhccceEEeeCCCcccHHhhccceeee
Confidence 44455567899999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred cCcccchHHHHHHHHHHHhCCCcEEEEeecccchhhhcCCceEEEecCCHhHhhhHHHHHHHcCCCcceEEeeecceeEE
Q 001301 167 EDDVGKNRALASIQKLQELNNAVAISALTTELTKEKLSDFQAVVFTDISLEKAVEFDDYCHNHQPPIAFIKSEVRGLFGN 246 (1104)
Q Consensus 167 ~~diGk~Kaea~~~~L~eLNp~V~V~~~~~~l~~e~l~~~dvVV~~~~~~~~~~~ln~~c~~~~~~ipfI~~~~~G~~G~ 246 (1104)
++|||+|||+++.++|++||++|.|.++++.++++++++|+|||+|+.+.+.+.+||++||++| |.||.+.++|++|+
T Consensus 85 E~DigknRA~as~~~LaeLN~yV~V~v~t~~~~~e~L~~FqvVVlt~~~le~q~~i~~fch~~~--i~fi~ad~RGLfg~ 162 (1013)
T KOG2012|consen 85 EEDIGKNRAEASVEKLAELNNYVPVVVLTGPLTEEFLSDFQVVVLTDASLEEQLKINDFCHSHG--IAFIAADTRGLFGQ 162 (1013)
T ss_pred HHhcCCchHHHHHHHHHHhhcceeeEEecCcccHHHHhCCcEEEEecCchHHHHHHHHHHHhcC--eEEEEeccchhhhh
Confidence 9999999999999999999999999999999999999999999999999999999999999999 99999999999999
Q ss_pred EEeecCCceEEecCCCCCCccceeccccCCCCCceeecccccccccCCCeEEEeEeecccccCCCCCeeeeccCCccccc
Q 001301 247 IFCDFGPEFTVFDVDGEEPHTGIIASISNDNPPLISCVDDERIEFQDGDLVVFSEVHGMTELNDGKPRKVKNARPYSFSI 326 (1104)
Q Consensus 247 vf~d~g~~f~v~d~~ge~p~~~~i~~i~~~~~~lv~~~~~~~h~~~dgd~v~f~ev~gm~~ln~~~~~~i~~~~~~~~~i 326 (1104)
+|||||++|+|.|++|++|.+++|.+|++++|++|+|+++.||+|+|||+|+|+||+||+++|+|+|++|++++||+|+|
T Consensus 163 lFCDFG~eF~v~D~tGeeP~t~mI~~Is~d~pGvvT~ld~~rH~lEdGd~V~FsEveGm~eLN~~~P~kI~v~~p~sf~I 242 (1013)
T KOG2012|consen 163 LFCDFGEEFTVLDPTGEEPLTGMIASISQDNPGVVTCLDGARHGFEDGDLVTFSEVEGMTELNDCKPRKITVLGPYSFSI 242 (1013)
T ss_pred hhccCCCceEEeCCCCCcchhhHHhhccCCCCceEEEecCccccCccCCEEEEEeeccccccCCCCceEEEEecCceEEe
Confidence 99999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred ccCcccccccccCCeEEEeecCeeecccchhhhhcCCCCccccccccCCCcchHHHHHHHHHHHHHHhCCCCCCCCHHHH
Q 001301 327 DEDTTNYSAYEKGGIVTQVKQPKIINFKPLREALKDPGDFLLSDFSKFDRPPVLHLAFQALDKFIQELGRFPVAGSEEDA 406 (1104)
Q Consensus 327 ~~dt~~f~~y~~gg~~~qvk~p~~~~f~sL~e~L~~p~~~~~~d~~k~~r~~~l~~~~~al~~F~~~~gr~P~~~~~~Da 406 (1104)
+||+.|+.|.+||+++|||+|++++|+||+++|.+| +++.+|++|++|+++||++|+||++|.+.|||+|.+++++|+
T Consensus 243 -gdt~~f~~y~~GGi~tQVK~Pk~isfKsL~~~L~~P-~fl~~df~k~~rp~~lH~af~AL~~F~~~~Gr~P~p~~e~DA 320 (1013)
T KOG2012|consen 243 -GDTTEFGEYKKGGIFTQVKVPKTISFKSLREALKEP-EFLISDFAKFDRPPQLHLAFQALHQFQEAHGRLPRPGNEEDA 320 (1013)
T ss_pred -ccccchhhhhcCceeEEeecCceEecccHHHhhcCC-CeeeeccccccccHHHHHHHHHHHHHHHHhCCCCCCCChhhH
Confidence 579999999999999999999999999999999999 899999999999999999999999999999999999999999
Q ss_pred HHHHHHHHHHHhhcCCccccccCHHHHHHHHhhccCccCchhhhhcchhhHHHHHhhccCcccccceeeccCCCCCCCC-
Q 001301 407 QKIISLFTNINDNLADERVEEIDHKLLCHFAFGARAVLNPMAAMFGGIVGQEVVKACSGKFHPLLQFFYFDSVESLPSE- 485 (1104)
Q Consensus 407 ~~l~~ia~~i~~~~~~~~~~~i~~~li~~~~~~~~~el~PvaA~iGGiaAQEVIKaiTgKf~PI~q~l~fD~~e~lp~~- 485 (1104)
++|+.++..+.+..+ ...++++++|++|++.+++.|.||+|++||+|||||+|+|||||+||.||||||++|+||++
T Consensus 321 ~~l~~l~~~i~~~~~--~~~~vde~Lir~~s~~a~g~L~pm~A~~GG~vaQEvlKa~sgKF~PL~Q~lYfDale~LP~d~ 398 (1013)
T KOG2012|consen 321 EELVELARDISEGLG--LEEDVDEKLIRHFSFSARGDLNPMVAFFGGIVAQEVLKACSGKFTPLKQWLYFDALESLPSDN 398 (1013)
T ss_pred HHHHHHHHHhhhhcc--ccccchHHHHHHHHHhhccCcchHHHHHhhhhHHHHHHhhccCccchhHheehhhHhhCCCcC
Confidence 999999999988655 24689999999999999999999999999999999999999999999999999999999975
Q ss_pred -CCCCCCCCCccCcchhhhhccCHHHHHHHhcCcEEEEcCCcchHHHHHHHHhcccccCCCcceEEecCCcccccCcccc
Q 001301 486 -PLDPRDLQPLNSRYDAQISVFGSKLQKKLEEAKVFVVGSGALGCEFLKNLALMGVSCGNQGKLTITDDDVIEKSNLSRQ 564 (1104)
Q Consensus 486 -~~~~~~~~~~~~RYdrqi~l~G~~~q~kL~~~~VlvvG~GgiG~evlknLa~~Gv~~~~~g~i~iiD~D~Ie~sNLnRQ 564 (1104)
++++++++|.++|||.||++||...|+||.+.++|+|||||||||++||||+|||+||..|+|+|+|||.||.||||||
T Consensus 399 ~~~~e~d~~prgsRYD~qiavfG~~fqeKL~~~~~FlVGaGAIGCE~LKN~am~Gvg~g~~g~ItVTDmD~IEkSNLnRQ 478 (1013)
T KOG2012|consen 399 LPPSEEDCQPRGSRYDGQIAVFGAKFQEKLADQKVFLVGAGAIGCELLKNFALMGVGCGNSGKITVTDMDHIEKSNLNRQ 478 (1013)
T ss_pred CCCCHHHcccccCccccchhhhchHHHHHHhhCcEEEEccchhhHHHHHhhhheeeccCCCCceEEeccchhhhccccce
Confidence 7788999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred cCcccCccccchHHHHHHHHHHhCCCcEEeeecccCCccccccchhhhhccCCEEEEccCCHHHHHHHhhcccccccceE
Q 001301 565 FLFRDWNIGQAKSTVAASAAALINPHLNTEALQIRANPETENVFNDTFWENLNVVVNALDNVNARLYIDQRCLYFQKPLL 644 (1104)
Q Consensus 565 fLf~~~diG~~Ka~vaa~~l~~~np~~~i~~~~~~v~~~~~~~~~~~f~~~~DvVi~alDn~~aR~~i~~~c~~~~~pli 644 (1104)
||||.+|||++||++||++++.|||+++|+++..+++++||+||+++||++.|+|++||||+.||+||+++|+.+.+||+
T Consensus 479 FLFR~~dVgk~KSe~AA~A~~~mNp~l~I~a~~~rvgpeTE~If~D~Ff~~ld~VanALDNVdAR~YvD~RCv~~~kPLL 558 (1013)
T KOG2012|consen 479 FLFRPWDVGKPKSEVAAAAARGMNPDLNIIALQNRVGPETEHIFNDEFFENLDGVANALDNVDARRYVDRRCVYYRKPLL 558 (1013)
T ss_pred eeccccccCchHHHHHHHHHHhcCCCceeeehhhccCcccccccchhHHhhhHHHHHhhcchhhhhhhhhhhhhhccchh
Confidence 99999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred ecccCCcccceEEEeCCcccccCcCCCCCCCCCCcccccCCCCChhhHHHHHHHHhhhhhccChhhHhhhcCCcHHHHHH
Q 001301 645 ESGTLGAKCNTQMVIPHLTENYGASRDPPEKQAPMCTVHSFPHNIDHCLTWARSEFEGLLEKTPAEVNAYLTSPTEYASA 724 (1104)
Q Consensus 645 ~~g~~G~~G~v~v~ip~~t~~y~~~~~p~~~~~p~Ct~~~fP~~~~hci~wAr~~F~~~f~~~~~~~~~~l~~~~~~~~~ 724 (1104)
++||+|++|++|+++|++||+|++++||||+++|+||+++||+.|+|||+|||+.||++|.+.++++|.||++|..+...
T Consensus 559 ESGTlGTKGntQVvvPhlTEsY~SS~DPPEksiP~CTlknFPn~IeHTiqWAR~eFEg~F~~~~e~vN~yls~p~f~e~s 638 (1013)
T KOG2012|consen 559 ESGTLGTKGNTQVVVPHLTESYGSSRDPPEKSIPVCTLKSFPNAIEHTIQWARDEFEGLFKQSAENVNKYLSDPVFYETS 638 (1013)
T ss_pred hccCcCCccceeEEeccccccccccCCCcccCCceeeeccCchHHHHHHHHHHHHHHHHhhCCHHHHHHHhcCchHHHHH
Confidence 99999999999999999999999999999999999999999999999999999999999999999999999999977778
Q ss_pred hhhcCchhHHHhHHHHHHHhhhhcccchHHHHHHHHHHHHHHHHHHHHHhhhcCCCCccCCCCCCcccCCCCCCCccccc
Q 001301 725 MKNAGDAQARDNLDRVLECLDKERCETFQDCITWARLRFEDYFADRVKQLTFTFPENATTSNGTPFWSAPKRFPRPLQFS 804 (1104)
Q Consensus 725 ~~~~~~~~~~~~l~~~~~~l~~~~~~~~~~ci~~a~~~f~~~F~~~i~~Ll~~~p~d~~~~~g~~fws~~kr~P~pl~fd 804 (1104)
++..++.+..+.|+.|.+.|. .+|.+|+||++|||..|+++|+++|+|||++||+|++|++|+||||||||||+|++||
T Consensus 639 l~~~~~~~~~~~l~~v~~~l~-~rp~~~~dCv~warl~f~~~f~~~ikqLl~~FP~d~~t~~G~pFWs~pKr~P~pl~Fd 717 (1013)
T KOG2012|consen 639 LKLIGEPQSLETLERVVDCLS-ERPQNWQDCVEWARLHFEKYFHNRIKQLLHNFPPDAKTSDGAPFWSGPKRCPRPLEFD 717 (1013)
T ss_pred HhhccCcchhHHHHHHHHHhh-cCCccHHHHHHHHHHHHHHHhhHHHHHhhcCCCcccccCCCCcCCCCCCCCCCceeec
Confidence 888888999999999999998 9999999999999999999999999999999999999999999999999999999999
Q ss_pred CCcchhHHHHHHHHHHHHHHcCCCCCCCCCChhHHHHhhhhccCCCCCCCCCccccccccccccCCCCcChHHHHHHHHH
Q 001301 805 VDDLSHLQFLMAASILRAETYGIPIPDWVKSPVKLADAVNKVIVPDFQPKENVKIETDEKATSMSTGSIDDAVVINELLQ 884 (1104)
Q Consensus 805 ~~~~~h~~fv~~~a~l~a~~~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~~~~~~~~~~~~~~~~~~~~l~~ 884 (1104)
.+|++|+.||++||+|||++|||+.. .+...++.++..+++|+|+|+++++|.+++.+...++.+.|+...+++|..
T Consensus 718 ~n~~~hl~fv~Aaa~l~a~~~gi~~~---~d~~~~~~~~~~v~~p~f~P~~~~~i~~~~~~~~~~~~s~d~~~~i~~l~~ 794 (1013)
T KOG2012|consen 718 VNDPLHLNFVQAAANLRAEVYGIPGS---QDREALAELLERVIVPEFEPKQKVKIVVEEAELAASSASVDDSAAIDQLNK 794 (1013)
T ss_pred CCCchhHHHHHHHHHHHHHhcCCCcc---cCHHHhhhhHhhcCCCccccccCCeecccccccccccccCCchHHHHHHhh
Confidence 99999999999999999999999984 456689999999999999999999999998887777778888889999999
Q ss_pred HHHHhhhcCCCCCCCCCceecccCCCCchhHHHHHHhhhhhhhcCCCCccHHHHHHHhccccchhhhhhhHHHHHHHHHH
Q 001301 885 KLEKCQKQLPTGYKMNPIQFEKDDDTNFHMDLIAGLANMRARNYGIPEVDKLKAKFIAGRIIPAIATSTAMATGLVCLEL 964 (1104)
Q Consensus 885 ~l~~~~~~~~~~~~~~p~~FeKDDd~n~hidFI~AasNLRA~ny~I~~~d~~~~K~iAG~IIPAIATTtA~VaGl~~lEl 964 (1104)
.+..+.. ..++++.|++||||||+|+|||||+|||||||.||+||++||+++|+||||||||||||||+|+||+||||
T Consensus 795 ~l~~~~~--~~~~~~~p~~FEKDDDsN~H~dfi~aasnlRA~nY~I~~adr~k~K~IaGkIIPAIATtTa~v~Glv~LEl 872 (1013)
T KOG2012|consen 795 ALPSPSV--LPSFKMKPLDFEKDDDSNFHMDFITAASNLRAQNYSIPPADRLKTKRIAGKIIPAIATTTAAVSGLVCLEL 872 (1013)
T ss_pred ccccccc--CCCCceeeeeeccccccccchHHHHHHhhhhhhccCCCccchhhhheeeeeEEEEEeehhHHHHHHHHhhh
Confidence 8887765 45589999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred HHHhcCCCCcccccccccccccCcccccCCCCCCccc-cCCcceeEEeEEEeCCCCcHHHHHHHHHHc-CCceeeeecCC
Q 001301 965 YKVLDGGHKLEDYRNTFANLALPLFSMAEPVPPKVFK-HQDMSWTVWDRWILRDNPTLRQLLQWLQDK-GLNAYSISYGS 1042 (1104)
Q Consensus 965 ~K~l~~~~~~~~~rn~f~nla~p~~~~~eP~~~~~~~-~~~~~~t~wd~~~v~~~~TL~~li~~~~~~-~l~~~~i~~g~ 1042 (1104)
||++.|+.+++.|||+|+|||+|+|.++||.|+++.. +.+.+||+||||++.|++||++||++++++ |++++||++|+
T Consensus 873 yKv~~G~~~~e~~Kn~flnLAlp~f~~~ep~~~pk~~~~~~~~~tlWdR~~v~g~~tL~~~L~~~~~~~gl~i~mls~G~ 952 (1013)
T KOG2012|consen 873 YKVVDGKRPVEAYKNTFLNLALPFFSFAEPLAAPKVQYHNDLSWTLWDRWEVKGEPTLREFLDHLEEQHGLEITMLSQGV 952 (1013)
T ss_pred hhhccCCCchHHhhhhhhcccccceeecccCCCcceeeecccceeeeEEEEecCCCCHHHHHHHHhhhcCceEEEEeccc
Confidence 9999998899999999999999999999999977766 456699999999999999999999999988 99999999999
Q ss_pred ceeeccCCcchhhcccCcHHHHHHhhhcCCCCCCeeEEEEEEEeecCCCCccccCeEEEEe
Q 001301 1043 CLLFNSMFPRHKERMDKKVVDLVRDVAKAELPPYRQHFDVVVACVDEDDNDIDIPQISIYF 1103 (1104)
Q Consensus 1043 ~~LY~~~~~~~~~~l~~~l~~l~~~v~~~~~~~~~~~~~l~~~~~d~~~~~~~~P~v~~~~ 1103 (1104)
+|||++||+++++||+++++||++.++++++|+++++|+|+++|+|++|+|+++|+|||+|
T Consensus 953 ~lly~~~~~k~~erl~~~v~elv~~~~k~~~~~~~~~lvle~~~~d~~~eDve~P~v~y~f 1013 (1013)
T KOG2012|consen 953 SLLYASFMPKHAERLPLRVTELVRDVTKKKLPPHVRHLVLEVACEDDDDEDVEVPPVRYYF 1013 (1013)
T ss_pred eeehhhhhhHHHHhcCCcHHHHHHHHhcccCCCcceEEEEEEecCCCCCCcCCCCceEEeC
Confidence 9999999999999999999999999999999999999999999999999999999999986
|
|
| >TIGR01408 Ube1 ubiquitin-activating enzyme E1 | Back alignment and domain information |
|---|
| >cd01490 Ube1_repeat2 Ubiquitin activating enzyme (E1), repeat 2 | Back alignment and domain information |
|---|
| >KOG2013 consensus SMT3/SUMO-activating complex, catalytic component UBA2 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd01489 Uba2_SUMO Ubiquitin activating enzyme (E1) subunit UBA2 | Back alignment and domain information |
|---|
| >cd01491 Ube1_repeat1 Ubiquitin activating enzyme (E1), repeat 1 | Back alignment and domain information |
|---|
| >cd01484 E1-2_like Ubiquitin activating enzyme (E1), repeat 2-like | Back alignment and domain information |
|---|
| >KOG2015 consensus NEDD8-activating complex, catalytic component UBA3 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd01488 Uba3_RUB Ubiquitin activating enzyme (E1) subunit UBA3 | Back alignment and domain information |
|---|
| >cd01493 APPBP1_RUB Ubiquitin activating enzyme (E1) subunit APPBP1 | Back alignment and domain information |
|---|
| >KOG2014 consensus SMT3/SUMO-activating complex, AOS1/RAD31 component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG2016 consensus NEDD8-activating complex, APP-BP1/UBA5 component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd01492 Aos1_SUMO Ubiquitin activating enzyme (E1) subunit Aos1 | Back alignment and domain information |
|---|
| >cd01485 E1-1_like Ubiquitin activating enzyme (E1), repeat 1-like | Back alignment and domain information |
|---|
| >PRK08223 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >TIGR02356 adenyl_thiF thiazole biosynthesis adenylyltransferase ThiF, E | Back alignment and domain information |
|---|
| >cd00757 ThiF_MoeB_HesA_family ThiF_MoeB_HesA | Back alignment and domain information |
|---|
| >PRK05690 molybdopterin biosynthesis protein MoeB; Provisional | Back alignment and domain information |
|---|
| >PRK07411 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK08328 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK05597 molybdopterin biosynthesis protein MoeB; Validated | Back alignment and domain information |
|---|
| >TIGR02355 moeB molybdopterin synthase sulfurylase MoeB | Back alignment and domain information |
|---|
| >cd01492 Aos1_SUMO Ubiquitin activating enzyme (E1) subunit Aos1 | Back alignment and domain information |
|---|
| >cd01493 APPBP1_RUB Ubiquitin activating enzyme (E1) subunit APPBP1 | Back alignment and domain information |
|---|
| >PRK07878 molybdopterin biosynthesis-like protein MoeZ; Validated | Back alignment and domain information |
|---|
| >PRK07878 molybdopterin biosynthesis-like protein MoeZ; Validated | Back alignment and domain information |
|---|
| >PRK05600 thiamine biosynthesis protein ThiF; Validated | Back alignment and domain information |
|---|
| >cd01489 Uba2_SUMO Ubiquitin activating enzyme (E1) subunit UBA2 | Back alignment and domain information |
|---|
| >cd01491 Ube1_repeat1 Ubiquitin activating enzyme (E1), repeat 1 | Back alignment and domain information |
|---|
| >cd01485 E1-1_like Ubiquitin activating enzyme (E1), repeat 1-like | Back alignment and domain information |
|---|
| >PRK05597 molybdopterin biosynthesis protein MoeB; Validated | Back alignment and domain information |
|---|
| >PRK12475 thiamine/molybdopterin biosynthesis MoeB-like protein; Provisional | Back alignment and domain information |
|---|
| >PRK07688 thiamine/molybdopterin biosynthesis ThiF/MoeB-like protein; Validated | Back alignment and domain information |
|---|
| >PRK08223 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK05690 molybdopterin biosynthesis protein MoeB; Provisional | Back alignment and domain information |
|---|
| >TIGR02356 adenyl_thiF thiazole biosynthesis adenylyltransferase ThiF, E | Back alignment and domain information |
|---|
| >PRK08762 molybdopterin biosynthesis protein MoeB; Validated | Back alignment and domain information |
|---|
| >KOG2017 consensus Molybdopterin synthase sulfurylase [Coenzyme transport and metabolism] | Back alignment and domain information |
|---|
| >COG0476 ThiF Dinucleotide-utilizing enzymes involved in molybdopterin and thiamine biosynthesis family 2 [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PRK07411 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >cd00757 ThiF_MoeB_HesA_family ThiF_MoeB_HesA | Back alignment and domain information |
|---|
| >PF09358 UBA_e1_C: Ubiquitin-activating enzyme e1 C-terminal domain; InterPro: IPR018965 This presumed domain found at the C terminus of Ubiquitin-activating enzyme e1 proteins is functionally uncharacterised | Back alignment and domain information |
|---|
| >cd01488 Uba3_RUB Ubiquitin activating enzyme (E1) subunit UBA3 | Back alignment and domain information |
|---|
| >PRK08328 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK14851 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR03736 PRTRC_ThiF PRTRC system ThiF family protein | Back alignment and domain information |
|---|
| >PRK05600 thiamine biosynthesis protein ThiF; Validated | Back alignment and domain information |
|---|
| >TIGR02355 moeB molybdopterin synthase sulfurylase MoeB | Back alignment and domain information |
|---|
| >PRK14852 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG2013 consensus SMT3/SUMO-activating complex, catalytic component UBA2 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK15116 sulfur acceptor protein CsdL; Provisional | Back alignment and domain information |
|---|
| >cd01484 E1-2_like Ubiquitin activating enzyme (E1), repeat 2-like | Back alignment and domain information |
|---|
| >PRK07688 thiamine/molybdopterin biosynthesis ThiF/MoeB-like protein; Validated | Back alignment and domain information |
|---|
| >PRK12475 thiamine/molybdopterin biosynthesis MoeB-like protein; Provisional | Back alignment and domain information |
|---|
| >cd00755 YgdL_like Family of activating enzymes (E1) of ubiquitin-like proteins related to the E | Back alignment and domain information |
|---|
| >PRK07877 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK08644 thiamine biosynthesis protein ThiF; Provisional | Back alignment and domain information |
|---|
| >TIGR01408 Ube1 ubiquitin-activating enzyme E1 | Back alignment and domain information |
|---|
| >COG0476 ThiF Dinucleotide-utilizing enzymes involved in molybdopterin and thiamine biosynthesis family 2 [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PF00899 ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-activating enzyme (E1 enzyme) [, ] activates ubiquitin by first adenylating with ATP its C-terminal glycine residue and thereafter linking this residue to the side chain of a cysteine residue in E1, yielding an ubiquitin-E1 thiolester and free AMP | Back alignment and domain information |
|---|
| >KOG2017 consensus Molybdopterin synthase sulfurylase [Coenzyme transport and metabolism] | Back alignment and domain information |
|---|
| >PRK15116 sulfur acceptor protein CsdL; Provisional | Back alignment and domain information |
|---|
| >COG1179 Dinucleotide-utilizing enzymes involved in molybdopterin and thiamine biosynthesis family 1 [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >KOG2015 consensus NEDD8-activating complex, catalytic component UBA3 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK08762 molybdopterin biosynthesis protein MoeB; Validated | Back alignment and domain information |
|---|
| >PRK14852 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PTZ00245 ubiquitin activating enzyme; Provisional | Back alignment and domain information |
|---|
| >cd01490 Ube1_repeat2 Ubiquitin activating enzyme (E1), repeat 2 | Back alignment and domain information |
|---|
| >TIGR01381 E1_like_apg7 E1-like protein-activating enzyme Gsa7p/Apg7p | Back alignment and domain information |
|---|
| >PRK14851 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >cd01483 E1_enzyme_family Superfamily of activating enzymes (E1) of the ubiquitin-like proteins | Back alignment and domain information |
|---|
| >TIGR03603 cyclo_dehy_ocin bacteriocin biosynthesis cyclodehydratase, SagC family | Back alignment and domain information |
|---|
| >PF00899 ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-activating enzyme (E1 enzyme) [, ] activates ubiquitin by first adenylating with ATP its C-terminal glycine residue and thereafter linking this residue to the side chain of a cysteine residue in E1, yielding an ubiquitin-E1 thiolester and free AMP | Back alignment and domain information |
|---|
| >cd01486 Apg7 Apg7 is an E1-like protein, that activates two different ubiquitin-like proteins, Apg12 and Apg8, and assigns them to specific E2 enzymes, Apg10 and Apg3, respectively | Back alignment and domain information |
|---|
| >cd00755 YgdL_like Family of activating enzymes (E1) of ubiquitin-like proteins related to the E | Back alignment and domain information |
|---|
| >cd01487 E1_ThiF_like E1_ThiF_like | Back alignment and domain information |
|---|
| >PRK08644 thiamine biosynthesis protein ThiF; Provisional | Back alignment and domain information |
|---|
| >cd01483 E1_enzyme_family Superfamily of activating enzymes (E1) of the ubiquitin-like proteins | Back alignment and domain information |
|---|
| >TIGR02354 thiF_fam2 thiamine biosynthesis protein ThiF, family 2 | Back alignment and domain information |
|---|
| >COG1179 Dinucleotide-utilizing enzymes involved in molybdopterin and thiamine biosynthesis family 1 [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PTZ00245 ubiquitin activating enzyme; Provisional | Back alignment and domain information |
|---|
| >PRK07877 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR01381 E1_like_apg7 E1-like protein-activating enzyme Gsa7p/Apg7p | Back alignment and domain information |
|---|
| >PRK06153 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG2014 consensus SMT3/SUMO-activating complex, AOS1/RAD31 component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd01486 Apg7 Apg7 is an E1-like protein, that activates two different ubiquitin-like proteins, Apg12 and Apg8, and assigns them to specific E2 enzymes, Apg10 and Apg3, respectively | Back alignment and domain information |
|---|
| >TIGR03603 cyclo_dehy_ocin bacteriocin biosynthesis cyclodehydratase, SagC family | Back alignment and domain information |
|---|
| >KOG2016 consensus NEDD8-activating complex, APP-BP1/UBA5 component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd01487 E1_ThiF_like E1_ThiF_like | Back alignment and domain information |
|---|
| >KOG2336 consensus Molybdopterin biosynthesis-related protein [Coenzyme transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR02354 thiF_fam2 thiamine biosynthesis protein ThiF, family 2 | Back alignment and domain information |
|---|
| >PF02134 UBACT: Repeat in ubiquitin-activating (UBA) protein; InterPro: IPR000127 The post-translational attachment of ubiquitin (IPR000626 from INTERPRO) to proteins (ubiquitinylation) alters the function, location or trafficking of a protein, or targets it to the 26S proteasome for degradation [, , ] | Back alignment and domain information |
|---|
| >KOG2018 consensus Predicted dinucleotide-utilizing enzyme involved in molybdopterin and thiamine biosynthesis [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG2012 consensus Ubiquitin activating enzyme UBA1 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK06153 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG2018 consensus Predicted dinucleotide-utilizing enzyme involved in molybdopterin and thiamine biosynthesis [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR03736 PRTRC_ThiF PRTRC system ThiF family protein | Back alignment and domain information |
|---|
| >KOG2336 consensus Molybdopterin biosynthesis-related protein [Coenzyme transport and metabolism] | Back alignment and domain information |
|---|
| >PF10585 UBA_e1_thiolCys: Ubiquitin-activating enzyme active site ; InterPro: IPR019572 Ubiquitin-activating enzyme (E1 enzyme) activates ubiquitin by first adenylating with ATP its C-terminal glycine residue and thereafter linking this residue to the side chain of a cysteine residue in E1, yielding an ubiquitin-E1 thiolester and free AMP | Back alignment and domain information |
|---|
| >TIGR03693 ocin_ThiF_like putative thiazole-containing bacteriocin maturation protein | Back alignment and domain information |
|---|
| >KOG2337 consensus Ubiquitin activating E1 enzyme-like protein [Coenzyme transport and metabolism] | Back alignment and domain information |
|---|
| >KOG2337 consensus Ubiquitin activating E1 enzyme-like protein [Coenzyme transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR03693 ocin_ThiF_like putative thiazole-containing bacteriocin maturation protein | Back alignment and domain information |
|---|
| >COG4015 Predicted dinucleotide-utilizing enzyme of the ThiF/HesA family [General function prediction only] | Back alignment and domain information |
|---|
| >PF02134 UBACT: Repeat in ubiquitin-activating (UBA) protein; InterPro: IPR000127 The post-translational attachment of ubiquitin (IPR000626 from INTERPRO) to proteins (ubiquitinylation) alters the function, location or trafficking of a protein, or targets it to the 26S proteasome for degradation [, , ] | Back alignment and domain information |
|---|
| >PF08825 E2_bind: E2 binding domain; InterPro: IPR014929 E1 and E2 enzymes play a central role in ubiquitin and ubiquitin-like protein transfer cascades | Back alignment and domain information |
|---|
| >PRK06718 precorrin-2 dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >TIGR01470 cysG_Nterm siroheme synthase, N-terminal domain | Back alignment and domain information |
|---|
| >PF01488 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; InterPro: IPR006151 This entry represents a domain found in shikimate and quinate dehydrogenases, as well as glutamyl-tRNA reductases | Back alignment and domain information |
|---|
| >TIGR03882 cyclo_dehyd_2 bacteriocin biosynthesis cyclodehydratase domain | Back alignment and domain information |
|---|
| >COG1748 LYS9 Saccharopine dehydrogenase and related proteins [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >COG1748 LYS9 Saccharopine dehydrogenase and related proteins [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK12549 shikimate 5-dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PF13241 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_B 1PJT_A 1PJS_A 1PJQ_A 1KYQ_B | Back alignment and domain information |
|---|
| >PRK06719 precorrin-2 dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK12549 shikimate 5-dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >COG4015 Predicted dinucleotide-utilizing enzyme of the ThiF/HesA family [General function prediction only] | Back alignment and domain information |
|---|
| >PRK05562 precorrin-2 dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06718 precorrin-2 dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PF01488 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; InterPro: IPR006151 This entry represents a domain found in shikimate and quinate dehydrogenases, as well as glutamyl-tRNA reductases | Back alignment and domain information |
|---|
| >PF13241 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_B 1PJT_A 1PJS_A 1PJQ_A 1KYQ_B | Back alignment and domain information |
|---|
| >TIGR01470 cysG_Nterm siroheme synthase, N-terminal domain | Back alignment and domain information |
|---|
| >PRK06719 precorrin-2 dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK14027 quinate/shikimate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >COG1648 CysG Siroheme synthase (precorrin-2 oxidase/ferrochelatase domain) [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PRK10637 cysG siroheme synthase; Provisional | Back alignment and domain information |
|---|
| >PF03435 Saccharop_dh: Saccharopine dehydrogenase ; InterPro: IPR005097 This entry represents saccharopine dehydrogenase and homospermidine synthase | Back alignment and domain information |
|---|
| >PF00056 Ldh_1_N: lactate/malate dehydrogenase, NAD binding domain Prosite entry for lactate dehydrogenase Prosite entry for malate dehydrogenase; InterPro: IPR001236 L-lactate dehydrogenases are metabolic enzymes which catalyse the conversion of L-lactate to pyruvate, the last step in anaerobic glycolysis [] | Back alignment and domain information |
|---|
| >PRK05562 precorrin-2 dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK14106 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional | Back alignment and domain information |
|---|
| >PRK12548 shikimate 5-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR01809 Shik-DH-AROM shikimate-5-dehydrogenase, fungal AROM-type | Back alignment and domain information |
|---|
| >PRK14027 quinate/shikimate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PF03435 Saccharop_dh: Saccharopine dehydrogenase ; InterPro: IPR005097 This entry represents saccharopine dehydrogenase and homospermidine synthase | Back alignment and domain information |
|---|
| >COG0373 HemA Glutamyl-tRNA reductase [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >COG0169 AroE Shikimate 5-dehydrogenase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK00258 aroE shikimate 5-dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PRK12548 shikimate 5-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >cd05291 HicDH_like L-2-hydroxyisocapronate dehydrogenases and some bacterial L-lactate dehydrogenases | Back alignment and domain information |
|---|
| >TIGR01809 Shik-DH-AROM shikimate-5-dehydrogenase, fungal AROM-type | Back alignment and domain information |
|---|
| >PRK13940 glutamyl-tRNA reductase; Provisional | Back alignment and domain information |
|---|
| >KOG4169 consensus 15-hydroxyprostaglandin dehydrogenase and related dehydrogenases [Lipid transport and metabolism; General function prediction only] | Back alignment and domain information |
|---|
| >PRK12749 quinate/shikimate dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PRK07819 3-hydroxybutyryl-CoA dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK04148 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >COG0373 HemA Glutamyl-tRNA reductase [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >TIGR03882 cyclo_dehyd_2 bacteriocin biosynthesis cyclodehydratase domain | Back alignment and domain information |
|---|
| >PRK00258 aroE shikimate 5-dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PF05237 MoeZ_MoeB: MoeZ/MoeB domain; InterPro: IPR007901 This putative domain is found in the MoeZ protein and the MoeB protein | Back alignment and domain information |
|---|
| >COG0569 TrkA K+ transport systems, NAD-binding component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK14106 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional | Back alignment and domain information |
|---|
| >PRK13940 glutamyl-tRNA reductase; Provisional | Back alignment and domain information |
|---|
| >PF00070 Pyr_redox: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR001327 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] | Back alignment and domain information |
|---|
| >PF03446 NAD_binding_2: NAD binding domain of 6-phosphogluconate dehydrogenase; InterPro: IPR006115 6-Phosphogluconate dehydrogenase (1 | Back alignment and domain information |
|---|
| >COG1648 CysG Siroheme synthase (precorrin-2 oxidase/ferrochelatase domain) [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >cd01065 NAD_bind_Shikimate_DH NAD(P) binding domain of Shikimate dehydrogenase | Back alignment and domain information |
|---|
| >PF14732 UAE_UbL: Ubiquitin/SUMO-activating enzyme ubiquitin-like domain; PDB: 1Y8Q_B 1Y8R_E 3KYD_B 3KYC_B | Back alignment and domain information |
|---|
| >PF01113 DapB_N: Dihydrodipicolinate reductase, N-terminus; InterPro: IPR000846 Dihydrodipicolinate reductase catalyzes the second step in the biosynthesis of diaminopimelic acid and lysine, the NAD or NADP-dependent reduction of 2,3-dihydrodipicolinate into 2,3,4,5-tetrahydrodipicolinate [, , ] | Back alignment and domain information |
|---|
| >PRK12749 quinate/shikimate dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PF02826 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain; InterPro: IPR006140 A number of NAD-dependent 2-hydroxyacid dehydrogenases which seem to be specific for the D-isomer of their substrate have been shown to be functionally and structurally related | Back alignment and domain information |
|---|
| >PRK00066 ldh L-lactate dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >cd05213 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain of glutamyl-tRNA reductase | Back alignment and domain information |
|---|
| >PLN00203 glutamyl-tRNA reductase | Back alignment and domain information |
|---|
| >PRK05808 3-hydroxybutyryl-CoA dehydrogenase; Validated | Back alignment and domain information |
|---|
| >cd05290 LDH_3 A subgroup of L-lactate dehydrogenases | Back alignment and domain information |
|---|
| >KOG4169 consensus 15-hydroxyprostaglandin dehydrogenase and related dehydrogenases [Lipid transport and metabolism; General function prediction only] | Back alignment and domain information |
|---|
| >TIGR01035 hemA glutamyl-tRNA reductase | Back alignment and domain information |
|---|
| >PF02254 TrkA_N: TrkA-N domain; InterPro: IPR003148 The regulator of K+ conductance (RCK) domain is found in many ligand-gated K+ channels, most often attached to the intracellular carboxy terminus | Back alignment and domain information |
|---|
| >PRK07066 3-hydroxybutyryl-CoA dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PF10585 UBA_e1_thiolCys: Ubiquitin-activating enzyme active site ; InterPro: IPR019572 Ubiquitin-activating enzyme (E1 enzyme) activates ubiquitin by first adenylating with ATP its C-terminal glycine residue and thereafter linking this residue to the side chain of a cysteine residue in E1, yielding an ubiquitin-E1 thiolester and free AMP | Back alignment and domain information |
|---|
| >PLN02602 lactate dehydrogenase | Back alignment and domain information |
|---|
| >cd05293 LDH_1 A subgroup of L-lactate dehydrogenases | Back alignment and domain information |
|---|
| >PF01118 Semialdhyde_dh: Semialdehyde dehydrogenase, NAD binding domain; InterPro: IPR000534 The semialdehyde dehydrogenase family is found in N-acetyl-glutamine semialdehyde dehydrogenase (AgrC), which is involved in arginine biosynthesis, and aspartate-semialdehyde dehydrogenase [], an enzyme involved in the biosynthesis of various amino acids from aspartate | Back alignment and domain information |
|---|
| >cd00300 LDH_like L-lactate dehydrogenase-like enzymes | Back alignment and domain information |
|---|
| >COG0169 AroE Shikimate 5-dehydrogenase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK09260 3-hydroxybutyryl-CoA dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK10637 cysG siroheme synthase; Provisional | Back alignment and domain information |
|---|
| >cd01080 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of methylene-tetrahydrofolate dehydrogenase/cyclohydrolase | Back alignment and domain information |
|---|
| >COG0569 TrkA K+ transport systems, NAD-binding component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >cd05291 HicDH_like L-2-hydroxyisocapronate dehydrogenases and some bacterial L-lactate dehydrogenases | Back alignment and domain information |
|---|
| >PRK00141 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional | Back alignment and domain information |
|---|
| >PRK05708 2-dehydropantoate 2-reductase; Provisional | Back alignment and domain information |
|---|
| >PLN00203 glutamyl-tRNA reductase | Back alignment and domain information |
|---|
| >cd05311 NAD_bind_2_malic_enz NAD(P) binding domain of malic enzyme (ME), subgroup 2 | Back alignment and domain information |
|---|
| >cd05311 NAD_bind_2_malic_enz NAD(P) binding domain of malic enzyme (ME), subgroup 2 | Back alignment and domain information |
|---|
| >PRK06130 3-hydroxybutyryl-CoA dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK05476 S-adenosyl-L-homocysteine hydrolase; Provisional | Back alignment and domain information |
|---|
| >cd01078 NAD_bind_H4MPT_DH NADP binding domain of methylene tetrahydromethanopterin dehydrogenase | Back alignment and domain information |
|---|
| >PF00056 Ldh_1_N: lactate/malate dehydrogenase, NAD binding domain Prosite entry for lactate dehydrogenase Prosite entry for malate dehydrogenase; InterPro: IPR001236 L-lactate dehydrogenases are metabolic enzymes which catalyse the conversion of L-lactate to pyruvate, the last step in anaerobic glycolysis [] | Back alignment and domain information |
|---|
| >cd05213 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain of glutamyl-tRNA reductase | Back alignment and domain information |
|---|
| >PRK01438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional | Back alignment and domain information |
|---|
| >PRK01710 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional | Back alignment and domain information |
|---|
| >PRK04148 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK08293 3-hydroxybutyryl-CoA dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PTZ00117 malate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK00066 ldh L-lactate dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >COG0111 SerA Phosphoglycerate dehydrogenase and related dehydrogenases [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK00045 hemA glutamyl-tRNA reductase; Reviewed | Back alignment and domain information |
|---|
| >cd05290 LDH_3 A subgroup of L-lactate dehydrogenases | Back alignment and domain information |
|---|
| >PF03807 F420_oxidored: NADP oxidoreductase coenzyme F420-dependent; InterPro: IPR004455 The function of F420-dependent NADP reductase is the transfer of electrons from reduced coenzyme F420 into an electron transport chain | Back alignment and domain information |
|---|
| >PF03446 NAD_binding_2: NAD binding domain of 6-phosphogluconate dehydrogenase; InterPro: IPR006115 6-Phosphogluconate dehydrogenase (1 | Back alignment and domain information |
|---|
| >PTZ00082 L-lactate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PLN02206 UDP-glucuronate decarboxylase | Back alignment and domain information |
|---|
| >PTZ00082 L-lactate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06197 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07063 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK09599 6-phosphogluconate dehydrogenase-like protein; Reviewed | Back alignment and domain information |
|---|
| >cd01075 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase | Back alignment and domain information |
|---|
| >PRK06197 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK15469 ghrA bifunctional glyoxylate/hydroxypyruvate reductase A; Provisional | Back alignment and domain information |
|---|
| >PRK05854 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >cd01080 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of methylene-tetrahydrofolate dehydrogenase/cyclohydrolase | Back alignment and domain information |
|---|
| >cd05293 LDH_1 A subgroup of L-lactate dehydrogenases | Back alignment and domain information |
|---|
| >COG1086 Predicted nucleoside-diphosphate sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PLN02819 lysine-ketoglutarate reductase/saccharopine dehydrogenase | Back alignment and domain information |
|---|
| >PRK14192 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >COG0300 DltE Short-chain dehydrogenases of various substrate specificities [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR00872 gnd_rel 6-phosphogluconate dehydrogenase (decarboxylating) | Back alignment and domain information |
|---|
| >PRK08410 2-hydroxyacid dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK13243 glyoxylate reductase; Reviewed | Back alignment and domain information |
|---|
| >TIGR02992 ectoine_eutC ectoine utilization protein EutC | Back alignment and domain information |
|---|
| >PRK06130 3-hydroxybutyryl-CoA dehydrogenase; Validated | Back alignment and domain information |
|---|
| >TIGR01759 MalateDH-SF1 malate dehydrogenase | Back alignment and domain information |
|---|
| >PRK05808 3-hydroxybutyryl-CoA dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PLN02166 dTDP-glucose 4,6-dehydratase | Back alignment and domain information |
|---|
| >cd01078 NAD_bind_H4MPT_DH NADP binding domain of methylene tetrahydromethanopterin dehydrogenase | Back alignment and domain information |
|---|
| >PRK07819 3-hydroxybutyryl-CoA dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK06487 glycerate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PF13460 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X_A 3GPI_A 3QVO_A 2Q46_B 1YBM_B 1XQ6_B 2Q4B_B 3EW7_A 3IUS_B | Back alignment and domain information |
|---|
| >cd05296 GH4_P_beta_glucosidase Glycoside Hydrolases Family 4; Phospho-beta-glucosidase | Back alignment and domain information |
|---|
| >TIGR00507 aroE shikimate 5-dehydrogenase | Back alignment and domain information |
|---|
| >PF02737 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain; InterPro: IPR006176 3-hydroxyacyl-CoA dehydrogenase (1 | Back alignment and domain information |
|---|
| >PLN02819 lysine-ketoglutarate reductase/saccharopine dehydrogenase | Back alignment and domain information |
|---|
| >PRK05476 S-adenosyl-L-homocysteine hydrolase; Provisional | Back alignment and domain information |
|---|
| >PF01118 Semialdhyde_dh: Semialdehyde dehydrogenase, NAD binding domain; InterPro: IPR000534 The semialdehyde dehydrogenase family is found in N-acetyl-glutamine semialdehyde dehydrogenase (AgrC), which is involved in arginine biosynthesis, and aspartate-semialdehyde dehydrogenase [], an enzyme involved in the biosynthesis of various amino acids from aspartate | Back alignment and domain information |
|---|
| >PRK02705 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional | Back alignment and domain information |
|---|
| >PRK07574 formate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >cd00401 AdoHcyase S-adenosyl-L-homocysteine hydrolase (AdoHycase) catalyzes the hydrolysis of S-adenosyl-L-homocysteine (AdoHyc) to form adenosine (Ado) and homocysteine (Hcy) | Back alignment and domain information |
|---|
| >PRK06932 glycerate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >COG0039 Mdh Malate/lactate dehydrogenases [Energy production and conversion] | Back alignment and domain information |
|---|
| >PTZ00325 malate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PF01113 DapB_N: Dihydrodipicolinate reductase, N-terminus; InterPro: IPR000846 Dihydrodipicolinate reductase catalyzes the second step in the biosynthesis of diaminopimelic acid and lysine, the NAD or NADP-dependent reduction of 2,3-dihydrodipicolinate into 2,3,4,5-tetrahydrodipicolinate [, , ] | Back alignment and domain information |
|---|
| >TIGR00507 aroE shikimate 5-dehydrogenase | Back alignment and domain information |
|---|
| >PLN02602 lactate dehydrogenase | Back alignment and domain information |
|---|
| >PRK06141 ornithine cyclodeaminase; Validated | Back alignment and domain information |
|---|
| >PRK07831 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK09496 trkA potassium transporter peripheral membrane component; Reviewed | Back alignment and domain information |
|---|
| >cd00401 AdoHcyase S-adenosyl-L-homocysteine hydrolase (AdoHycase) catalyzes the hydrolysis of S-adenosyl-L-homocysteine (AdoHyc) to form adenosine (Ado) and homocysteine (Hcy) | Back alignment and domain information |
|---|
| >PRK07062 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK04308 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional | Back alignment and domain information |
|---|
| >COG1086 Predicted nucleoside-diphosphate sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PRK15438 erythronate-4-phosphate dehydrogenase PdxB; Provisional | Back alignment and domain information |
|---|
| >PRK07634 pyrroline-5-carboxylate reductase; Reviewed | Back alignment and domain information |
|---|
| >PF01210 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus; InterPro: IPR011128 NAD-dependent glycerol-3-phosphate dehydrogenase (GPDH) catalyses the interconversion of dihydroxyacetone phosphate and L-glycerol-3-phosphate | Back alignment and domain information |
|---|
| >COG0771 MurD UDP-N-acetylmuramoylalanine-D-glutamate ligase [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >PRK09242 tropinone reductase; Provisional | Back alignment and domain information |
|---|
| >PRK08618 ornithine cyclodeaminase; Validated | Back alignment and domain information |
|---|
| >PRK07530 3-hydroxybutyryl-CoA dehydrogenase; Validated | Back alignment and domain information |
|---|
| >TIGR00936 ahcY adenosylhomocysteinase | Back alignment and domain information |
|---|
| >PRK06436 glycerate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK11880 pyrroline-5-carboxylate reductase; Reviewed | Back alignment and domain information |
|---|
| >cd05191 NAD_bind_amino_acid_DH NAD(P) binding domain of amino acid dehydrogenase-like proteins | Back alignment and domain information |
|---|
| >PRK00048 dihydrodipicolinate reductase; Provisional | Back alignment and domain information |
|---|
| >PRK07066 3-hydroxybutyryl-CoA dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PLN03139 formate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK14619 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR01757 Malate-DH_plant malate dehydrogenase, NADP-dependent | Back alignment and domain information |
|---|
| >PRK08251 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >cd05191 NAD_bind_amino_acid_DH NAD(P) binding domain of amino acid dehydrogenase-like proteins | Back alignment and domain information |
|---|
| >PRK12490 6-phosphogluconate dehydrogenase-like protein; Reviewed | Back alignment and domain information |
|---|
| >PF02254 TrkA_N: TrkA-N domain; InterPro: IPR003148 The regulator of K+ conductance (RCK) domain is found in many ligand-gated K+ channels, most often attached to the intracellular carboxy terminus | Back alignment and domain information |
|---|
| >PF03807 F420_oxidored: NADP oxidoreductase coenzyme F420-dependent; InterPro: IPR004455 The function of F420-dependent NADP reductase is the transfer of electrons from reduced coenzyme F420 into an electron transport chain | Back alignment and domain information |
|---|
| >cd00300 LDH_like L-lactate dehydrogenase-like enzymes | Back alignment and domain information |
|---|
| >PRK00257 erythronate-4-phosphate dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PLN02427 UDP-apiose/xylose synthase | Back alignment and domain information |
|---|
| >PLN03209 translocon at the inner envelope of chloroplast subunit 62; Provisional | Back alignment and domain information |
|---|
| >PRK07340 ornithine cyclodeaminase; Validated | Back alignment and domain information |
|---|
| >PRK09496 trkA potassium transporter peripheral membrane component; Reviewed | Back alignment and domain information |
|---|
| >PF00070 Pyr_redox: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR001327 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] | Back alignment and domain information |
|---|
| >PLN02545 3-hydroxybutyryl-CoA dehydrogenase | Back alignment and domain information |
|---|
| >cd01075 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase | Back alignment and domain information |
|---|
| >PRK03562 glutathione-regulated potassium-efflux system protein KefC; Provisional | Back alignment and domain information |
|---|
| >PRK08618 ornithine cyclodeaminase; Validated | Back alignment and domain information |
|---|
| >cd01065 NAD_bind_Shikimate_DH NAD(P) binding domain of Shikimate dehydrogenase | Back alignment and domain information |
|---|
| >cd01338 MDH_choloroplast_like Chloroplast-like malate dehydrogenases | Back alignment and domain information |
|---|
| >PRK07502 cyclohexadienyl dehydrogenase; Validated | Back alignment and domain information |
|---|
| >TIGR01915 npdG NADPH-dependent F420 reductase | Back alignment and domain information |
|---|
| >PF01210 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus; InterPro: IPR011128 NAD-dependent glycerol-3-phosphate dehydrogenase (GPDH) catalyses the interconversion of dihydroxyacetone phosphate and L-glycerol-3-phosphate | Back alignment and domain information |
|---|
| >PRK09242 tropinone reductase; Provisional | Back alignment and domain information |
|---|
| >PRK02472 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional | Back alignment and domain information |
|---|
| >TIGR00518 alaDH alanine dehydrogenase | Back alignment and domain information |
|---|
| >PRK11908 NAD-dependent epimerase/dehydratase family protein; Provisional | Back alignment and domain information |
|---|
| >PRK04663 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional | Back alignment and domain information |
|---|
| >cd05292 LDH_2 A subgroup of L-lactate dehydrogenases | Back alignment and domain information |
|---|
| >PRK06035 3-hydroxyacyl-CoA dehydrogenase; Validated | Back alignment and domain information |
|---|
| >TIGR00465 ilvC ketol-acid reductoisomerase | Back alignment and domain information |
|---|
| >PRK06522 2-dehydropantoate 2-reductase; Reviewed | Back alignment and domain information |
|---|
| >PRK04690 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional | Back alignment and domain information |
|---|
| >PRK08293 3-hydroxybutyryl-CoA dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PLN02350 phosphogluconate dehydrogenase (decarboxylating) | Back alignment and domain information |
|---|
| >PRK06223 malate dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PRK02006 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional | Back alignment and domain information |
|---|
| >PF10727 Rossmann-like: Rossmann-like domain; InterPro: IPR019665 This entry represents an NAD/NADP-binding domain with a core Rossmann-type fold, found in an uncharacterised protein family thought to be putative NADP oxidoreductase coenzyme F420-dependent proteins and/or NAD-dependent glycerol-3-phosphate dehydrogenase-like proteins | Back alignment and domain information |
|---|
| >PF02826 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain; InterPro: IPR006140 A number of NAD-dependent 2-hydroxyacid dehydrogenases which seem to be specific for the D-isomer of their substrate have been shown to be functionally and structurally related | Back alignment and domain information |
|---|
| >PRK03659 glutathione-regulated potassium-efflux system protein KefB; Provisional | Back alignment and domain information |
|---|
| >PLN00016 RNA-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK12826 3-ketoacyl-(acyl-carrier-protein) reductase; Reviewed | Back alignment and domain information |
|---|
| >PRK05854 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PF02558 ApbA: Ketopantoate reductase PanE/ApbA; InterPro: IPR013332 ApbA, the ketopantoate reductase enzyme 1 | Back alignment and domain information |
|---|
| >PRK07576 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07531 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioesterase; Validated | Back alignment and domain information |
|---|
| >PRK06249 2-dehydropantoate 2-reductase; Provisional | Back alignment and domain information |
|---|
| >PRK05867 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PF00106 adh_short: short chain dehydrogenase alcohol dehydrogenase superfamily signature glucose/ribitol dehydrogenase family signature; InterPro: IPR002198 The short-chain dehydrogenases/reductases family (SDR) [] is a very large family of enzymes, most of which are known to be NAD- or NADP-dependent oxidoreductases | Back alignment and domain information |
|---|
| >PRK14175 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK05708 2-dehydropantoate 2-reductase; Provisional | Back alignment and domain information |
|---|
| >PF10727 Rossmann-like: Rossmann-like domain; InterPro: IPR019665 This entry represents an NAD/NADP-binding domain with a core Rossmann-type fold, found in an uncharacterised protein family thought to be putative NADP oxidoreductase coenzyme F420-dependent proteins and/or NAD-dependent glycerol-3-phosphate dehydrogenase-like proteins | Back alignment and domain information |
|---|
| >PRK03369 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional | Back alignment and domain information |
|---|
| >PRK11880 pyrroline-5-carboxylate reductase; Reviewed | Back alignment and domain information |
|---|
| >PRK03803 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional | Back alignment and domain information |
|---|
| >PLN02206 UDP-glucuronate decarboxylase | Back alignment and domain information |
|---|
| >PTZ00142 6-phosphogluconate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >COG1893 ApbA Ketopantoate reductase [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PRK08217 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK10537 voltage-gated potassium channel; Provisional | Back alignment and domain information |
|---|
| >PRK07063 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PF02719 Polysacc_synt_2: Polysaccharide biosynthesis protein; InterPro: IPR003869 This domain is found in diverse bacterial polysaccharide biosynthesis proteins including the CapD protein from Staphylococcus aureus [], the WalL protein, mannosyl-transferase [], and several putative epimerases | Back alignment and domain information |
|---|
| >PLN02240 UDP-glucose 4-epimerase | Back alignment and domain information |
|---|
| >PLN02780 ketoreductase/ oxidoreductase | Back alignment and domain information |
|---|
| >TIGR01771 L-LDH-NAD L-lactate dehydrogenase | Back alignment and domain information |
|---|
| >PRK00094 gpsA NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK07523 gluconate 5-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07680 late competence protein ComER; Validated | Back alignment and domain information |
|---|
| >cd01337 MDH_glyoxysomal_mitochondrial Glyoxysomal and mitochondrial malate dehydrogenases | Back alignment and domain information |
|---|
| >PRK15469 ghrA bifunctional glyoxylate/hydroxypyruvate reductase A; Provisional | Back alignment and domain information |
|---|
| >PRK12921 2-dehydropantoate 2-reductase; Provisional | Back alignment and domain information |
|---|
| >PRK09186 flagellin modification protein A; Provisional | Back alignment and domain information |
|---|
| >PRK03562 glutathione-regulated potassium-efflux system protein KefC; Provisional | Back alignment and domain information |
|---|
| >PRK07062 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR00872 gnd_rel 6-phosphogluconate dehydrogenase (decarboxylating) | Back alignment and domain information |
|---|
| >cd01339 LDH-like_MDH L-lactate dehydrogenase-like malate dehydrogenase proteins | Back alignment and domain information |
|---|
| >PRK14619 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PF02737 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain; InterPro: IPR006176 3-hydroxyacyl-CoA dehydrogenase (1 | Back alignment and domain information |
|---|
| >PRK08291 ectoine utilization protein EutC; Validated | Back alignment and domain information |
|---|
| >PRK07478 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK05442 malate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK11790 D-3-phosphoglycerate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >cd00650 LDH_MDH_like NAD-dependent, lactate dehydrogenase-like, 2-hydroxycarboxylate dehydrogenase family | Back alignment and domain information |
|---|
| >COG1063 Tdh Threonine dehydrogenase and related Zn-dependent dehydrogenases [Amino acid transport and metabolism / General function prediction only] | Back alignment and domain information |
|---|
| >PTZ00431 pyrroline carboxylate reductase; Provisional | Back alignment and domain information |
|---|
| >PF00106 adh_short: short chain dehydrogenase alcohol dehydrogenase superfamily signature glucose/ribitol dehydrogenase family signature; InterPro: IPR002198 The short-chain dehydrogenases/reductases family (SDR) [] is a very large family of enzymes, most of which are known to be NAD- or NADP-dependent oxidoreductases | Back alignment and domain information |
|---|
| >KOG0069 consensus Glyoxylate/hydroxypyruvate reductase (D-isomer-specific 2-hydroxy acid dehydrogenase superfamily) [Energy production and conversion] | Back alignment and domain information |
|---|
| >PRK09599 6-phosphogluconate dehydrogenase-like protein; Reviewed | Back alignment and domain information |
|---|
| >PRK06223 malate dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >TIGR00873 gnd 6-phosphogluconate dehydrogenase, decarboxylating | Back alignment and domain information |
|---|
| >PRK09260 3-hydroxybutyryl-CoA dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK07679 pyrroline-5-carboxylate reductase; Reviewed | Back alignment and domain information |
|---|
| >PRK05479 ketol-acid reductoisomerase; Provisional | Back alignment and domain information |
|---|
| >PLN03209 translocon at the inner envelope of chloroplast subunit 62; Provisional | Back alignment and domain information |
|---|
| >PRK07531 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioesterase; Validated | Back alignment and domain information |
|---|
| >PTZ00431 pyrroline carboxylate reductase; Provisional | Back alignment and domain information |
|---|
| >PRK07417 arogenate dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PLN02253 xanthoxin dehydrogenase | Back alignment and domain information |
|---|
| >PF04321 RmlD_sub_bind: RmlD substrate binding domain; InterPro: IPR005913 dTDP-4-dehydrorhamnose reductase (1 | Back alignment and domain information |
|---|
| >PRK11908 NAD-dependent epimerase/dehydratase family protein; Provisional | Back alignment and domain information |
|---|
| >PLN02306 hydroxypyruvate reductase | Back alignment and domain information |
|---|
| >cd05197 GH4_glycoside_hydrolases Glycoside Hydrases Family 4 | Back alignment and domain information |
|---|
| >KOG0024 consensus Sorbitol dehydrogenase [Secondary metabolites biosynthesis, transport and catabolism] | Back alignment and domain information |
|---|
| >PRK05335 tRNA (uracil-5-)-methyltransferase Gid; Reviewed | Back alignment and domain information |
|---|
| >PRK08339 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06928 pyrroline-5-carboxylate reductase; Reviewed | Back alignment and domain information |
|---|
| >PRK12384 sorbitol-6-phosphate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06523 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR01035 hemA glutamyl-tRNA reductase | Back alignment and domain information |
|---|
| >PRK00048 dihydrodipicolinate reductase; Provisional | Back alignment and domain information |
|---|
| >PRK07831 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >KOG0069 consensus Glyoxylate/hydroxypyruvate reductase (D-isomer-specific 2-hydroxy acid dehydrogenase superfamily) [Energy production and conversion] | Back alignment and domain information |
|---|
| >PRK06476 pyrroline-5-carboxylate reductase; Reviewed | Back alignment and domain information |
|---|
| >PRK07576 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK00421 murC UDP-N-acetylmuramate--L-alanine ligase; Provisional | Back alignment and domain information |
|---|
| >COG1063 Tdh Threonine dehydrogenase and related Zn-dependent dehydrogenases [Amino acid transport and metabolism / General function prediction only] | Back alignment and domain information |
|---|
| >TIGR01772 MDH_euk_gproteo malate dehydrogenase, NAD-dependent | Back alignment and domain information |
|---|
| >PTZ00117 malate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >cd00704 MDH Malate dehydrogenase | Back alignment and domain information |
|---|
| >cd01076 NAD_bind_1_Glu_DH NAD(P) binding domain of glutamate dehydrogenase, subgroup 1 | Back alignment and domain information |
|---|
| >PRK14620 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >cd05211 NAD_bind_Glu_Leu_Phe_Val NAD(P) binding domain of glutamate dehydrogenase, leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase | Back alignment and domain information |
|---|
| >PRK15409 bifunctional glyoxylate/hydroxypyruvate reductase B; Provisional | Back alignment and domain information |
|---|
| >PRK13403 ketol-acid reductoisomerase; Provisional | Back alignment and domain information |
|---|
| >PF02558 ApbA: Ketopantoate reductase PanE/ApbA; InterPro: IPR013332 ApbA, the ketopantoate reductase enzyme 1 | Back alignment and domain information |
|---|
| >PRK07792 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PLN00106 malate dehydrogenase | Back alignment and domain information |
|---|
| >COG1250 FadB 3-hydroxyacyl-CoA dehydrogenase [Lipid metabolism] | Back alignment and domain information |
|---|
| >TIGR00065 ftsZ cell division protein FtsZ | Back alignment and domain information |
|---|
| >TIGR03589 PseB UDP-N-acetylglucosamine 4,6-dehydratase | Back alignment and domain information |
|---|
| >PRK14618 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >cd05211 NAD_bind_Glu_Leu_Phe_Val NAD(P) binding domain of glutamate dehydrogenase, leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase | Back alignment and domain information |
|---|
| >TIGR01763 MalateDH_bact malate dehydrogenase, NAD-dependent | Back alignment and domain information |
|---|
| >PRK07231 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >TIGR00936 ahcY adenosylhomocysteinase | Back alignment and domain information |
|---|
| >COG1091 RfbD dTDP-4-dehydrorhamnose reductase [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >TIGR02992 ectoine_eutC ectoine utilization protein EutC | Back alignment and domain information |
|---|
| >PRK12939 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK03806 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional | Back alignment and domain information |
|---|
| >cd05298 GH4_GlvA_pagL_like Glycoside Hydrolases Family 4; GlvA- and pagL-like glycosidases | Back alignment and domain information |
|---|
| >PRK15181 Vi polysaccharide biosynthesis protein TviC; Provisional | Back alignment and domain information |
|---|
| >PRK06522 2-dehydropantoate 2-reductase; Reviewed | Back alignment and domain information |
|---|
| >PLN02427 UDP-apiose/xylose synthase | Back alignment and domain information |
|---|
| >PRK06125 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK14982 acyl-ACP reductase; Provisional | Back alignment and domain information |
|---|
| >COG1893 ApbA Ketopantoate reductase [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PRK12550 shikimate 5-dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PLN03129 NADP-dependent malic enzyme; Provisional | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST
Original result of BLAST against Protein Data Bank
| ID | Alignment Graph | Length |
Definition |
E-value | |
| Query | 1104 | ||||
| 3cmm_A | 1015 | Crystal Structure Of The Uba1-Ubiquitin Complex Len | 0.0 | ||
| 4ii2_A | 1001 | Crystal Structure Of Ubiquitin Activating Enzyme 1 | 0.0 | ||
| 1z7l_A | 276 | Crystal Structure Of Fragment Of Mouse Ubiquitin-Ac | 3e-53 | ||
| 2v31_A | 112 | Structure Of First Catalytic Cysteine Half-Domain O | 1e-23 | ||
| 1y8q_A | 346 | Sumo E1 Activating Enzyme Sae1-Sae2-Mg-Atp Complex | 3e-22 | ||
| 1y8q_A | 346 | Sumo E1 Activating Enzyme Sae1-Sae2-Mg-Atp Complex | 3e-07 | ||
| 3kyd_B | 551 | Human Sumo E1~sumo1-amp Tetrahedral Intermediate Mi | 3e-21 | ||
| 3kyd_B | 551 | Human Sumo E1~sumo1-amp Tetrahedral Intermediate Mi | 2e-06 | ||
| 3kyc_B | 660 | Human Sumo E1 Complex With A Sumo1-Amp Mimic Length | 4e-21 | ||
| 3kyc_B | 660 | Human Sumo E1 Complex With A Sumo1-Amp Mimic Length | 2e-06 | ||
| 1yov_B | 444 | Insights Into The Ubiquitin Transfer Cascade From T | 3e-20 | ||
| 1tt5_B | 434 | Structure Of Appbp1-Uba3-Ubc12n26: A Unique E1-E2 I | 4e-20 | ||
| 3gzn_B | 463 | Structure Of Nedd8-Activating Enzyme In Complex Wit | 4e-20 | ||
| 2nvu_B | 805 | Structure Of Appbp1-Uba3~nedd8-Nedd8-Mgatp-Ubc12(C1 | 4e-20 | ||
| 1y8q_B | 640 | Sumo E1 Activating Enzyme Sae1-Sae2-Mg-Atp Complex | 6e-20 | ||
| 1y8q_B | 640 | Sumo E1 Activating Enzyme Sae1-Sae2-Mg-Atp Complex | 2e-06 | ||
| 3dbr_B | 434 | Structural Dissection Of A Gating Mechanism Prevent | 2e-19 | ||
| 3dbl_B | 434 | Structural Dissection Of A Gating Mechanism Prevent | 5e-19 | ||
| 1r4m_B | 431 | Appbp1-Uba3-Nedd8, An E1-Ubiquitin-Like Protein Com | 6e-19 | ||
| 3dbh_B | 434 | Structural Dissection Of A Gating Mechanism Prevent | 8e-19 | ||
| 3gzn_A | 534 | Structure Of Nedd8-Activating Enzyme In Complex Wit | 5e-11 | ||
| 3gzn_A | 534 | Structure Of Nedd8-Activating Enzyme In Complex Wit | 5e-05 | ||
| 2nvu_A | 536 | Structure Of Appbp1-Uba3~nedd8-Nedd8-Mgatp-Ubc12(C1 | 6e-11 | ||
| 2nvu_A | 536 | Structure Of Appbp1-Uba3~nedd8-Nedd8-Mgatp-Ubc12(C1 | 5e-05 | ||
| 1tt5_A | 531 | Structure Of Appbp1-Uba3-Ubc12n26: A Unique E1-E2 I | 6e-11 | ||
| 1tt5_A | 531 | Structure Of Appbp1-Uba3-Ubc12n26: A Unique E1-E2 I | 5e-05 | ||
| 1yov_A | 537 | Insights Into The Ubiquitin Transfer Cascade From T | 6e-11 | ||
| 1yov_A | 537 | Insights Into The Ubiquitin Transfer Cascade From T | 5e-05 | ||
| 1r4m_A | 529 | Appbp1-Uba3-Nedd8, An E1-Ubiquitin-Like Protein Com | 6e-11 | ||
| 1r4m_A | 529 | Appbp1-Uba3-Nedd8, An E1-Ubiquitin-Like Protein Com | 6e-05 | ||
| 1zfn_A | 253 | Structural Analysis Of Escherichia Coli Thif Length | 9e-10 | ||
| 1zfn_A | 253 | Structural Analysis Of Escherichia Coli Thif Length | 8e-08 | ||
| 1zud_1 | 251 | Structure Of This-Thif Protein Complex Length = 251 | 3e-09 | ||
| 1zud_1 | 251 | Structure Of This-Thif Protein Complex Length = 251 | 8e-08 | ||
| 1jwb_B | 249 | Structure Of The Covalent Acyl-Adenylate Form Of Th | 6e-09 | ||
| 3h5a_A | 358 | Crystal Structure Of E. Coli Mccb Length = 358 | 4e-06 | ||
| 3h5n_A | 353 | Crystal Structure Of E. Coli Mccb + Atp Length = 35 | 4e-06 |
| >pdb|3CMM|A Chain A, Crystal Structure Of The Uba1-Ubiquitin Complex Length = 1015 | Back alignment and structure |
|
| >pdb|4II2|A Chain A, Crystal Structure Of Ubiquitin Activating Enzyme 1 (uba1) In Complex With The Ub E2 Ubc4, Ubiquitin, And Atp/mg Length = 1001 | Back alignment and structure |
| >pdb|1Z7L|A Chain A, Crystal Structure Of Fragment Of Mouse Ubiquitin-Activating Enzyme Length = 276 | Back alignment and structure |
| >pdb|2V31|A Chain A, Structure Of First Catalytic Cysteine Half-Domain Of Mouse Ubiquitin-Activating Enzyme Length = 112 | Back alignment and structure |
| >pdb|1Y8Q|A Chain A, Sumo E1 Activating Enzyme Sae1-Sae2-Mg-Atp Complex Length = 346 | Back alignment and structure |
| >pdb|1Y8Q|A Chain A, Sumo E1 Activating Enzyme Sae1-Sae2-Mg-Atp Complex Length = 346 | Back alignment and structure |
| >pdb|3KYD|B Chain B, Human Sumo E1~sumo1-amp Tetrahedral Intermediate Mimic Length = 551 | Back alignment and structure |
| >pdb|3KYD|B Chain B, Human Sumo E1~sumo1-amp Tetrahedral Intermediate Mimic Length = 551 | Back alignment and structure |
| >pdb|3KYC|B Chain B, Human Sumo E1 Complex With A Sumo1-Amp Mimic Length = 660 | Back alignment and structure |
| >pdb|3KYC|B Chain B, Human Sumo E1 Complex With A Sumo1-Amp Mimic Length = 660 | Back alignment and structure |
| >pdb|1YOV|B Chain B, Insights Into The Ubiquitin Transfer Cascade From The Refined Structure Of The Activating Enzyme For Nedd8 Length = 444 | Back alignment and structure |
| >pdb|1TT5|B Chain B, Structure Of Appbp1-Uba3-Ubc12n26: A Unique E1-E2 Interaction Required For Optimal Conjugation Of The Ubiquitin-Like Protein Nedd8 Length = 434 | Back alignment and structure |
| >pdb|3GZN|B Chain B, Structure Of Nedd8-Activating Enzyme In Complex With Nedd8 And Mln4924 Length = 463 | Back alignment and structure |
| >pdb|2NVU|B Chain B, Structure Of Appbp1-Uba3~nedd8-Nedd8-Mgatp-Ubc12(C111a), A Trapped Ubiquitin-Like Protein Activation Complex Length = 805 | Back alignment and structure |
| >pdb|1Y8Q|B Chain B, Sumo E1 Activating Enzyme Sae1-Sae2-Mg-Atp Complex Length = 640 | Back alignment and structure |
| >pdb|1Y8Q|B Chain B, Sumo E1 Activating Enzyme Sae1-Sae2-Mg-Atp Complex Length = 640 | Back alignment and structure |
| >pdb|3DBR|B Chain B, Structural Dissection Of A Gating Mechanism Preventing Misactivation Of Ubiquitin By Nedd8's E1 (Appbp1- Uba3arg190gln-Nedd8ala72arg) Length = 434 | Back alignment and structure |
| >pdb|3DBL|B Chain B, Structural Dissection Of A Gating Mechanism Preventing Misactivation Of Ubiquitin By Nedd8's E1 (Appbp1- Uba3arg190wt-Nedd8ala72gln) Length = 434 | Back alignment and structure |
| >pdb|1R4M|B Chain B, Appbp1-Uba3-Nedd8, An E1-Ubiquitin-Like Protein Complex Length = 431 | Back alignment and structure |
| >pdb|3DBH|B Chain B, Structural Dissection Of A Gating Mechanism Preventing Misactivation Of Ubiquitin By Nedd8's E1 (Appbp1- Uba3arg190ala-Nedd8ala72arg) Length = 434 | Back alignment and structure |
| >pdb|3GZN|A Chain A, Structure Of Nedd8-Activating Enzyme In Complex With Nedd8 And Mln4924 Length = 534 | Back alignment and structure |
| >pdb|3GZN|A Chain A, Structure Of Nedd8-Activating Enzyme In Complex With Nedd8 And Mln4924 Length = 534 | Back alignment and structure |
| >pdb|2NVU|A Chain A, Structure Of Appbp1-Uba3~nedd8-Nedd8-Mgatp-Ubc12(C111a), A Trapped Ubiquitin-Like Protein Activation Complex Length = 536 | Back alignment and structure |
| >pdb|2NVU|A Chain A, Structure Of Appbp1-Uba3~nedd8-Nedd8-Mgatp-Ubc12(C111a), A Trapped Ubiquitin-Like Protein Activation Complex Length = 536 | Back alignment and structure |
| >pdb|1TT5|A Chain A, Structure Of Appbp1-Uba3-Ubc12n26: A Unique E1-E2 Interaction Required For Optimal Conjugation Of The Ubiquitin-Like Protein Nedd8 Length = 531 | Back alignment and structure |
| >pdb|1TT5|A Chain A, Structure Of Appbp1-Uba3-Ubc12n26: A Unique E1-E2 Interaction Required For Optimal Conjugation Of The Ubiquitin-Like Protein Nedd8 Length = 531 | Back alignment and structure |
| >pdb|1YOV|A Chain A, Insights Into The Ubiquitin Transfer Cascade From The Refined Structure Of The Activating Enzyme For Nedd8 Length = 537 | Back alignment and structure |
| >pdb|1YOV|A Chain A, Insights Into The Ubiquitin Transfer Cascade From The Refined Structure Of The Activating Enzyme For Nedd8 Length = 537 | Back alignment and structure |
| >pdb|1R4M|A Chain A, Appbp1-Uba3-Nedd8, An E1-Ubiquitin-Like Protein Complex Length = 529 | Back alignment and structure |
| >pdb|1R4M|A Chain A, Appbp1-Uba3-Nedd8, An E1-Ubiquitin-Like Protein Complex Length = 529 | Back alignment and structure |
| >pdb|1ZFN|A Chain A, Structural Analysis Of Escherichia Coli Thif Length = 253 | Back alignment and structure |
| >pdb|1ZFN|A Chain A, Structural Analysis Of Escherichia Coli Thif Length = 253 | Back alignment and structure |
| >pdb|1ZUD|1 Chain 1, Structure Of This-Thif Protein Complex Length = 251 | Back alignment and structure |
| >pdb|1ZUD|1 Chain 1, Structure Of This-Thif Protein Complex Length = 251 | Back alignment and structure |
| >pdb|1JWB|B Chain B, Structure Of The Covalent Acyl-Adenylate Form Of The Moeb-Moad Protein Complex Length = 249 | Back alignment and structure |
| >pdb|3H5A|A Chain A, Crystal Structure Of E. Coli Mccb Length = 358 | Back alignment and structure |
| >pdb|3H5N|A Chain A, Crystal Structure Of E. Coli Mccb + Atp Length = 353 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST
Original result of RPS-BLAST against PDB70 database
| >3cmm_A Ubiquitin-activating enzyme E1 1; UBA1, protein turnover, ligase, conformationa thioester, adenylation, transthioesterification, ATP-bindin nucleotide-binding; 2.70A {Saccharomyces cerevisiae} Length = 1015 | Back alignment and structure |
|---|
Score = 1012 bits (2618), Expect = 0.0
Identities = 456/1024 (44%), Positives = 654/1024 (63%), Gaps = 26/1024 (2%)
Query: 95 SDIDEDLHSRQLAVYGRETMRRLFASNILISGMQGLGAEIAKNLILAGVKSVTLHDEGVV 154
+IDE L+SRQL V G+E M ++ SN+LI G++GLG EIAKN++LAGVKS+T+ D V
Sbjct: 3 GEIDESLYSRQLYVLGKEAMLKMQTSNVLILGLKGLGVEIAKNVVLAGVKSMTVFDPEPV 62
Query: 155 ELWDLSSNFIFSEDDVGKNRALASIQKLQELNNAVAISALTTELTKEKLSDFQAVVFTD- 213
+L DLS+ F +E D+G+ R + KL ELN V ++ L + +LS FQ VV TD
Sbjct: 63 QLADLSTQFFLTEKDIGQKRGDVTRAKLAELNAYVPVNVLDSLDDVTQLSQFQVVVATDT 122
Query: 214 ISLEKAVEFDDYCHNHQPPIAFIKSEVRGLFGNIFCDFGPEFTVFDVDGEEPHTGIIASI 273
+SLE V+ +++CH+ I FI SE RGLFGN F D G EFTV D GEEP TG+++ I
Sbjct: 123 VSLEDKVKINEFCHSSG--IRFISSETRGLFGNTFVDLGDEFTVLDPTGEEPRTGMVSDI 180
Query: 274 SNDNPPLISCVDDERIEFQDGDLVVFSEVHGMTELNDGKPRKVKNARPYSFSIDEDTTNY 333
D ++ +DD R +DG+ V FSEV G+ +LNDG KV+ P++F I Y
Sbjct: 181 EPD--GTVTMLDDNRHGLEDGNFVRFSEVEGLDKLNDGTLFKVEVLGPFAFRI-GSVKEY 237
Query: 334 SAYEKGGIVTQVKQPKIINFKPLREALKDPGDFLLSDFSKFDRPPVLHLAFQALDKF-IQ 392
Y+KGGI T+VK P+ I+FK L++ L +P +F+ SDF+KFDR LHL FQAL +F ++
Sbjct: 238 GEYKKGGIFTEVKVPRKISFKSLKQQLSNP-EFVFSDFAKFDRAAQLHLGFQALHQFAVR 296
Query: 393 ELGRFPVAGSEEDAQKIISLFTNINDNLAD--ERVEEIDHKLLCHFAFGARAVLNPMAAM 450
G P ++EDA ++I L T+++ + +++ L+ ++ AR + + A
Sbjct: 297 HNGELPRTMNDEDANELIKLVTDLSVQQPEVLGEGVDVNEDLIKELSYQARGDIPGVVAF 356
Query: 451 FGGIVGQEVVKACSGKFHPLLQFFYFDSVESLP---SEPLDPRDLQPLNSRYDAQISVFG 507
FGG+V QEV+KACSGKF PL QF YFDS+ESLP + P + + QP+NSRYD QI+VFG
Sbjct: 357 FGGLVAQEVLKACSGKFTPLKQFMYFDSLESLPDPKNFPRNEKTTQPVNSRYDNQIAVFG 416
Query: 508 SKLQKKLEEAKVFVVGSGALGCEFLKNLALMGVSCGNQGKLTITDDDVIEKSNLSRQFLF 567
QKK+ +KVF+VGSGA+GCE LKN AL+G+ G+ G + +TD+D IEKSNL+RQFLF
Sbjct: 417 LDFQKKIANSKVFLVGSGAIGCEMLKNWALLGLGSGSDGYIVVTDNDSIEKSNLNRQFLF 476
Query: 568 RDWNIGQAKSTVAASAAALINPHLNTE--ALQIRANPETENVFNDTFWENLNVVVNALDN 625
R ++G+ KS VAA A +NP L + A + PETE +FND+FWE+L+ V NALDN
Sbjct: 477 RPKDVGKNKSEVAAEAVCAMNPDLKGKINAKIDKVGPETEEIFNDSFWESLDFVTNALDN 536
Query: 626 VNARLYIDQRCLYFQKPLLESGTLGAKCNTQMVIPHLTENYGASRDPPEKQAPMCTVHSF 685
V+AR Y+D+RC++++KPLLESGTLG K NTQ++IP LTE+Y +SRDPPEK P+CT+ SF
Sbjct: 537 VDARTYVDRRCVFYRKPLLESGTLGTKGNTQVIIPRLTESYSSSRDPPEKSIPLCTLRSF 596
Query: 686 PHNIDHCLTWARSEFEGLLEKTPAEVNAYLTSPTEYASAMKNAGDAQARDNLDRVLECLD 745
P+ IDH + WA+S F+G + VN YLT P +K +GD + L+ + + L
Sbjct: 597 PNKIDHTIAWAKSLFQGYFTDSAENVNMYLTQPNFVEQTLKQSGD--VKGVLESISDSLS 654
Query: 746 KERCETFQDCITWARLRFEDYFADRVKQLTFTFPENATTSNGTPFWSAPKRFPRPLQFSV 805
+ F+DCI WARL FE F +KQL F FP++A TSNG PFWS KR P PL+F +
Sbjct: 655 -SKPHNFEDCIKWARLEFEKKFNHDIKQLLFNFPKDAKTSNGEPFWSGAKRAPTPLEFDI 713
Query: 806 DDLSHLQFLMAASILRAETYGIPIPDWVKSPV--KLADAVNKVIVPDFQPKENVKIETDE 863
+ H F++A + LRA YGI D P + ++ +I+P+F P N+KI+ ++
Sbjct: 714 YNNDHFHFVVAGASLRAYNYGIKSDDSNSKPNVDEYKSVIDHMIIPEFTPNANLKIQVND 773
Query: 864 KATSMSTGSIDDAVVINELLQKLEKCQKQLPTGYKMNPIQFEKDDDTNFHMDLIAGLANM 923
+ + + + I++L+ L G+K+ P+ FEKDDDTN H++ I +N
Sbjct: 774 DDPDPNANAANGSDEIDQLVSSLPDPSTL--AGFKLEPVDFEKDDDTNHHIEFITACSNC 831
Query: 924 RARNYGIPEVDKLKAKFIAGRIIPAIATSTAMATGLVCLELYKVLDGGHKLEDYRNTFAN 983
RA+NY I D+ K KFIAGRIIPAIAT+T++ TGLV LELYK++D +E Y+N F N
Sbjct: 832 RAQNYFIETADRQKTKFIAGRIIPAIATTTSLVTGLVNLELYKLIDNKTDIEQYKNGFVN 891
Query: 984 LALPLFSMAEPVPPKVFKHQDMSW-TVWDRWILRDNPTLRQLLQWLQDK-GLNAYSISYG 1041
LALP F +EP+ ++ + + +WDR+ ++ + L L++ + GL +SYG
Sbjct: 892 LALPFFGFSEPIASPKGEYNNKKYDKIWDRFDIKGDIKLSDLIEHFEKDEGLEITMLSYG 951
Query: 1042 SCLLFNSMFPRHK--ERMDKKVVDLVRDVAKAELPPYRQHFDVVVACVDEDDNDIDIPQI 1099
LL+ S FP K ER++ + LV+ V K ++P + + + D++ D+++P I
Sbjct: 952 VSLLYASFFPPKKLKERLNLPITQLVKLVTKKDIPAHVSTMILEICADDKEGEDVEVPFI 1011
Query: 1100 SIYF 1103
+I+
Sbjct: 1012 TIHL 1015
|
| >3cmm_A Ubiquitin-activating enzyme E1 1; UBA1, protein turnover, ligase, conformationa thioester, adenylation, transthioesterification, ATP-bindin nucleotide-binding; 2.70A {Saccharomyces cerevisiae} Length = 1015 | Back alignment and structure |
|---|
| >1y8q_B Anthracycline-, ubiquitin-like 2 activating enzyme E1B; SUMO, heterodimer, UBL, ligase; HET: ATP; 2.25A {Homo sapiens} PDB: 1y8r_B* 3kyc_B* 3kyd_B* 2px9_A Length = 640 | Back alignment and structure |
|---|
| >1y8q_B Anthracycline-, ubiquitin-like 2 activating enzyme E1B; SUMO, heterodimer, UBL, ligase; HET: ATP; 2.25A {Homo sapiens} PDB: 1y8r_B* 3kyc_B* 3kyd_B* 2px9_A Length = 640 | Back alignment and structure |
|---|
| >1y8q_A Ubiquitin-like 1 activating enzyme E1A; SUMO, heterodimer, UBL, ligase; HET: ATP; 2.25A {Homo sapiens} PDB: 1y8r_A* 3kyc_A* 3kyd_A* Length = 346 | Back alignment and structure |
|---|
| >1y8q_A Ubiquitin-like 1 activating enzyme E1A; SUMO, heterodimer, UBL, ligase; HET: ATP; 2.25A {Homo sapiens} PDB: 1y8r_A* 3kyc_A* 3kyd_A* Length = 346 | Back alignment and structure |
|---|
| >1z7l_A Ubiquitin-activating enzyme E1 1; SCCH, second catalytic cysteine half-domain, ligase; HET: TBR; 2.80A {Mus musculus} Length = 276 | Back alignment and structure |
|---|
| >2nvu_B Maltose binding protein/NEDD8-activating enzyme E1 catalytic subunit chimera; multifunction macromolecular complex, ubiquitin, ATP, conformational change, thioester, switch, adenylation, protein turnover, ligase; HET: ATP; 2.80A {Homo sapiens} SCOP: c.111.1.2 c.94.1.1 Length = 805 | Back alignment and structure |
|---|
| >2nvu_B Maltose binding protein/NEDD8-activating enzyme E1 catalytic subunit chimera; multifunction macromolecular complex, ubiquitin, ATP, conformational change, thioester, switch, adenylation, protein turnover, ligase; HET: ATP; 2.80A {Homo sapiens} SCOP: c.111.1.2 c.94.1.1 Length = 805 | Back alignment and structure |
|---|
| >2nvu_B Maltose binding protein/NEDD8-activating enzyme E1 catalytic subunit chimera; multifunction macromolecular complex, ubiquitin, ATP, conformational change, thioester, switch, adenylation, protein turnover, ligase; HET: ATP; 2.80A {Homo sapiens} SCOP: c.111.1.2 c.94.1.1 Length = 805 | Back alignment and structure |
|---|
| >1tt5_B Ubiquitin-activating enzyme E1C isoform 1; cell cycle, ligase; 2.60A {Homo sapiens} SCOP: c.111.1.2 PDB: 3dbl_B 3dbr_B 3dbh_B 3gzn_B* 1yov_B 1r4m_B 1r4n_B* Length = 434 | Back alignment and structure |
|---|
| >1tt5_B Ubiquitin-activating enzyme E1C isoform 1; cell cycle, ligase; 2.60A {Homo sapiens} SCOP: c.111.1.2 PDB: 3dbl_B 3dbr_B 3dbh_B 3gzn_B* 1yov_B 1r4m_B 1r4n_B* Length = 434 | Back alignment and structure |
|---|
| >1tt5_B Ubiquitin-activating enzyme E1C isoform 1; cell cycle, ligase; 2.60A {Homo sapiens} SCOP: c.111.1.2 PDB: 3dbl_B 3dbr_B 3dbh_B 3gzn_B* 1yov_B 1r4m_B 1r4n_B* Length = 434 | Back alignment and structure |
|---|
| >1tt5_A APPBP1, amyloid protein-binding protein 1; cell cycle, ligase; 2.60A {Homo sapiens} SCOP: c.111.1.2 PDB: 3dbh_A 3dbl_A 3dbr_A 1r4m_A 1r4n_A* 2nvu_A* 1yov_A 3gzn_A* Length = 531 | Back alignment and structure |
|---|
| >1tt5_A APPBP1, amyloid protein-binding protein 1; cell cycle, ligase; 2.60A {Homo sapiens} SCOP: c.111.1.2 PDB: 3dbh_A 3dbl_A 3dbr_A 1r4m_A 1r4n_A* 2nvu_A* 1yov_A 3gzn_A* Length = 531 | Back alignment and structure |
|---|
| >1tt5_A APPBP1, amyloid protein-binding protein 1; cell cycle, ligase; 2.60A {Homo sapiens} SCOP: c.111.1.2 PDB: 3dbh_A 3dbl_A 3dbr_A 1r4m_A 1r4n_A* 2nvu_A* 1yov_A 3gzn_A* Length = 531 | Back alignment and structure |
|---|
| >2v31_A Ubiquitin-activating enzyme E1 X; ligase, phosphorylation, catalytic domain, heteronuclear first catalytic cysteine half-domain, E1 protein; NMR {Mus musculus} Length = 112 | Back alignment and structure |
|---|
| >3h5n_A MCCB protein; ubiquitin-activating enzyme, microcin, protein structure, MCCC7, peptide antibiotics, N-P bond formation, transferase; HET: ATP; 1.90A {Escherichia coli} PDB: 3h5r_A 3h9g_A 3h9j_A* 3h9q_A 3h5a_A Length = 353 | Back alignment and structure |
|---|
| >3h5n_A MCCB protein; ubiquitin-activating enzyme, microcin, protein structure, MCCC7, peptide antibiotics, N-P bond formation, transferase; HET: ATP; 1.90A {Escherichia coli} PDB: 3h5r_A 3h9g_A 3h9j_A* 3h9q_A 3h5a_A Length = 353 | Back alignment and structure |
|---|
| >1jw9_B Molybdopterin biosynthesis MOEB protein; MOEB: modified rossmann fold, (2) Cys-X-X-Cys zinc-binding M MOAD: ubiquitin-like fold; 1.70A {Escherichia coli} SCOP: c.111.1.1 PDB: 1jwa_B* 1jwb_B* Length = 249 | Back alignment and structure |
|---|
| >1jw9_B Molybdopterin biosynthesis MOEB protein; MOEB: modified rossmann fold, (2) Cys-X-X-Cys zinc-binding M MOAD: ubiquitin-like fold; 1.70A {Escherichia coli} SCOP: c.111.1.1 PDB: 1jwa_B* 1jwb_B* Length = 249 | Back alignment and structure |
|---|
| >1zud_1 Adenylyltransferase THIF; thiamin, thiazole, protein-protein complex, THIF, TRAN biosynthetic protein complex; 1.98A {Escherichia coli} PDB: 1zfn_A* 1zkm_A Length = 251 | Back alignment and structure |
|---|
| >1zud_1 Adenylyltransferase THIF; thiamin, thiazole, protein-protein complex, THIF, TRAN biosynthetic protein complex; 1.98A {Escherichia coli} PDB: 1zfn_A* 1zkm_A Length = 251 | Back alignment and structure |
|---|
| >3h8v_A Ubiquitin-like modifier-activating enzyme 5; rossman fold, ATP-binding, UBL conjugation pathway, transfer structural genomics consortium, SGC; HET: ATP; 2.00A {Homo sapiens} PDB: 3guc_A* Length = 292 | Back alignment and structure |
|---|
| >3h8v_A Ubiquitin-like modifier-activating enzyme 5; rossman fold, ATP-binding, UBL conjugation pathway, transfer structural genomics consortium, SGC; HET: ATP; 2.00A {Homo sapiens} PDB: 3guc_A* Length = 292 | Back alignment and structure |
|---|
| >3rui_A Ubiquitin-like modifier-activating enzyme ATG7; autophagosome formation, non-canonical E1, ATP BI UBL, ATG8, ATG12, ATG10, ATG3, UBL activation, thiolation; 1.91A {Saccharomyces cerevisiae} PDB: 3t7e_A 3vh3_A 3vh4_A* Length = 340 | Back alignment and structure |
|---|
| >3rui_A Ubiquitin-like modifier-activating enzyme ATG7; autophagosome formation, non-canonical E1, ATP BI UBL, ATG8, ATG12, ATG10, ATG3, UBL activation, thiolation; 1.91A {Saccharomyces cerevisiae} PDB: 3t7e_A 3vh3_A 3vh4_A* Length = 340 | Back alignment and structure |
|---|
| >3vh1_A Ubiquitin-like modifier-activating enzyme ATG7; autophagy, zinc binding, metal binding protein; 3.00A {Saccharomyces cerevisiae} PDB: 3vh2_A Length = 598 | Back alignment and structure |
|---|
| >3vh1_A Ubiquitin-like modifier-activating enzyme ATG7; autophagy, zinc binding, metal binding protein; 3.00A {Saccharomyces cerevisiae} PDB: 3vh2_A Length = 598 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch
Original result of HHsearch against PDB70 database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 1104 | |||
| 3cmm_A | 1015 | Ubiquitin-activating enzyme E1 1; UBA1, protein tu | 100.0 | |
| 1y8q_B | 640 | Anthracycline-, ubiquitin-like 2 activating enzyme | 100.0 | |
| 1z7l_A | 276 | Ubiquitin-activating enzyme E1 1; SCCH, second cat | 100.0 | |
| 1tt5_A | 531 | APPBP1, amyloid protein-binding protein 1; cell cy | 100.0 | |
| 1y8q_A | 346 | Ubiquitin-like 1 activating enzyme E1A; SUMO, hete | 100.0 | |
| 1tt5_B | 434 | Ubiquitin-activating enzyme E1C isoform 1; cell cy | 100.0 | |
| 2nvu_B | 805 | Maltose binding protein/NEDD8-activating enzyme E1 | 100.0 | |
| 1y8q_A | 346 | Ubiquitin-like 1 activating enzyme E1A; SUMO, hete | 100.0 | |
| 1tt5_A | 531 | APPBP1, amyloid protein-binding protein 1; cell cy | 100.0 | |
| 1tt5_B | 434 | Ubiquitin-activating enzyme E1C isoform 1; cell cy | 100.0 | |
| 3h8v_A | 292 | Ubiquitin-like modifier-activating enzyme 5; rossm | 100.0 | |
| 1zud_1 | 251 | Adenylyltransferase THIF; thiamin, thiazole, prote | 99.98 | |
| 1zud_1 | 251 | Adenylyltransferase THIF; thiamin, thiazole, prote | 99.98 | |
| 2nvu_B | 805 | Maltose binding protein/NEDD8-activating enzyme E1 | 99.97 | |
| 1jw9_B | 249 | Molybdopterin biosynthesis MOEB protein; MOEB: mod | 99.97 | |
| 3h5n_A | 353 | MCCB protein; ubiquitin-activating enzyme, microci | 99.97 | |
| 1y8q_B | 640 | Anthracycline-, ubiquitin-like 2 activating enzyme | 99.97 | |
| 3rui_A | 340 | Ubiquitin-like modifier-activating enzyme ATG7; au | 99.96 | |
| 3cmm_A | 1015 | Ubiquitin-activating enzyme E1 1; UBA1, protein tu | 99.96 | |
| 1jw9_B | 249 | Molybdopterin biosynthesis MOEB protein; MOEB: mod | 99.95 | |
| 3h8v_A | 292 | Ubiquitin-like modifier-activating enzyme 5; rossm | 99.95 | |
| 4gsl_A | 615 | Ubiquitin-like modifier-activating enzyme ATG7; ub | 99.95 | |
| 3vh1_A | 598 | Ubiquitin-like modifier-activating enzyme ATG7; au | 99.95 | |
| 3h5n_A | 353 | MCCB protein; ubiquitin-activating enzyme, microci | 99.94 | |
| 3rui_A | 340 | Ubiquitin-like modifier-activating enzyme ATG7; au | 99.93 | |
| 4gsl_A | 615 | Ubiquitin-like modifier-activating enzyme ATG7; ub | 99.92 | |
| 3vh1_A | 598 | Ubiquitin-like modifier-activating enzyme ATG7; au | 99.92 | |
| 2v31_A | 112 | Ubiquitin-activating enzyme E1 X; ligase, phosphor | 99.91 | |
| 1z7l_A | 276 | Ubiquitin-activating enzyme E1 1; SCCH, second cat | 98.43 | |
| 1y8x_B | 98 | Ubiquitin-activating enzyme E1C; ubiquitin-conjuga | 97.16 | |
| 3dfz_A | 223 | SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase | 97.15 | |
| 3jyo_A | 283 | Quinate/shikimate dehydrogenase; enzyme-cofactor c | 96.99 | |
| 3jyo_A | 283 | Quinate/shikimate dehydrogenase; enzyme-cofactor c | 96.74 | |
| 1kyq_A | 274 | Met8P, siroheme biosynthesis protein Met8; homodim | 96.66 | |
| 1pjq_A | 457 | CYSG, siroheme synthase; rossman fold, nucleotide | 96.58 | |
| 3ic5_A | 118 | Putative saccharopine dehydrogenase; structural ge | 96.53 | |
| 3dfz_A | 223 | SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase | 96.51 | |
| 3ic5_A | 118 | Putative saccharopine dehydrogenase; structural ge | 96.36 | |
| 3llv_A | 141 | Exopolyphosphatase-related protein; NAD(P)-binding | 96.06 | |
| 2g1u_A | 155 | Hypothetical protein TM1088A; structural genomics, | 95.98 | |
| 3t4e_A | 312 | Quinate/shikimate dehydrogenase; structural genomi | 95.9 | |
| 3llv_A | 141 | Exopolyphosphatase-related protein; NAD(P)-binding | 95.87 | |
| 3tnl_A | 315 | Shikimate dehydrogenase; structural genomics, cent | 95.87 | |
| 2hmt_A | 144 | YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane | 95.8 | |
| 2g1u_A | 155 | Hypothetical protein TM1088A; structural genomics, | 95.74 | |
| 2hmt_A | 144 | YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane | 95.47 | |
| 3tum_A | 269 | Shikimate dehydrogenase family protein; rossmann-f | 95.47 | |
| 1id1_A | 153 | Putative potassium channel protein; RCK domain, E. | 95.42 | |
| 3tum_A | 269 | Shikimate dehydrogenase family protein; rossmann-f | 95.35 | |
| 1lss_A | 140 | TRK system potassium uptake protein TRKA homolog; | 95.23 | |
| 3tnl_A | 315 | Shikimate dehydrogenase; structural genomics, cent | 95.17 | |
| 1lss_A | 140 | TRK system potassium uptake protein TRKA homolog; | 95.02 | |
| 1kyq_A | 274 | Met8P, siroheme biosynthesis protein Met8; homodim | 94.99 | |
| 3e8x_A | 236 | Putative NAD-dependent epimerase/dehydratase; stru | 94.92 | |
| 3abi_A | 365 | Putative uncharacterized protein PH1688; L-lysine | 94.78 | |
| 3abi_A | 365 | Putative uncharacterized protein PH1688; L-lysine | 94.74 | |
| 3pwz_A | 272 | Shikimate dehydrogenase 3; alpha-beta, oxidoreduct | 94.73 | |
| 2ph5_A | 480 | Homospermidine synthase; alpha-beta protein, struc | 94.66 | |
| 4ina_A | 405 | Saccharopine dehydrogenase; structural genomics, P | 94.6 | |
| 3t4e_A | 312 | Quinate/shikimate dehydrogenase; structural genomi | 94.57 | |
| 3gvi_A | 324 | Malate dehydrogenase; NAD, oxidoreductase, tricarb | 94.5 | |
| 1pjq_A | 457 | CYSG, siroheme synthase; rossman fold, nucleotide | 94.37 | |
| 3oj0_A | 144 | Glutr, glutamyl-tRNA reductase; structural genomic | 94.35 | |
| 3o8q_A | 281 | Shikimate 5-dehydrogenase I alpha; structural geno | 94.35 | |
| 3pwz_A | 272 | Shikimate dehydrogenase 3; alpha-beta, oxidoreduct | 94.32 | |
| 4ina_A | 405 | Saccharopine dehydrogenase; structural genomics, P | 94.28 | |
| 1id1_A | 153 | Putative potassium channel protein; RCK domain, E. | 94.27 | |
| 3c85_A | 183 | Putative glutathione-regulated potassium-efflux S | 94.21 | |
| 3l4b_C | 218 | TRKA K+ channel protien TM1088B; potassium channel | 94.21 | |
| 2egg_A | 297 | AROE, shikimate 5-dehydrogenase; dimer, X-RAY diff | 94.18 | |
| 3fwz_A | 140 | Inner membrane protein YBAL; TRKA-N domain, E.coli | 94.06 | |
| 3oj0_A | 144 | Glutr, glutamyl-tRNA reductase; structural genomic | 93.97 | |
| 2z2v_A | 365 | Hypothetical protein PH1688; L-lysine dehydrogenas | 93.77 | |
| 3o8q_A | 281 | Shikimate 5-dehydrogenase I alpha; structural geno | 93.76 | |
| 3e8x_A | 236 | Putative NAD-dependent epimerase/dehydratase; stru | 93.64 | |
| 3l4b_C | 218 | TRKA K+ channel protien TM1088B; potassium channel | 93.61 | |
| 1hyh_A | 309 | L-hicdh, L-2-hydroxyisocaproate dehydrogenase; L-2 | 93.61 | |
| 2egg_A | 297 | AROE, shikimate 5-dehydrogenase; dimer, X-RAY diff | 93.56 | |
| 3p7m_A | 321 | Malate dehydrogenase; putative dehydrogenase, enzy | 93.45 | |
| 2d4a_B | 308 | Malate dehydrogenase; archaea, hyperthermophIle, o | 93.42 | |
| 3rku_A | 287 | Oxidoreductase YMR226C; substrate fingerprint, sho | 93.4 | |
| 3ruf_A | 351 | WBGU; rossmann fold, UDP-hexose 4-epimerase, isome | 93.34 | |
| 3don_A | 277 | Shikimate dehydrogenase; alpha-beta structure, ros | 93.28 | |
| 3qsg_A | 312 | NAD-binding phosphogluconate dehydrogenase-like P; | 93.2 | |
| 3h2s_A | 224 | Putative NADH-flavin reductase; Q03B84, NESG, LCR1 | 93.19 | |
| 3d0o_A | 317 | L-LDH 1, L-lactate dehydrogenase 1; cytoplasm, gly | 93.16 | |
| 3don_A | 277 | Shikimate dehydrogenase; alpha-beta structure, ros | 93.12 | |
| 3t4x_A | 267 | Oxidoreductase, short chain dehydrogenase/reducta; | 93.04 | |
| 3dqp_A | 219 | Oxidoreductase YLBE; alpha-beta protein., structur | 92.96 | |
| 1hdo_A | 206 | Biliverdin IX beta reductase; foetal metabolism, H | 92.9 | |
| 3gpi_A | 286 | NAD-dependent epimerase/dehydratase; structural ge | 92.85 | |
| 2raf_A | 209 | Putative dinucleotide-binding oxidoreductase; NP_7 | 92.83 | |
| 1ldn_A | 316 | L-lactate dehydrogenase; oxidoreductase(CHOH(D)-NA | 92.78 | |
| 3dhn_A | 227 | NAD-dependent epimerase/dehydratase; reductase, PF | 92.71 | |
| 2z2v_A | 365 | Hypothetical protein PH1688; L-lysine dehydrogenas | 92.69 | |
| 3vku_A | 326 | L-LDH, L-lactate dehydrogenase; rossmann fold, NAD | 92.56 | |
| 1oju_A | 294 | MDH, malate dehydrogenase; hyperthermophilic, oxid | 92.46 | |
| 1npy_A | 271 | Hypothetical shikimate 5-dehydrogenase-like protei | 92.42 | |
| 3pqe_A | 326 | L-LDH, L-lactate dehydrogenase; FBP, oxidoreductas | 92.32 | |
| 2b69_A | 343 | UDP-glucuronate decarboxylase 1; UDP-glucoronic ac | 92.32 | |
| 3dhn_A | 227 | NAD-dependent epimerase/dehydratase; reductase, PF | 92.31 | |
| 2ewd_A | 317 | Lactate dehydrogenase,; protein-substrate_cofactor | 92.28 | |
| 4g65_A | 461 | TRK system potassium uptake protein TRKA; structur | 92.2 | |
| 3doj_A | 310 | AT3G25530, dehydrogenase-like protein; gamma-hydro | 92.18 | |
| 4aj2_A | 331 | L-lactate dehydrogenase A chain; oxidoreductase-in | 92.17 | |
| 2hk9_A | 275 | Shikimate dehydrogenase; shikimate pathway, drug d | 92.08 | |
| 2aef_A | 234 | Calcium-gated potassium channel MTHK; rossmann fol | 92.03 | |
| 3gpi_A | 286 | NAD-dependent epimerase/dehydratase; structural ge | 92.02 | |
| 2x0j_A | 294 | Malate dehydrogenase; oxidoreductase, hyperthermop | 92.01 | |
| 4ezb_A | 317 | Uncharacterized conserved protein; structural geno | 91.97 | |
| 3tl2_A | 315 | Malate dehydrogenase; center for structural genomi | 91.97 | |
| 4e21_A | 358 | 6-phosphogluconate dehydrogenase (decarboxylating; | 91.95 | |
| 3o38_A | 266 | Short chain dehydrogenase; tuberculosis, ortholog | 91.82 | |
| 2h78_A | 302 | Hibadh, 3-hydroxyisobutyrate dehydrogenase; APC601 | 91.8 | |
| 4egb_A | 346 | DTDP-glucose 4,6-dehydratase; rhamnose pathway, ce | 91.79 | |
| 3slg_A | 372 | PBGP3 protein; structural genomics, seattle struct | 91.68 | |
| 4id9_A | 347 | Short-chain dehydrogenase/reductase; putative dehy | 91.65 | |
| 1hdo_A | 206 | Biliverdin IX beta reductase; foetal metabolism, H | 91.63 | |
| 4id9_A | 347 | Short-chain dehydrogenase/reductase; putative dehy | 91.63 | |
| 3fbt_A | 282 | Chorismate mutase and shikimate 5-dehydrogenase fu | 91.54 | |
| 4egb_A | 346 | DTDP-glucose 4,6-dehydratase; rhamnose pathway, ce | 91.5 | |
| 3lf2_A | 265 | Short chain oxidoreductase Q9HYA2; SDR, SCOR, ross | 91.44 | |
| 2raf_A | 209 | Putative dinucleotide-binding oxidoreductase; NP_7 | 91.39 | |
| 3slg_A | 372 | PBGP3 protein; structural genomics, seattle struct | 91.29 | |
| 3rku_A | 287 | Oxidoreductase YMR226C; substrate fingerprint, sho | 91.29 | |
| 3gvi_A | 324 | Malate dehydrogenase; NAD, oxidoreductase, tricarb | 91.25 | |
| 1xg5_A | 279 | ARPG836; short chain dehydrogenase, human, SGC, st | 91.23 | |
| 1gpj_A | 404 | Glutamyl-tRNA reductase; tRNA-dependent tetrapyrro | 91.22 | |
| 3onh_A | 127 | Ubiquitin-activating enzyme E1-like; ligase, SUMO | 91.21 | |
| 2hjr_A | 328 | Malate dehydrogenase; malaria, structural genomics | 91.19 | |
| 1p9l_A | 245 | Dihydrodipicolinate reductase; oxidoreductase, lys | 91.15 | |
| 3ldh_A | 330 | Lactate dehydrogenase; oxidoreductase, CHOH donor, | 91.15 | |
| 2v6b_A | 304 | L-LDH, L-lactate dehydrogenase; oxidoreductase, ra | 91.15 | |
| 1ur5_A | 309 | Malate dehydrogenase; oxidoreductase, tricarboxyli | 91.14 | |
| 3phh_A | 269 | Shikimate dehydrogenase; shikimate pathway, helico | 91.02 | |
| 2axq_A | 467 | Saccharopine dehydrogenase; rossmann fold variant, | 90.99 | |
| 4e12_A | 283 | Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1 | 90.95 | |
| 3qsg_A | 312 | NAD-binding phosphogluconate dehydrogenase-like P; | 90.88 | |
| 3ruf_A | 351 | WBGU; rossmann fold, UDP-hexose 4-epimerase, isome | 90.86 | |
| 4ezb_A | 317 | Uncharacterized conserved protein; structural geno | 90.82 | |
| 1y1p_A | 342 | ARII, aldehyde reductase II; rossmann fold, short | 90.72 | |
| 3nyw_A | 250 | Putative oxidoreductase; fatty acid synthesis,3-ox | 90.67 | |
| 2pzm_A | 330 | Putative nucleotide sugar epimerase/ dehydratase; | 90.64 | |
| 3l9w_A | 413 | Glutathione-regulated potassium-efflux system Pro | 90.63 | |
| 1lld_A | 319 | L-lactate dehydrogenase; oxidoreductase(CHOH (D)-N | 90.57 | |
| 3l9w_A | 413 | Glutathione-regulated potassium-efflux system Pro | 90.52 | |
| 3ew7_A | 221 | LMO0794 protein; Q8Y8U8_lismo, putative NAD-depend | 90.42 | |
| 3dqp_A | 219 | Oxidoreductase YLBE; alpha-beta protein., structur | 90.38 | |
| 3d1l_A | 266 | Putative NADP oxidoreductase BF3122; structural ge | 90.37 | |
| 3o26_A | 311 | Salutaridine reductase; short chain dehydrogenase/ | 90.29 | |
| 3qiv_A | 253 | Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR | 90.28 | |
| 3qvo_A | 236 | NMRA family protein; structural genomics, PSI-biol | 90.27 | |
| 3m2p_A | 311 | UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J | 90.27 | |
| 1iy8_A | 267 | Levodione reductase; oxidoreductase; HET: NAD; 1.6 | 90.23 | |
| 2ph5_A | 480 | Homospermidine synthase; alpha-beta protein, struc | 90.23 | |
| 3obb_A | 300 | Probable 3-hydroxyisobutyrate dehydrogenase; struc | 90.22 | |
| 1nyt_A | 271 | Shikimate 5-dehydrogenase; alpha/beta domains, WID | 90.15 | |
| 3tri_A | 280 | Pyrroline-5-carboxylate reductase; amino acid bios | 90.14 | |
| 3hg7_A | 324 | D-isomer specific 2-hydroxyacid dehydrogenase FAM | 90.14 | |
| 1p77_A | 272 | Shikimate 5-dehydrogenase; NADPH, oxidoreductase; | 90.12 | |
| 1y1p_A | 342 | ARII, aldehyde reductase II; rossmann fold, short | 90.07 | |
| 3tri_A | 280 | Pyrroline-5-carboxylate reductase; amino acid bios | 90.06 | |
| 3fwz_A | 140 | Inner membrane protein YBAL; TRKA-N domain, E.coli | 90.05 | |
| 1sb8_A | 352 | WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCN | 90.02 | |
| 3fi9_A | 343 | Malate dehydrogenase; structural genomics, oxidore | 90.0 | |
| 3d1l_A | 266 | Putative NADP oxidoreductase BF3122; structural ge | 89.96 | |
| 1ez4_A | 318 | Lactate dehydrogenase; rossmann fold, oxidoreducta | 89.92 | |
| 3pp8_A | 315 | Glyoxylate/hydroxypyruvate reductase A; structural | 89.88 | |
| 1t2d_A | 322 | LDH-P, L-lactate dehydrogenase; ternary complex, o | 89.87 | |
| 3u62_A | 253 | Shikimate dehydrogenase; shikimate pathway, oxidor | 89.87 | |
| 3m2p_A | 311 | UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J | 89.83 | |
| 3evt_A | 324 | Phosphoglycerate dehydrogenase; structural genomic | 89.78 | |
| 1lu9_A | 287 | Methylene tetrahydromethanopterin dehydrogenase; a | 89.77 | |
| 1nvt_A | 287 | Shikimate 5'-dehydrogenase; structural genomics, P | 89.64 | |
| 4gbj_A | 297 | 6-phosphogluconate dehydrogenase NAD-binding; stru | 89.62 | |
| 2bka_A | 242 | CC3, TAT-interacting protein TIP30; NADPH, PEG600, | 89.61 | |
| 2pzm_A | 330 | Putative nucleotide sugar epimerase/ dehydratase; | 89.58 | |
| 3pef_A | 287 | 6-phosphogluconate dehydrogenase, NAD-binding; gam | 89.46 | |
| 3ius_A | 286 | Uncharacterized conserved protein; APC63810, silic | 89.35 | |
| 1sby_A | 254 | Alcohol dehydrogenase; ternary complex, NAD, trifl | 89.3 | |
| 1a5z_A | 319 | L-lactate dehydrogenase; oxidoreductase, glycolysi | 89.27 | |
| 4g65_A | 461 | TRK system potassium uptake protein TRKA; structur | 89.22 | |
| 3qvo_A | 236 | NMRA family protein; structural genomics, PSI-biol | 89.2 | |
| 3ko8_A | 312 | NAD-dependent epimerase/dehydratase; isomerase, UD | 89.16 | |
| 2gn4_A | 344 | FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann | 89.12 | |
| 3rkr_A | 262 | Short chain oxidoreductase; rossmann fold; HET: NA | 89.11 | |
| 2hjr_A | 328 | Malate dehydrogenase; malaria, structural genomics | 89.06 | |
| 1lu9_A | 287 | Methylene tetrahydromethanopterin dehydrogenase; a | 89.06 | |
| 3p7m_A | 321 | Malate dehydrogenase; putative dehydrogenase, enzy | 89.05 | |
| 3dtt_A | 245 | NADP oxidoreductase; structural genomics, joint ce | 89.04 | |
| 3c85_A | 183 | Putative glutathione-regulated potassium-efflux S | 89.02 | |
| 1ff9_A | 450 | Saccharopine reductase; lysine biosynthesis, alpha | 88.98 | |
| 3r6d_A | 221 | NAD-dependent epimerase/dehydratase; structural ge | 88.97 | |
| 3nzo_A | 399 | UDP-N-acetylglucosamine 4,6-dehydratase; structura | 88.97 | |
| 2b69_A | 343 | UDP-glucuronate decarboxylase 1; UDP-glucoronic ac | 88.92 | |
| 3ius_A | 286 | Uncharacterized conserved protein; APC63810, silic | 88.91 | |
| 3ioy_A | 319 | Short-chain dehydrogenase/reductase SDR; structura | 88.87 | |
| 3vps_A | 321 | TUNA, NAD-dependent epimerase/dehydratase; tunicam | 88.82 | |
| 3nep_X | 314 | Malate dehydrogenase; halophIle, molecular adpatat | 88.79 | |
| 1sb8_A | 352 | WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCN | 88.76 | |
| 3vku_A | 326 | L-LDH, L-lactate dehydrogenase; rossmann fold, NAD | 88.74 | |
| 2zqz_A | 326 | L-LDH, L-lactate dehydrogenase; oxidoreductase, ro | 88.73 | |
| 1p9l_A | 245 | Dihydrodipicolinate reductase; oxidoreductase, lys | 88.73 | |
| 3pdu_A | 287 | 3-hydroxyisobutyrate dehydrogenase family protein; | 88.7 | |
| 3lk7_A | 451 | UDP-N-acetylmuramoylalanine--D-glutamate ligase; a | 88.69 | |
| 3i1j_A | 247 | Oxidoreductase, short chain dehydrogenase/reducta; | 88.63 | |
| 2axq_A | 467 | Saccharopine dehydrogenase; rossmann fold variant, | 88.52 | |
| 2cvz_A | 289 | Dehydrogenase, 3-hydroxyisobutyrate dehydrogenase; | 88.51 | |
| 2x6t_A | 357 | ADP-L-glycero-D-manno-heptose-6-epimerase; isomera | 88.49 | |
| 3i6i_A | 346 | Putative leucoanthocyanidin reductase 1; rossmann | 88.48 | |
| 2pv7_A | 298 | T-protein [includes: chorismate mutase (EC 5.4.99 | 88.47 | |
| 2bll_A | 345 | Protein YFBG; decarboxylase, short chain dehydroge | 88.45 | |
| 3sxp_A | 362 | ADP-L-glycero-D-mannoheptose-6-epimerase; rossman | 88.43 | |
| 2d5c_A | 263 | AROE, shikimate 5-dehydrogenase; substrate, dimer, | 88.39 | |
| 2xxj_A | 310 | L-LDH, L-lactate dehydrogenase; oxidoreductase, hy | 88.37 | |
| 2bka_A | 242 | CC3, TAT-interacting protein TIP30; NADPH, PEG600, | 88.36 | |
| 1xu9_A | 286 | Corticosteroid 11-beta-dehydrogenase, isozyme 1; h | 88.35 | |
| 2gf2_A | 296 | Hibadh, 3-hydroxyisobutyrate dehydrogenase; struct | 88.31 | |
| 3pqe_A | 326 | L-LDH, L-lactate dehydrogenase; FBP, oxidoreductas | 88.31 | |
| 2x0j_A | 294 | Malate dehydrogenase; oxidoreductase, hyperthermop | 88.21 | |
| 3svt_A | 281 | Short-chain type dehydrogenase/reductase; ssgcid, | 88.16 | |
| 2z1m_A | 345 | GDP-D-mannose dehydratase; short-chain dehydrogena | 88.11 | |
| 3u62_A | 253 | Shikimate dehydrogenase; shikimate pathway, oxidor | 88.09 | |
| 3rft_A | 267 | Uronate dehydrogenase; apoenzyme, rossmann fold, N | 88.08 | |
| 4e21_A | 358 | 6-phosphogluconate dehydrogenase (decarboxylating; | 88.06 | |
| 3r6d_A | 221 | NAD-dependent epimerase/dehydratase; structural ge | 88.0 | |
| 3i6i_A | 346 | Putative leucoanthocyanidin reductase 1; rossmann | 87.98 | |
| 3vps_A | 321 | TUNA, NAD-dependent epimerase/dehydratase; tunicam | 87.98 | |
| 2rir_A | 300 | Dipicolinate synthase, A chain; structural genomic | 87.94 | |
| 3sju_A | 279 | Keto reductase; short-chain dehydrogenase, oxidore | 87.92 | |
| 3kkj_A | 336 | Amine oxidase, flavin-containing; oxidoreductase, | 87.91 | |
| 1pjc_A | 361 | Protein (L-alanine dehydrogenase); oxidoreductase, | 87.81 | |
| 3gt0_A | 247 | Pyrroline-5-carboxylate reductase; structural geno | 87.8 | |
| 3tjr_A | 301 | Short chain dehydrogenase; structural genomics, se | 87.78 | |
| 4fn4_A | 254 | Short chain dehydrogenase; NADH-binding, rossmann | 87.7 | |
| 1ks9_A | 291 | KPA reductase;, 2-dehydropantoate 2-reductase; PAN | 87.7 | |
| 3h7a_A | 252 | Short chain dehydrogenase; oxidoreductase, PSI-2, | 87.68 | |
| 2q1s_A | 377 | Putative nucleotide sugar epimerase/ dehydratase; | 87.64 | |
| 3ucx_A | 264 | Short chain dehydrogenase; ssgcid, seattle structu | 87.64 | |
| 3lyl_A | 247 | 3-oxoacyl-(acyl-carrier-protein) reductase; alpha | 87.51 | |
| 2x4g_A | 342 | Nucleoside-diphosphate-sugar epimerase; isomerase; | 87.47 | |
| 2rcy_A | 262 | Pyrroline carboxylate reductase; malaria, structur | 87.44 | |
| 3gaf_A | 256 | 7-alpha-hydroxysteroid dehydrogenase; seattle stru | 87.42 | |
| 3r1i_A | 276 | Short-chain type dehydrogenase/reductase; structur | 87.39 | |
| 3tox_A | 280 | Short chain dehydrogenase; structural genomics, PS | 87.35 | |
| 1vl6_A | 388 | Malate oxidoreductase; TM0542, NAD-dependent malic | 87.34 | |
| 2x4g_A | 342 | Nucleoside-diphosphate-sugar epimerase; isomerase; | 87.31 | |
| 3sc4_A | 285 | Short chain dehydrogenase (A0QTM2 homolog); ssgcid | 87.29 | |
| 4huj_A | 220 | Uncharacterized protein; PSI-biology, nysgrc, stru | 87.28 | |
| 3sxp_A | 362 | ADP-L-glycero-D-mannoheptose-6-epimerase; rossman | 87.27 | |
| 3uve_A | 286 | Carveol dehydrogenase ((+)-trans-carveol dehydrog; | 87.25 | |
| 4ibo_A | 271 | Gluconate dehydrogenase; enzyme function initiativ | 87.18 | |
| 2cvz_A | 289 | Dehydrogenase, 3-hydroxyisobutyrate dehydrogenase; | 87.17 | |
| 3rwb_A | 247 | TPLDH, pyridoxal 4-dehydrogenase; short chain dehy | 87.14 | |
| 1pzg_A | 331 | LDH, lactate dehydrogenase; apicomplexa, APAD, tet | 87.14 | |
| 2pv7_A | 298 | T-protein [includes: chorismate mutase (EC 5.4.99 | 87.13 | |
| 2z1m_A | 345 | GDP-D-mannose dehydratase; short-chain dehydrogena | 87.08 | |
| 2vhw_A | 377 | Alanine dehydrogenase; NAD, secreted, oxidoreducta | 87.04 | |
| 1x7d_A | 350 | Ornithine cyclodeaminase; binds NAD+, binds L-orni | 87.04 | |
| 1oju_A | 294 | MDH, malate dehydrogenase; hyperthermophilic, oxid | 87.04 | |
| 1guz_A | 310 | Malate dehydrogenase; oxidoreductase, tricarboxyli | 87.03 | |
| 3ego_A | 307 | Probable 2-dehydropantoate 2-reductase; structural | 87.03 | |
| 4da9_A | 280 | Short-chain dehydrogenase/reductase; structural ge | 86.98 | |
| 2z1n_A | 260 | Dehydrogenase; reductase, SDR, oxidoreductase; 1.8 | 86.98 | |
| 4imr_A | 275 | 3-oxoacyl-(acyl-carrier-protein) reductase; oxidor | 86.97 | |
| 3pk0_A | 262 | Short-chain dehydrogenase/reductase SDR; ssgcid, s | 86.95 | |
| 2d4a_B | 308 | Malate dehydrogenase; archaea, hyperthermophIle, o | 86.94 | |
| 3tfo_A | 264 | Putative 3-oxoacyl-(acyl-carrier-protein) reducta; | 86.92 | |
| 4gx0_A | 565 | TRKA domain protein; membrane protein, ION channel | 86.81 | |
| 3ggo_A | 314 | Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-b | 86.8 | |
| 1jay_A | 212 | Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossma | 86.79 | |
| 2eez_A | 369 | Alanine dehydrogenase; TTHA0216, structural genomi | 86.77 | |
| 3e48_A | 289 | Putative nucleoside-diphosphate-sugar epimerase; a | 86.74 | |
| 4dqv_A | 478 | Probable peptide synthetase NRP (peptide synthase; | 86.7 | |
| 1y6j_A | 318 | L-lactate dehydrogenase; southeast collaboratory f | 86.7 | |
| 1lnq_A | 336 | MTHK channels, potassium channel related protein; | 86.67 | |
| 2dpo_A | 319 | L-gulonate 3-dehydrogenase; structural genomics, N | 86.63 | |
| 3nzo_A | 399 | UDP-N-acetylglucosamine 4,6-dehydratase; structura | 86.45 | |
| 3nyw_A | 250 | Putative oxidoreductase; fatty acid synthesis,3-ox | 86.43 | |
| 1ldn_A | 316 | L-lactate dehydrogenase; oxidoreductase(CHOH(D)-NA | 86.38 | |
| 2f1k_A | 279 | Prephenate dehydrogenase; tyrosine synthesis, X-RA | 86.38 | |
| 2a9f_A | 398 | Putative malic enzyme ((S)-malate:NAD+ oxidoreduct | 86.37 | |
| 4e6p_A | 259 | Probable sorbitol dehydrogenase (L-iditol 2-dehyd; | 86.36 | |
| 1vkn_A | 351 | N-acetyl-gamma-glutamyl-phosphate reductase; TM178 | 86.36 | |
| 3ew7_A | 221 | LMO0794 protein; Q8Y8U8_lismo, putative NAD-depend | 86.29 | |
| 3doj_A | 310 | AT3G25530, dehydrogenase-like protein; gamma-hydro | 86.28 | |
| 2ae2_A | 260 | Protein (tropinone reductase-II); oxidoreductase, | 86.24 | |
| 1bg6_A | 359 | N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L | 86.22 | |
| 1np3_A | 338 | Ketol-acid reductoisomerase; A DEEP figure-OF-eigh | 86.22 | |
| 3ksu_A | 262 | 3-oxoacyl-acyl carrier protein reductase; structur | 86.19 | |
| 3qlj_A | 322 | Short chain dehydrogenase; structural genomics, se | 86.17 | |
| 2ew2_A | 316 | 2-dehydropantoate 2-reductase, putative; alpha-str | 86.17 | |
| 1gee_A | 261 | Glucose 1-dehydrogenase; short-chain dehydrogenase | 86.16 | |
| 2zat_A | 260 | Dehydrogenase/reductase SDR family member 4; alpha | 86.08 | |
| 1t2d_A | 322 | LDH-P, L-lactate dehydrogenase; ternary complex, o | 86.07 | |
| 4fgs_A | 273 | Probable dehydrogenase protein; PSI-biology, nysgr | 86.06 | |
| 3o38_A | 266 | Short chain dehydrogenase; tuberculosis, ortholog | 86.02 | |
| 3sx2_A | 278 | Putative 3-ketoacyl-(acyl-carrier-protein) reduct; | 86.0 | |
| 3eag_A | 326 | UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-ME | 85.98 | |
| 3v8b_A | 283 | Putative dehydrogenase, possibly 3-oxoacyl-[acyl- | 85.98 | |
| 3hn2_A | 312 | 2-dehydropantoate 2-reductase; PSI-2, NYSGXRC, str | 85.97 | |
| 1fmc_A | 255 | 7 alpha-hydroxysteroid dehydrogenase; short-chain | 85.95 | |
| 1oaa_A | 259 | Sepiapterin reductase; tetrahydrobiopterin, oxidor | 85.86 | |
| 2h78_A | 302 | Hibadh, 3-hydroxyisobutyrate dehydrogenase; APC601 | 85.86 | |
| 3tsc_A | 277 | Putative oxidoreductase; structural genomics, seat | 85.8 | |
| 1zcj_A | 463 | Peroxisomal bifunctional enzyme; peroxisomal multi | 85.8 | |
| 2q1s_A | 377 | Putative nucleotide sugar epimerase/ dehydratase; | 85.78 | |
| 3afn_B | 258 | Carbonyl reductase; alpha/beta/alpha, rossmann-fol | 85.72 | |
| 3t4x_A | 267 | Oxidoreductase, short chain dehydrogenase/reducta; | 85.71 | |
| 3fbt_A | 282 | Chorismate mutase and shikimate 5-dehydrogenase fu | 85.71 | |
| 3pef_A | 287 | 6-phosphogluconate dehydrogenase, NAD-binding; gam | 85.68 | |
| 2c5a_A | 379 | GDP-mannose-3', 5'-epimerase; short chain dehydrat | 85.67 | |
| 3h2s_A | 224 | Putative NADH-flavin reductase; Q03B84, NESG, LCR1 | 85.66 | |
| 1ez4_A | 318 | Lactate dehydrogenase; rossmann fold, oxidoreducta | 85.65 | |
| 3gt0_A | 247 | Pyrroline-5-carboxylate reductase; structural geno | 85.61 | |
| 3ko8_A | 312 | NAD-dependent epimerase/dehydratase; isomerase, UD | 85.6 | |
| 4egf_A | 266 | L-xylulose reductase; structural genomics, ssgcid, | 85.55 | |
| 4iin_A | 271 | 3-ketoacyl-acyl carrier protein reductase (FABG); | 85.47 | |
| 3pgx_A | 280 | Carveol dehydrogenase; structural genomics, seattl | 85.4 | |
| 2jah_A | 247 | Clavulanic acid dehydrogenase; short-chain dehydro | 85.38 | |
| 3phh_A | 269 | Shikimate dehydrogenase; shikimate pathway, helico | 85.34 | |
| 1rkx_A | 357 | CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; | 85.33 | |
| 3v2h_A | 281 | D-beta-hydroxybutyrate dehydrogenase; structural g | 85.31 | |
| 2ywl_A | 180 | Thioredoxin reductase related protein; uncharacter | 85.25 | |
| 3lf2_A | 265 | Short chain oxidoreductase Q9HYA2; SDR, SCOR, ross | 85.23 | |
| 4fc7_A | 277 | Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossman | 85.2 | |
| 2zyd_A | 480 | 6-phosphogluconate dehydrogenase, decarboxylating; | 85.16 | |
| 4gwg_A | 484 | 6-phosphogluconate dehydrogenase, decarboxylating; | 85.11 | |
| 4gx0_A | 565 | TRKA domain protein; membrane protein, ION channel | 85.1 | |
| 1xg5_A | 279 | ARPG836; short chain dehydrogenase, human, SGC, st | 85.1 | |
| 3awd_A | 260 | GOX2181, putative polyol dehydrogenase; oxidoreduc | 85.08 | |
| 3enk_A | 341 | UDP-glucose 4-epimerase; seattle structural genomi | 85.06 | |
| 1o6z_A | 303 | MDH, malate dehydrogenase; halophilic, ION-binding | 85.03 | |
| 1x7d_A | 350 | Ornithine cyclodeaminase; binds NAD+, binds L-orni | 84.99 | |
| 3d0o_A | 317 | L-LDH 1, L-lactate dehydrogenase 1; cytoplasm, gly | 84.98 | |
| 2rcy_A | 262 | Pyrroline carboxylate reductase; malaria, structur | 84.97 | |
| 3grp_A | 266 | 3-oxoacyl-(acyl carrierprotein) reductase; structu | 84.96 | |
| 2dc1_A | 236 | L-aspartate dehydrogenase; NAD, oxidoreductase; HE | 84.94 | |
| 4iiu_A | 267 | 3-oxoacyl-[acyl-carrier protein] reductase; struct | 84.92 | |
| 2i99_A | 312 | MU-crystallin homolog; thyroid hormine binding pro | 84.89 | |
| 3ftp_A | 270 | 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid | 84.89 | |
| 3c24_A | 286 | Putative oxidoreductase; YP_511008.1, structural g | 84.87 | |
| 3l77_A | 235 | Short-chain alcohol dehydrogenase; oxidoreductase; | 84.8 | |
| 2zyd_A | 480 | 6-phosphogluconate dehydrogenase, decarboxylating; | 84.79 | |
| 1eq2_A | 310 | ADP-L-glycero-D-mannoheptose 6-epimerase; N-termin | 84.78 | |
| 1rkx_A | 357 | CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; | 84.76 | |
| 2g5c_A | 281 | Prephenate dehydrogenase; TYRA, oxidoreductase; HE | 84.73 | |
| 3tzq_B | 271 | Short-chain type dehydrogenase/reductase; ssgcid, | 84.73 | |
| 3r3s_A | 294 | Oxidoreductase; structural genomics, csgid, center | 84.72 | |
| 3st7_A | 369 | Capsular polysaccharide synthesis enzyme CAP5F; ro | 84.68 | |
| 1vl0_A | 292 | DTDP-4-dehydrorhamnose reductase, RFBD ortholog; s | 84.56 | |
| 3v2g_A | 271 | 3-oxoacyl-[acyl-carrier-protein] reductase; struct | 84.53 | |
| 4hb9_A | 412 | Similarities with probable monooxygenase; flavin, | 84.53 | |
| 3ijr_A | 291 | Oxidoreductase, short chain dehydrogenase/reducta; | 84.52 | |
| 3enk_A | 341 | UDP-glucose 4-epimerase; seattle structural genomi | 84.5 | |
| 4f6c_A | 427 | AUSA reductase domain protein; thioester reductase | 84.45 | |
| 2hun_A | 336 | 336AA long hypothetical DTDP-glucose 4,6-dehydrat; | 84.44 | |
| 2c5a_A | 379 | GDP-mannose-3', 5'-epimerase; short chain dehydrat | 84.42 | |
| 3hhp_A | 312 | Malate dehydrogenase; MDH, citric acid cycle, TCA | 84.39 | |
| 3l6d_A | 306 | Putative oxidoreductase; structural genomics, prot | 84.36 | |
| 1yb1_A | 272 | 17-beta-hydroxysteroid dehydrogenase type XI; shor | 84.29 | |
| 3ehe_A | 313 | UDP-glucose 4-epimerase (GALE-1); PSI-II, NYSGXRC, | 84.27 | |
| 2ydy_A | 315 | Methionine adenosyltransferase 2 subunit beta; oxi | 84.24 | |
| 3i83_A | 320 | 2-dehydropantoate 2-reductase; structural genomics | 84.23 | |
| 3dtt_A | 245 | NADP oxidoreductase; structural genomics, joint ce | 84.1 | |
| 1yxm_A | 303 | Pecra, peroxisomal trans 2-enoyl COA reductase; pe | 84.09 | |
| 2hun_A | 336 | 336AA long hypothetical DTDP-glucose 4,6-dehydrat; | 84.07 | |
| 3sc6_A | 287 | DTDP-4-dehydrorhamnose reductase; RFBD, structural | 84.05 | |
| 3pdu_A | 287 | 3-hydroxyisobutyrate dehydrogenase family protein; | 84.03 | |
| 2rhc_B | 277 | Actinorhodin polyketide ketoreductase; oxidoreduct | 84.03 | |
| 2q1w_A | 333 | Putative nucleotide sugar epimerase/ dehydratase; | 84.03 | |
| 2hq1_A | 247 | Glucose/ribitol dehydrogenase; CTH-1438, structura | 83.99 | |
| 2qq5_A | 260 | DHRS1, dehydrogenase/reductase SDR family member 1 | 83.99 | |
| 3ngx_A | 276 | Bifunctional protein fold; methylenetetrahydrofola | 83.98 | |
| 2dc1_A | 236 | L-aspartate dehydrogenase; NAD, oxidoreductase; HE | 83.98 | |
| 1omo_A | 322 | Alanine dehydrogenase; two-domain, beta-sandwich-d | 83.97 | |
| 1a4i_A | 301 | Methylenetetrahydrofolate dehydrogenase / methenyl | 83.96 | |
| 3rih_A | 293 | Short chain dehydrogenase or reductase; structural | 83.91 | |
| 3ehe_A | 313 | UDP-glucose 4-epimerase (GALE-1); PSI-II, NYSGXRC, | 83.89 | |
| 2gn4_A | 344 | FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann | 83.89 | |
| 1i36_A | 264 | Conserved hypothetical protein MTH1747; NADP bindi | 83.88 | |
| 2zqz_A | 326 | L-LDH, L-lactate dehydrogenase; oxidoreductase, ro | 83.88 | |
| 2bgk_A | 278 | Rhizome secoisolariciresinol dehydrogenase; oxidor | 83.88 | |
| 2q1w_A | 333 | Putative nucleotide sugar epimerase/ dehydratase; | 83.86 | |
| 1iy8_A | 267 | Levodione reductase; oxidoreductase; HET: NAD; 1.6 | 83.85 | |
| 3rft_A | 267 | Uronate dehydrogenase; apoenzyme, rossmann fold, N | 83.84 | |
| 1ur5_A | 309 | Malate dehydrogenase; oxidoreductase, tricarboxyli | 83.81 | |
| 3rkr_A | 262 | Short chain oxidoreductase; rossmann fold; HET: NA | 83.8 | |
| 3hn2_A | 312 | 2-dehydropantoate 2-reductase; PSI-2, NYSGXRC, str | 83.75 | |
| 3nep_X | 314 | Malate dehydrogenase; halophIle, molecular adpatat | 83.71 | |
| 3tl2_A | 315 | Malate dehydrogenase; center for structural genomi | 83.7 | |
| 1vl6_A | 388 | Malate oxidoreductase; TM0542, NAD-dependent malic | 83.67 | |
| 3qha_A | 296 | Putative oxidoreductase; seattle structural genomi | 83.6 | |
| 3gvc_A | 277 | Oxidoreductase, probable short-chain type dehydrog | 83.57 | |
| 2xxj_A | 310 | L-LDH, L-lactate dehydrogenase; oxidoreductase, hy | 83.56 | |
| 1wma_A | 276 | Carbonyl reductase [NADPH] 1; oxidoreductase; HET: | 83.55 | |
| 4fs3_A | 256 | Enoyl-[acyl-carrier-protein] reductase [NADPH] FA; | 83.55 | |
| 3qiv_A | 253 | Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR | 83.54 | |
| 3edm_A | 259 | Short chain dehydrogenase; structural genomics, ox | 83.54 | |
| 4a26_A | 300 | Putative C-1-tetrahydrofolate synthase, cytoplasm; | 83.46 | |
| 3imf_A | 257 | Short chain dehydrogenase; structural genomics, in | 83.42 | |
| 4dry_A | 281 | 3-oxoacyl-[acyl-carrier-protein] reductase; struct | 83.41 | |
| 3n74_A | 261 | 3-ketoacyl-(acyl-carrier-protein) reductase; seatt | 83.35 | |
| 4dyv_A | 272 | Short-chain dehydrogenase/reductase SDR; structura | 83.34 | |
| 3osu_A | 246 | 3-oxoacyl-[acyl-carrier-protein] reductase; struct | 83.33 | |
| 4dll_A | 320 | 2-hydroxy-3-oxopropionate reductase; structural ge | 83.21 | |
| 1orr_A | 347 | CDP-tyvelose-2-epimerase; rossmann fold, short-cha | 83.18 | |
| 1hye_A | 313 | L-lactate/malate dehydrogenase; nucleotide binding | 83.14 | |
| 1orr_A | 347 | CDP-tyvelose-2-epimerase; rossmann fold, short-cha | 83.12 | |
| 3u9l_A | 324 | 3-oxoacyl-[acyl-carrier-protein] reductase; struct | 83.11 | |
| 1b0a_A | 288 | Protein (fold bifunctional protein); folate, dehyd | 83.09 | |
| 2dvm_A | 439 | Malic enzyme, 439AA long hypothetical malate oxido | 83.06 | |
| 3kkj_A | 336 | Amine oxidase, flavin-containing; oxidoreductase, | 83.04 | |
| 3hg7_A | 324 | D-isomer specific 2-hydroxyacid dehydrogenase FAM | 83.03 | |
| 3i83_A | 320 | 2-dehydropantoate 2-reductase; structural genomics | 83.02 | |
| 4g81_D | 255 | Putative hexonate dehydrogenase; enzyme function i | 83.0 | |
| 4dqv_A | 478 | Probable peptide synthetase NRP (peptide synthase; | 82.93 | |
| 2gdz_A | 267 | NAD+-dependent 15-hydroxyprostaglandin dehydrogen; | 82.85 | |
| 3e48_A | 289 | Putative nucleoside-diphosphate-sugar epimerase; a | 82.85 | |
| 2aef_A | 234 | Calcium-gated potassium channel MTHK; rossmann fol | 82.82 | |
| 2i6t_A | 303 | Ubiquitin-conjugating enzyme E2-like isoform A; L- | 82.81 | |
| 4dmm_A | 269 | 3-oxoacyl-[acyl-carrier-protein] reductase; rossma | 82.77 | |
| 1r6d_A | 337 | TDP-glucose-4,6-dehydratase; rossmann fold, short- | 82.77 | |
| 2jl1_A | 287 | Triphenylmethane reductase; oxidoreductase, biorem | 82.76 | |
| 1s6y_A | 450 | 6-phospho-beta-glucosidase; hydrolase, structural | 82.76 | |
| 1sby_A | 254 | Alcohol dehydrogenase; ternary complex, NAD, trifl | 82.74 | |
| 2hk9_A | 275 | Shikimate dehydrogenase; shikimate pathway, drug d | 82.72 | |
| 3ai3_A | 263 | NADPH-sorbose reductase; rossmann-fold, NADPH-depe | 82.7 | |
| 3gvx_A | 290 | Glycerate dehydrogenase related protein; NYSGXRC, | 82.62 | |
| 1zem_A | 262 | Xylitol dehydrogenase; rossmann fold, dinucleotide | 82.58 | |
| 1gpj_A | 404 | Glutamyl-tRNA reductase; tRNA-dependent tetrapyrro | 82.49 | |
| 1o0s_A | 605 | NAD-ME, NAD-dependent malic enzyme; oxidoreductase | 82.46 | |
| 1spx_A | 278 | Short-chain reductase family member (5L265); paral | 82.4 | |
| 3p2o_A | 285 | Bifunctional protein fold; structural genomics, ce | 82.39 | |
| 2hrz_A | 342 | AGR_C_4963P, nucleoside-diphosphate-sugar epimeras | 82.35 | |
| 2o23_A | 265 | HADH2 protein; HSD17B10, schad, ERAB, type II HADH | 82.34 | |
| 2nwq_A | 272 | Probable short-chain dehydrogenase; oxidoreductase | 82.34 | |
| 2iz1_A | 474 | 6-phosphogluconate dehydrogenase, decarboxylating; | 82.33 | |
| 1dih_A | 273 | Dihydrodipicolinate reductase; oxidoreductase; HET | 82.31 | |
| 2pnf_A | 248 | 3-oxoacyl-[acyl-carrier-protein] reductase; short | 82.29 | |
| 1npy_A | 271 | Hypothetical shikimate 5-dehydrogenase-like protei | 82.27 | |
| 1ja9_A | 274 | 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; p | 82.22 | |
| 3i1j_A | 247 | Oxidoreductase, short chain dehydrogenase/reducta; | 82.17 | |
| 3ldh_A | 330 | Lactate dehydrogenase; oxidoreductase, CHOH donor, | 82.17 | |
| 3obb_A | 300 | Probable 3-hydroxyisobutyrate dehydrogenase; struc | 82.14 | |
| 3jtm_A | 351 | Formate dehydrogenase, mitochondrial; mitochondrio | 82.06 | |
| 3cxt_A | 291 | Dehydrogenase with different specificities; rossma | 82.04 | |
| 1xq1_A | 266 | Putative tropinone reducatse; structural genomics, | 81.97 | |
| 1n2s_A | 299 | DTDP-4-, DTDP-glucose oxidoreductase; rossman-fold | 81.91 | |
| 2iz1_A | 474 | 6-phosphogluconate dehydrogenase, decarboxylating; | 81.86 | |
| 1txg_A | 335 | Glycerol-3-phosphate dehydrogenase [NAD(P)+]; oxid | 81.84 | |
| 3qy9_A | 243 | DHPR, dihydrodipicolinate reductase; rossmann fold | 81.78 | |
| 3svt_A | 281 | Short-chain type dehydrogenase/reductase; ssgcid, | 81.68 | |
| 2a9f_A | 398 | Putative malic enzyme ((S)-malate:NAD+ oxidoreduct | 81.68 | |
| 3g17_A | 294 | Similar to 2-dehydropantoate 2-reductase; structur | 81.67 | |
| 1ek6_A | 348 | UDP-galactose 4-epimerase; short-chain dehydrogena | 81.66 | |
| 4e12_A | 283 | Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1 | 81.64 | |
| 3mog_A | 483 | Probable 3-hydroxybutyryl-COA dehydrogenase; struc | 81.61 | |
| 3hdj_A | 313 | Probable ornithine cyclodeaminase; APC62486, borde | 81.56 | |
| 3k6j_A | 460 | Protein F01G10.3, confirmed by transcript evidenc; | 81.54 | |
| 1nyt_A | 271 | Shikimate 5-dehydrogenase; alpha/beta domains, WID | 81.51 | |
| 3ioy_A | 319 | Short-chain dehydrogenase/reductase SDR; structura | 81.5 | |
| 2x9g_A | 288 | PTR1, pteridine reductase; short chain dehydrogena | 81.49 | |
| 1guz_A | 310 | Malate dehydrogenase; oxidoreductase, tricarboxyli | 81.48 | |
| 3ghy_A | 335 | Ketopantoate reductase protein; oxidoreductase, NA | 81.45 | |
| 3kb6_A | 334 | D-lactate dehydrogenase; oxidoreductase, D-LDH, NA | 81.4 | |
| 1u8x_X | 472 | Maltose-6'-phosphate glucosidase; structural genom | 81.38 | |
| 1z82_A | 335 | Glycerol-3-phosphate dehydrogenase; TM0378, struct | 81.36 | |
| 4ej6_A | 370 | Putative zinc-binding dehydrogenase; structural ge | 81.36 | |
| 2gas_A | 307 | Isoflavone reductase; NADPH-dependent reductase, o | 81.32 | |
| 1zk4_A | 251 | R-specific alcohol dehydrogenase; short chain redu | 81.28 | |
| 1ek6_A | 348 | UDP-galactose 4-epimerase; short-chain dehydrogena | 81.26 | |
| 1qyc_A | 308 | Phenylcoumaran benzylic ether reductase PT1; NADPH | 81.23 | |
| 1lld_A | 319 | L-lactate dehydrogenase; oxidoreductase(CHOH (D)-N | 81.23 | |
| 1sny_A | 267 | Sniffer CG10964-PA; alpha and beta protein, rossma | 81.2 | |
| 2b4q_A | 276 | Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier | 81.13 | |
| 1vl8_A | 267 | Gluconate 5-dehydrogenase; TM0441, structural geno | 81.13 | |
| 4aj2_A | 331 | L-lactate dehydrogenase A chain; oxidoreductase-in | 81.12 | |
| 3oid_A | 258 | Enoyl-[acyl-carrier-protein] reductase [NADPH]; fa | 81.1 | |
| 1qyd_A | 313 | Pinoresinol-lariciresinol reductase; NADPH-depende | 81.1 | |
| 3is3_A | 270 | 17BETA-hydroxysteroid dehydrogenase; short chain d | 81.07 | |
| 1g0o_A | 283 | Trihydroxynaphthalene reductase; protein-NADPH-act | 81.05 | |
| 1np3_A | 338 | Ketol-acid reductoisomerase; A DEEP figure-OF-eigh | 80.98 | |
| 3d4o_A | 293 | Dipicolinate synthase subunit A; NP_243269.1, stru | 80.96 | |
| 2jl1_A | 287 | Triphenylmethane reductase; oxidoreductase, biorem | 80.86 | |
| 1n2s_A | 299 | DTDP-4-, DTDP-glucose oxidoreductase; rossman-fold | 80.83 | |
| 1f0y_A | 302 | HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive | 80.83 | |
| 1xkq_A | 280 | Short-chain reductase family member (5D234); parra | 80.76 | |
| 4b1b_A | 542 | TRXR, thioredoxin reductase; oxidoreductase, FAD, | 80.76 | |
| 3k96_A | 356 | Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA | 80.75 | |
| 3u5t_A | 267 | 3-oxoacyl-[acyl-carrier-protein] reductase; struct | 80.74 | |
| 3hwr_A | 318 | 2-dehydropantoate 2-reductase; YP_299159.1, PANE/A | 80.71 | |
| 1ae1_A | 273 | Tropinone reductase-I; oxidoreductase, tropane alk | 80.69 | |
| 3rc1_A | 350 | Sugar 3-ketoreductase; sugar biosynthesis, TDP bin | 80.63 | |
| 1omo_A | 322 | Alanine dehydrogenase; two-domain, beta-sandwich-d | 80.59 | |
| 3gg2_A | 450 | Sugar dehydrogenase, UDP-glucose/GDP-mannose dehyd | 80.58 | |
| 3f9i_A | 249 | 3-oxoacyl-[acyl-carrier-protein] reductase; 3-keto | 80.57 | |
| 2rir_A | 300 | Dipicolinate synthase, A chain; structural genomic | 80.46 | |
| 1ks9_A | 291 | KPA reductase;, 2-dehydropantoate 2-reductase; PAN | 80.44 | |
| 3ctm_A | 279 | Carbonyl reductase; alcohol dehydrogenase, short-c | 80.43 |
| >3cmm_A Ubiquitin-activating enzyme E1 1; UBA1, protein turnover, ligase, conformationa thioester, adenylation, transthioesterification, ATP-bindin nucleotide-binding; 2.70A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
Probab=100.00 E-value=1.2e-215 Score=2018.92 Aligned_cols=998 Identities=45% Similarity=0.806 Sum_probs=938.6
Q ss_pred CchhHHHHhhhhhccCHHHHHHhhcCeEEEEcCChhhHHHHHHHHHhCCceEEEEeCCccCcccCccccccCcCcccchH
Q 001301 95 SDIDEDLHSRQLAVYGRETMRRLFASNILISGMQGLGAEIAKNLILAGVKSVTLHDEGVVELWDLSSNFIFSEDDVGKNR 174 (1104)
Q Consensus 95 ~~~d~~~Y~RQi~l~G~e~q~kL~~s~VlIiG~gglGseiaKnLvlaGVg~itLvD~d~V~~sdL~rqf~~~~~diGk~K 174 (1104)
.+++++|||||+++||.++|++|++++|||+|+||+|+++||||+++|||+|||+|+|.|+.+||+||||++++|||++|
T Consensus 3 ~~id~~rY~Rqi~l~G~~~q~rL~~s~VlIvG~GGlGseiak~La~aGVg~itlvD~D~V~~sNL~RQ~l~~~~dvG~~K 82 (1015)
T 3cmm_A 3 GEIDESLYSRQLYVLGKEAMLKMQTSNVLILGLKGLGVEIAKNVVLAGVKSMTVFDPEPVQLADLSTQFFLTEKDIGQKR 82 (1015)
T ss_dssp CCCCHHHHHHHHHHSCHHHHHHHTTCEEEEECCSHHHHHHHHHHHHHCCSEEEEECCSBCCGGGGGTCTTCCGGGTTSBH
T ss_pred hhhhhHhccchHhhcCHHHHHHHhcCEEEEECCChHHHHHHHHHHHcCCCeEEEecCCEechhhhccccccChhhcChHH
Confidence 47899999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred HHHHHHHHHHhCCCcEEEEeecccchhhhcCCceEEEecC-CHhHhhhHHHHHHHcCCCcceEEeeecceeEEEEeecCC
Q 001301 175 ALASIQKLQELNNAVAISALTTELTKEKLSDFQAVVFTDI-SLEKAVEFDDYCHNHQPPIAFIKSEVRGLFGNIFCDFGP 253 (1104)
Q Consensus 175 aea~~~~L~eLNp~V~V~~~~~~l~~e~l~~~dvVV~~~~-~~~~~~~ln~~c~~~~~~ipfI~~~~~G~~G~vf~d~g~ 253 (1104)
|++++++|+++||+|+|+++...++++++++||+||+|.+ +.+.+..||++|++++ +|||++++.|++|++|+|+|+
T Consensus 83 a~a~~~~L~~lNP~v~v~~~~~~l~~~~l~~~DvVv~~~d~~~~~r~~ln~~c~~~~--iplI~~~~~G~~G~v~~d~~~ 160 (1015)
T 3cmm_A 83 GDVTRAKLAELNAYVPVNVLDSLDDVTQLSQFQVVVATDTVSLEDKVKINEFCHSSG--IRFISSETRGLFGNTFVDLGD 160 (1015)
T ss_dssp HHHHHHHHTTSCTTSCEEECCCCCCSTTGGGCSEEEECTTSCHHHHHHHHHHHHHHT--CEEEEEEEETTEEEEEEECCS
T ss_pred HHHHHHHHHHHCCCCeEEEecCCCCHHHHhcCCEEEEcCCCCHHHHHHHHHHHHHcC--CCEEEEEecccEEEEEecCCC
Confidence 9999999999999999999999999899999999999999 9999999999999999 999999999999999999999
Q ss_pred ceEEecCCCCCCccceeccccCCCCCceeecccccccccCCCeEEEeEeecccccCCCCCeeeeccCCcccccccCcccc
Q 001301 254 EFTVFDVDGEEPHTGIIASISNDNPPLISCVDDERIEFQDGDLVVFSEVHGMTELNDGKPRKVKNARPYSFSIDEDTTNY 333 (1104)
Q Consensus 254 ~f~v~d~~ge~p~~~~i~~i~~~~~~lv~~~~~~~h~~~dgd~v~f~ev~gm~~ln~~~~~~i~~~~~~~~~i~~dt~~f 333 (1104)
+|.|++++|+.|.++.+.+| +.|++++|+++.+|++++||.+.|++++||+++|+++++++++.+||+|.| +||+.|
T Consensus 161 ~~~c~~~~~~~p~~~~i~~i--~~p~~v~~l~~~~h~~~~gd~v~F~ev~gm~elN~~e~~~i~~~~p~~f~I-~Dts~~ 237 (1015)
T 3cmm_A 161 EFTVLDPTGEEPRTGMVSDI--EPDGTVTMLDDNRHGLEDGNFVRFSEVEGLDKLNDGTLFKVEVLGPFAFRI-GSVKEY 237 (1015)
T ss_dssp CEEESBSSCCCCCEEEEEEE--CTTCEEEESTTCCCCCCTTCEEEEECCBTSGGGGSSCCEECEEEETTEEEC-SCCTTT
T ss_pred ceEEeeCCCCCCccccccCC--CCCceeEeeecccccCCCCCeEEEEeeccchhhcCccceeeEEcCCceeEe-cccchh
Confidence 99999999999999999999 567899999999999999999999999999999999999999999999999 689999
Q ss_pred cccccCCeEEEeecCeeecccchhhhhcCCCCccccccccCCCcchHHHHHHHHHHHHHHh-CCCCCCCCHHHHHHHHHH
Q 001301 334 SAYEKGGIVTQVKQPKIINFKPLREALKDPGDFLLSDFSKFDRPPVLHLAFQALDKFIQEL-GRFPVAGSEEDAQKIISL 412 (1104)
Q Consensus 334 ~~y~~gg~~~qvk~p~~~~f~sL~e~L~~p~~~~~~d~~k~~r~~~l~~~~~al~~F~~~~-gr~P~~~~~~Da~~l~~i 412 (1104)
..|.+||+++|+|+|++++|++|++++++| .++.+|+.|++++..+|++||||++|.++| ||+|++++++|+++|.++
T Consensus 238 ~~yv~~g~~~qvk~p~~i~f~~l~~~l~~p-~~l~~d~~k~~~~~~l~~~~~Al~~F~~~~~gr~P~~~~~~D~~~l~~~ 316 (1015)
T 3cmm_A 238 GEYKKGGIFTEVKVPRKISFKSLKQQLSNP-EFVFSDFAKFDRAAQLHLGFQALHQFAVRHNGELPRTMNDEDANELIKL 316 (1015)
T ss_dssp CCCCBCCEEEECCCCEEECCCCHHHHHHSC-CBCCSCGGGTHHHHHHHHHHHHHHHHHHHTTTCCCCTTCHHHHHHHHHH
T ss_pred hhhhcCceeEEecCCcccCHHHHHHHHcCh-HHHHHHHhccCcchHHHHHHHHHHHHHHhcCCCCCCCCCHHHHHHHHHH
Confidence 999999999999999999999999999999 577889999999999999999999999999 999999999999999999
Q ss_pred HHHHHhhcCCc--cccccCHHHHHHHHhhccCccCchhhhhcchhhHHHHHhhccCcccccceeeccCCCCCCC---CCC
Q 001301 413 FTNINDNLADE--RVEEIDHKLLCHFAFGARAVLNPMAAMFGGIVGQEVVKACSGKFHPLLQFFYFDSVESLPS---EPL 487 (1104)
Q Consensus 413 a~~i~~~~~~~--~~~~i~~~li~~~~~~~~~el~PvaA~iGGiaAQEVIKaiTgKf~PI~q~l~fD~~e~lp~---~~~ 487 (1104)
+++++.+.+.. ...+++++++++|+++++++|||||||+||+|||||||+|||||+||+||||||+++++|. .++
T Consensus 317 a~~~~~~~~~~~~~~~~~~~~~~~e~~~~~~~el~pvaA~iGGivAQEVIKaiT~kf~Pi~~~~~~d~~~~~~~~~~~~~ 396 (1015)
T 3cmm_A 317 VTDLSVQQPEVLGEGVDVNEDLIKELSYQARGDIPGVVAFFGGLVAQEVLKACSGKFTPLKQFMYFDSLESLPDPKNFPR 396 (1015)
T ss_dssp HHHHHHHCHHHHCTTCCCCHHHHHHHHHTTTCCCHHHHHHHHHHHHHHHHHHHHCBSCCCCSEEEEECGGGSCCTTTSCC
T ss_pred HHHHHHhcCCCccccccCcHHHHHHHHHhcCcccCcHHHHhcchHHHHHHHHhccCCCcccceEEecchhhccccccCCC
Confidence 99998764321 0036889999999999999999999999999999999999999999999999999999994 567
Q ss_pred CCCCCCCccCcchhhhhccCHHHHHHHhcCcEEEEcCCcchHHHHHHHHhcccccCCCcceEEecCCcccccCcccccCc
Q 001301 488 DPRDLQPLNSRYDAQISVFGSKLQKKLEEAKVFVVGSGALGCEFLKNLALMGVSCGNQGKLTITDDDVIEKSNLSRQFLF 567 (1104)
Q Consensus 488 ~~~~~~~~~~RYdrqi~l~G~~~q~kL~~~~VlvvG~GgiG~evlknLa~~Gv~~~~~g~i~iiD~D~Ie~sNLnRQfLf 567 (1104)
+++++.|.++||+||+++||.++|++|++++|+|||||||||++|++||++||+||++|+|+|+|+|+|+.|||||||||
T Consensus 397 ~~~~~~~~~~Ry~rq~~l~G~~~q~kL~~~~VlvVGaGGlGsevlk~La~~Gv~~g~~G~i~lvD~D~Ve~SNLnRQ~lf 476 (1015)
T 3cmm_A 397 NEKTTQPVNSRYDNQIAVFGLDFQKKIANSKVFLVGSGAIGCEMLKNWALLGLGSGSDGYIVVTDNDSIEKSNLNRQFLF 476 (1015)
T ss_dssp STTTTSCCSSTTHHHHHHHCHHHHHHHHTCEEEEECCSHHHHHHHHHHHHHTTTCSTTCEEEEECCCBCCGGGTTTCTTC
T ss_pred ChhhccchhhhhhhHHHhcCHHHHHHHhcCeEEEEecCHHHHHHHHHHHHcCcCcCCCCeEEEEeCCEeccccccccccC
Confidence 88888888999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred ccCccccchHHHHHHHHHHhCCCc--EEeeecccCCccccccchhhhhccCCEEEEccCCHHHHHHHhhcccccccceEe
Q 001301 568 RDWNIGQAKSTVAASAAALINPHL--NTEALQIRANPETENVFNDTFWENLNVVVNALDNVNARLYIDQRCLYFQKPLLE 645 (1104)
Q Consensus 568 ~~~diG~~Ka~vaa~~l~~~np~~--~i~~~~~~v~~~~~~~~~~~f~~~~DvVi~alDn~~aR~~i~~~c~~~~~pli~ 645 (1104)
+.+|||++||++|+++++++||++ +|+++..+++++++.+|+++||+++|+||+|+||+++|++++++|+.+++|+|+
T Consensus 477 ~~~dvG~~Ka~~aa~~l~~iNP~v~~~v~~~~~~i~~~~~~~~~~~~~~~~D~Vi~a~Dn~~aR~~ln~~c~~~~~Pli~ 556 (1015)
T 3cmm_A 477 RPKDVGKNKSEVAAEAVCAMNPDLKGKINAKIDKVGPETEEIFNDSFWESLDFVTNALDNVDARTYVDRRCVFYRKPLLE 556 (1015)
T ss_dssp CGGGTTSBHHHHHHHHHHHHCGGGTTTEEEECCCCSGGGTTTSCHHHHHHCSEEEECCSSHHHHHHHHHHHHHHTCCEEE
T ss_pred ChhhCCCHHHHHHHHHHHHHCCCCcceEEEEecccCchhhhhccHhhhccCCEEEECCCCHHHHHHHHHHHHHcCCcEEE
Confidence 999999999999999999999999 999999999988887888899999999999999999999999999999999999
Q ss_pred cccCCcccceEEEeCCcccccCcCCCCCCCCCCcccccCCCCChhhHHHHHHHHhhhhhccChhhHhhhcCCcHHHHHHh
Q 001301 646 SGTLGAKCNTQMVIPHLTENYGASRDPPEKQAPMCTVHSFPHNIDHCLTWARSEFEGLLEKTPAEVNAYLTSPTEYASAM 725 (1104)
Q Consensus 646 ~g~~G~~G~v~v~ip~~t~~y~~~~~p~~~~~p~Ct~~~fP~~~~hci~wAr~~F~~~f~~~~~~~~~~l~~~~~~~~~~ 725 (1104)
+|+.|++|++++++|+.|+||.|..+|+++.+|.||+++||+.++|||+|||++|+++|+..++++|+|++|| .|++.+
T Consensus 557 ~g~~G~~G~v~v~~p~~t~cy~c~~dp~~~~~P~Ctl~~~P~~~~h~i~wa~~~f~~lf~~~~~~~~~~l~~~-~~~~~~ 635 (1015)
T 3cmm_A 557 SGTLGTKGNTQVIIPRLTESYSSSRDPPEKSIPLCTLRSFPNKIDHTIAWAKSLFQGYFTDSAENVNMYLTQP-NFVEQT 635 (1015)
T ss_dssp EEEETTEEEEEEECTTTBCCGGGSCCCCCCCCCHHHHHTCCCSHHHHHHHHHHHHHHHHTHHHHHHHHHHHCT-THHHHH
T ss_pred eCCCccccceEEEeCCCCCccCCCCCCCCCCCCcccccCCCCCcHHHHHHHHHHHHHHHhhhhhhhhhhccCc-hhHHHH
Confidence 9999999999999999999999999999999999999999999999999999999999999999999999999 677777
Q ss_pred hhcCchhHHHhHHHHHHHhhhhcccchHHHHHHHHHHHHHHHHHHHHHhhhcCCCCccCCCCCCcccCCCCCCCcccccC
Q 001301 726 KNAGDAQARDNLDRVLECLDKERCETFQDCITWARLRFEDYFADRVKQLTFTFPENATTSNGTPFWSAPKRFPRPLQFSV 805 (1104)
Q Consensus 726 ~~~~~~~~~~~l~~~~~~l~~~~~~~~~~ci~~a~~~f~~~F~~~i~~Ll~~~p~d~~~~~g~~fws~~kr~P~pl~fd~ 805 (1104)
.+....+. +.|+.+++.| ..+|.+|++|++||+.+|+++|+++|+|||++||+|++|++|+||||++||+|+||+||+
T Consensus 636 ~~~~~~~~-~~l~~~~~~l-~~~~~~~~~c~~~a~~~f~~~F~~~I~~Ll~~~p~d~~~~~g~~fW~~~kr~P~pl~fd~ 713 (1015)
T 3cmm_A 636 LKQSGDVK-GVLESISDSL-SSKPHNFEDCIKWARLEFEKKFNHDIKQLLFNFPKDAKTSNGEPFWSGAKRAPTPLEFDI 713 (1015)
T ss_dssp HC---CCH-HHHHHHHHHH-HSCCSSHHHHHHHHHHHHHHHHTHHHHHHHHHSCTTCBCSTTCBSSCTTCCCCCCCCCCT
T ss_pred HhccchhH-HHHHHHHHHh-hcCCCcHHHHHHHHHHHHHHHHHHHHHHHHHhCCcccccccCcccccCCCCCCCCcccCC
Confidence 66544333 6788898888 788999999999999999999999999999999999999999999999999999999999
Q ss_pred CcchhHHHHHHHHHHHHHHcCCCCC--CCCCChhHHHHhhhhccCCCCCCCCCccccccccccccCCCCcChHHHHHHHH
Q 001301 806 DDLSHLQFLMAASILRAETYGIPIP--DWVKSPVKLADAVNKVIVPDFQPKENVKIETDEKATSMSTGSIDDAVVINELL 883 (1104)
Q Consensus 806 ~~~~h~~fv~~~a~l~a~~~~i~~~--~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~~~~~~~~~~~~~~~~~~~~l~ 883 (1104)
+|++|++||+++|+|+|++|||+.+ .|..+.+.+.++++++.+|+|.|+++++|.+++++...++...++.+.+++|.
T Consensus 714 ~~~~h~~fi~~~a~l~a~~~~i~~~~~~~~~~~~~~~~~~~~~~v~~f~~~~~~ki~~~~~~~~~~~~~~~~~~~~~~l~ 793 (1015)
T 3cmm_A 714 YNNDHFHFVVAGASLRAYNYGIKSDDSNSKPNVDEYKSVIDHMIIPEFTPNANLKIQVNDDDPDPNANAANGSDEIDQLV 793 (1015)
T ss_dssp TSHHHHHHHHHHHHHHHHHHTCCCSSTTSSCCHHHHHHHHTTCCCCCCCCCSSCCCCSSTTSSCC---------CCHHHH
T ss_pred CCHHHHHHHHHHHHhHHHhcCCCCccccccCCHHHHHHHHhhCcCCCcCCccCceeccchhhhcccccccccHHHHHHHH
Confidence 9999999999999999999999985 47778999999999999999999999999988765443322222445566777
Q ss_pred HHHHHhhhcCCCCCCCCCceecccCCCCchhHHHHHHhhhhhhhcCCCCccHHHHHHHhccccchhhhhhhHHHHHHHHH
Q 001301 884 QKLEKCQKQLPTGYKMNPIQFEKDDDTNFHMDLIAGLANMRARNYGIPEVDKLKAKFIAGRIIPAIATSTAMATGLVCLE 963 (1104)
Q Consensus 884 ~~l~~~~~~~~~~~~~~p~~FeKDDd~n~hidFI~AasNLRA~ny~I~~~d~~~~K~iAG~IIPAIATTtA~VaGl~~lE 963 (1104)
++|++... ..++++.|++||||||+|+|||||+|||||||+||+||++|||++|+||||||||||||||+||||+|+|
T Consensus 794 ~~l~~~~~--~~~~~~~~~~FeKDDd~n~h~dFi~aasNlRa~ny~I~~~~~~~~k~iaG~IIPAIaTT~AivaGl~~lE 871 (1015)
T 3cmm_A 794 SSLPDPST--LAGFKLEPVDFEKDDDTNHHIEFITACSNCRAQNYFIETADRQKTKFIAGRIIPAIATTTSLVTGLVNLE 871 (1015)
T ss_dssp TTSCCGGG--GTTCCCCCCCCCTTCTTSSHHHHHHHHHHHHHHHTTCCCCCHHHHHHHHTTCCCCCHHHHHHHHHHHHHH
T ss_pred HHhccchh--cccCCCCceeeecCCCchhHHHHHHHHHHHHHHHcCCCccCHHHHHHHhCCcCccchhHHHHHHHHHHHH
Confidence 66655433 2567899999999999999999999999999999999999999999999999999999999999999999
Q ss_pred HHHHhcCCCCcccccccccccccCcccccCCCCCCccccCCcce-eEEeEEEeCCCCcHHHHHHHHHHc-CCceeeeecC
Q 001301 964 LYKVLDGGHKLEDYRNTFANLALPLFSMAEPVPPKVFKHQDMSW-TVWDRWILRDNPTLRQLLQWLQDK-GLNAYSISYG 1041 (1104)
Q Consensus 964 l~K~l~~~~~~~~~rn~f~nla~p~~~~~eP~~~~~~~~~~~~~-t~wd~~~v~~~~TL~~li~~~~~~-~l~~~~i~~g 1041 (1104)
+||+++|.++++.|||+|+|||+|+|.|+||.+|++.++..++| |+||||++.+++||++|+++|+++ |++++||++|
T Consensus 872 ~~K~~~~~~~~~~~kn~f~nla~~~~~~~~p~~~~~~~~~~~~~~t~wd~~~v~~~~Tl~~li~~~~~~~~~~~~~i~~~ 951 (1015)
T 3cmm_A 872 LYKLIDNKTDIEQYKNGFVNLALPFFGFSEPIASPKGEYNNKKYDKIWDRFDIKGDIKLSDLIEHFEKDEGLEITMLSYG 951 (1015)
T ss_dssp HHHHHTTCCCGGGCCEEEEETTTTEEEEECCCBCCEEEETTEEEETTTCEEEEESCCBHHHHHHHHHHTTCCEEEEEEET
T ss_pred HHHHHhcccchhhhhhHHHhccCCceeecCCCCCCCCCCCCCCCCeEEEEEEECCCCcHHHHHHHHHHHhCCcceeeccC
Confidence 99999987889999999999999999999999999988888999 999999999999999999999999 9999999999
Q ss_pred CceeeccCCc--chhhcccCcHHHHHHhhhcCCCCCCeeEEEEEEEeecCCCCccccCeEEEEe
Q 001301 1042 SCLLFNSMFP--RHKERMDKKVVDLVRDVAKAELPPYRQHFDVVVACVDEDDNDIDIPQISIYF 1103 (1104)
Q Consensus 1042 ~~~LY~~~~~--~~~~~l~~~l~~l~~~v~~~~~~~~~~~~~l~~~~~d~~~~~~~~P~v~~~~ 1103 (1104)
++|||++++| ++++||+++|+||++.++++++|++++||+|+|+|+|++++||++|+|+|+|
T Consensus 952 ~~~ly~~~~~~~~~~~~l~~~l~~l~~~~~~~~~~~~~~~~~~~~~~~d~~~~d~~~p~v~~~~ 1015 (1015)
T 3cmm_A 952 VSLLYASFFPPKKLKERLNLPITQLVKLVTKKDIPAHVSTMILEICADDKEGEDVEVPFITIHL 1015 (1015)
T ss_dssp TEEEEETTCCHHHHHHHTTSBHHHHHHHHSSSCCCSSCCEEEEEEEEECTTSCEECCCEEEEEC
T ss_pred CcEEEecCCCchhhHHhccCCHHHHHHhhccCcCCCCceEEEEEEEecCCCCCcCCCCcEEEeC
Confidence 9999999987 7789999999999999999999999999999999999989999999999986
|
| >1y8q_B Anthracycline-, ubiquitin-like 2 activating enzyme E1B; SUMO, heterodimer, UBL, ligase; HET: ATP; 2.25A {Homo sapiens} PDB: 1y8r_B* 3kyc_B* 3kyd_B* 2px9_A | Back alignment and structure |
|---|
| >1z7l_A Ubiquitin-activating enzyme E1 1; SCCH, second catalytic cysteine half-domain, ligase; HET: TBR; 2.80A {Mus musculus} | Back alignment and structure |
|---|
| >1tt5_A APPBP1, amyloid protein-binding protein 1; cell cycle, ligase; 2.60A {Homo sapiens} SCOP: c.111.1.2 PDB: 3dbh_A 3dbl_A 3dbr_A 1r4m_A 1r4n_A* 2nvu_A* 1yov_A 3gzn_A* | Back alignment and structure |
|---|
| >1y8q_A Ubiquitin-like 1 activating enzyme E1A; SUMO, heterodimer, UBL, ligase; HET: ATP; 2.25A {Homo sapiens} PDB: 1y8r_A* 3kyc_A* 3kyd_A* | Back alignment and structure |
|---|
| >1tt5_B Ubiquitin-activating enzyme E1C isoform 1; cell cycle, ligase; 2.60A {Homo sapiens} SCOP: c.111.1.2 PDB: 3dbl_B 3dbr_B 3dbh_B 3gzn_B* 1yov_B 1r4m_B 1r4n_B* | Back alignment and structure |
|---|
| >2nvu_B Maltose binding protein/NEDD8-activating enzyme E1 catalytic subunit chimera; multifunction macromolecular complex, ubiquitin, ATP, conformational change, thioester, switch, adenylation, protein turnover, ligase; HET: ATP; 2.80A {Homo sapiens} SCOP: c.111.1.2 c.94.1.1 | Back alignment and structure |
|---|
| >1y8q_A Ubiquitin-like 1 activating enzyme E1A; SUMO, heterodimer, UBL, ligase; HET: ATP; 2.25A {Homo sapiens} PDB: 1y8r_A* 3kyc_A* 3kyd_A* | Back alignment and structure |
|---|
| >1tt5_A APPBP1, amyloid protein-binding protein 1; cell cycle, ligase; 2.60A {Homo sapiens} SCOP: c.111.1.2 PDB: 3dbh_A 3dbl_A 3dbr_A 1r4m_A 1r4n_A* 2nvu_A* 1yov_A 3gzn_A* | Back alignment and structure |
|---|
| >1tt5_B Ubiquitin-activating enzyme E1C isoform 1; cell cycle, ligase; 2.60A {Homo sapiens} SCOP: c.111.1.2 PDB: 3dbl_B 3dbr_B 3dbh_B 3gzn_B* 1yov_B 1r4m_B 1r4n_B* | Back alignment and structure |
|---|
| >3h8v_A Ubiquitin-like modifier-activating enzyme 5; rossman fold, ATP-binding, UBL conjugation pathway, transfer structural genomics consortium, SGC; HET: ATP; 2.00A {Homo sapiens} PDB: 3guc_A* | Back alignment and structure |
|---|
| >1zud_1 Adenylyltransferase THIF; thiamin, thiazole, protein-protein complex, THIF, TRAN biosynthetic protein complex; 1.98A {Escherichia coli} PDB: 1zfn_A* 1zkm_A | Back alignment and structure |
|---|
| >1zud_1 Adenylyltransferase THIF; thiamin, thiazole, protein-protein complex, THIF, TRAN biosynthetic protein complex; 1.98A {Escherichia coli} PDB: 1zfn_A* 1zkm_A | Back alignment and structure |
|---|
| >2nvu_B Maltose binding protein/NEDD8-activating enzyme E1 catalytic subunit chimera; multifunction macromolecular complex, ubiquitin, ATP, conformational change, thioester, switch, adenylation, protein turnover, ligase; HET: ATP; 2.80A {Homo sapiens} SCOP: c.111.1.2 c.94.1.1 | Back alignment and structure |
|---|
| >1jw9_B Molybdopterin biosynthesis MOEB protein; MOEB: modified rossmann fold, (2) Cys-X-X-Cys zinc-binding M MOAD: ubiquitin-like fold; 1.70A {Escherichia coli} SCOP: c.111.1.1 PDB: 1jwa_B* 1jwb_B* | Back alignment and structure |
|---|
| >3h5n_A MCCB protein; ubiquitin-activating enzyme, microcin, protein structure, MCCC7, peptide antibiotics, N-P bond formation, transferase; HET: ATP; 1.90A {Escherichia coli} PDB: 3h5r_A 3h9g_A 3h9j_A* 3h9q_A 3h5a_A | Back alignment and structure |
|---|
| >1y8q_B Anthracycline-, ubiquitin-like 2 activating enzyme E1B; SUMO, heterodimer, UBL, ligase; HET: ATP; 2.25A {Homo sapiens} PDB: 1y8r_B* 3kyc_B* 3kyd_B* 2px9_A | Back alignment and structure |
|---|
| >3rui_A Ubiquitin-like modifier-activating enzyme ATG7; autophagosome formation, non-canonical E1, ATP BI UBL, ATG8, ATG12, ATG10, ATG3, UBL activation, thiolation; 1.91A {Saccharomyces cerevisiae} PDB: 3t7e_A 3vh3_A 3vh4_A* | Back alignment and structure |
|---|
| >3cmm_A Ubiquitin-activating enzyme E1 1; UBA1, protein turnover, ligase, conformationa thioester, adenylation, transthioesterification, ATP-bindin nucleotide-binding; 2.70A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1jw9_B Molybdopterin biosynthesis MOEB protein; MOEB: modified rossmann fold, (2) Cys-X-X-Cys zinc-binding M MOAD: ubiquitin-like fold; 1.70A {Escherichia coli} SCOP: c.111.1.1 PDB: 1jwa_B* 1jwb_B* | Back alignment and structure |
|---|
| >3h8v_A Ubiquitin-like modifier-activating enzyme 5; rossman fold, ATP-binding, UBL conjugation pathway, transfer structural genomics consortium, SGC; HET: ATP; 2.00A {Homo sapiens} PDB: 3guc_A* | Back alignment and structure |
|---|
| >4gsl_A Ubiquitin-like modifier-activating enzyme ATG7; ubiquitin-like protein activation enzyme, ubiquitin-like Pro transfer enzyme, protein transport; 2.70A {Saccharomyces cerevisiae} PDB: 3vh2_A 4gsk_A 3vh1_A | Back alignment and structure |
|---|
| >3vh1_A Ubiquitin-like modifier-activating enzyme ATG7; autophagy, zinc binding, metal binding protein; 3.00A {Saccharomyces cerevisiae} PDB: 3vh2_A | Back alignment and structure |
|---|
| >3h5n_A MCCB protein; ubiquitin-activating enzyme, microcin, protein structure, MCCC7, peptide antibiotics, N-P bond formation, transferase; HET: ATP; 1.90A {Escherichia coli} PDB: 3h5r_A 3h9g_A 3h9j_A* 3h9q_A 3h5a_A | Back alignment and structure |
|---|
| >3rui_A Ubiquitin-like modifier-activating enzyme ATG7; autophagosome formation, non-canonical E1, ATP BI UBL, ATG8, ATG12, ATG10, ATG3, UBL activation, thiolation; 1.91A {Saccharomyces cerevisiae} PDB: 3t7e_A 3vh3_A 3vh4_A* | Back alignment and structure |
|---|
| >4gsl_A Ubiquitin-like modifier-activating enzyme ATG7; ubiquitin-like protein activation enzyme, ubiquitin-like Pro transfer enzyme, protein transport; 2.70A {Saccharomyces cerevisiae} PDB: 3vh2_A 4gsk_A 3vh1_A | Back alignment and structure |
|---|
| >3vh1_A Ubiquitin-like modifier-activating enzyme ATG7; autophagy, zinc binding, metal binding protein; 3.00A {Saccharomyces cerevisiae} PDB: 3vh2_A | Back alignment and structure |
|---|
| >2v31_A Ubiquitin-activating enzyme E1 X; ligase, phosphorylation, catalytic domain, heteronuclear first catalytic cysteine half-domain, E1 protein; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1z7l_A Ubiquitin-activating enzyme E1 1; SCCH, second catalytic cysteine half-domain, ligase; HET: TBR; 2.80A {Mus musculus} | Back alignment and structure |
|---|
| >1y8x_B Ubiquitin-activating enzyme E1C; ubiquitin-conjugating enzyme E2 M, ligase; 2.40A {Homo sapiens} SCOP: c.111.1.2 PDB: 3fn1_A | Back alignment and structure |
|---|
| >3dfz_A SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase, cobalamin biosynthesis, NAD, oxidoreducta porphyrin biosynthesis; 2.30A {Bacillus megaterium} | Back alignment and structure |
|---|
| >3jyo_A Quinate/shikimate dehydrogenase; enzyme-cofactor complex, amino-acid biosynthesis, aromatic A biosynthesis, NAD, oxidoreductase; HET: NAD; 1.00A {Corynebacterium glutamicum} PDB: 3jyp_A* 3jyq_A* 2nlo_A | Back alignment and structure |
|---|
| >3jyo_A Quinate/shikimate dehydrogenase; enzyme-cofactor complex, amino-acid biosynthesis, aromatic A biosynthesis, NAD, oxidoreductase; HET: NAD; 1.00A {Corynebacterium glutamicum} PDB: 3jyp_A* 3jyq_A* 2nlo_A | Back alignment and structure |
|---|
| >1kyq_A Met8P, siroheme biosynthesis protein Met8; homodimer, oxidoreductase, lyase; HET: NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.2.1.11 e.37.1.1 | Back alignment and structure |
|---|
| >1pjq_A CYSG, siroheme synthase; rossman fold, nucleotide binding motif, SAM, NAD, phosphoserine, transferase/oxidoreductase/lyase complex; HET: SEP PGE SAH; 2.21A {Salmonella typhimurium} SCOP: c.2.1.11 c.90.1.1 e.37.1.1 PDB: 1pjs_A* 1pjt_A* | Back alignment and structure |
|---|
| >3ic5_A Putative saccharopine dehydrogenase; structural genomics, APC63807.2, N-terminal domain, saccharo dehydrogenase, PSI-2; HET: MSE; 2.08A {Ruegeria pomeroyi} | Back alignment and structure |
|---|
| >3dfz_A SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase, cobalamin biosynthesis, NAD, oxidoreducta porphyrin biosynthesis; 2.30A {Bacillus megaterium} | Back alignment and structure |
|---|
| >3ic5_A Putative saccharopine dehydrogenase; structural genomics, APC63807.2, N-terminal domain, saccharo dehydrogenase, PSI-2; HET: MSE; 2.08A {Ruegeria pomeroyi} | Back alignment and structure |
|---|
| >3llv_A Exopolyphosphatase-related protein; NAD(P)-binding, rossmann, PSI, M structural genomics; 1.70A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >2g1u_A Hypothetical protein TM1088A; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.50A {Thermotoga maritima} PDB: 3l4b_A* | Back alignment and structure |
|---|
| >3t4e_A Quinate/shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 1.95A {Salmonella enterica subsp} PDB: 1npd_A* 1o9b_A* 1vi2_A* | Back alignment and structure |
|---|
| >3llv_A Exopolyphosphatase-related protein; NAD(P)-binding, rossmann, PSI, M structural genomics; 1.70A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >3tnl_A Shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD SKM; 1.45A {Listeria monocytogenes} PDB: 3toz_A* | Back alignment and structure |
|---|
| >2hmt_A YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane protein, ION transporter, symporter, transport protein; HET: NAI; 2.20A {Bacillus subtilis} SCOP: c.2.1.9 PDB: 2hms_A* 2hmu_A* 2hmv_A* 2hmw_A* 1lsu_A* | Back alignment and structure |
|---|
| >2g1u_A Hypothetical protein TM1088A; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.50A {Thermotoga maritima} PDB: 3l4b_A* | Back alignment and structure |
|---|
| >2hmt_A YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane protein, ION transporter, symporter, transport protein; HET: NAI; 2.20A {Bacillus subtilis} SCOP: c.2.1.9 PDB: 2hms_A* 2hmu_A* 2hmv_A* 2hmw_A* 1lsu_A* | Back alignment and structure |
|---|
| >1id1_A Putative potassium channel protein; RCK domain, E.coli potassium channel, BK channel, rossmann fold, membrane protein; 2.40A {Escherichia coli} SCOP: c.2.1.9 | Back alignment and structure |
|---|
| >1lss_A TRK system potassium uptake protein TRKA homolog; KTN domain, NAD, RCK domain, potassium transport, potassium channel, KTRA; HET: NAD; 2.30A {Methanocaldococcus jannaschii} SCOP: c.2.1.9 | Back alignment and structure |
|---|
| >3tnl_A Shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD SKM; 1.45A {Listeria monocytogenes} PDB: 3toz_A* | Back alignment and structure |
|---|
| >1lss_A TRK system potassium uptake protein TRKA homolog; KTN domain, NAD, RCK domain, potassium transport, potassium channel, KTRA; HET: NAD; 2.30A {Methanocaldococcus jannaschii} SCOP: c.2.1.9 | Back alignment and structure |
|---|
| >1kyq_A Met8P, siroheme biosynthesis protein Met8; homodimer, oxidoreductase, lyase; HET: NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.2.1.11 e.37.1.1 | Back alignment and structure |
|---|
| >3e8x_A Putative NAD-dependent epimerase/dehydratase; structural genomics, APC7755, NADP, P protein structure initiative; HET: MSE NAP; 2.10A {Bacillus halodurans} | Back alignment and structure |
|---|
| >3abi_A Putative uncharacterized protein PH1688; L-lysine dehydrogenase, oxidoreductase; HET: NAD; 2.44A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >3abi_A Putative uncharacterized protein PH1688; L-lysine dehydrogenase, oxidoreductase; HET: NAD; 2.44A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >3pwz_A Shikimate dehydrogenase 3; alpha-beta, oxidoreductase; 1.71A {Pseudomonas putida} | Back alignment and structure |
|---|
| >2ph5_A Homospermidine synthase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: NAD; 2.50A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >4ina_A Saccharopine dehydrogenase; structural genomics, PSI-biology, northeast structural genom consortium, NESG, oxidoreductas; 2.49A {Wolinella succinogenes} | Back alignment and structure |
|---|
| >3t4e_A Quinate/shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 1.95A {Salmonella enterica subsp} PDB: 1npd_A* 1o9b_A* 1vi2_A* | Back alignment and structure |
|---|
| >3gvi_A Malate dehydrogenase; NAD, oxidoreductase, tricarboxylic acid cycle, structural genomics; HET: ADP; 2.25A {Brucella melitensis biovar ABORTUS2308} PDB: 3gvh_A* | Back alignment and structure |
|---|
| >1pjq_A CYSG, siroheme synthase; rossman fold, nucleotide binding motif, SAM, NAD, phosphoserine, transferase/oxidoreductase/lyase complex; HET: SEP PGE SAH; 2.21A {Salmonella typhimurium} SCOP: c.2.1.11 c.90.1.1 e.37.1.1 PDB: 1pjs_A* 1pjt_A* | Back alignment and structure |
|---|
| >3oj0_A Glutr, glutamyl-tRNA reductase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE SO4; 1.65A {Thermoplasma volcanium} | Back alignment and structure |
|---|
| >3o8q_A Shikimate 5-dehydrogenase I alpha; structural genomics, center for structural genomics of infec diseases, csgid; HET: EPE; 1.45A {Vibrio cholerae biovar el tor} PDB: 3sef_A* 3pgj_A* 3o8q_B* | Back alignment and structure |
|---|
| >3pwz_A Shikimate dehydrogenase 3; alpha-beta, oxidoreductase; 1.71A {Pseudomonas putida} | Back alignment and structure |
|---|
| >4ina_A Saccharopine dehydrogenase; structural genomics, PSI-biology, northeast structural genom consortium, NESG, oxidoreductas; 2.49A {Wolinella succinogenes} | Back alignment and structure |
|---|
| >1id1_A Putative potassium channel protein; RCK domain, E.coli potassium channel, BK channel, rossmann fold, membrane protein; 2.40A {Escherichia coli} SCOP: c.2.1.9 | Back alignment and structure |
|---|
| >3c85_A Putative glutathione-regulated potassium-efflux S protein KEFB; TRKA domain; HET: AMP; 1.90A {Vibrio parahaemolyticus rimd 2210633} | Back alignment and structure |
|---|
| >3l4b_C TRKA K+ channel protien TM1088B; potassium channel, ring-gating complex, structural GEN PSI-2-2, protein structure initiative; HET: AMP; 3.45A {Thermotoga maritima} | Back alignment and structure |
|---|
| >2egg_A AROE, shikimate 5-dehydrogenase; dimer, X-RAY diffraction, structural genomics, NPPSFA; 2.25A {Geobacillus kaustophilus} | Back alignment and structure |
|---|
| >3fwz_A Inner membrane protein YBAL; TRKA-N domain, E.coli, structural genomics, PSI-2, Pro structure initiative; HET: MSE AMP; 1.79A {Escherichia coli k-12} | Back alignment and structure |
|---|
| >3oj0_A Glutr, glutamyl-tRNA reductase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE SO4; 1.65A {Thermoplasma volcanium} | Back alignment and structure |
|---|
| >3o8q_A Shikimate 5-dehydrogenase I alpha; structural genomics, center for structural genomics of infec diseases, csgid; HET: EPE; 1.45A {Vibrio cholerae biovar el tor} PDB: 3sef_A* 3pgj_A* 3o8q_B* | Back alignment and structure |
|---|
| >3e8x_A Putative NAD-dependent epimerase/dehydratase; structural genomics, APC7755, NADP, P protein structure initiative; HET: MSE NAP; 2.10A {Bacillus halodurans} | Back alignment and structure |
|---|
| >3l4b_C TRKA K+ channel protien TM1088B; potassium channel, ring-gating complex, structural GEN PSI-2-2, protein structure initiative; HET: AMP; 3.45A {Thermotoga maritima} | Back alignment and structure |
|---|
| >1hyh_A L-hicdh, L-2-hydroxyisocaproate dehydrogenase; L-2-hydroxycarboxylate dehydrogenase, L-lactate dehydrogenas oxidoreductase (CHOH(D)-NAD+(A)); HET: NAD; 2.20A {Weissella confusa} SCOP: c.2.1.5 d.162.1.1 | Back alignment and structure |
|---|
| >2egg_A AROE, shikimate 5-dehydrogenase; dimer, X-RAY diffraction, structural genomics, NPPSFA; 2.25A {Geobacillus kaustophilus} | Back alignment and structure |
|---|
| >3p7m_A Malate dehydrogenase; putative dehydrogenase, enzyme, structural genomics, center structural genomics of infectious diseases, csgid; 2.20A {Francisella tularensis} | Back alignment and structure |
|---|
| >2d4a_B Malate dehydrogenase; archaea, hyperthermophIle, oxidoreductase; 2.87A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >3rku_A Oxidoreductase YMR226C; substrate fingerprint, short chain oxidoreductase, rossmann oxidoreductase; HET: NAP; 2.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3ruf_A WBGU; rossmann fold, UDP-hexose 4-epimerase, isomerase; HET: NAD UDP; 2.00A {Plesiomonas shigelloides} SCOP: c.2.1.2 PDB: 3ru9_A* 3rud_A* 3rue_A* 3rua_A* 3ruh_A* 3ruc_A* 3ru7_A* 3lu1_A* | Back alignment and structure |
|---|
| >3don_A Shikimate dehydrogenase; alpha-beta structure, rossman fold, amino-acid biosynthesis, amino acid biosynthesis, NADP, oxidoreductase; 2.10A {Staphylococcus epidermidis} PDB: 3doo_A* | Back alignment and structure |
|---|
| >3qsg_A NAD-binding phosphogluconate dehydrogenase-like P; structural genomics, PSI-biology, midwest center for structu genomics; 1.90A {Alicyclobacillus acidocaldarius subsp} | Back alignment and structure |
|---|
| >3h2s_A Putative NADH-flavin reductase; Q03B84, NESG, LCR19, structural genomics, PSI-2, protein structure initiative; HET: NDP; 1.78A {Lactobacillus casei atcc 334} | Back alignment and structure |
|---|
| >3d0o_A L-LDH 1, L-lactate dehydrogenase 1; cytoplasm, glycolysis, NAD, oxidoreductase, phosphoprotein; 1.80A {Staphylococcus aureus} PDB: 3d4p_A* 3h3j_A* | Back alignment and structure |
|---|
| >3don_A Shikimate dehydrogenase; alpha-beta structure, rossman fold, amino-acid biosynthesis, amino acid biosynthesis, NADP, oxidoreductase; 2.10A {Staphylococcus epidermidis} PDB: 3doo_A* | Back alignment and structure |
|---|
| >3t4x_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, center for structural genomics of infec diseases, csgid; 2.80A {Bacillus anthracis} | Back alignment and structure |
|---|
| >3dqp_A Oxidoreductase YLBE; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 1.40A {Lactococcus lactis subsp} | Back alignment and structure |
|---|
| >1hdo_A Biliverdin IX beta reductase; foetal metabolism, HAEM degradation, flavin reductase, diaphorase, green HAEM binding protein; HET: NAP; 1.15A {Homo sapiens} SCOP: c.2.1.2 PDB: 1he2_A* 1he3_A* 1he4_A* 1he5_A* | Back alignment and structure |
|---|
| >3gpi_A NAD-dependent epimerase/dehydratase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.44A {Methylobacillus flagellatus KT} | Back alignment and structure |
|---|
| >2raf_A Putative dinucleotide-binding oxidoreductase; NP_786167.1, NADP oxidoreductase coenzyme F420-dependent, structural genomics; HET: MSE NAP; 1.60A {Lactobacillus plantarum WCFS1} | Back alignment and structure |
|---|
| >1ldn_A L-lactate dehydrogenase; oxidoreductase(CHOH(D)-NAD(A)); HET: FBP NAD; 2.50A {Geobacillus stearothermophilus} SCOP: c.2.1.5 d.162.1.1 PDB: 1ldb_A 2ldb_A* | Back alignment and structure |
|---|
| >3dhn_A NAD-dependent epimerase/dehydratase; reductase, PF01370, Q89Z24_bactn, NESG, BTR310, structural genomics, PSI-2; 2.00A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >3vku_A L-LDH, L-lactate dehydrogenase; rossmann fold, NADH binding, oxidoreductase; 1.96A {Lactobacillus casei} PDB: 2zqz_A 2zqy_A 3vkv_A* 1llc_A* | Back alignment and structure |
|---|
| >1oju_A MDH, malate dehydrogenase; hyperthermophilic, oxidoreductase; HET: ENA; 2.79A {Archaeoglobus fulgidus} PDB: 1ojs_A* 2x0i_A* 2x0j_A* | Back alignment and structure |
|---|
| >1npy_A Hypothetical shikimate 5-dehydrogenase-like protein HI0607; structural genomics, PSI, protein structure initiative; 1.75A {Haemophilus influenzae} SCOP: c.2.1.7 c.58.1.5 | Back alignment and structure |
|---|
| >3pqe_A L-LDH, L-lactate dehydrogenase; FBP, oxidoreductase; 2.20A {Bacillus subtilis} PDB: 3pqf_A* 3pqd_A* | Back alignment and structure |
|---|
| >2b69_A UDP-glucuronate decarboxylase 1; UDP-glucoronic acid decarboxylase, structural genomics, STRU genomics consortium, SGC, lyase; HET: MSE NAD UDP; 1.21A {Homo sapiens} SCOP: c.2.1.2 PDB: 4ef7_A* | Back alignment and structure |
|---|
| >3dhn_A NAD-dependent epimerase/dehydratase; reductase, PF01370, Q89Z24_bactn, NESG, BTR310, structural genomics, PSI-2; 2.00A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >2ewd_A Lactate dehydrogenase,; protein-substrate_cofactor analog complex, oxidoreductase; HET: A3D; 2.00A {Cryptosporidium parvum} PDB: 2frm_A 2fn7_A* 2fnz_A* 2fm3_A | Back alignment and structure |
|---|
| >4g65_A TRK system potassium uptake protein TRKA; structural genomics, center for structural genomics of infec diseases, csgid, niaid; HET: MSE; 2.09A {Vibrio vulnificus} | Back alignment and structure |
|---|
| >3doj_A AT3G25530, dehydrogenase-like protein; gamma-hydroxybutyrate dehydrogenase, 4-hydroxybutyrate dehydrogenase; 2.10A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >4aj2_A L-lactate dehydrogenase A chain; oxidoreductase-inhibitor complex, fragment-based LEAD genera inhibitors; HET: 52C; 1.75A {Rattus norvegicus} PDB: 4aj1_A* 4aje_A* 4ajh_A* 4aji_A* 4ajj_A* 4ajk_A* 4ajl_A* 4ajn_A* 4ajo_A* 4al4_A* 4aj4_A* 4ajp_A* 1i10_A* 3h3f_A* 9ldt_A* 9ldb_A* 1t2f_A* 1i0z_A* 5ldh_A* 1ldm_A* ... | Back alignment and structure |
|---|
| >2hk9_A Shikimate dehydrogenase; shikimate pathway, drug design, oxidoreductase; HET: ATR SKM NAP; 2.20A {Aquifex aeolicus} PDB: 2hk8_A 2hk7_A | Back alignment and structure |
|---|
| >2aef_A Calcium-gated potassium channel MTHK; rossmann fold, helix-turn-helix, Ca2+ binding, flexible interface; 1.70A {Methanothermobacterthermautotrophicus} PDB: 2aej_A 2aem_A 3rbx_A 2ogu_A 2fy8_A 3kxd_A | Back alignment and structure |
|---|
| >3gpi_A NAD-dependent epimerase/dehydratase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.44A {Methylobacillus flagellatus KT} | Back alignment and structure |
|---|
| >2x0j_A Malate dehydrogenase; oxidoreductase, hyperthermophilic, tricarboxylic acid cycle; HET: ENA; 2.79A {Archaeoglobus fulgidus dsm 4304} PDB: 2x0i_A* | Back alignment and structure |
|---|
| >4ezb_A Uncharacterized conserved protein; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 2.10A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >3tl2_A Malate dehydrogenase; center for structural genomics of infectious diseases, csgid dehydrogenase, oxidoreductase, citric acid cycle; 1.70A {Bacillus anthracis} | Back alignment and structure |
|---|
| >4e21_A 6-phosphogluconate dehydrogenase (decarboxylating; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.30A {Geobacter metallireducens} | Back alignment and structure |
|---|
| >3o38_A Short chain dehydrogenase; tuberculosis, ortholog from A non-pathogenic dehydrogenase, structural genomics; 1.95A {Mycobacterium smegmatis} | Back alignment and structure |
|---|
| >4egb_A DTDP-glucose 4,6-dehydratase; rhamnose pathway, center for structural genomics of infectio diseases, csgid, niaid; HET: NAD SUC; 3.00A {Bacillus anthracis} | Back alignment and structure |
|---|
| >3slg_A PBGP3 protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid, melioidosis, glanders; 2.10A {Burkholderia pseudomallei} | Back alignment and structure |
|---|
| >4id9_A Short-chain dehydrogenase/reductase; putative dehydrogenase, enzyme function initiative, EFI, STR genomics, oxidoreductase; HET: NAD; 1.60A {Agrobacterium fabrum} PDB: 4idg_A* | Back alignment and structure |
|---|
| >1hdo_A Biliverdin IX beta reductase; foetal metabolism, HAEM degradation, flavin reductase, diaphorase, green HAEM binding protein; HET: NAP; 1.15A {Homo sapiens} SCOP: c.2.1.2 PDB: 1he2_A* 1he3_A* 1he4_A* 1he5_A* | Back alignment and structure |
|---|
| >4id9_A Short-chain dehydrogenase/reductase; putative dehydrogenase, enzyme function initiative, EFI, STR genomics, oxidoreductase; HET: NAD; 1.60A {Agrobacterium fabrum} PDB: 4idg_A* | Back alignment and structure |
|---|
| >3fbt_A Chorismate mutase and shikimate 5-dehydrogenase fusion protein; structural genomics, oxidoreductase, amino-acid biosynthesis; 2.10A {Clostridium acetobutylicum} | Back alignment and structure |
|---|
| >4egb_A DTDP-glucose 4,6-dehydratase; rhamnose pathway, center for structural genomics of infectio diseases, csgid, niaid; HET: NAD SUC; 3.00A {Bacillus anthracis} | Back alignment and structure |
|---|
| >3lf2_A Short chain oxidoreductase Q9HYA2; SDR, SCOR, rossmann fold; HET: NAP; 2.30A {Pseudomonas aeruginosa} PDB: 3lf1_A* | Back alignment and structure |
|---|
| >2raf_A Putative dinucleotide-binding oxidoreductase; NP_786167.1, NADP oxidoreductase coenzyme F420-dependent, structural genomics; HET: MSE NAP; 1.60A {Lactobacillus plantarum WCFS1} | Back alignment and structure |
|---|
| >3slg_A PBGP3 protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid, melioidosis, glanders; 2.10A {Burkholderia pseudomallei} | Back alignment and structure |
|---|
| >3rku_A Oxidoreductase YMR226C; substrate fingerprint, short chain oxidoreductase, rossmann oxidoreductase; HET: NAP; 2.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3gvi_A Malate dehydrogenase; NAD, oxidoreductase, tricarboxylic acid cycle, structural genomics; HET: ADP; 2.25A {Brucella melitensis biovar ABORTUS2308} PDB: 3gvh_A* | Back alignment and structure |
|---|
| >1xg5_A ARPG836; short chain dehydrogenase, human, SGC, structural genomics, structural genomics consortium, oxidoreductase; HET: NAP; 1.53A {Homo sapiens} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >1gpj_A Glutamyl-tRNA reductase; tRNA-dependent tetrapyrrole biosynthesis; HET: GMC CIT; 1.95A {Methanopyrus kandleri} SCOP: a.151.1.1 c.2.1.7 d.58.39.1 | Back alignment and structure |
|---|
| >3onh_A Ubiquitin-activating enzyme E1-like; ligase, SUMO conjugation, UBC9; 1.60A {Saccharomyces cerevisiae} PDB: 3ong_A | Back alignment and structure |
|---|
| >2hjr_A Malate dehydrogenase; malaria, structural genomics, structural genomics consortium, SGC, oxidoreductase; HET: CIT APR; 2.20A {Cryptosporidium parvum} | Back alignment and structure |
|---|
| >1p9l_A Dihydrodipicolinate reductase; oxidoreductase, lysine biosynthesis, NADH binding specificity, TB structural genomics consortium; HET: NAD PDC PG4; 2.30A {Mycobacterium tuberculosis} SCOP: c.2.1.3 d.81.1.3 PDB: 1c3v_A* 1yl5_A 1yl7_A* 1yl6_A* | Back alignment and structure |
|---|
| >3ldh_A Lactate dehydrogenase; oxidoreductase, CHOH donor, NAD acceptor; HET: NAD; 3.00A {Squalus acanthias} SCOP: i.12.1.1 | Back alignment and structure |
|---|
| >2v6b_A L-LDH, L-lactate dehydrogenase; oxidoreductase, radioresistance, NAD, cytoplasm, mesophilic, glycolysis; 2.50A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >1ur5_A Malate dehydrogenase; oxidoreductase, tricarboxylic acid cycle; HET: NAD; 1.75A {Chloroflexus aurantiacus} SCOP: c.2.1.5 d.162.1.1 PDB: 1uxg_A* 1guy_A* 1uxk_A* 1uxh_A* 1uxj_A* 1uxi_A* | Back alignment and structure |
|---|
| >3phh_A Shikimate dehydrogenase; shikimate pathway, helicobacter PYL oxidoreductase, alpha/beta domain, rossmann fold; HET: SKM; 1.42A {Helicobacter pylori} PDB: 3phg_A* 3phi_A* 3phj_A* 4foo_A 4fpx_A 4fos_A* 4fr5_A* 4fq8_A* | Back alignment and structure |
|---|
| >2axq_A Saccharopine dehydrogenase; rossmann fold variant, saccharopine reductase fold (domain II), alpha/beta protein; 1.70A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4e12_A Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1.93A {Acinetobacter baylyi} PDB: 4dyd_A* 4e13_A* | Back alignment and structure |
|---|
| >3qsg_A NAD-binding phosphogluconate dehydrogenase-like P; structural genomics, PSI-biology, midwest center for structu genomics; 1.90A {Alicyclobacillus acidocaldarius subsp} | Back alignment and structure |
|---|
| >3ruf_A WBGU; rossmann fold, UDP-hexose 4-epimerase, isomerase; HET: NAD UDP; 2.00A {Plesiomonas shigelloides} SCOP: c.2.1.2 PDB: 3ru9_A* 3rud_A* 3rue_A* 3rua_A* 3ruh_A* 3ruc_A* 3ru7_A* 3lu1_A* | Back alignment and structure |
|---|
| >4ezb_A Uncharacterized conserved protein; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 2.10A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >1y1p_A ARII, aldehyde reductase II; rossmann fold, short chain dehydrogenase reductase, oxidoreductase; HET: NMN AMP; 1.60A {Sporidiobolus salmonicolor} SCOP: c.2.1.2 PDB: 1ujm_A* 1zze_A | Back alignment and structure |
|---|
| >3nyw_A Putative oxidoreductase; fatty acid synthesis,3-oxoacyl-[ACP] reductase, NADP+ bindin rossman fold, PSI-II, nysgxrc; 2.16A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >2pzm_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, protein-nucleotide comple binding protein; HET: NAD UDP; 2.00A {Bordetella bronchiseptica} PDB: 2pzl_A* 2pzk_A* | Back alignment and structure |
|---|
| >3l9w_A Glutathione-regulated potassium-efflux system Pro linker, ancillary protein KEFF; potassium channel regulation, domains, antiport; HET: FMN AMP GSH; 1.75A {Escherichia coli} PDB: 3eyw_A* 3l9x_A* | Back alignment and structure |
|---|
| >1lld_A L-lactate dehydrogenase; oxidoreductase(CHOH (D)-NAD (A)); HET: NAD; 2.00A {Bifidobacterium longum subsp} SCOP: c.2.1.5 d.162.1.1 PDB: 1lth_T* | Back alignment and structure |
|---|
| >3l9w_A Glutathione-regulated potassium-efflux system Pro linker, ancillary protein KEFF; potassium channel regulation, domains, antiport; HET: FMN AMP GSH; 1.75A {Escherichia coli} PDB: 3eyw_A* 3l9x_A* | Back alignment and structure |
|---|
| >3ew7_A LMO0794 protein; Q8Y8U8_lismo, putative NAD-dependent epimerase/dehydratase, LMR162, NESG, structural genomics, PSI-2; 2.73A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >3dqp_A Oxidoreductase YLBE; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 1.40A {Lactococcus lactis subsp} | Back alignment and structure |
|---|
| >3d1l_A Putative NADP oxidoreductase BF3122; structural genomics, PSI-2, protein structure initiative, M center for structural genomics, MCSG; 2.19A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >3o26_A Salutaridine reductase; short chain dehydrogenase/reductases, oxidoreductase; HET: NDP; 1.91A {Papaver somniferum} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >3qiv_A Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR protein] reductase; structural genomics; 2.25A {Mycobacterium avium subsp} | Back alignment and structure |
|---|
| >3qvo_A NMRA family protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MNB; 2.30A {Shigella flexneri 2A} | Back alignment and structure |
|---|
| >3m2p_A UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J, isomerase, structural genomics, PSI-2, protein structure initiative; HET: UDP; 2.95A {Bacillus cereus} | Back alignment and structure |
|---|
| >1iy8_A Levodione reductase; oxidoreductase; HET: NAD; 1.60A {Leifsonia aquatica} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >2ph5_A Homospermidine synthase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: NAD; 2.50A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >3obb_A Probable 3-hydroxyisobutyrate dehydrogenase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics; HET: EPE; 2.20A {Pseudomonas aeruginosa} PDB: 3q3c_A* | Back alignment and structure |
|---|
| >1nyt_A Shikimate 5-dehydrogenase; alpha/beta domains, WIDE cleft separation, oxidoreductase; HET: NAP; 1.50A {Escherichia coli} SCOP: c.2.1.7 c.58.1.5 | Back alignment and structure |
|---|
| >3tri_A Pyrroline-5-carboxylate reductase; amino acid biosynthesis, oxidoreductase; HET: NAP; 2.50A {Coxiella burnetii} | Back alignment and structure |
|---|
| >3hg7_A D-isomer specific 2-hydroxyacid dehydrogenase FAM protein; structural genomics; 1.80A {Aeromonas salmonicida subsp} | Back alignment and structure |
|---|
| >1p77_A Shikimate 5-dehydrogenase; NADPH, oxidoreductase; HET: ATR; 1.95A {Haemophilus influenzae} SCOP: c.2.1.7 c.58.1.5 PDB: 1p74_A* | Back alignment and structure |
|---|
| >1y1p_A ARII, aldehyde reductase II; rossmann fold, short chain dehydrogenase reductase, oxidoreductase; HET: NMN AMP; 1.60A {Sporidiobolus salmonicolor} SCOP: c.2.1.2 PDB: 1ujm_A* 1zze_A | Back alignment and structure |
|---|
| >3tri_A Pyrroline-5-carboxylate reductase; amino acid biosynthesis, oxidoreductase; HET: NAP; 2.50A {Coxiella burnetii} | Back alignment and structure |
|---|
| >3fwz_A Inner membrane protein YBAL; TRKA-N domain, E.coli, structural genomics, PSI-2, Pro structure initiative; HET: MSE AMP; 1.79A {Escherichia coli k-12} | Back alignment and structure |
|---|
| >1sb8_A WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCNAC, SDR, G SYK, UDP, N-acetylglucosamine, N- acetylgalactosamine, UDP-GLC, isomerase; HET: NAD UD2; 2.10A {Pseudomonas aeruginosa} SCOP: c.2.1.2 PDB: 1sb9_A* | Back alignment and structure |
|---|
| >3fi9_A Malate dehydrogenase; structural genomics, oxidoreductase, PSI-2, protein structur initiative; 1.90A {Porphyromonas gingivalis} | Back alignment and structure |
|---|
| >3d1l_A Putative NADP oxidoreductase BF3122; structural genomics, PSI-2, protein structure initiative, M center for structural genomics, MCSG; 2.19A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >1ez4_A Lactate dehydrogenase; rossmann fold, oxidoreductase; HET: NAD; 2.30A {Lactobacillus pentosus} SCOP: c.2.1.5 d.162.1.1 | Back alignment and structure |
|---|
| >3pp8_A Glyoxylate/hydroxypyruvate reductase A; structural genomics, center for structural genomics of infec diseases, csgid; 2.10A {Salmonella enterica subsp} PDB: 3kbo_A | Back alignment and structure |
|---|
| >1t2d_A LDH-P, L-lactate dehydrogenase; ternary complex, oxidoreductase; HET: NAD; 1.10A {Plasmodium falciparum} SCOP: c.2.1.5 d.162.1.1 PDB: 1t25_A* 1t26_A* 1t2c_A* 1t24_A* 2x8l_A 2ydn_A* 2a94_A* 1u4s_A* 1u5a_A* 1u5c_A* 1u4o_A* 1t2e_A* 1xiv_A* 1ceq_A 1ldg_A* 1cet_A* 1oc4_A* 2a92_A* 2aa3_A* | Back alignment and structure |
|---|
| >3u62_A Shikimate dehydrogenase; shikimate pathway, oxidoreductase; 1.45A {Thermotoga maritima} | Back alignment and structure |
|---|
| >3m2p_A UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J, isomerase, structural genomics, PSI-2, protein structure initiative; HET: UDP; 2.95A {Bacillus cereus} | Back alignment and structure |
|---|
| >3evt_A Phosphoglycerate dehydrogenase; structural genomics, PSI-2, protein structure initiative; 2.20A {Lactobacillus plantarum} | Back alignment and structure |
|---|
| >1lu9_A Methylene tetrahydromethanopterin dehydrogenase; alpha/beta twisted open sheet structure, oxidoreductase; 1.90A {Methylobacterium extorquens} SCOP: c.2.1.7 c.58.1.4 PDB: 1lua_A* | Back alignment and structure |
|---|
| >1nvt_A Shikimate 5'-dehydrogenase; structural genomics, PSI, protein structure initiative; HET: NAP; 2.35A {Methanocaldococcus jannaschii} SCOP: c.2.1.7 c.58.1.5 | Back alignment and structure |
|---|
| >4gbj_A 6-phosphogluconate dehydrogenase NAD-binding; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.05A {Dyadobacter fermentans} | Back alignment and structure |
|---|
| >2bka_A CC3, TAT-interacting protein TIP30; NADPH, PEG600, transcription; HET: NDP PE8; 1.7A {Homo sapiens} SCOP: c.2.1.2 PDB: 2fmu_A | Back alignment and structure |
|---|
| >2pzm_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, protein-nucleotide comple binding protein; HET: NAD UDP; 2.00A {Bordetella bronchiseptica} PDB: 2pzl_A* 2pzk_A* | Back alignment and structure |
|---|
| >3pef_A 6-phosphogluconate dehydrogenase, NAD-binding; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R geobacter metallireducens; HET: NAP; 2.07A {Geobacter metallireducens} | Back alignment and structure |
|---|
| >3ius_A Uncharacterized conserved protein; APC63810, silicibacter pomeroyi DSS, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.66A {Ruegeria pomeroyi dss-3} | Back alignment and structure |
|---|
| >1sby_A Alcohol dehydrogenase; ternary complex, NAD, trifluoroethanol, oxidoreductase; HET: NAD; 1.10A {Scaptodrosophila lebanonensis} SCOP: c.2.1.2 PDB: 1b14_A* 1b15_A* 1a4u_A* 1b2l_A* 1b16_A* 3rj5_A* 3rj9_A* 1mg5_A* | Back alignment and structure |
|---|
| >1a5z_A L-lactate dehydrogenase; oxidoreductase, glycolysis, hyperthermophiles, thermotoga MA protein stability; HET: FBP NAD; 2.10A {Thermotoga maritima} SCOP: c.2.1.5 d.162.1.1 | Back alignment and structure |
|---|
| >4g65_A TRK system potassium uptake protein TRKA; structural genomics, center for structural genomics of infec diseases, csgid, niaid; HET: MSE; 2.09A {Vibrio vulnificus} | Back alignment and structure |
|---|
| >3qvo_A NMRA family protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MNB; 2.30A {Shigella flexneri 2A} | Back alignment and structure |
|---|
| >3ko8_A NAD-dependent epimerase/dehydratase; isomerase, UDP-galactose 4-epimerase; HET: NAD; 1.80A {Pyrobaculum calidifontis} SCOP: c.2.1.0 PDB: 3icp_A* 3aw9_A* | Back alignment and structure |
|---|
| >2gn4_A FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann fold, TYK triad, SDR, enzyme, NADP, NADPH, lyase; HET: NDP UD1 MES; 1.90A {Helicobacter pylori} PDB: 2gn6_A* 2gn8_A* 2gn9_A* 2gna_A* | Back alignment and structure |
|---|
| >3rkr_A Short chain oxidoreductase; rossmann fold; HET: NAP; 2.42A {Uncultured bacterium BIO5} | Back alignment and structure |
|---|
| >2hjr_A Malate dehydrogenase; malaria, structural genomics, structural genomics consortium, SGC, oxidoreductase; HET: CIT APR; 2.20A {Cryptosporidium parvum} | Back alignment and structure |
|---|
| >1lu9_A Methylene tetrahydromethanopterin dehydrogenase; alpha/beta twisted open sheet structure, oxidoreductase; 1.90A {Methylobacterium extorquens} SCOP: c.2.1.7 c.58.1.4 PDB: 1lua_A* | Back alignment and structure |
|---|
| >3p7m_A Malate dehydrogenase; putative dehydrogenase, enzyme, structural genomics, center structural genomics of infectious diseases, csgid; 2.20A {Francisella tularensis} | Back alignment and structure |
|---|
| >3dtt_A NADP oxidoreductase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: NAP; 1.70A {Arthrobacter SP} | Back alignment and structure |
|---|
| >3c85_A Putative glutathione-regulated potassium-efflux S protein KEFB; TRKA domain; HET: AMP; 1.90A {Vibrio parahaemolyticus rimd 2210633} | Back alignment and structure |
|---|
| >1ff9_A Saccharopine reductase; lysine biosynthesis, alpha-aminoadipate pathway, dehydrogenase, oxidoreductase; 2.00A {Magnaporthe grisea} SCOP: c.2.1.3 d.81.1.2 PDB: 1e5l_A* 1e5q_A | Back alignment and structure |
|---|
| >3r6d_A NAD-dependent epimerase/dehydratase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, veillo parvula; HET: MLZ; 1.25A {Veillonella parvula dsm 2008} PDB: 4hng_A 4hnh_A* 3r14_A* | Back alignment and structure |
|---|
| >2b69_A UDP-glucuronate decarboxylase 1; UDP-glucoronic acid decarboxylase, structural genomics, STRU genomics consortium, SGC, lyase; HET: MSE NAD UDP; 1.21A {Homo sapiens} SCOP: c.2.1.2 PDB: 4ef7_A* | Back alignment and structure |
|---|
| >3ius_A Uncharacterized conserved protein; APC63810, silicibacter pomeroyi DSS, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.66A {Ruegeria pomeroyi dss-3} | Back alignment and structure |
|---|
| >3ioy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structure initiative; 1.90A {Novosphingobium aromaticivorans DSM12444} | Back alignment and structure |
|---|
| >3vps_A TUNA, NAD-dependent epimerase/dehydratase; tunicamycins, biosynthesis, EXO-glycal, rossman transferase; HET: UD1 NAD; 1.90A {Streptomyces chartreusis} | Back alignment and structure |
|---|
| >3nep_X Malate dehydrogenase; halophIle, molecular adpatation, NAD, oxidoreductase, tricarboxylic acid cycle; 1.55A {Salinibacter ruber} | Back alignment and structure |
|---|
| >1sb8_A WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCNAC, SDR, G SYK, UDP, N-acetylglucosamine, N- acetylgalactosamine, UDP-GLC, isomerase; HET: NAD UD2; 2.10A {Pseudomonas aeruginosa} SCOP: c.2.1.2 PDB: 1sb9_A* | Back alignment and structure |
|---|
| >3vku_A L-LDH, L-lactate dehydrogenase; rossmann fold, NADH binding, oxidoreductase; 1.96A {Lactobacillus casei} PDB: 2zqz_A 2zqy_A 3vkv_A* 1llc_A* | Back alignment and structure |
|---|
| >2zqz_A L-LDH, L-lactate dehydrogenase; oxidoreductase, rossmann fold, cytoplasm, glycolysis, NAD, phosphoprotein; 2.50A {Lactobacillus casei} PDB: 2zqy_A 3vkv_A* 1llc_A* | Back alignment and structure |
|---|
| >1p9l_A Dihydrodipicolinate reductase; oxidoreductase, lysine biosynthesis, NADH binding specificity, TB structural genomics consortium; HET: NAD PDC PG4; 2.30A {Mycobacterium tuberculosis} SCOP: c.2.1.3 d.81.1.3 PDB: 1c3v_A* 1yl5_A 1yl7_A* 1yl6_A* | Back alignment and structure |
|---|
| >3pdu_A 3-hydroxyisobutyrate dehydrogenase family protein; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R glyoxylate metabolism; HET: NAP; 1.89A {Geobacter sulfurreducens} | Back alignment and structure |
|---|
| >3lk7_A UDP-N-acetylmuramoylalanine--D-glutamate ligase; agalacitae, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: MSE; 1.50A {Streptococcus agalactiae} | Back alignment and structure |
|---|
| >3i1j_A Oxidoreductase, short chain dehydrogenase/reducta; dimer, MIXE beta, structural genomics, PSI-2; 1.90A {Pseudomonas syringae PV} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >2axq_A Saccharopine dehydrogenase; rossmann fold variant, saccharopine reductase fold (domain II), alpha/beta protein; 1.70A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2cvz_A Dehydrogenase, 3-hydroxyisobutyrate dehydrogenase; valine catabolism, NADP+, structural GEN riken structural genomics/proteomics initiative; HET: NDP; 1.80A {Thermus thermophilus} SCOP: a.100.1.1 c.2.1.6 PDB: 1wp4_A* | Back alignment and structure |
|---|
| >2x6t_A ADP-L-glycero-D-manno-heptose-6-epimerase; isomerase, carbohydrate metabolism, stress response; HET: NAP ADP BMA; 2.36A {Escherichia coli} PDB: 2x86_A* | Back alignment and structure |
|---|
| >3i6i_A Putative leucoanthocyanidin reductase 1; rossmann fold, short chain dehydrogenase reductase, flavonoi oxidoreductase; HET: NDP; 1.75A {Vitis vinifera} PDB: 3i5m_A 3i52_A* 3i6q_A* | Back alignment and structure |
|---|
| >2pv7_A T-protein [includes: chorismate mutase (EC 5.4.99 and prephenate dehydrogenase (EC...; 1574749, chorismate mutase type II; HET: MSE TYR NAD; 2.00A {Haemophilus influenzae} SCOP: a.100.1.12 c.2.1.6 | Back alignment and structure |
|---|
| >2bll_A Protein YFBG; decarboxylase, short chain dehydrogenase, L-ARA4N biosynthes methyltransferase, transferase; 2.3A {Escherichia coli} SCOP: c.2.1.2 PDB: 1u9j_A 1z73_A 1z75_A 1z7b_A 1z74_A | Back alignment and structure |
|---|
| >3sxp_A ADP-L-glycero-D-mannoheptose-6-epimerase; rossman fold, NAD binding, isomerase; HET: NAD; 2.55A {Helicobacter pylori} | Back alignment and structure |
|---|
| >2d5c_A AROE, shikimate 5-dehydrogenase; substrate, dimer, structural genomics, NPPSFA, Na project on protein structural and functional analyses; HET: SKM; 1.65A {Thermus thermophilus} PDB: 1wxd_A* 2cy0_A* 2ev9_A* | Back alignment and structure |
|---|
| >2xxj_A L-LDH, L-lactate dehydrogenase; oxidoreductase, hyperthermophIle; HET: NAD; 1.964A {Thermus thermophilus} PDB: 2xxb_A* 3zzn_A* 2v7p_A* 2e37_A* 2v6m_A* 2xxe_A 4a73_A | Back alignment and structure |
|---|
| >2bka_A CC3, TAT-interacting protein TIP30; NADPH, PEG600, transcription; HET: NDP PE8; 1.7A {Homo sapiens} SCOP: c.2.1.2 PDB: 2fmu_A | Back alignment and structure |
|---|
| >1xu9_A Corticosteroid 11-beta-dehydrogenase, isozyme 1; hydroxysteroid, SDR, oxidoreductase; HET: NDP CPS MES; 1.55A {Homo sapiens} SCOP: c.2.1.2 PDB: 1xu7_A* 3bzu_A* 3czr_A* 3d3e_A* 3d4n_A* 3fco_A* 3frj_A* 3h6k_A* 3hfg_A* 3oq1_A* 3qqp_A* 3pdj_A* 3d5q_A* 2rbe_A* 3byz_A* 3ey4_A* 3tfq_A* 3ch6_A* 2irw_A* 2ilt_A* ... | Back alignment and structure |
|---|
| >2gf2_A Hibadh, 3-hydroxyisobutyrate dehydrogenase; structural genomics, structural genomics consortium, SGC, oxidoreductase; 2.38A {Homo sapiens} PDB: 2i9p_A* | Back alignment and structure |
|---|
| >3pqe_A L-LDH, L-lactate dehydrogenase; FBP, oxidoreductase; 2.20A {Bacillus subtilis} PDB: 3pqf_A* 3pqd_A* | Back alignment and structure |
|---|
| >2x0j_A Malate dehydrogenase; oxidoreductase, hyperthermophilic, tricarboxylic acid cycle; HET: ENA; 2.79A {Archaeoglobus fulgidus dsm 4304} PDB: 2x0i_A* | Back alignment and structure |
|---|
| >3svt_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 2.00A {Mycobacterium ulcerans} | Back alignment and structure |
|---|
| >2z1m_A GDP-D-mannose dehydratase; short-chain dehydrogenase/reductase, lyase, structural genom NPPSFA; HET: NDP GDP; 2.00A {Aquifex aeolicus} PDB: 2z95_A* | Back alignment and structure |
|---|
| >3u62_A Shikimate dehydrogenase; shikimate pathway, oxidoreductase; 1.45A {Thermotoga maritima} | Back alignment and structure |
|---|
| >3rft_A Uronate dehydrogenase; apoenzyme, rossmann fold, NAD binding, oxidoreductase; 1.90A {Agrobacterium tumefaciens} PDB: 3rfv_A* 3rfx_A* | Back alignment and structure |
|---|
| >4e21_A 6-phosphogluconate dehydrogenase (decarboxylating; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.30A {Geobacter metallireducens} | Back alignment and structure |
|---|
| >3r6d_A NAD-dependent epimerase/dehydratase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, veillo parvula; HET: MLZ; 1.25A {Veillonella parvula dsm 2008} PDB: 4hng_A 4hnh_A* 3r14_A* | Back alignment and structure |
|---|
| >3i6i_A Putative leucoanthocyanidin reductase 1; rossmann fold, short chain dehydrogenase reductase, flavonoi oxidoreductase; HET: NDP; 1.75A {Vitis vinifera} PDB: 3i5m_A 3i52_A* 3i6q_A* | Back alignment and structure |
|---|
| >3vps_A TUNA, NAD-dependent epimerase/dehydratase; tunicamycins, biosynthesis, EXO-glycal, rossman transferase; HET: UD1 NAD; 1.90A {Streptomyces chartreusis} | Back alignment and structure |
|---|
| >2rir_A Dipicolinate synthase, A chain; structural genomics, APC1343, PSI-2, structure initiative; HET: MSE NAP; 2.79A {Bacillus subtilis} | Back alignment and structure |
|---|
| >3sju_A Keto reductase; short-chain dehydrogenase, oxidoreductase; HET: NDP; 2.40A {Streptomyces griseoruber} | Back alignment and structure |
|---|
| >3kkj_A Amine oxidase, flavin-containing; oxidoreductase, PSR10, Q888A4, X-RAY, structure, PSI, protein structure initiative; HET: FAD; 2.50A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >1pjc_A Protein (L-alanine dehydrogenase); oxidoreductase, NAD; HET: NAD; 2.00A {Phormidium lapideum} SCOP: c.2.1.4 c.23.12.2 PDB: 1pjb_A* 1say_A | Back alignment and structure |
|---|
| >3gt0_A Pyrroline-5-carboxylate reductase; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG; 2.00A {Bacillus cereus atcc 14579} | Back alignment and structure |
|---|
| >3tjr_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, SCD, NAD; HET: UNL; 1.60A {Mycobacterium avium subsp} | Back alignment and structure |
|---|
| >4fn4_A Short chain dehydrogenase; NADH-binding, rossmann fold, oxidoreductase; HET: NAD; 1.75A {Sulfolobus acidocaldarius} | Back alignment and structure |
|---|
| >1ks9_A KPA reductase;, 2-dehydropantoate 2-reductase; PANE, APBA, ketopantoate reductase, rossman fold, monomer, APO, oxidoreductase; 1.70A {Escherichia coli} SCOP: a.100.1.7 c.2.1.6 PDB: 1yon_A* 1yjq_A* 2ofp_A* | Back alignment and structure |
|---|
| >3h7a_A Short chain dehydrogenase; oxidoreductase, PSI-2, NYSGXRC, structural genomics, protein structure initiative; 1.87A {Rhodopseudomonas palustris} | Back alignment and structure |
|---|
| >2q1s_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NADH complex, sugar binding protein; HET: NAI; 1.50A {Bordetella bronchiseptica} PDB: 2pzj_A* 2q1t_A* 2q1u_A* | Back alignment and structure |
|---|
| >3ucx_A Short chain dehydrogenase; ssgcid, seattle structural genomics center for infectious DI dehydrogenase, oxidoreductase; HET: 1PE; 1.85A {Mycobacterium smegmatis} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >3lyl_A 3-oxoacyl-(acyl-carrier-protein) reductase; alpha and beta protein, NAD(P)-binding rossmann fold, csgid, oxidoreductase; 1.95A {Francisella tularensis subsp} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >2x4g_A Nucleoside-diphosphate-sugar epimerase; isomerase; 2.65A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >2rcy_A Pyrroline carboxylate reductase; malaria, structural genomics, pyrroline reductase, oxidoredu structural genomics consortium, SGC; HET: NAP; 2.30A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >3gaf_A 7-alpha-hydroxysteroid dehydrogenase; seattle structural genomics center for infectious disease, ssgcid, oxidoreductase, structural genomics; 2.20A {Brucella melitensis} | Back alignment and structure |
|---|
| >3r1i_A Short-chain type dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.95A {Mycobacterium marinum} | Back alignment and structure |
|---|
| >3tox_A Short chain dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; HET: NAP; 1.93A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >1vl6_A Malate oxidoreductase; TM0542, NAD-dependent malic enzyme, structural genomics, JCS protein structure initiative, PSI; 2.61A {Thermotoga maritima} SCOP: c.2.1.7 c.58.1.3 PDB: 2hae_A* | Back alignment and structure |
|---|
| >2x4g_A Nucleoside-diphosphate-sugar epimerase; isomerase; 2.65A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >3sc4_A Short chain dehydrogenase (A0QTM2 homolog); ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, structu genomics; 2.50A {Mycobacterium thermoresistibile} | Back alignment and structure |
|---|
| >4huj_A Uncharacterized protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, dinucleotide-binding; 1.77A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >3sxp_A ADP-L-glycero-D-mannoheptose-6-epimerase; rossman fold, NAD binding, isomerase; HET: NAD; 2.55A {Helicobacter pylori} | Back alignment and structure |
|---|
| >3uve_A Carveol dehydrogenase ((+)-trans-carveol dehydrog; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; HET: NAD PG4; 1.55A {Mycobacterium avium} SCOP: c.2.1.0 PDB: 3uwr_A* | Back alignment and structure |
|---|
| >4ibo_A Gluconate dehydrogenase; enzyme function initiative structural genomics, oxidoreductase; 2.10A {Agrobacterium fabrum} | Back alignment and structure |
|---|
| >2cvz_A Dehydrogenase, 3-hydroxyisobutyrate dehydrogenase; valine catabolism, NADP+, structural GEN riken structural genomics/proteomics initiative; HET: NDP; 1.80A {Thermus thermophilus} SCOP: a.100.1.1 c.2.1.6 PDB: 1wp4_A* | Back alignment and structure |
|---|
| >3rwb_A TPLDH, pyridoxal 4-dehydrogenase; short chain dehydrogenase/reductase, 4-pyridoxola NAD+, oxidoreductase; HET: NAD 4PL; 1.70A {Mesorhizobium loti} PDB: 3ndr_A* 3nug_A* | Back alignment and structure |
|---|
| >1pzg_A LDH, lactate dehydrogenase; apicomplexa, APAD, tetramer, rossmann fold, oxidoreductase; HET: CME A3D; 1.60A {Toxoplasma gondii} SCOP: c.2.1.5 d.162.1.1 PDB: 1pzf_A* 1pze_A* 1pzh_A* 3om9_A* 1sov_A 1sow_A* 3czm_A* | Back alignment and structure |
|---|
| >2pv7_A T-protein [includes: chorismate mutase (EC 5.4.99 and prephenate dehydrogenase (EC...; 1574749, chorismate mutase type II; HET: MSE TYR NAD; 2.00A {Haemophilus influenzae} SCOP: a.100.1.12 c.2.1.6 | Back alignment and structure |
|---|
| >2z1m_A GDP-D-mannose dehydratase; short-chain dehydrogenase/reductase, lyase, structural genom NPPSFA; HET: NDP GDP; 2.00A {Aquifex aeolicus} PDB: 2z95_A* | Back alignment and structure |
|---|
| >2vhw_A Alanine dehydrogenase; NAD, secreted, oxidoreductase; HET: NAI; 2.0A {Mycobacterium tuberculosis} PDB: 2vhx_A* 2vhy_A 2vhz_A* 2vhv_A* 2voe_A 2voj_A* | Back alignment and structure |
|---|
| >1x7d_A Ornithine cyclodeaminase; binds NAD+, binds L-ornithine, binds L-proline, 2 bundle, beta barrel, rossmann fold, lyase; HET: NAD ORN MES; 1.60A {Pseudomonas putida} SCOP: c.2.1.13 PDB: 1u7h_A* | Back alignment and structure |
|---|
| >1oju_A MDH, malate dehydrogenase; hyperthermophilic, oxidoreductase; HET: ENA; 2.79A {Archaeoglobus fulgidus} PDB: 1ojs_A* 2x0i_A* 2x0j_A* | Back alignment and structure |
|---|
| >1guz_A Malate dehydrogenase; oxidoreductase, tricarboxylic acid cycle, NAD; HET: NAD; 2.0A {Chlorobium vibrioforme} SCOP: c.2.1.5 d.162.1.1 PDB: 1gv1_A 1gv0_A* | Back alignment and structure |
|---|
| >3ego_A Probable 2-dehydropantoate 2-reductase; structural genomics, PANE, unknown function, cytoplasm, NADP, oxidoreductase; 1.90A {Bacillus subtilis} | Back alignment and structure |
|---|
| >4da9_A Short-chain dehydrogenase/reductase; structural genomics, protein structure initiative, PSI-biology; 2.50A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >2z1n_A Dehydrogenase; reductase, SDR, oxidoreductase; 1.80A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >4imr_A 3-oxoacyl-(acyl-carrier-protein) reductase; oxidoreductase, nicotinamide adenine dinucleotide phosphate, structural genomics; HET: NAP; 1.96A {Agrobacterium fabrum} | Back alignment and structure |
|---|
| >3pk0_A Short-chain dehydrogenase/reductase SDR; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; 1.75A {Mycobacterium smegmatis} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >2d4a_B Malate dehydrogenase; archaea, hyperthermophIle, oxidoreductase; 2.87A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >3tfo_A Putative 3-oxoacyl-(acyl-carrier-protein) reducta; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.08A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >4gx0_A TRKA domain protein; membrane protein, ION channel, ADP binding, NAD binding, MEM transport protein; HET: MAL GLC; 2.60A {Geobacter sulfurreducens} PDB: 4gx1_A* 4gx2_A* 4gx5_A 4gvl_A* | Back alignment and structure |
|---|
| >3ggo_A Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-beta, oxidoreductase; HET: NAI ENO; 2.15A {Aquifex aeolicus} PDB: 3ggg_D* 3ggp_A* | Back alignment and structure |
|---|
| >1jay_A Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossman fold, structural genomics; HET: NAP F42; 1.65A {Archaeoglobus fulgidus} SCOP: c.2.1.6 PDB: 1jax_A* | Back alignment and structure |
|---|
| >2eez_A Alanine dehydrogenase; TTHA0216, structural genomic NPPSFA, national project on protein structural and function analyses; 2.71A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3e48_A Putative nucleoside-diphosphate-sugar epimerase; alpha-beta protein., structural genomics, PSI-2, protein STR initiative; 1.60A {Staphylococcus aureus subsp} | Back alignment and structure |
|---|
| >4dqv_A Probable peptide synthetase NRP (peptide synthase; GXXGXXG motif, rossmann fold, short chain dehydrogenase/REDU family, reductase; 2.30A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >1y6j_A L-lactate dehydrogenase; southeast collaboratory for structural genomics, secsg, protein struc initiative, PSI, oxidoreductase; 3.01A {Clostridium thermocellum} SCOP: c.2.1.5 d.162.1.1 | Back alignment and structure |
|---|
| >1lnq_A MTHK channels, potassium channel related protein; rossman fold, helix bundle, membrane protein; 3.30A {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: c.2.1.9 d.286.1.1 f.14.1.1 PDB: 3rbz_A | Back alignment and structure |
|---|
| >3nyw_A Putative oxidoreductase; fatty acid synthesis,3-oxoacyl-[ACP] reductase, NADP+ bindin rossman fold, PSI-II, nysgxrc; 2.16A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >1ldn_A L-lactate dehydrogenase; oxidoreductase(CHOH(D)-NAD(A)); HET: FBP NAD; 2.50A {Geobacillus stearothermophilus} SCOP: c.2.1.5 d.162.1.1 PDB: 1ldb_A 2ldb_A* | Back alignment and structure |
|---|
| >2f1k_A Prephenate dehydrogenase; tyrosine synthesis, X-RA crystallography structure, oxidoreductase; HET: OMT NAP; 1.55A {Synechocystis SP} SCOP: a.100.1.12 c.2.1.6 | Back alignment and structure |
|---|
| >2a9f_A Putative malic enzyme ((S)-malate:NAD+ oxidoreductase (decarboxylating)); hypothetical protein, structural genomics, PSI; 2.50A {Streptococcus pyogenes} | Back alignment and structure |
|---|
| >4e6p_A Probable sorbitol dehydrogenase (L-iditol 2-dehyd; NAD(P)-binding, structural genomics, PSI-biology; HET: MSE; 2.10A {Sinorhizobium meliloti} PDB: 1k2w_A | Back alignment and structure |
|---|
| >1vkn_A N-acetyl-gamma-glutamyl-phosphate reductase; TM1782, structu genomics, JCSG, PSI, protein structure initiative, joint CE structural genomics; 1.80A {Thermotoga maritima} SCOP: c.2.1.3 d.81.1.1 | Back alignment and structure |
|---|
| >3ew7_A LMO0794 protein; Q8Y8U8_lismo, putative NAD-dependent epimerase/dehydratase, LMR162, NESG, structural genomics, PSI-2; 2.73A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >3doj_A AT3G25530, dehydrogenase-like protein; gamma-hydroxybutyrate dehydrogenase, 4-hydroxybutyrate dehydrogenase; 2.10A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2ae2_A Protein (tropinone reductase-II); oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to pseudotropine; HET: NAP PTO; 1.90A {Datura stramonium} SCOP: c.2.1.2 PDB: 2ae1_A* 1ipe_A* 1ipf_A* | Back alignment and structure |
|---|
| >1bg6_A N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L) stereospecific opine dehydrogenase, oxidoreductase; 1.80A {Arthrobacter SP} SCOP: a.100.1.5 c.2.1.6 | Back alignment and structure |
|---|
| >1np3_A Ketol-acid reductoisomerase; A DEEP figure-OF-eight knot, C-terminal alpha-helical domain oxidoreductase; 2.00A {Pseudomonas aeruginosa} SCOP: a.100.1.2 c.2.1.6 | Back alignment and structure |
|---|
| >3ksu_A 3-oxoacyl-acyl carrier protein reductase; structural genomics, PSI-2, dehydrogenase, protein structure initiative; 2.30A {Oenococcus oeni psu-1} | Back alignment and structure |
|---|
| >3qlj_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis; 1.80A {Mycobacterium avium} | Back alignment and structure |
|---|
| >2ew2_A 2-dehydropantoate 2-reductase, putative; alpha-structure, alpha-beta structure, structural genomics, protein structure initiative; HET: MSE; 2.00A {Enterococcus faecalis} | Back alignment and structure |
|---|
| >1gee_A Glucose 1-dehydrogenase; short-chain dehydrogenase/reductase, oxidoreductase; HET: NAD; 1.60A {Bacillus megaterium} SCOP: c.2.1.2 PDB: 1rwb_A* 1gco_A* 1g6k_A* 3aus_A 3aut_A* 3auu_A* | Back alignment and structure |
|---|
| >2zat_A Dehydrogenase/reductase SDR family member 4; alpha/beta, oxidoreductase; HET: NAP; 1.50A {Sus scrofa} PDB: 3o4r_A* | Back alignment and structure |
|---|
| >1t2d_A LDH-P, L-lactate dehydrogenase; ternary complex, oxidoreductase; HET: NAD; 1.10A {Plasmodium falciparum} SCOP: c.2.1.5 d.162.1.1 PDB: 1t25_A* 1t26_A* 1t2c_A* 1t24_A* 2x8l_A 2ydn_A* 2a94_A* 1u4s_A* 1u5a_A* 1u5c_A* 1u4o_A* 1t2e_A* 1xiv_A* 1ceq_A 1ldg_A* 1cet_A* 1oc4_A* 2a92_A* 2aa3_A* | Back alignment and structure |
|---|
| >4fgs_A Probable dehydrogenase protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, three layer; 1.76A {Rhizobium etli} | Back alignment and structure |
|---|
| >3o38_A Short chain dehydrogenase; tuberculosis, ortholog from A non-pathogenic dehydrogenase, structural genomics; 1.95A {Mycobacterium smegmatis} | Back alignment and structure |
|---|
| >3sx2_A Putative 3-ketoacyl-(acyl-carrier-protein) reduct; ssgcid, 3-ketoacyl-(acyl-carrier-protein) reductase, mycobac paratuberculosis; HET: NAD; 1.50A {Mycobacterium avium subsp} | Back alignment and structure |
|---|
| >3eag_A UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-ME diaminopimelate ligase; UDP-N-acetylmuramate:L-alanyl-G glutamyl-MESO-diaminopimelate ligase; 2.55A {Neisseria meningitidis MC58} | Back alignment and structure |
|---|
| >3v8b_A Putative dehydrogenase, possibly 3-oxoacyl-[acyl- protein] reductase; PSI-biology, structural genomics, protein structure initiati nysgrc; 2.70A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >3hn2_A 2-dehydropantoate 2-reductase; PSI-2, NYSGXRC, structural GE protein structure initiative; 2.50A {Geobacter metallireducens} | Back alignment and structure |
|---|
| >1fmc_A 7 alpha-hydroxysteroid dehydrogenase; short-chain dehydrogenase/reductase, bIle acid catabolism, oxidoreductase; HET: CHO NAD; 1.80A {Escherichia coli} SCOP: c.2.1.2 PDB: 1ahi_A* 1ahh_A* | Back alignment and structure |
|---|
| >1oaa_A Sepiapterin reductase; tetrahydrobiopterin, oxidoreductase; HET: NAP; 1.25A {Mus musculus} SCOP: c.2.1.2 PDB: 1nas_A* 1sep_A* 1z6z_A* | Back alignment and structure |
|---|
| >3tsc_A Putative oxidoreductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, nucleotide; HET: NAD; 2.05A {Mycobacterium avium subsp} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >1zcj_A Peroxisomal bifunctional enzyme; peroxisomal multifunctional enzyme type 1, L-bifunction enzyme, MFE-1, fatty acid beta oxidation; 1.90A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2q1s_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NADH complex, sugar binding protein; HET: NAI; 1.50A {Bordetella bronchiseptica} PDB: 2pzj_A* 2q1t_A* 2q1u_A* | Back alignment and structure |
|---|
| >3afn_B Carbonyl reductase; alpha/beta/alpha, rossmann-fold, oxidoreductase; HET: NAP; 1.63A {Sphingomonas SP} PDB: 3afm_A* | Back alignment and structure |
|---|
| >3t4x_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, center for structural genomics of infec diseases, csgid; 2.80A {Bacillus anthracis} | Back alignment and structure |
|---|
| >3fbt_A Chorismate mutase and shikimate 5-dehydrogenase fusion protein; structural genomics, oxidoreductase, amino-acid biosynthesis; 2.10A {Clostridium acetobutylicum} | Back alignment and structure |
|---|
| >3pef_A 6-phosphogluconate dehydrogenase, NAD-binding; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R geobacter metallireducens; HET: NAP; 2.07A {Geobacter metallireducens} | Back alignment and structure |
|---|
| >2c5a_A GDP-mannose-3', 5'-epimerase; short chain dehydratase/reductase, GDP-gulose, GDP-galactose, keto intermediate, vitamin C, SDR; HET: GDC NAD BTB; 1.4A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2c59_A* 2c54_A* 2c5e_A* | Back alignment and structure |
|---|
| >3h2s_A Putative NADH-flavin reductase; Q03B84, NESG, LCR19, structural genomics, PSI-2, protein structure initiative; HET: NDP; 1.78A {Lactobacillus casei atcc 334} | Back alignment and structure |
|---|
| >1ez4_A Lactate dehydrogenase; rossmann fold, oxidoreductase; HET: NAD; 2.30A {Lactobacillus pentosus} SCOP: c.2.1.5 d.162.1.1 | Back alignment and structure |
|---|
| >3gt0_A Pyrroline-5-carboxylate reductase; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG; 2.00A {Bacillus cereus atcc 14579} | Back alignment and structure |
|---|
| >3ko8_A NAD-dependent epimerase/dehydratase; isomerase, UDP-galactose 4-epimerase; HET: NAD; 1.80A {Pyrobaculum calidifontis} SCOP: c.2.1.0 PDB: 3icp_A* 3aw9_A* | Back alignment and structure |
|---|
| >4egf_A L-xylulose reductase; structural genomics, ssgcid, seattle structural genomics CEN infectious disease, oxidoreductase; 2.30A {Mycobacterium smegmatis} | Back alignment and structure |
|---|
| >4iin_A 3-ketoacyl-acyl carrier protein reductase (FABG); structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 2.40A {Helicobacter pylori} PDB: 4ijk_A | Back alignment and structure |
|---|
| >3pgx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.85A {Mycobacterium avium} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >2jah_A Clavulanic acid dehydrogenase; short-chain dehydrogenase/reductase, lactamase inhibitor, AN biosynthesis, NADPH, oxidoreductase; HET: MSE NDP; 1.80A {Streptomyces clavuligerus} PDB: 2jap_A* | Back alignment and structure |
|---|
| >3phh_A Shikimate dehydrogenase; shikimate pathway, helicobacter PYL oxidoreductase, alpha/beta domain, rossmann fold; HET: SKM; 1.42A {Helicobacter pylori} PDB: 3phg_A* 3phi_A* 3phj_A* 4foo_A 4fpx_A 4fos_A* 4fr5_A* 4fq8_A* | Back alignment and structure |
|---|
| >1rkx_A CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; 1.80A {Yersinia pseudotuberculosis} SCOP: c.2.1.2 PDB: 1wvg_A* | Back alignment and structure |
|---|
| >3v2h_A D-beta-hydroxybutyrate dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 3.00A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >2ywl_A Thioredoxin reductase related protein; uncharacterized conserved protein, rossmann fold, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2cvj_A* | Back alignment and structure |
|---|
| >3lf2_A Short chain oxidoreductase Q9HYA2; SDR, SCOR, rossmann fold; HET: NAP; 2.30A {Pseudomonas aeruginosa} PDB: 3lf1_A* | Back alignment and structure |
|---|
| >4fc7_A Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossmann fold, peroxisomal beta-oxidation, oxidoreductas; HET: NAP COA; 1.84A {Homo sapiens} PDB: 4fc6_A* | Back alignment and structure |
|---|
| >2zyd_A 6-phosphogluconate dehydrogenase, decarboxylating; NADP, pentose phosphate pathway, oxidoreductase, 6-phosphogl dehydrogenase; HET: GLO; 1.50A {Escherichia coli} PDB: 2zya_A* 3fwn_A* 2zyg_A 2w8z_A* 2w90_A* | Back alignment and structure |
|---|
| >4gwg_A 6-phosphogluconate dehydrogenase, decarboxylating; 6-phosphoglyconate dehydrogenase, NADP, oxido; HET: MES; 1.39A {Homo sapiens} PDB: 4gwk_A* 2jkv_A* 2pgd_A 1pgo_A* 1pgp_A* 1pgq_A* 1pgn_A | Back alignment and structure |
|---|
| >4gx0_A TRKA domain protein; membrane protein, ION channel, ADP binding, NAD binding, MEM transport protein; HET: MAL GLC; 2.60A {Geobacter sulfurreducens} PDB: 4gx1_A* 4gx2_A* 4gx5_A 4gvl_A* | Back alignment and structure |
|---|
| >1xg5_A ARPG836; short chain dehydrogenase, human, SGC, structural genomics, structural genomics consortium, oxidoreductase; HET: NAP; 1.53A {Homo sapiens} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3awd_A GOX2181, putative polyol dehydrogenase; oxidoreductase; 1.80A {Gluconobacter oxydans} | Back alignment and structure |
|---|
| >3enk_A UDP-glucose 4-epimerase; seattle structural genomics center for infectious disease, ssgcid, isomerase, NAD; HET: NAD GUD; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >1o6z_A MDH, malate dehydrogenase; halophilic, ION-binding, protein-solvent interaction, oxidoreductase; HET: NAD; 1.95A {Haloarcula marismortui} SCOP: c.2.1.5 d.162.1.1 PDB: 1gt2_A* 2x0r_A* 2j5k_A 2j5q_A 2j5r_A 1d3a_A 1hlp_A* 2hlp_A | Back alignment and structure |
|---|
| >1x7d_A Ornithine cyclodeaminase; binds NAD+, binds L-ornithine, binds L-proline, 2 bundle, beta barrel, rossmann fold, lyase; HET: NAD ORN MES; 1.60A {Pseudomonas putida} SCOP: c.2.1.13 PDB: 1u7h_A* | Back alignment and structure |
|---|
| >3d0o_A L-LDH 1, L-lactate dehydrogenase 1; cytoplasm, glycolysis, NAD, oxidoreductase, phosphoprotein; 1.80A {Staphylococcus aureus} PDB: 3d4p_A* 3h3j_A* | Back alignment and structure |
|---|
| >2rcy_A Pyrroline carboxylate reductase; malaria, structural genomics, pyrroline reductase, oxidoredu structural genomics consortium, SGC; HET: NAP; 2.30A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >3grp_A 3-oxoacyl-(acyl carrierprotein) reductase; structural genomics, oxidoreductase, S structural genomics center for infectious disease, ssgcid; 2.09A {Bartonella henselae} PDB: 3enn_A 3emk_A | Back alignment and structure |
|---|
| >2dc1_A L-aspartate dehydrogenase; NAD, oxidoreductase; HET: CIT NAD; 1.90A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >4iiu_A 3-oxoacyl-[acyl-carrier protein] reductase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAP; 2.10A {Escherichia coli} PDB: 4iiv_A* | Back alignment and structure |
|---|
| >2i99_A MU-crystallin homolog; thyroid hormine binding protein, oxidoreductase; HET: NDP; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >3ftp_A 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid, 3-ketoacyl-(acyl-carrier- protein) reductase, oxidoreductase, structural genomics; 2.05A {Burkholderia pseudomallei} | Back alignment and structure |
|---|
| >3c24_A Putative oxidoreductase; YP_511008.1, structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.62A {Jannaschia SP} | Back alignment and structure |
|---|
| >3l77_A Short-chain alcohol dehydrogenase; oxidoreductase; HET: NJP PG4; 1.60A {Thermococcus sibiricus} SCOP: c.2.1.0 PDB: 3tn7_A* | Back alignment and structure |
|---|
| >2zyd_A 6-phosphogluconate dehydrogenase, decarboxylating; NADP, pentose phosphate pathway, oxidoreductase, 6-phosphogl dehydrogenase; HET: GLO; 1.50A {Escherichia coli} PDB: 2zya_A* 3fwn_A* 2zyg_A 2w8z_A* 2w90_A* | Back alignment and structure |
|---|
| >1eq2_A ADP-L-glycero-D-mannoheptose 6-epimerase; N-terminal domain rossmann fold, C-terminal mixed alpha/beta domain; HET: NAP ADQ; 2.00A {Escherichia coli} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >1rkx_A CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; 1.80A {Yersinia pseudotuberculosis} SCOP: c.2.1.2 PDB: 1wvg_A* | Back alignment and structure |
|---|
| >2g5c_A Prephenate dehydrogenase; TYRA, oxidoreductase; HET: NAD; 1.90A {Aquifex aeolicus} SCOP: a.100.1.12 c.2.1.6 | Back alignment and structure |
|---|
| >3tzq_B Short-chain type dehydrogenase/reductase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; 2.50A {Mycobacterium marinum} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >3r3s_A Oxidoreductase; structural genomics, csgid, center for structural genomics O infectious diseases, 3-layer(ABA) sandwich, rossmann fold; HET: NAD; 1.25A {Salmonella enterica subsp} | Back alignment and structure |
|---|
| >3st7_A Capsular polysaccharide synthesis enzyme CAP5F; rossmann fold, cupid domain, short-chain dehydrogenase/reduc NADPH; 2.45A {Staphylococcus aureus} PDB: 2zkl_A 3vhr_A | Back alignment and structure |
|---|
| >1vl0_A DTDP-4-dehydrorhamnose reductase, RFBD ortholog; structural joint center for structural genomics, JCSG, protein structu initiative; HET: NAI UNL; 2.05A {Clostridium acetobutylicum} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3v2g_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, protein structure initiati nysgrc; 2.30A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >4hb9_A Similarities with probable monooxygenase; flavin, structural genomics, NEW YORK structural genomics RE consortium, nysgrc, PSI; HET: MSE FAD; 1.93A {Photorhabdus luminescens} | Back alignment and structure |
|---|
| >3ijr_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, infectious D center for structural genomics of infectious diseases; HET: NAD; 2.05A {Bacillus anthracis str} PDB: 3i3o_A* | Back alignment and structure |
|---|
| >3enk_A UDP-glucose 4-epimerase; seattle structural genomics center for infectious disease, ssgcid, isomerase, NAD; HET: NAD GUD; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >4f6c_A AUSA reductase domain protein; thioester reductase, oxidoreductase; 2.81A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >2hun_A 336AA long hypothetical DTDP-glucose 4,6-dehydrat; rossmann fold, structural genomics, NPPSFA; HET: NAD; 2.07A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >2c5a_A GDP-mannose-3', 5'-epimerase; short chain dehydratase/reductase, GDP-gulose, GDP-galactose, keto intermediate, vitamin C, SDR; HET: GDC NAD BTB; 1.4A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2c59_A* 2c54_A* 2c5e_A* | Back alignment and structure |
|---|
| >3hhp_A Malate dehydrogenase; MDH, citric acid cycle, TCA cycle, NAD, oxidoreductase, tricarboxylic acid cycle; 1.45A {Escherichia coli k-12} PDB: 2pwz_A 2cmd_A* 1emd_A* 1ib6_A* 1ie3_A* 4e0b_A* | Back alignment and structure |
|---|
| >3l6d_A Putative oxidoreductase; structural genomics, protein structure initiative, oxidoredu PSI-2; HET: MSE; 1.90A {Pseudomonas putida} | Back alignment and structure |
|---|
| >1yb1_A 17-beta-hydroxysteroid dehydrogenase type XI; short chain dehydrogenase, HUM structural genomics, structural genomics consortium, SGC; HET: AE2; 1.95A {Homo sapiens} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3ehe_A UDP-glucose 4-epimerase (GALE-1); PSI-II, NYSGXRC, ST genomics, protein structure initiative, NEW YORK SGX resear for structural genomics; HET: NAD; 1.87A {Archaeoglobus fulgidus} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >2ydy_A Methionine adenosyltransferase 2 subunit beta; oxidoreductase; 2.25A {Homo sapiens} PDB: 2ydx_A | Back alignment and structure |
|---|
| >3i83_A 2-dehydropantoate 2-reductase; structural genomics, oxidoreductase, NADP, pantothenate BIOS PSI-2, protein structure initiative; 1.90A {Methylococcus capsulatus} | Back alignment and structure |
|---|
| >3dtt_A NADP oxidoreductase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: NAP; 1.70A {Arthrobacter SP} | Back alignment and structure |
|---|
| >1yxm_A Pecra, peroxisomal trans 2-enoyl COA reductase; perioxisomes, fatty acid synthesis, short-chain dehydrogenases/reductases, structural genomics; HET: ADE; 1.90A {Homo sapiens} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >2hun_A 336AA long hypothetical DTDP-glucose 4,6-dehydrat; rossmann fold, structural genomics, NPPSFA; HET: NAD; 2.07A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >3sc6_A DTDP-4-dehydrorhamnose reductase; RFBD, structural genomics, infectious diseases, bacillus anthracis STR. AMES, rhamnose biosynthetic pathway; HET: NAP; 2.65A {Bacillus anthracis} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >3pdu_A 3-hydroxyisobutyrate dehydrogenase family protein; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R glyoxylate metabolism; HET: NAP; 1.89A {Geobacter sulfurreducens} | Back alignment and structure |
|---|
| >2rhc_B Actinorhodin polyketide ketoreductase; oxidoreductase, combinatorial biosynthesis, short chain dehydrogenase/reductase; HET: NAP EMO; 2.10A {Streptomyces coelicolor} SCOP: c.2.1.2 PDB: 2rh4_A* 1w4z_A* 3csd_B* 3qrw_A* 3ri3_B* 2rhr_B* 1x7g_A* 1x7h_A* 1xr3_A* | Back alignment and structure |
|---|
| >2q1w_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, sugar binding protein; HET: NAD; 2.19A {Bordetella bronchiseptica} | Back alignment and structure |
|---|
| >2hq1_A Glucose/ribitol dehydrogenase; CTH-1438, structural genomics, southeast collaboratory for structural genomics, secsg, PSI; 1.90A {Clostridium thermocellum} | Back alignment and structure |
|---|
| >2qq5_A DHRS1, dehydrogenase/reductase SDR family member 1; short-chain, structura genomics consortium, SGC, oxidoreductase; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3ngx_A Bifunctional protein fold; methylenetetrahydrofolate dehydrogenase/cyclohydrolase; 2.30A {Thermoplasma acidophilum} PDB: 3ngl_A | Back alignment and structure |
|---|
| >2dc1_A L-aspartate dehydrogenase; NAD, oxidoreductase; HET: CIT NAD; 1.90A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >1omo_A Alanine dehydrogenase; two-domain, beta-sandwich-dimer, rossmann-fold NAD domain, human MU crystallin homolog; HET: NAD; 2.32A {Archaeoglobus fulgidus} SCOP: c.2.1.13 PDB: 1vll_A | Back alignment and structure |
|---|
| >1a4i_A Methylenetetrahydrofolate dehydrogenase / methenyltetrahydrofolate cyclohydrolase...; THF, bifunctional, oxidoreductase; HET: NDP; 1.50A {Homo sapiens} SCOP: c.2.1.7 c.58.1.2 PDB: 1dia_A* 1dib_A* 1dig_A* | Back alignment and structure |
|---|
| >3rih_A Short chain dehydrogenase or reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: PG5; 2.15A {Mycobacterium abscessus} | Back alignment and structure |
|---|
| >3ehe_A UDP-glucose 4-epimerase (GALE-1); PSI-II, NYSGXRC, ST genomics, protein structure initiative, NEW YORK SGX resear for structural genomics; HET: NAD; 1.87A {Archaeoglobus fulgidus} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >2gn4_A FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann fold, TYK triad, SDR, enzyme, NADP, NADPH, lyase; HET: NDP UD1 MES; 1.90A {Helicobacter pylori} PDB: 2gn6_A* 2gn8_A* 2gn9_A* 2gna_A* | Back alignment and structure |
|---|
| >1i36_A Conserved hypothetical protein MTH1747; NADP binding domain, protein NADP complex, structural genomics, PSI; HET: NAP; 2.00A {Methanothermobacterthermautotrophicus} SCOP: a.100.1.8 c.2.1.6 | Back alignment and structure |
|---|
| >2zqz_A L-LDH, L-lactate dehydrogenase; oxidoreductase, rossmann fold, cytoplasm, glycolysis, NAD, phosphoprotein; 2.50A {Lactobacillus casei} PDB: 2zqy_A 3vkv_A* 1llc_A* | Back alignment and structure |
|---|
| >2bgk_A Rhizome secoisolariciresinol dehydrogenase; oxidoreductase; 1.6A {Podophyllum peltatum} SCOP: c.2.1.2 PDB: 2bgl_A* 2bgm_A* | Back alignment and structure |
|---|
| >2q1w_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, sugar binding protein; HET: NAD; 2.19A {Bordetella bronchiseptica} | Back alignment and structure |
|---|
| >1iy8_A Levodione reductase; oxidoreductase; HET: NAD; 1.60A {Leifsonia aquatica} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3rft_A Uronate dehydrogenase; apoenzyme, rossmann fold, NAD binding, oxidoreductase; 1.90A {Agrobacterium tumefaciens} PDB: 3rfv_A* 3rfx_A* | Back alignment and structure |
|---|
| >1ur5_A Malate dehydrogenase; oxidoreductase, tricarboxylic acid cycle; HET: NAD; 1.75A {Chloroflexus aurantiacus} SCOP: c.2.1.5 d.162.1.1 PDB: 1uxg_A* 1guy_A* 1uxk_A* 1uxh_A* 1uxj_A* 1uxi_A* | Back alignment and structure |
|---|
| >3rkr_A Short chain oxidoreductase; rossmann fold; HET: NAP; 2.42A {Uncultured bacterium BIO5} | Back alignment and structure |
|---|
| >3hn2_A 2-dehydropantoate 2-reductase; PSI-2, NYSGXRC, structural GE protein structure initiative; 2.50A {Geobacter metallireducens} | Back alignment and structure |
|---|
| >3nep_X Malate dehydrogenase; halophIle, molecular adpatation, NAD, oxidoreductase, tricarboxylic acid cycle; 1.55A {Salinibacter ruber} | Back alignment and structure |
|---|
| >3tl2_A Malate dehydrogenase; center for structural genomics of infectious diseases, csgid dehydrogenase, oxidoreductase, citric acid cycle; 1.70A {Bacillus anthracis} | Back alignment and structure |
|---|
| >1vl6_A Malate oxidoreductase; TM0542, NAD-dependent malic enzyme, structural genomics, JCS protein structure initiative, PSI; 2.61A {Thermotoga maritima} SCOP: c.2.1.7 c.58.1.3 PDB: 2hae_A* | Back alignment and structure |
|---|
| >3qha_A Putative oxidoreductase; seattle structural genomics center for infectious disease, S mycobacterium avium 104, rossmann fold; 2.25A {Mycobacterium avium} | Back alignment and structure |
|---|
| >3gvc_A Oxidoreductase, probable short-chain type dehydrogenase/reductase; ssgcid, decode, niaid, UWPPG, SBRI, structural genomics; 2.45A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >2xxj_A L-LDH, L-lactate dehydrogenase; oxidoreductase, hyperthermophIle; HET: NAD; 1.964A {Thermus thermophilus} PDB: 2xxb_A* 3zzn_A* 2v7p_A* 2e37_A* 2v6m_A* 2xxe_A 4a73_A | Back alignment and structure |
|---|
| >1wma_A Carbonyl reductase [NADPH] 1; oxidoreductase; HET: AB3 NDP PE5 P33; 1.24A {Homo sapiens} SCOP: c.2.1.2 PDB: 3bhi_A* 3bhj_A* 3bhm_A* 2pfg_A* 1n5d_A* 2hrb_A* | Back alignment and structure |
|---|
| >4fs3_A Enoyl-[acyl-carrier-protein] reductase [NADPH] FA; rossmann fold, short chain dehydrogenase, NADPH binding, oxidoreductase; HET: 0WD 0WE; 1.80A {Staphylococcus aureus subsp} PDB: 3gr6_A* 3gns_A* 4all_A* 3gnt_A 4alk_A* 4alj_A* 4ali_A* 4alm_A 4aln_A | Back alignment and structure |
|---|
| >3qiv_A Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR protein] reductase; structural genomics; 2.25A {Mycobacterium avium subsp} | Back alignment and structure |
|---|
| >3edm_A Short chain dehydrogenase; structural genomics, oxidoreductase, PSI-2, P structure initiative; 2.30A {Agrobacterium tumefaciens str} | Back alignment and structure |
|---|
| >4a26_A Putative C-1-tetrahydrofolate synthase, cytoplasm; oxidoreductase, hydrolase, leishmaniasis; 2.70A {Leishmania major} | Back alignment and structure |
|---|
| >3imf_A Short chain dehydrogenase; structural genomics, infectious D center for structural genomics of infectious diseases, oxidoreductase, csgid; HET: MSE; 1.99A {Bacillus anthracis str} | Back alignment and structure |
|---|
| >4dry_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.50A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >3n74_A 3-ketoacyl-(acyl-carrier-protein) reductase; seattle structural genomics center for infectious disease, S brucellosis; 2.20A {Brucella melitensis biovar abortus} | Back alignment and structure |
|---|
| >4dyv_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.80A {Xanthobacter autotrophicus} | Back alignment and structure |
|---|
| >3osu_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, csgid, center for structural genomics O infectious diseases; 1.90A {Staphylococcus aureus subsp} SCOP: c.2.1.0 PDB: 3sj7_A* | Back alignment and structure |
|---|
| >4dll_A 2-hydroxy-3-oxopropionate reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.11A {Polaromonas SP} | Back alignment and structure |
|---|
| >1orr_A CDP-tyvelose-2-epimerase; rossmann fold, short-chain dehydrogenase/reductase, isomeras; HET: NAD CDP; 1.50A {Salmonella typhi} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >1hye_A L-lactate/malate dehydrogenase; nucleotide binding domain, oxidoreductase; HET: NAP; 1.90A {Methanocaldococcus jannaschii} SCOP: c.2.1.5 d.162.1.1 PDB: 1hyg_A* | Back alignment and structure |
|---|
| >1orr_A CDP-tyvelose-2-epimerase; rossmann fold, short-chain dehydrogenase/reductase, isomeras; HET: NAD CDP; 1.50A {Salmonella typhi} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3u9l_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.10A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >1b0a_A Protein (fold bifunctional protein); folate, dehydrogenase, cyclcohydrolase, channeling, oxidoreductase,hydrolase; 2.56A {Escherichia coli K12} SCOP: c.2.1.7 c.58.1.2 | Back alignment and structure |
|---|
| >2dvm_A Malic enzyme, 439AA long hypothetical malate oxidoreductase; NAD, structural genomics, NPPSFA; HET: NAD MES; 1.60A {Pyrococcus horikoshii} PDB: 1ww8_A* | Back alignment and structure |
|---|
| >3kkj_A Amine oxidase, flavin-containing; oxidoreductase, PSR10, Q888A4, X-RAY, structure, PSI, protein structure initiative; HET: FAD; 2.50A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >3hg7_A D-isomer specific 2-hydroxyacid dehydrogenase FAM protein; structural genomics; 1.80A {Aeromonas salmonicida subsp} | Back alignment and structure |
|---|
| >3i83_A 2-dehydropantoate 2-reductase; structural genomics, oxidoreductase, NADP, pantothenate BIOS PSI-2, protein structure initiative; 1.90A {Methylococcus capsulatus} | Back alignment and structure |
|---|
| >4g81_D Putative hexonate dehydrogenase; enzyme function initiative, EFI, structural genomics, dehydr oxidoreductase; 1.90A {Salmonella enterica subsp} | Back alignment and structure |
|---|
| >4dqv_A Probable peptide synthetase NRP (peptide synthase; GXXGXXG motif, rossmann fold, short chain dehydrogenase/REDU family, reductase; 2.30A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >2gdz_A NAD+-dependent 15-hydroxyprostaglandin dehydrogen; dehydrogenase, structural genomics, SH dehydrogenase/reductase, inflammation; HET: NAD; 1.65A {Homo sapiens} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3e48_A Putative nucleoside-diphosphate-sugar epimerase; alpha-beta protein., structural genomics, PSI-2, protein STR initiative; 1.60A {Staphylococcus aureus subsp} | Back alignment and structure |
|---|
| >2aef_A Calcium-gated potassium channel MTHK; rossmann fold, helix-turn-helix, Ca2+ binding, flexible interface; 1.70A {Methanothermobacterthermautotrophicus} PDB: 2aej_A 2aem_A 3rbx_A 2ogu_A 2fy8_A 3kxd_A | Back alignment and structure |
|---|
| >2i6t_A Ubiquitin-conjugating enzyme E2-like isoform A; L-lactate dehydrogenase, oxidoreductase, ubiquitin-protein L unknown function; 2.10A {Homo sapiens} PDB: 3dl2_A | Back alignment and structure |
|---|
| >4dmm_A 3-oxoacyl-[acyl-carrier-protein] reductase; rossmann fold, oxoacyl-ACP reductase, NADP binding, fatty AC biosynthsis, oxidoreductase; HET: NAP; 2.38A {Synechococcus elongatus} PDB: 4dml_A* | Back alignment and structure |
|---|
| >1r6d_A TDP-glucose-4,6-dehydratase; rossmann fold, short-chain dehydrogenase/reductase, lyase; HET: NAD DAU; 1.35A {Streptomyces venezuelae} SCOP: c.2.1.2 PDB: 1r66_A* | Back alignment and structure |
|---|
| >2jl1_A Triphenylmethane reductase; oxidoreductase, bioremediation; HET: NAP GOL; 1.96A {Citrobacter SP} PDB: 2vrb_A* 2vrc_A 2vrc_D | Back alignment and structure |
|---|
| >1s6y_A 6-phospho-beta-glucosidase; hydrolase, structural genomics, PSI, protein structure initi midwest center for structural genomics; 2.31A {Geobacillus stearothermophilus} SCOP: c.2.1.5 d.162.1.2 | Back alignment and structure |
|---|
| >1sby_A Alcohol dehydrogenase; ternary complex, NAD, trifluoroethanol, oxidoreductase; HET: NAD; 1.10A {Scaptodrosophila lebanonensis} SCOP: c.2.1.2 PDB: 1b14_A* 1b15_A* 1a4u_A* 1b2l_A* 1b16_A* 3rj5_A* 3rj9_A* 1mg5_A* | Back alignment and structure |
|---|
| >2hk9_A Shikimate dehydrogenase; shikimate pathway, drug design, oxidoreductase; HET: ATR SKM NAP; 2.20A {Aquifex aeolicus} PDB: 2hk8_A 2hk7_A | Back alignment and structure |
|---|
| >3ai3_A NADPH-sorbose reductase; rossmann-fold, NADPH-dependent reductase, short chain dehydrogenase/reductase, oxidoreductase; HET: NAP SOL SOE; 1.80A {Gluconobacter frateurii} PDB: 3ai2_A* 3ai1_A* | Back alignment and structure |
|---|
| >3gvx_A Glycerate dehydrogenase related protein; NYSGXRC, PSI-II, 11143J, structural genomics, protein structure initiative; 2.20A {Thermoplasma acidophilum} | Back alignment and structure |
|---|
| >1zem_A Xylitol dehydrogenase; rossmann fold, dinucleotide-binding domain, oxidoreductase; HET: NAD; 1.90A {Gluconobacter oxydans} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >1gpj_A Glutamyl-tRNA reductase; tRNA-dependent tetrapyrrole biosynthesis; HET: GMC CIT; 1.95A {Methanopyrus kandleri} SCOP: a.151.1.1 c.2.1.7 d.58.39.1 | Back alignment and structure |
|---|
| >1o0s_A NAD-ME, NAD-dependent malic enzyme; oxidoreductase, oxidative decarboxylase, rossmann fold, MAla dehydrogenase; HET: NAI; 2.00A {Ascaris suum} SCOP: c.2.1.7 c.58.1.3 PDB: 1llq_A* | Back alignment and structure |
|---|
| >1spx_A Short-chain reductase family member (5L265); parallel beta-sheet of seven strands in the order 3214567; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3p2o_A Bifunctional protein fold; structural genomics, center for structural genomics of infec diseases, csgid, alpha-beta-alpha sandwich; HET: NAD; 2.23A {Campylobacter jejuni subsp} | Back alignment and structure |
|---|
| >2hrz_A AGR_C_4963P, nucleoside-diphosphate-sugar epimerase; agrobacterium tumefa structural genomics, PSI-2, protein structure initiative; 1.85A {Agrobacterium tumefaciens} | Back alignment and structure |
|---|
| >2o23_A HADH2 protein; HSD17B10, schad, ERAB, type II HADH, 2-methyl-3-hydroxybuTyr dehydrogenase, MHBD, structural genomics, structural genomi consortium; HET: NAD GOL; 1.20A {Homo sapiens} SCOP: c.2.1.2 PDB: 1so8_A 1u7t_A* 1e3s_A* 1e3w_B* 1e3w_A* 1e6w_A* | Back alignment and structure |
|---|
| >2nwq_A Probable short-chain dehydrogenase; oxidoreductase; 2.30A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >2iz1_A 6-phosphogluconate dehydrogenase, decarboxylating; pentose shunt, oxidoreductase, gluconate utilization; HET: ATR RES P33; 2.30A {Lactococcus lactis} PDB: 2iz0_A* 2iyp_A* 2iyo_A* | Back alignment and structure |
|---|
| >1dih_A Dihydrodipicolinate reductase; oxidoreductase; HET: NDP; 2.20A {Escherichia coli} SCOP: c.2.1.3 d.81.1.3 PDB: 1arz_A* 1dru_A* 1drv_A* 1drw_A* | Back alignment and structure |
|---|
| >2pnf_A 3-oxoacyl-[acyl-carrier-protein] reductase; short chain oxidoreductase, rossmann fold, oxidoreductase; HET: 1PE MES; 1.80A {Aquifex aeolicus} PDB: 2p68_A* | Back alignment and structure |
|---|
| >1npy_A Hypothetical shikimate 5-dehydrogenase-like protein HI0607; structural genomics, PSI, protein structure initiative; 1.75A {Haemophilus influenzae} SCOP: c.2.1.7 c.58.1.5 | Back alignment and structure |
|---|
| >1ja9_A 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, oxidoreductase, chain dehydrogenase; HET: NDP PYQ; 1.50A {Magnaporthe grisea} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3i1j_A Oxidoreductase, short chain dehydrogenase/reducta; dimer, MIXE beta, structural genomics, PSI-2; 1.90A {Pseudomonas syringae PV} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >3ldh_A Lactate dehydrogenase; oxidoreductase, CHOH donor, NAD acceptor; HET: NAD; 3.00A {Squalus acanthias} SCOP: i.12.1.1 | Back alignment and structure |
|---|
| >3obb_A Probable 3-hydroxyisobutyrate dehydrogenase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics; HET: EPE; 2.20A {Pseudomonas aeruginosa} PDB: 3q3c_A* | Back alignment and structure |
|---|
| >3jtm_A Formate dehydrogenase, mitochondrial; mitochondrion, NAD, oxidoreductase, T peptide; 1.30A {Arabidopsis thaliana} PDB: 3n7u_A* 3naq_A | Back alignment and structure |
|---|
| >1xq1_A Putative tropinone reducatse; structural genomics, protein structure initiative, CESG, AT1 reductively methylated protein; 2.10A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2q45_A | Back alignment and structure |
|---|
| >1n2s_A DTDP-4-, DTDP-glucose oxidoreductase; rossman-fold, sugar-nucleotide-binding domain; HET: NAD; 2.00A {Salmonella enterica subsp} SCOP: c.2.1.2 PDB: 1kc1_A* 1kc3_A* 1kbz_A* | Back alignment and structure |
|---|
| >2iz1_A 6-phosphogluconate dehydrogenase, decarboxylating; pentose shunt, oxidoreductase, gluconate utilization; HET: ATR RES P33; 2.30A {Lactococcus lactis} PDB: 2iz0_A* 2iyp_A* 2iyo_A* | Back alignment and structure |
|---|
| >1txg_A Glycerol-3-phosphate dehydrogenase [NAD(P)+]; oxidoreductase; 1.70A {Archaeoglobus fulgidus} SCOP: a.100.1.6 c.2.1.6 | Back alignment and structure |
|---|
| >3qy9_A DHPR, dihydrodipicolinate reductase; rossmann fold, NADH, NADPH, oxidoreductase; 1.80A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >3svt_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 2.00A {Mycobacterium ulcerans} | Back alignment and structure |
|---|
| >2a9f_A Putative malic enzyme ((S)-malate:NAD+ oxidoreductase (decarboxylating)); hypothetical protein, structural genomics, PSI; 2.50A {Streptococcus pyogenes} | Back alignment and structure |
|---|
| >3g17_A Similar to 2-dehydropantoate 2-reductase; structural genomics, putative 2-dehydropantoate 2-reductase, protein structure initiative; 2.30A {Staphylococcus aureus subsp} | Back alignment and structure |
|---|
| >1ek6_A UDP-galactose 4-epimerase; short-chain dehydrogenase, galactosemia, isomerase; HET: NAI UPG; 1.50A {Homo sapiens} SCOP: c.2.1.2 PDB: 1ek5_A* 1hzj_A* 1i3k_A* 1i3l_A* 1i3m_A* 1i3n_A* | Back alignment and structure |
|---|
| >4e12_A Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1.93A {Acinetobacter baylyi} PDB: 4dyd_A* 4e13_A* | Back alignment and structure |
|---|
| >3mog_A Probable 3-hydroxybutyryl-COA dehydrogenase; structural genomics, PSI, protein structure initiative, NYSG oxidoreductase; 2.20A {Escherichia coli} | Back alignment and structure |
|---|
| >3hdj_A Probable ornithine cyclodeaminase; APC62486, bordetella pertussis TOH structural genomics, PSI-2, protein structure initiative; 1.70A {Bordetella pertussis} | Back alignment and structure |
|---|
| >3k6j_A Protein F01G10.3, confirmed by transcript evidenc; rossmann fold, oxidoreductase; 2.20A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >1nyt_A Shikimate 5-dehydrogenase; alpha/beta domains, WIDE cleft separation, oxidoreductase; HET: NAP; 1.50A {Escherichia coli} SCOP: c.2.1.7 c.58.1.5 | Back alignment and structure |
|---|
| >3ioy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structure initiative; 1.90A {Novosphingobium aromaticivorans DSM12444} | Back alignment and structure |
|---|
| >2x9g_A PTR1, pteridine reductase; short chain dehydrogenase, oxidoreductase; HET: NAP LYA; 1.10A {Trypanosoma brucei brucei} PDB: 2x9n_A* 2x9v_A* 3bmc_A* 3bmd_A* 3bme_A* 3bmf_A* 3bmg_A* 3bmh_A* 3bmi_A* 3bmj_A* 3bmk_A* 3bml_A* 3bmm_A* 3bmn_A* 3bmo_A* 3bmq_A* 3bmr_A* 3gn1_A* 3gn2_A* 3jq6_A* ... | Back alignment and structure |
|---|
| >1guz_A Malate dehydrogenase; oxidoreductase, tricarboxylic acid cycle, NAD; HET: NAD; 2.0A {Chlorobium vibrioforme} SCOP: c.2.1.5 d.162.1.1 PDB: 1gv1_A 1gv0_A* | Back alignment and structure |
|---|
| >3ghy_A Ketopantoate reductase protein; oxidoreductase, NAD-binding domain, PSI-2, NYSGXRC, structur genomics, protein structure initiative; 2.00A {Ralstonia solanacearum} | Back alignment and structure |
|---|
| >3kb6_A D-lactate dehydrogenase; oxidoreductase, D-LDH, NAD, structural genomics, NPPSFA, NAT project on protein structural and functional analyses; HET: MSE NAD 1PE; 2.12A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >1u8x_X Maltose-6'-phosphate glucosidase; structural genomics, PSI, protein structure initiative, MCSG glucosidase, NAD-dependent; HET: G6P NAD; 2.05A {Bacillus subtilis} SCOP: c.2.1.5 d.162.1.2 | Back alignment and structure |
|---|
| >1z82_A Glycerol-3-phosphate dehydrogenase; TM0378, structural genom joint center for structural genomics, JCSG, protein structu initiative, PSI; HET: MSE NDP G3H G3P; 2.00A {Thermotoga maritima} | Back alignment and structure |
|---|
| >4ej6_A Putative zinc-binding dehydrogenase; structural genomics, nysgrc, PSI-biology, NEW YORK structura genomics research consortium; 1.89A {Sinorhizobium meliloti} PDB: 4ejm_A* | Back alignment and structure |
|---|
| >2gas_A Isoflavone reductase; NADPH-dependent reductase, oxidoreductase; 1.60A {Medicago sativa} | Back alignment and structure |
|---|
| >1zk4_A R-specific alcohol dehydrogenase; short chain reductases/dehydrogenases, magnesium dependence, oxidoreductase; HET: NAP; 1.00A {Lactobacillus brevis} SCOP: c.2.1.2 PDB: 1nxq_A* 1zjy_A* 1zjz_A* 1zk0_A* 1zk1_A* 1zk2_A 1zk3_A | Back alignment and structure |
|---|
| >1ek6_A UDP-galactose 4-epimerase; short-chain dehydrogenase, galactosemia, isomerase; HET: NAI UPG; 1.50A {Homo sapiens} SCOP: c.2.1.2 PDB: 1ek5_A* 1hzj_A* 1i3k_A* 1i3l_A* 1i3m_A* 1i3n_A* | Back alignment and structure |
|---|
| >1qyc_A Phenylcoumaran benzylic ether reductase PT1; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.20A {Pinus taeda} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >1lld_A L-lactate dehydrogenase; oxidoreductase(CHOH (D)-NAD (A)); HET: NAD; 2.00A {Bifidobacterium longum subsp} SCOP: c.2.1.5 d.162.1.1 PDB: 1lth_T* | Back alignment and structure |
|---|
| >1sny_A Sniffer CG10964-PA; alpha and beta protein, rossmann fold, dinucleotide binding oxidoreductase; HET: NAP; 1.75A {Drosophila melanogaster} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >2b4q_A Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier-protein] reductase; RHLG-NADP complex, oxidoreductase; HET: NAP; 2.30A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >1vl8_A Gluconate 5-dehydrogenase; TM0441, structural genomics, JCSG structure initiative, PSI, joint center for structural GENO oxidoreductase; HET: NAP; 2.07A {Thermotoga maritima} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >4aj2_A L-lactate dehydrogenase A chain; oxidoreductase-inhibitor complex, fragment-based LEAD genera inhibitors; HET: 52C; 1.75A {Rattus norvegicus} PDB: 4aj1_A* 4aje_A* 4ajh_A* 4aji_A* 4ajj_A* 4ajk_A* 4ajl_A* 4ajn_A* 4ajo_A* 4al4_A* 4aj4_A* 4ajp_A* 1i10_A* 3h3f_A* 9ldt_A* 9ldb_A* 1t2f_A* 1i0z_A* 5ldh_A* 1ldm_A* ... | Back alignment and structure |
|---|
| >3oid_A Enoyl-[acyl-carrier-protein] reductase [NADPH]; fatty acid synthesis, enoyl-ACP reductases, FABL, rossmann-L NADPH binding, oxidoreductase; HET: TCL NDP; 1.80A {Bacillus subtilis} PDB: 3oic_A* | Back alignment and structure |
|---|
| >1qyd_A Pinoresinol-lariciresinol reductase; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.50A {Thuja plicata} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3is3_A 17BETA-hydroxysteroid dehydrogenase; short chain dehydrogenase/REDU SDR, fungi, oxidoreductase; HET: GOL; 1.48A {Cochliobolus lunatus} PDB: 3qwf_A* 3qwh_A* 3qwi_A* 3itd_A | Back alignment and structure |
|---|
| >1g0o_A Trihydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, dinucleotide binding fold, oxidoreductase; HET: NDP PYQ; 1.70A {Magnaporthe grisea} SCOP: c.2.1.2 PDB: 1doh_A* 1g0n_A* 1ybv_A* | Back alignment and structure |
|---|
| >1np3_A Ketol-acid reductoisomerase; A DEEP figure-OF-eight knot, C-terminal alpha-helical domain oxidoreductase; 2.00A {Pseudomonas aeruginosa} SCOP: a.100.1.2 c.2.1.6 | Back alignment and structure |
|---|
| >3d4o_A Dipicolinate synthase subunit A; NP_243269.1, structural GEN joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: MSE TAR; 2.10A {Bacillus halodurans} | Back alignment and structure |
|---|
| >2jl1_A Triphenylmethane reductase; oxidoreductase, bioremediation; HET: NAP GOL; 1.96A {Citrobacter SP} PDB: 2vrb_A* 2vrc_A 2vrc_D | Back alignment and structure |
|---|
| >1n2s_A DTDP-4-, DTDP-glucose oxidoreductase; rossman-fold, sugar-nucleotide-binding domain; HET: NAD; 2.00A {Salmonella enterica subsp} SCOP: c.2.1.2 PDB: 1kc1_A* 1kc3_A* 1kbz_A* | Back alignment and structure |
|---|
| >1f0y_A HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive ternary complex, oxidoreductase; HET: CAA NAD; 1.80A {Homo sapiens} SCOP: a.100.1.3 c.2.1.6 PDB: 3rqs_A 1lsj_A* 1il0_A* 1lso_A* 1m76_A* 1m75_A* 1f14_A 1f12_A 1f17_A* 3had_A* 2hdh_A* 3hdh_A* | Back alignment and structure |
|---|
| >1xkq_A Short-chain reductase family member (5D234); parrallel beta-sheet of seven strands in the order 3214567; HET: NDP; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >4b1b_A TRXR, thioredoxin reductase; oxidoreductase, FAD, NADPH, thiol-mediated redox metabolism, pyridine nucleotide-disulfide oxidoreductase; HET: FAD; 2.90A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >3k96_A Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA, IDP01976, oxidoreductase, phospholipid biosynthesis; HET: EPE; 2.10A {Coxiella burnetii} | Back alignment and structure |
|---|
| >3u5t_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.40A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >3hwr_A 2-dehydropantoate 2-reductase; YP_299159.1, PANE/APBA family ketopantoate reductase, struct genomics, joint center for structural genomics; HET: NDP BCN; 2.15A {Ralstonia eutropha} | Back alignment and structure |
|---|
| >1ae1_A Tropinone reductase-I; oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to tropine, short-chain dehydrogenase; HET: NAP; 2.40A {Datura stramonium} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3rc1_A Sugar 3-ketoreductase; sugar biosynthesis, TDP binding, NADP binding binding protein; HET: TLO NAP; 1.71A {Actinomadura kijaniata} PDB: 3rbv_A* 3rc2_A* 3rcb_A* 3rc7_A* 3rc9_A* | Back alignment and structure |
|---|
| >1omo_A Alanine dehydrogenase; two-domain, beta-sandwich-dimer, rossmann-fold NAD domain, human MU crystallin homolog; HET: NAD; 2.32A {Archaeoglobus fulgidus} SCOP: c.2.1.13 PDB: 1vll_A | Back alignment and structure |
|---|
| >3gg2_A Sugar dehydrogenase, UDP-glucose/GDP-mannose dehydrogenase family; structural genomics, oxidoreductase, PSI-2; HET: UGA; 1.70A {Porphyromonas gingivalis} | Back alignment and structure |
|---|
| >3f9i_A 3-oxoacyl-[acyl-carrier-protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase, FAT biosynthesis, lipid synthesis, NADP; 2.25A {Rickettsia prowazekii} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >2rir_A Dipicolinate synthase, A chain; structural genomics, APC1343, PSI-2, structure initiative; HET: MSE NAP; 2.79A {Bacillus subtilis} | Back alignment and structure |
|---|
| >1ks9_A KPA reductase;, 2-dehydropantoate 2-reductase; PANE, APBA, ketopantoate reductase, rossman fold, monomer, APO, oxidoreductase; 1.70A {Escherichia coli} SCOP: a.100.1.7 c.2.1.6 PDB: 1yon_A* 1yjq_A* 2ofp_A* | Back alignment and structure |
|---|
| >3ctm_A Carbonyl reductase; alcohol dehydrogenase, short-chain dehydrogenases/reductases (SDR), X-RAY crystallography, oxidoreductase; 2.69A {Candida parapsilosis} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST
Original result of RPS-BLAST against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
E-value |
| 1104 | ||||
| d1yova1 | 529 | c.111.1.2 (A:6-534) Amyloid beta precursor protein | 8e-59 | |
| d1yova1 | 529 | c.111.1.2 (A:6-534) Amyloid beta precursor protein | 4e-45 | |
| d1yova1 | 529 | c.111.1.2 (A:6-534) Amyloid beta precursor protein | 5e-32 | |
| d1yovb1 | 426 | c.111.1.2 (B:12-437) UBA3 {Human (Homo sapiens) [T | 1e-44 | |
| d1yovb1 | 426 | c.111.1.2 (B:12-437) UBA3 {Human (Homo sapiens) [T | 2e-19 | |
| d1yovb1 | 426 | c.111.1.2 (B:12-437) UBA3 {Human (Homo sapiens) [T | 3e-16 | |
| d1jw9b_ | 247 | c.111.1.1 (B:) Molybdenum cofactor biosynthesis pr | 2e-20 | |
| d1jw9b_ | 247 | c.111.1.1 (B:) Molybdenum cofactor biosynthesis pr | 1e-13 |
| >d1yova1 c.111.1.2 (A:6-534) Amyloid beta precursor protein-binding protein 1, APPBP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 529 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Activating enzymes of the ubiquitin-like proteins superfamily: Activating enzymes of the ubiquitin-like proteins family: Ubiquitin activating enzymes (UBA) domain: Amyloid beta precursor protein-binding protein 1, APPBP1 species: Human (Homo sapiens) [TaxId: 9606]
Score = 209 bits (534), Expect = 8e-59
Identities = 80/519 (15%), Positives = 167/519 (32%), Gaps = 65/519 (12%)
Query: 496 NSRYDAQISVFGSKLQKKLEEAKVFVVGSGALGCEFLKNLALMGVSCGNQGKLTITDDDV 555
+YD Q+ ++G Q+ LE A V ++ + A G E LKNL L G+ G TI D +
Sbjct: 5 EQKYDRQLRLWGDHGQEALESAHVCLINATATGTEILKNLVLPGI-----GSFTIIDGNQ 59
Query: 556 IEKSNLSRQFLFRDWNIGQAKSTVAASAAALINPHLNTEALQIRANPETENVFNDTFWEN 615
+ + F + +IG+ ++ A +N ++ ++ +N + +F+
Sbjct: 60 VSGEDAGNNFFLQRSSIGKNRAEAAMEFLQELNSDVSGSFVEESPENLLDN--DPSFFCR 117
Query: 616 LNVVVNALDNVNARLYIDQRCLYFQKPLLESGTLGAKCNTQMVIPHLTENYGASRDPPEK 675
VVV + L + Q PLL T G +++I E+ P
Sbjct: 118 FTVVVATQLPESTSLRLADVLWNSQIPLLICRTYGLVGYMRIIIK---EHPVIESHPDNA 174
Query: 676 QAPMCTVHSFPHNIDHCLTWARSEFEG-LLEKTPAEVNAYLTSPTEYASAMKNAGDAQAR 734
+ FP +H ++ E TP V +Y + + + +
Sbjct: 175 LEDLRLDKPFPELREHFQSYDLDHMEKKDHSHTPWIVIIA-----KYLAQWYSETNGRIP 229
Query: 735 DNLD-------------RVLECLDKERCETFQDCITWARLRFEDY-FADRVKQLTFTFPE 780
E E E F++ I ++ +
Sbjct: 230 KTYKEKEDFRDLIRQGILKNENGAPEDEENFEEAIKNVNTALNTTQIPSSIEDIFNDDRC 289
Query: 781 NATTSNGTPFW---SAPKRF-------PRPLQFSVDDL--SHLQFLMAASILR--AETYG 826
T FW A K F P++ ++ D+ +++ ++ R A+
Sbjct: 290 INITKQTPSFWILARALKEFVAKEGQGNLPVRGTIPDMIADSGKYIKLQNVYREKAKKDA 349
Query: 827 IPIPDWVKSPVKLADAVNKVIVPDFQPKENVKIETD---EKATSMSTGSIDDAVVINELL 883
+ + V ++ + I + + K + S++ D + +E++
Sbjct: 350 AAVGNHVAKLLQSIGQAPESI-SEKELKLLCSNSAFLRVVRCRSLAEEYGLDTINKDEII 408
Query: 884 QKLEKCQKQLPT--------------GYKMNPIQFEKDDDTNFHMDLIAGLANMRARNYG 929
++ ++ G ++ ++D + G +
Sbjct: 409 SSMDNPDNEIVLYLMLRAVDRFHKQQGRYPGVSNYQVEEDIGKLKSCLTGFLQEYGLSVM 468
Query: 930 IPEVDKLKAKFIAGRIIPAIATSTAMATGLVCLELYKVL 968
+ + + IA A G E+ K++
Sbjct: 469 VKDDYVHEFCRYGAAEPHTIA---AFLGGAAAQEVIKII 504
|
| >d1yova1 c.111.1.2 (A:6-534) Amyloid beta precursor protein-binding protein 1, APPBP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 529 | Back information, alignment and structure |
|---|
| >d1yova1 c.111.1.2 (A:6-534) Amyloid beta precursor protein-binding protein 1, APPBP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 529 | Back information, alignment and structure |
|---|
| >d1yovb1 c.111.1.2 (B:12-437) UBA3 {Human (Homo sapiens) [TaxId: 9606]} Length = 426 | Back information, alignment and structure |
|---|
| >d1yovb1 c.111.1.2 (B:12-437) UBA3 {Human (Homo sapiens) [TaxId: 9606]} Length = 426 | Back information, alignment and structure |
|---|
| >d1yovb1 c.111.1.2 (B:12-437) UBA3 {Human (Homo sapiens) [TaxId: 9606]} Length = 426 | Back information, alignment and structure |
|---|
| >d1jw9b_ c.111.1.1 (B:) Molybdenum cofactor biosynthesis protein MoeB {Escherichia coli [TaxId: 562]} Length = 247 | Back information, alignment and structure |
|---|
| >d1jw9b_ c.111.1.1 (B:) Molybdenum cofactor biosynthesis protein MoeB {Escherichia coli [TaxId: 562]} Length = 247 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch
Original result of HHsearch against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 1104 | |||
| d1yovb1 | 426 | UBA3 {Human (Homo sapiens) [TaxId: 9606]} | 100.0 | |
| d1yova1 | 529 | Amyloid beta precursor protein-binding protein 1, | 100.0 | |
| d1yova1 | 529 | Amyloid beta precursor protein-binding protein 1, | 100.0 | |
| d1yovb1 | 426 | UBA3 {Human (Homo sapiens) [TaxId: 9606]} | 100.0 | |
| d1jw9b_ | 247 | Molybdenum cofactor biosynthesis protein MoeB {Esc | 100.0 | |
| d1jw9b_ | 247 | Molybdenum cofactor biosynthesis protein MoeB {Esc | 99.97 | |
| d1pjqa1 | 113 | Siroheme synthase CysG, domain 1 {Salmonella typhi | 97.61 | |
| d1y8xb1 | 92 | UBA3 {Human (Homo sapiens) [TaxId: 9606]} | 97.15 | |
| d1pjqa1 | 113 | Siroheme synthase CysG, domain 1 {Salmonella typhi | 96.96 | |
| d1gpja2 | 159 | Glutamyl tRNA-reductase middle domain {Archaeon Me | 96.58 | |
| d1lssa_ | 132 | Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax | 96.42 | |
| d1kyqa1 | 150 | Bifunctional dehydrogenase/ferrochelatase Met8p, N | 96.38 | |
| d1gpja2 | 159 | Glutamyl tRNA-reductase middle domain {Archaeon Me | 96.25 | |
| d2jfga1 | 93 | UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase | 96.18 | |
| d1vi2a1 | 182 | Putative shikimate dehydrogenase YdiB {Escherichia | 96.11 | |
| d1vi2a1 | 182 | Putative shikimate dehydrogenase YdiB {Escherichia | 95.94 | |
| d1kyqa1 | 150 | Bifunctional dehydrogenase/ferrochelatase Met8p, N | 95.8 | |
| d1e5qa1 | 182 | Saccharopine reductase {Rice blast fungus (Magnapo | 95.8 | |
| d1lssa_ | 132 | Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax | 95.64 | |
| d2ldxa1 | 159 | Lactate dehydrogenase {Mouse (Mus musculus) [TaxId | 95.59 | |
| d3cuma2 | 162 | Hydroxyisobutyrate dehydrogenase {Pseudomonas aeru | 95.52 | |
| d1bg6a2 | 184 | N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {A | 95.51 | |
| d1pzga1 | 154 | Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5 | 95.5 | |
| d1e5qa1 | 182 | Saccharopine reductase {Rice blast fungus (Magnapo | 95.45 | |
| d1hyha1 | 146 | L-2-hydroxyisocapronate dehydrogenase, L-HICDH {La | 95.32 | |
| d1nyta1 | 170 | Shikimate 5-dehydrogenase AroE {Escherichia coli [ | 95.31 | |
| d1i0za1 | 160 | Lactate dehydrogenase {Human (Homo sapiens), heart | 95.24 | |
| d1ldna1 | 148 | Lactate dehydrogenase {Bacillus stearothermophilus | 95.2 | |
| d1npya1 | 167 | Shikimate 5-dehydrogenase-like protein HI0607 {Hae | 95.19 | |
| d2pgda2 | 176 | 6-phosphogluconate dehydrogenase {Sheep (Ovis orie | 95.18 | |
| d1npya1 | 167 | Shikimate 5-dehydrogenase-like protein HI0607 {Hae | 95.16 | |
| d1onfa2 | 117 | Glutathione reductase {Plasmodium falciparum [TaxI | 95.13 | |
| d1bg6a2 | 184 | N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {A | 94.97 | |
| d1gesa2 | 116 | Glutathione reductase {Escherichia coli [TaxId: 56 | 94.93 | |
| d1xg5a_ | 257 | Putative dehydrogenase ARPG836 (MGC4172) {Human (H | 94.78 | |
| d1hyea1 | 145 | MJ0490, lactate/malate dehydrogenase {Archaeon Met | 94.77 | |
| d1pl8a2 | 171 | Ketose reductase (sorbitol dehydrogenase) {Human ( | 94.63 | |
| d1llda1 | 143 | Lactate dehydrogenase {Bifidobacterium longum, str | 94.61 | |
| d1qp8a1 | 181 | Putative formate dehydrogenase {Archaeon Pyrobacul | 94.6 | |
| d1t2da1 | 150 | Lactate dehydrogenase {Malaria parasite (Plasmodiu | 94.59 | |
| d1nyta1 | 170 | Shikimate 5-dehydrogenase AroE {Escherichia coli [ | 94.58 | |
| d1xg5a_ | 257 | Putative dehydrogenase ARPG836 (MGC4172) {Human (H | 94.51 | |
| d1vj0a2 | 182 | Hypothetical protein TM0436 {Thermotoga maritima [ | 94.47 | |
| d1pzga1 | 154 | Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5 | 94.45 | |
| d1jqba2 | 174 | Bacterial secondary alcohol dehydrogenase {Clostri | 94.44 | |
| d1ks9a2 | 167 | Ketopantoate reductase PanE {Escherichia coli [Tax | 94.38 | |
| d2f1ka2 | 165 | Prephenate dehydrogenase TyrA {Synechocystis sp. p | 94.37 | |
| d2hmva1 | 134 | Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} | 94.21 | |
| d1d1ta2 | 176 | Alcohol dehydrogenase {Human (Homo sapiens), diffe | 94.2 | |
| d1v59a2 | 122 | Dihydrolipoamide dehydrogenase {Baker's yeast (Sac | 94.19 | |
| d1d7ya2 | 121 | NADH-dependent ferredoxin reductase, BphA4 {Pseudo | 94.18 | |
| d1mlda1 | 144 | Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 | 94.16 | |
| d2g5ca2 | 171 | Prephenate dehydrogenase TyrA {Aquifex aeolicus [T | 94.12 | |
| d1h6va2 | 122 | Mammalian thioredoxin reductase {Rat (Rattus norve | 94.11 | |
| d1ez4a1 | 146 | Lactate dehydrogenase {Lactobacillus pentosus [Tax | 93.95 | |
| d1nvta1 | 177 | Shikimate 5-dehydrogenase AroE {Archaeon Methanoco | 93.93 | |
| d1ebda2 | 117 | Dihydrolipoamide dehydrogenase {Bacillus stearothe | 93.91 | |
| d1iy8a_ | 258 | Levodione reductase {Corynebacterium aquaticum [Ta | 93.91 | |
| d1ps9a3 | 179 | 2,4-dienoyl-CoA reductase, middle domain {Escheric | 93.89 | |
| d1p77a1 | 171 | Shikimate 5-dehydrogenase AroE {Haemophilus influe | 93.86 | |
| d2f1ka2 | 165 | Prephenate dehydrogenase TyrA {Synechocystis sp. p | 93.63 | |
| d1f8fa2 | 174 | Benzyl alcohol dehydrogenase {Acinetobacter calcoa | 93.62 | |
| d1d7ya2 | 121 | NADH-dependent ferredoxin reductase, BphA4 {Pseudo | 93.58 | |
| d1j4aa1 | 197 | D-lactate dehydrogenase {Lactobacillus helveticus | 93.43 | |
| d1t2da1 | 150 | Lactate dehydrogenase {Malaria parasite (Plasmodiu | 93.43 | |
| d1mx3a1 | 193 | Transcription corepressor CtbP {Human (Homo sapien | 93.43 | |
| d2naca1 | 188 | Formate dehydrogenase {Pseudomonas sp., strain 101 | 93.4 | |
| d1lvla2 | 115 | Dihydrolipoamide dehydrogenase {Pseudomonas putida | 93.4 | |
| d1dxya1 | 199 | D-2-hydroxyisocaproate dehydrogenase {Lactobacillu | 93.4 | |
| d1guza1 | 142 | Malate dehydrogenase {Chlorobium vibrioforme [TaxI | 93.39 | |
| d1guza1 | 142 | Malate dehydrogenase {Chlorobium vibrioforme [TaxI | 93.39 | |
| d1nhpa2 | 123 | NADH peroxidase {Enterococcus faecalis [TaxId: 135 | 93.38 | |
| d1a5za1 | 140 | Lactate dehydrogenase {Thermotoga maritima [TaxId: | 93.35 | |
| d3lada2 | 119 | Dihydrolipoamide dehydrogenase {Azotobacter vinela | 93.32 | |
| d1xhca2 | 122 | NADH oxidase /nitrite reductase {Pyrococcus furios | 93.31 | |
| d1feca2 | 117 | Trypanothione reductase {Crithidia fasciculata [Ta | 93.3 | |
| d2hmva1 | 134 | Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} | 93.3 | |
| d3grsa2 | 125 | Glutathione reductase {Human (Homo sapiens) [TaxId | 93.26 | |
| d1ojta2 | 125 | Dihydrolipoamide dehydrogenase {Neisseria meningit | 93.24 | |
| d1luaa1 | 191 | Methylene-tetrahydromethanopterin dehydrogenase {M | 93.23 | |
| d2jhfa2 | 176 | Alcohol dehydrogenase {Horse (Equus caballus) [Tax | 93.18 | |
| d1vm6a3 | 128 | Dihydrodipicolinate reductase {Thermotoga maritima | 93.16 | |
| d1p77a1 | 171 | Shikimate 5-dehydrogenase AroE {Haemophilus influe | 93.12 | |
| d1p0fa2 | 174 | Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: | 93.05 | |
| d1e3ia2 | 174 | Alcohol dehydrogenase {Mouse (Mus musculus), class | 93.05 | |
| d1ojua1 | 142 | Malate dehydrogenase {Archaeon Archaeoglobus fulgi | 93.04 | |
| d2jfga1 | 93 | UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase | 92.95 | |
| d1f0ya2 | 192 | Short chain L-3-hydroxyacyl CoA dehydrogenase {Hum | 92.88 | |
| d1e3ja2 | 170 | Ketose reductase (sorbitol dehydrogenase) {Silverl | 92.85 | |
| d1pl8a2 | 171 | Ketose reductase (sorbitol dehydrogenase) {Human ( | 92.84 | |
| d1uxja1 | 142 | Malate dehydrogenase {Chloroflexus aurantiacus [Ta | 92.82 | |
| d1vpda2 | 161 | Hydroxyisobutyrate dehydrogenase {Salmonella typhi | 92.78 | |
| d1jqba2 | 174 | Bacterial secondary alcohol dehydrogenase {Clostri | 92.75 | |
| d1sc6a1 | 188 | Phosphoglycerate dehydrogenase {Escherichia coli [ | 92.69 | |
| d1p3da1 | 96 | UDP-N-acetylmuramate-alanine ligase MurC {Haemophi | 92.66 | |
| d1hyha1 | 146 | L-2-hydroxyisocapronate dehydrogenase, L-HICDH {La | 92.64 | |
| d1q1ra2 | 133 | Putidaredoxin reductase {Pseudomonas putida [TaxId | 92.54 | |
| d1gdha1 | 191 | D-glycerate dehydrogenase {Hyphomicrobium methylov | 92.54 | |
| d1id1a_ | 153 | Rck domain from putative potassium channel Kch {Es | 92.52 | |
| d1i36a2 | 152 | Conserved hypothetical protein MTH1747 {Archaeon M | 92.49 | |
| d2bkaa1 | 232 | TAT-interacting protein TIP30 {Human (Homo sapiens | 92.46 | |
| d1vpda2 | 161 | Hydroxyisobutyrate dehydrogenase {Salmonella typhi | 92.44 | |
| d1ks9a2 | 167 | Ketopantoate reductase PanE {Escherichia coli [Tax | 92.41 | |
| d1wdka3 | 186 | Fatty oxidation complex alpha subunit, middle doma | 92.41 | |
| d1mo9a2 | 121 | NADH-dependent 2-ketopropyl coenzyme M oxidoreduct | 92.39 | |
| d1a5za1 | 140 | Lactate dehydrogenase {Thermotoga maritima [TaxId: | 92.38 | |
| d2pgda2 | 176 | 6-phosphogluconate dehydrogenase {Sheep (Ovis orie | 92.35 | |
| d1pgja2 | 178 | 6-phosphogluconate dehydrogenase {Trypanosoma bruc | 92.29 | |
| d1e3ja2 | 170 | Ketose reductase (sorbitol dehydrogenase) {Silverl | 92.2 | |
| d1xhla_ | 274 | Hypothetical protein F25D1.5 {Caenorhabditis elega | 92.11 | |
| d1zema1 | 260 | Xylitol dehydrogenase {Gluconobacter oxydans [TaxI | 92.09 | |
| d1yxma1 | 297 | Peroxisomal trans 2-enoyl CoA reductase {Human (Ho | 92.05 | |
| d3cuma2 | 162 | Hydroxyisobutyrate dehydrogenase {Pseudomonas aeru | 92.02 | |
| d2ldxa1 | 159 | Lactate dehydrogenase {Mouse (Mus musculus) [TaxId | 92.02 | |
| d1yqga2 | 152 | Pyrroline-5-carboxylate reductase ProC {Neisseria | 92.0 | |
| d1o6za1 | 142 | Malate dehydrogenase {Archaeon Haloarcula marismor | 91.96 | |
| d1gtea4 | 196 | Dihydropyrimidine dehydrogenase, domain 2 {Pig (Su | 91.95 | |
| d1luaa1 | 191 | Methylene-tetrahydromethanopterin dehydrogenase {M | 91.93 | |
| d1gtea4 | 196 | Dihydropyrimidine dehydrogenase, domain 2 {Pig (Su | 91.87 | |
| d2b69a1 | 312 | UDP-glucuronate decarboxylase 1 {Human (Homo sapie | 91.8 | |
| d1hyea1 | 145 | MJ0490, lactate/malate dehydrogenase {Archaeon Met | 91.8 | |
| d1xkqa_ | 272 | Hypothetical protein R05D8.7 {Caenorhabditis elega | 91.6 | |
| d1llda1 | 143 | Lactate dehydrogenase {Bifidobacterium longum, str | 91.35 | |
| d1hdoa_ | 205 | Biliverdin IX beta reductase {Human (Homo sapiens) | 91.27 | |
| d1dxla2 | 123 | Dihydrolipoamide dehydrogenase {Garden pea (Pisum | 91.26 | |
| d1vj0a2 | 182 | Hypothetical protein TM0436 {Thermotoga maritima [ | 91.21 | |
| d1ps9a3 | 179 | 2,4-dienoyl-CoA reductase, middle domain {Escheric | 91.19 | |
| d1spxa_ | 264 | Glucose dehydrogenase (5l265) {Nematode (Caenorhab | 91.16 | |
| d1y6ja1 | 142 | Lactate dehydrogenase {Clostridium thermocellum [T | 91.14 | |
| d2gdza1 | 254 | 15-hydroxyprostaglandin dehydrogenase, PGDH {Human | 91.08 | |
| d1sbya1 | 254 | Drosophila alcohol dehydrogenase {Fly (Drosophila | 90.88 | |
| d1ez4a1 | 146 | Lactate dehydrogenase {Lactobacillus pentosus [Tax | 90.87 | |
| d1nvta1 | 177 | Shikimate 5-dehydrogenase AroE {Archaeon Methanoco | 90.63 | |
| d2ag5a1 | 245 | Dehydrogenase/reductase SDR family member 6, DHRS6 | 90.62 | |
| d1e3ia2 | 174 | Alcohol dehydrogenase {Mouse (Mus musculus), class | 90.59 | |
| d1t4ba1 | 146 | Aspartate beta-semialdehyde dehydrogenase {Escheri | 90.44 | |
| d1fmca_ | 255 | 7-alpha-hydroxysteroid dehydrogenase {Escherichia | 90.43 | |
| d1iy8a_ | 258 | Levodione reductase {Corynebacterium aquaticum [Ta | 90.38 | |
| d2vapa1 | 209 | Cell-division protein FtsZ {Archaeon Methanococcus | 90.33 | |
| d1i0za1 | 160 | Lactate dehydrogenase {Human (Homo sapiens), heart | 90.33 | |
| d1m6ia2 | 137 | Apoptosis-inducing factor (AIF) {Human (Homo sapie | 90.26 | |
| d2jhfa2 | 176 | Alcohol dehydrogenase {Horse (Equus caballus) [Tax | 90.23 | |
| d2cmda1 | 145 | Malate dehydrogenase {Escherichia coli [TaxId: 562 | 90.22 | |
| d1ojua1 | 142 | Malate dehydrogenase {Archaeon Archaeoglobus fulgi | 90.21 | |
| d1ldna1 | 148 | Lactate dehydrogenase {Bacillus stearothermophilus | 90.21 | |
| d1fcda1 | 186 | Flavocytochrome c sulfide dehydrogenase, FCSD, fla | 90.07 | |
| d1h2ba2 | 172 | Alcohol dehydrogenase {Archaeon Aeropyrum pernix [ | 90.02 | |
| d1uxja1 | 142 | Malate dehydrogenase {Chloroflexus aurantiacus [Ta | 89.95 | |
| d2bgka1 | 268 | Rhizome secoisolariciresinol dehydrogenase {Mayapp | 89.88 | |
| d1k2wa_ | 256 | Sorbitol dehydrogenase {Rhodobacter sphaeroides [T | 89.87 | |
| d1zk4a1 | 251 | R-specific alcohol dehydrogenase {Lactobacillus br | 89.87 | |
| d1u8xx1 | 167 | Maltose-6'-phosphate glucosidase GlvA {Bacillus su | 89.76 | |
| d1ae1a_ | 258 | Tropinone reductase {Jimsonweed (Datura stramonium | 89.74 | |
| d1txga2 | 180 | Glycerol-3- phosphate dehydrogenase {Archaeoglobus | 89.69 | |
| d2fzwa2 | 176 | Alcohol dehydrogenase {Human (Homo sapiens), diffe | 89.67 | |
| d1j6ua1 | 89 | UDP-N-acetylmuramate-alanine ligase MurC {Thermoto | 89.51 | |
| d1w5fa1 | 194 | Cell-division protein FtsZ {Thermotoga maritima [T | 89.25 | |
| d1vl8a_ | 251 | Gluconate 5-dehydrogenase {Thermotoga maritima [Ta | 89.17 | |
| d1w6ua_ | 294 | 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {H | 89.16 | |
| d1up7a1 | 162 | 6-phospho-beta-glucosidase {Thermotoga maritima [T | 89.16 | |
| d1aoga2 | 117 | Trypanothione reductase {Trypanosoma cruzi [TaxId: | 89.13 | |
| d1f8fa2 | 174 | Benzyl alcohol dehydrogenase {Acinetobacter calcoa | 89.12 | |
| d1pj5a2 | 305 | N,N-dimethylglycine oxidase {Arthrobacter globifor | 89.1 | |
| d1id1a_ | 153 | Rck domain from putative potassium channel Kch {Es | 88.97 | |
| d2cvza2 | 156 | Hydroxyisobutyrate dehydrogenase {Thermus thermoph | 88.91 | |
| d1ofua1 | 198 | Cell-division protein FtsZ {Pseudomonas aeruginosa | 88.9 | |
| d1mlda1 | 144 | Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 | 88.89 | |
| d1yb1a_ | 244 | 17-beta-hydroxysteroid dehydrogenase type XI {Huma | 88.83 | |
| d1ygya1 | 184 | Phosphoglycerate dehydrogenase {Mycobacterium tube | 88.62 | |
| d1xq1a_ | 259 | Tropinone reductase {Thale cress (Arabidopsis thal | 88.59 | |
| d2pv7a2 | 152 | Prephenate dehydrogenase TyrA {Haemophilus influen | 88.56 | |
| d1cdoa2 | 175 | Alcohol dehydrogenase {Cod (Gadus callarias) [TaxI | 88.51 | |
| d1geea_ | 261 | Glucose dehydrogenase {Bacillus megaterium [TaxId: | 88.46 | |
| d1yqga2 | 152 | Pyrroline-5-carboxylate reductase ProC {Neisseria | 88.38 | |
| d1o6za1 | 142 | Malate dehydrogenase {Archaeon Haloarcula marismor | 88.29 | |
| d1c0pa1 | 268 | D-aminoacid oxidase, N-terminal domain {Rhodotorul | 88.26 | |
| d1d1ta2 | 176 | Alcohol dehydrogenase {Human (Homo sapiens), diffe | 88.26 | |
| d1p0fa2 | 174 | Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: | 88.1 | |
| d1xhca2 | 122 | NADH oxidase /nitrite reductase {Pyrococcus furios | 88.02 | |
| d1obba1 | 171 | Alpha-glucosidase AglA {Thermotoga maritima [TaxId | 88.02 | |
| d2ae2a_ | 259 | Tropinone reductase {Jimsonweed (Datura stramonium | 87.94 | |
| d2hjsa1 | 144 | Usg-1 protein homolog PA3116 {Pseudomonas aerugino | 87.93 | |
| d1u8xx1 | 167 | Maltose-6'-phosphate glucosidase GlvA {Bacillus su | 87.76 | |
| d1j5pa4 | 132 | Hypothetical protein TM1643 {Thermotoga maritima [ | 87.73 | |
| d2g5ca2 | 171 | Prephenate dehydrogenase TyrA {Aquifex aeolicus [T | 87.71 | |
| d1xhla_ | 274 | Hypothetical protein F25D1.5 {Caenorhabditis elega | 87.7 | |
| d1zema1 | 260 | Xylitol dehydrogenase {Gluconobacter oxydans [TaxI | 87.68 | |
| d1wdka3 | 186 | Fatty oxidation complex alpha subunit, middle doma | 87.66 | |
| d2c07a1 | 251 | beta-keto acyl carrier protein reductase {Malaria | 87.66 | |
| d1f0ya2 | 192 | Short chain L-3-hydroxyacyl CoA dehydrogenase {Hum | 87.6 | |
| d1obba1 | 171 | Alpha-glucosidase AglA {Thermotoga maritima [TaxId | 87.48 | |
| d2pv7a2 | 152 | Prephenate dehydrogenase TyrA {Haemophilus influen | 87.47 | |
| d1ydea1 | 250 | Retinal dehydrogenase/reductase 3 {Human (Homo sap | 87.4 | |
| d1i36a2 | 152 | Conserved hypothetical protein MTH1747 {Archaeon M | 87.37 | |
| d1y6ja1 | 142 | Lactate dehydrogenase {Clostridium thermocellum [T | 87.33 | |
| d1ebda2 | 117 | Dihydrolipoamide dehydrogenase {Bacillus stearothe | 87.21 | |
| d1db3a_ | 357 | GDP-mannose 4,6-dehydratase {Escherichia coli [Tax | 87.1 | |
| d1pj5a2 | 305 | N,N-dimethylglycine oxidase {Arthrobacter globifor | 86.93 | |
| d1vm6a3 | 128 | Dihydrodipicolinate reductase {Thermotoga maritima | 86.9 | |
| d1pgja2 | 178 | 6-phosphogluconate dehydrogenase {Trypanosoma bruc | 86.89 | |
| d1j5pa4 | 132 | Hypothetical protein TM1643 {Thermotoga maritima [ | 86.71 | |
| d1bdba_ | 276 | Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Ps | 86.7 | |
| d1xkqa_ | 272 | Hypothetical protein R05D8.7 {Caenorhabditis elega | 86.67 | |
| d1xhca1 | 167 | NADH oxidase /nitrite reductase {Pyrococcus furios | 86.64 | |
| d1q1ra1 | 185 | Putidaredoxin reductase {Pseudomonas putida [TaxId | 86.62 | |
| d2ew8a1 | 247 | (s)-1-phenylethanol dehydrogenase {Azoarcus sp. eb | 86.52 | |
| d1gesa2 | 116 | Glutathione reductase {Escherichia coli [TaxId: 56 | 86.41 | |
| d1g0oa_ | 272 | 1,3,8-trihydroxynaphtalene reductase (THNR, naphto | 86.39 | |
| d1b5qa1 | 347 | Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} | 86.38 | |
| d1pr9a_ | 244 | Carbonyl reductase {Human (Homo sapiens) [TaxId: 9 | 86.27 | |
| d1txga2 | 180 | Glycerol-3- phosphate dehydrogenase {Archaeoglobus | 86.21 | |
| d1nhpa2 | 123 | NADH peroxidase {Enterococcus faecalis [TaxId: 135 | 86.2 | |
| d1spxa_ | 264 | Glucose dehydrogenase (5l265) {Nematode (Caenorhab | 86.07 | |
| d1hdoa_ | 205 | Biliverdin IX beta reductase {Human (Homo sapiens) | 86.02 | |
| d1x1ta1 | 260 | D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas | 86.01 | |
| d1y7ta1 | 154 | Malate dehydrogenase {Thermus thermophilus [TaxId: | 85.96 | |
| d2b69a1 | 312 | UDP-glucuronate decarboxylase 1 {Human (Homo sapie | 85.9 | |
| d1ryia1 | 276 | Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} | 85.88 | |
| d1c1da1 | 201 | Phenylalanine dehydrogenase {Rhodococcus sp., M4 [ | 85.85 | |
| d1pjca1 | 168 | L-alanine dehydrogenase {Phormidium lapideum [TaxI | 85.74 | |
| d1y1pa1 | 342 | Aldehyde reductase II {Sporobolomyces salmonicolor | 85.5 | |
| d1cyda_ | 242 | Carbonyl reductase {Mouse (Mus musculus) [TaxId: 1 | 85.46 | |
| d1onfa2 | 117 | Glutathione reductase {Plasmodium falciparum [TaxI | 85.4 | |
| d1djqa3 | 233 | Trimethylamine dehydrogenase, middle domain {Methy | 85.38 | |
| d1qyda_ | 312 | Pinoresinol-lariciresinol reductase {Giant arborvi | 85.37 | |
| d1v59a2 | 122 | Dihydrolipoamide dehydrogenase {Baker's yeast (Sac | 85.37 | |
| d1k0ia1 | 292 | p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas a | 85.33 | |
| d1yxma1 | 297 | Peroxisomal trans 2-enoyl CoA reductase {Human (Ho | 85.32 | |
| d1gega_ | 255 | meso-2,3-butanediol dehydrogenase {Klebsiella pneu | 85.3 | |
| d1seza1 | 373 | Protoporphyrinogen oxidase {Tobacco (Nicotiana tab | 85.3 | |
| d1qp8a1 | 181 | Putative formate dehydrogenase {Archaeon Pyrobacul | 85.2 | |
| d1jaya_ | 212 | Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archae | 85.19 | |
| d1c0pa1 | 268 | D-aminoacid oxidase, N-terminal domain {Rhodotorul | 84.93 | |
| d1uufa2 | 168 | Hypothetical protein YahK {Escherichia coli [TaxId | 84.93 | |
| d5mdha1 | 154 | Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 | 84.92 | |
| d1hdca_ | 254 | 3-alpha,20-beta-hydroxysteroid dehydrogenase {Stre | 84.68 | |
| d2ahra2 | 152 | Pyrroline-5-carboxylate reductase ProC {Streptococ | 84.65 | |
| d1fcda1 | 186 | Flavocytochrome c sulfide dehydrogenase, FCSD, fla | 84.61 | |
| d1yl7a1 | 135 | Dihydrodipicolinate reductase {Mycobacterium tuber | 84.56 | |
| d2voua1 | 265 | Dihydroxypyridine hydroxylase DhpH {Arthrobacter n | 84.44 | |
| d1s6ya1 | 169 | 6-phospho-beta-glucosidase {Bacillus stearothermop | 84.35 | |
| d1lvla2 | 115 | Dihydrolipoamide dehydrogenase {Pseudomonas putida | 84.33 | |
| d1h6va2 | 122 | Mammalian thioredoxin reductase {Rat (Rattus norve | 84.32 | |
| d1n1ea2 | 189 | Glycerol-3- phosphate dehydrogenase {Trypanosome ( | 84.25 | |
| d1jvba2 | 170 | Alcohol dehydrogenase {Archaeon Sulfolobus solfata | 84.21 | |
| d1wmaa1 | 275 | Carbonyl reductase/20beta-hydroxysteroid dehydroge | 83.96 | |
| d1d7ya1 | 183 | NADH-dependent ferredoxin reductase, BphA4 {Pseudo | 83.92 | |
| d7mdha1 | 175 | Malate dehydrogenase {Sorghum (Sorghum vulgare), c | 83.73 | |
| d2fy8a1 | 129 | Potassium channel-related protein MthK {Archaeon M | 83.65 | |
| d1q1ra2 | 133 | Putidaredoxin reductase {Pseudomonas putida [TaxId | 83.55 | |
| d2rhca1 | 257 | beta-keto acyl carrier protein reductase {Streptom | 83.5 | |
| d1seza1 | 373 | Protoporphyrinogen oxidase {Tobacco (Nicotiana tab | 83.4 | |
| d1q7ba_ | 243 | beta-keto acyl carrier protein reductase {Escheric | 83.36 | |
| d1mb4a1 | 147 | Aspartate beta-semialdehyde dehydrogenase {Vibrio | 83.27 | |
| d1r6da_ | 322 | dTDP-glucose 4,6-dehydratase (RmlB) {Streptomyces | 83.27 | |
| d1sbya1 | 254 | Drosophila alcohol dehydrogenase {Fly (Drosophila | 83.26 | |
| d2fzwa2 | 176 | Alcohol dehydrogenase {Human (Homo sapiens), diffe | 83.24 | |
| d1up7a1 | 162 | 6-phospho-beta-glucosidase {Thermotoga maritima [T | 83.21 | |
| d1fmca_ | 255 | 7-alpha-hydroxysteroid dehydrogenase {Escherichia | 83.02 | |
| d3grsa2 | 125 | Glutathione reductase {Human (Homo sapiens) [TaxId | 82.99 | |
| d2a4ka1 | 241 | beta-keto acyl carrier protein reductase {Thermus | 82.91 | |
| d1b5qa1 | 347 | Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} | 82.83 | |
| d1nffa_ | 244 | Putative oxidoreductase Rv2002 {Mycobacterium tube | 82.79 | |
| d1zk4a1 | 251 | R-specific alcohol dehydrogenase {Lactobacillus br | 82.78 | |
| d2voua1 | 265 | Dihydroxypyridine hydroxylase DhpH {Arthrobacter n | 82.66 | |
| d1ja9a_ | 259 | 1,3,6,8-tetrahydroxynaphthalene reductase {Rice bl | 82.62 | |
| d1ydwa1 | 184 | Probable oxidoreductase At4g09670 {Thale cress (Ar | 82.54 | |
| d1uufa2 | 168 | Hypothetical protein YahK {Escherichia coli [TaxId | 82.45 | |
| d1ek6a_ | 346 | Uridine diphosphogalactose-4-epimerase (UDP-galact | 82.01 | |
| d1jvba2 | 170 | Alcohol dehydrogenase {Archaeon Sulfolobus solfata | 81.97 | |
| d2bi7a1 | 314 | UDP-galactopyranose mutase, N-terminal domain {Kle | 81.92 | |
| d1orra_ | 338 | CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: | 81.91 | |
| d2bgka1 | 268 | Rhizome secoisolariciresinol dehydrogenase {Mayapp | 81.76 | |
| d1j4aa1 | 197 | D-lactate dehydrogenase {Lactobacillus helveticus | 81.64 | |
| d1rq2a1 | 198 | Cell-division protein FtsZ {Mycobacterium tubercul | 81.64 | |
| d1djqa3 | 233 | Trimethylamine dehydrogenase, middle domain {Methy | 81.62 | |
| d1i24a_ | 393 | Sulfolipid biosynthesis protein SQD1 {Thale cress | 81.58 | |
| d1e6ua_ | 315 | GDP-4-keto-6-deoxy-d-mannose epimerase/reductase ( | 81.5 | |
| d1vl8a_ | 251 | Gluconate 5-dehydrogenase {Thermotoga maritima [Ta | 81.46 | |
| d1vl6a1 | 222 | Malate oxidoreductase (malic enzyme) {Thermotoga m | 81.43 | |
| d1cjca2 | 230 | Adrenodoxin reductase of mitochondrial p450 system | 81.32 | |
| d2gdza1 | 254 | 15-hydroxyprostaglandin dehydrogenase, PGDH {Human | 81.24 | |
| d1z45a2 | 347 | Uridine diphosphogalactose-4-epimerase (UDP-galact | 81.19 | |
| d1h5qa_ | 260 | Mannitol dehydrogenase {Mushroom (Agaricus bisporu | 81.18 | |
| d1sb8a_ | 341 | UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomo | 80.92 | |
| d1gz6a_ | 302 | (3R)-hydroxyacyl-CoA dehydrogenase domain of estra | 80.9 | |
| d2iida1 | 370 | L-aminoacid oxidase {Malayan pit viper (Calloselas | 80.72 | |
| d1w6ua_ | 294 | 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {H | 80.65 | |
| d1k0ia1 | 292 | p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas a | 80.61 | |
| d1yb1a_ | 244 | 17-beta-hydroxysteroid dehydrogenase type XI {Huma | 80.58 | |
| d2naca1 | 188 | Formate dehydrogenase {Pseudomonas sp., strain 101 | 80.47 | |
| d1geea_ | 261 | Glucose dehydrogenase {Bacillus megaterium [TaxId: | 80.39 | |
| d1cjca2 | 230 | Adrenodoxin reductase of mitochondrial p450 system | 80.36 | |
| d2c07a1 | 251 | beta-keto acyl carrier protein reductase {Malaria | 80.29 | |
| d1kewa_ | 361 | dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus | 80.2 | |
| d1w5fa1 | 194 | Cell-division protein FtsZ {Thermotoga maritima [T | 80.08 | |
| d1s6ya1 | 169 | 6-phospho-beta-glucosidase {Bacillus stearothermop | 80.04 | |
| d1ydwa1 | 184 | Probable oxidoreductase At4g09670 {Thale cress (Ar | 80.01 | |
| d3c96a1 | 288 | Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: | 80.01 |
| >d1yovb1 c.111.1.2 (B:12-437) UBA3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Activating enzymes of the ubiquitin-like proteins superfamily: Activating enzymes of the ubiquitin-like proteins family: Ubiquitin activating enzymes (UBA) domain: UBA3 species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00 E-value=6.9e-64 Score=583.31 Aligned_cols=360 Identities=28% Similarity=0.435 Sum_probs=273.5
Q ss_pred cchhhhhccC-HHHHHHHhcCcEEEEcCCcchHHHHHHHHhcccccCCCcceEEecCCcccccCcccccCcccCccccch
Q 001301 498 RYDAQISVFG-SKLQKKLEEAKVFVVGSGALGCEFLKNLALMGVSCGNQGKLTITDDDVIEKSNLSRQFLFRDWNIGQAK 576 (1104)
Q Consensus 498 RYdrqi~l~G-~~~q~kL~~~~VlvvG~GgiG~evlknLa~~Gv~~~~~g~i~iiD~D~Ie~sNLnRQfLf~~~diG~~K 576 (1104)
+|.++.-..| ...|.+|+++||+||||||+|||+||+|+++|| |+|+|+|+|+||.|||||||||+++|||++|
T Consensus 18 ~~~~~~~~~~~e~~~~~l~~~kVlvvG~GglG~ei~k~L~~~Gv-----g~i~lvD~D~Ve~sNL~RQflf~~~diG~~K 92 (426)
T d1yovb1 18 PFTHPDFEPSTESLQFLLDTCKVLVIGAGGLGCELLKNLALSGF-----RQIHVIDMDTIDVSNLNRQFLFRPKDIGRPK 92 (426)
T ss_dssp TTCCTTCCCCSSHHHHHHHHCCEEEECSSTTHHHHHHHHHTTTC-----CCEEEECCCBCCGGGGGTCTTCCGGGTTSBH
T ss_pred CCcCcccccChHHHHHHHhcCeEEEECCCHHHHHHHHHHHHcCC-----CeEEEEECCCcchhhhcccccCChhHcCcHH
Confidence 3444433334 356888999999999999999999999999999 9999999999999999999999999999999
Q ss_pred HHHHHHHHHHhCCCcEEeeecccCCccccccchhhhhccCCEEEEccCCHHHHHHHhhccc------------ccccceE
Q 001301 577 STVAASAAALINPHLNTEALQIRANPETENVFNDTFWENLNVVVNALDNVNARLYIDQRCL------------YFQKPLL 644 (1104)
Q Consensus 577 a~vaa~~l~~~np~~~i~~~~~~v~~~~~~~~~~~f~~~~DvVi~alDn~~aR~~i~~~c~------------~~~~pli 644 (1104)
|++|+++++++||+++|+++..++.+ ++++|++++|+||+|+||+++|+++|++|+ ..++|+|
T Consensus 93 a~~a~~~l~~~np~v~i~~~~~~i~~-----~~~~~~~~~DlVi~~~Dn~~aR~~in~~c~~l~k~~~~~~~~~~~iPlI 167 (426)
T d1yovb1 93 AEVAAEFLNDRVPNCNVVPHFNKIQD-----FNDTFYRQFHIIVCGLDSIIARRWINGMLISLLNYEDGVLDPSSIVPLI 167 (426)
T ss_dssp HHHHHHHHHHHSTTCCCEEECSCGGG-----BCHHHHTTCSEEEECCSCHHHHHHHHHHHHHTCCEETTEECGGGCCCEE
T ss_pred HHHHHHHHHhhCCCCceEeeeccccc-----hHHHHHHhcchheeccCcHHHHHHHHHHHHHhhcccccccccccCCceE
Confidence 99999999999999999999988864 335789999999999999999999999997 4578999
Q ss_pred ecccCCcccceEEEeCCcccccCcCC--CCCCCCCCcccccCCCCChhhHHHHHHHHhhhhhccChhhHhhhcCCcHHHH
Q 001301 645 ESGTLGAKCNTQMVIPHLTENYGASR--DPPEKQAPMCTVHSFPHNIDHCLTWARSEFEGLLEKTPAEVNAYLTSPTEYA 722 (1104)
Q Consensus 645 ~~g~~G~~G~v~v~ip~~t~~y~~~~--~p~~~~~p~Ct~~~fP~~~~hci~wAr~~F~~~f~~~~~~~~~~l~~~~~~~ 722 (1104)
++|+.|+.|++++++|+.|+||.|.. .|+++.+|.||++++|+.++|||+|||.+.
T Consensus 168 ~gg~~G~~G~~~vi~p~~t~Cy~C~~~~~p~~~~~p~CTi~~~P~~~~hci~~ak~l~---------------------- 225 (426)
T d1yovb1 168 DGGTEGFKGNARVILPGMTACIECTLELYPPQVNFPMCTIASMPRLPEHCIEYVRMLQ---------------------- 225 (426)
T ss_dssp EEEEETTEEEEEEECTTTSCCGGGGGGGSCCCCCCCHHHHHHCCCSHHHHHHHHHHTH----------------------
T ss_pred EeEEeeeEEEEEEECCCCCCCcCcCCCCCCCCCCCCcccccCCCCCchheeehhhhhc----------------------
Confidence 99999999999999999999999964 478889999999999999999999998520
Q ss_pred HHhhhcCchhHHHhHHHHHHHhhhhcccchHHHHHHHHHHHHHHHHHHHHHhhhcCCCCccCCCCCCcccCCCCCCCccc
Q 001301 723 SAMKNAGDAQARDNLDRVLECLDKERCETFQDCITWARLRFEDYFADRVKQLTFTFPENATTSNGTPFWSAPKRFPRPLQ 802 (1104)
Q Consensus 723 ~~~~~~~~~~~~~~l~~~~~~l~~~~~~~~~~ci~~a~~~f~~~F~~~i~~Ll~~~p~d~~~~~g~~fws~~kr~P~pl~ 802 (1104)
|.+ .+..
T Consensus 226 -----------------------------------~~~---------------------------------~~~~----- 232 (426)
T d1yovb1 226 -----------------------------------WPK---------------------------------EQPF----- 232 (426)
T ss_dssp -----------------------------------HHH---------------------------------SCTT-----
T ss_pred -----------------------------------ccc---------------------------------cccc-----
Confidence 100 0000
Q ss_pred ccCCcchhHHHHHHHHHHHHHHcCCCCCCCCCChhHHHHhhhhccCCCCCCCCCccccccccccccCCCCcChHHHHHHH
Q 001301 803 FSVDDLSHLQFLMAASILRAETYGIPIPDWVKSPVKLADAVNKVIVPDFQPKENVKIETDEKATSMSTGSIDDAVVINEL 882 (1104)
Q Consensus 803 fd~~~~~h~~fv~~~a~l~a~~~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~~~~~~~~~~~~~~~~~~~~l 882 (1104)
T Consensus 233 -------------------------------------------------------------------------------- 232 (426)
T d1yovb1 233 -------------------------------------------------------------------------------- 232 (426)
T ss_dssp --------------------------------------------------------------------------------
T ss_pred --------------------------------------------------------------------------------
Confidence
Q ss_pred HHHHHHhhhcCCCCCCCCCceecccCCCCchhHHHHHHhhhhhhhcCCCCccHHHHHHHhccccchhhhhhhHHHHHHHH
Q 001301 883 LQKLEKCQKQLPTGYKMNPIQFEKDDDTNFHMDLIAGLANMRARNYGIPEVDKLKAKFIAGRIIPAIATSTAMATGLVCL 962 (1104)
Q Consensus 883 ~~~l~~~~~~~~~~~~~~p~~FeKDDd~n~hidFI~AasNLRA~ny~I~~~d~~~~K~iAG~IIPAIATTtA~VaGl~~l 962 (1104)
.....||+||+ .||+||+++||+||.+|+|+..+++.+|++|||||||||||||+|||++++
T Consensus 233 ----------------~~~~~~d~dd~--~~i~~i~~~a~~ra~~~~I~~~~~~~~k~ia~nIIPaiatTnAIVagl~~~ 294 (426)
T d1yovb1 233 ----------------GEGVPLDGDDP--EHIQWIFQKSLERASQYNIRGVTYRLTQGVVKRIIPAVASTNAVIAAVCAT 294 (426)
T ss_dssp ----------------STTCCCCTTCH--HHHHHHHHHHHHHHHHTTCCCCCHHHHHHHHTTCCCCCHHHHHHHHHHHHH
T ss_pred ----------------cccCCCCCCCH--HHHHHHHHHHHHHHHhcCCCCccHHHHHHHhhccccccccHHHHHHHHHHH
Confidence 00123566665 499999999999999999999999999999999999999999999999999
Q ss_pred HHHHHhcCCCCccccccccc-ccccCcccccCCCCCCccc-cCCcceeEEeEEEeCCCCcHHHHHHHHHHc-CCce--ee
Q 001301 963 ELYKVLDGGHKLEDYRNTFA-NLALPLFSMAEPVPPKVFK-HQDMSWTVWDRWILRDNPTLRQLLQWLQDK-GLNA--YS 1037 (1104)
Q Consensus 963 El~K~l~~~~~~~~~rn~f~-nla~p~~~~~eP~~~~~~~-~~~~~~t~wd~~~v~~~~TL~~li~~~~~~-~l~~--~~ 1037 (1104)
|++|++.+... ..+|.|+ +-..+.+..+.+..+...+ .++. .|..+.+..++||+||+++++++ +++. ++
T Consensus 295 E~iK~lt~~~~--p~~n~~~~~~~~~~~~~~~~~~k~~~C~vC~~---~~~~~~~~~~~tL~~li~~~~~~~~l~~~~p~ 369 (426)
T d1yovb1 295 EVFKIATSAYI--PLNNYLVFNDVDGLYTYTFEAERKENCPACSQ---LPQNIQFSPSAKLQEVLDYLTNSASLQMKSPA 369 (426)
T ss_dssp HHHHHHHCSSC--CCCSEEEEECSBSCEEEEECCCCCTTCTTTCS---SCBCCC------CTTHHHHTTTCSSSCCSSCC
T ss_pred HHHHHHhcCCc--cccceEEEecCCCceEeeeeccCCCCCCeeCC---ceEEEEECCCCCHHHHHHHHHHhhCcCccCCc
Confidence 99999997532 2233332 3333444333333222211 1221 12234556789999999999988 6654 32
Q ss_pred ----eecCCceeeccCCc----chhhcccCcHHHHH
Q 001301 1038 ----ISYGSCLLFNSMFP----RHKERMDKKVVDLV 1065 (1104)
Q Consensus 1038 ----i~~g~~~LY~~~~~----~~~~~l~~~l~~l~ 1065 (1104)
+..|.++||..+.+ ..++||+|+|+||.
T Consensus 370 ~~~~~~~~~~~Ly~~~~~~le~~~~~nl~k~L~eL~ 405 (426)
T d1yovb1 370 ITATLEGKNRTLYLQSVTSIEERTRPNLSKTLKELG 405 (426)
T ss_dssp EECC-----CEECCCC----CGGGSTTC--------
T ss_pred ceeeecCCCcEEEecCCchhhHHhhhhhcCCHHHhC
Confidence 33467899988754 44789999999994
|
| >d1yova1 c.111.1.2 (A:6-534) Amyloid beta precursor protein-binding protein 1, APPBP1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1yova1 c.111.1.2 (A:6-534) Amyloid beta precursor protein-binding protein 1, APPBP1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1yovb1 c.111.1.2 (B:12-437) UBA3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jw9b_ c.111.1.1 (B:) Molybdenum cofactor biosynthesis protein MoeB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1jw9b_ c.111.1.1 (B:) Molybdenum cofactor biosynthesis protein MoeB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1pjqa1 c.2.1.11 (A:1-113) Siroheme synthase CysG, domain 1 {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1y8xb1 c.111.1.2 (B:349-440) UBA3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pjqa1 c.2.1.11 (A:1-113) Siroheme synthase CysG, domain 1 {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1gpja2 c.2.1.7 (A:144-302) Glutamyl tRNA-reductase middle domain {Archaeon Methanopyrus kandleri [TaxId: 2320]} | Back information, alignment and structure |
|---|
| >d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1kyqa1 c.2.1.11 (A:1-150) Bifunctional dehydrogenase/ferrochelatase Met8p, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1gpja2 c.2.1.7 (A:144-302) Glutamyl tRNA-reductase middle domain {Archaeon Methanopyrus kandleri [TaxId: 2320]} | Back information, alignment and structure |
|---|
| >d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1vi2a1 c.2.1.7 (A:107-288) Putative shikimate dehydrogenase YdiB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1vi2a1 c.2.1.7 (A:107-288) Putative shikimate dehydrogenase YdiB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1kyqa1 c.2.1.11 (A:1-150) Bifunctional dehydrogenase/ferrochelatase Met8p, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} | Back information, alignment and structure |
|---|
| >d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d2ldxa1 c.2.1.5 (A:1-159) Lactate dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d3cuma2 c.2.1.6 (A:1-162) Hydroxyisobutyrate dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]} | Back information, alignment and structure |
|---|
| >d1pzga1 c.2.1.5 (A:14-163) Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5811]} | Back information, alignment and structure |
|---|
| >d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} | Back information, alignment and structure |
|---|
| >d1hyha1 c.2.1.5 (A:21-166) L-2-hydroxyisocapronate dehydrogenase, L-HICDH {Lactobacillus confusus [TaxId: 1583]} | Back information, alignment and structure |
|---|
| >d1nyta1 c.2.1.7 (A:102-271) Shikimate 5-dehydrogenase AroE {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1i0za1 c.2.1.5 (A:1-160) Lactate dehydrogenase {Human (Homo sapiens), heart isoform (H chain) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ldna1 c.2.1.5 (A:15-162) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1npya1 c.2.1.7 (A:103-269) Shikimate 5-dehydrogenase-like protein HI0607 {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d2pgda2 c.2.1.6 (A:1-176) 6-phosphogluconate dehydrogenase {Sheep (Ovis orientalis aries) [TaxId: 9940]} | Back information, alignment and structure |
|---|
| >d1npya1 c.2.1.7 (A:103-269) Shikimate 5-dehydrogenase-like protein HI0607 {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]} | Back information, alignment and structure |
|---|
| >d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1xg5a_ c.2.1.2 (A:) Putative dehydrogenase ARPG836 (MGC4172) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hyea1 c.2.1.5 (A:1-145) MJ0490, lactate/malate dehydrogenase {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1llda1 c.2.1.5 (A:7-149) Lactate dehydrogenase {Bifidobacterium longum, strain am101-2 [TaxId: 216816]} | Back information, alignment and structure |
|---|
| >d1qp8a1 c.2.1.4 (A:83-263) Putative formate dehydrogenase {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} | Back information, alignment and structure |
|---|
| >d1t2da1 c.2.1.5 (A:1-150) Lactate dehydrogenase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1nyta1 c.2.1.7 (A:102-271) Shikimate 5-dehydrogenase AroE {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1xg5a_ c.2.1.2 (A:) Putative dehydrogenase ARPG836 (MGC4172) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1pzga1 c.2.1.5 (A:14-163) Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5811]} | Back information, alignment and structure |
|---|
| >d1jqba2 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} | Back information, alignment and structure |
|---|
| >d1ks9a2 c.2.1.6 (A:1-167) Ketopantoate reductase PanE {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2f1ka2 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {Synechocystis sp. pcc 6803 [TaxId: 1148]} | Back information, alignment and structure |
|---|
| >d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1d1ta2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} | Back information, alignment and structure |
|---|
| >d1mlda1 c.2.1.5 (A:1-144) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d2g5ca2 c.2.1.6 (A:30-200) Prephenate dehydrogenase TyrA {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1h6va2 c.3.1.5 (A:171-292) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1ez4a1 c.2.1.5 (A:16-162) Lactate dehydrogenase {Lactobacillus pentosus [TaxId: 1589]} | Back information, alignment and structure |
|---|
| >d1nvta1 c.2.1.7 (A:111-287) Shikimate 5-dehydrogenase AroE {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1ebda2 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1iy8a_ c.2.1.2 (A:) Levodione reductase {Corynebacterium aquaticum [TaxId: 144185]} | Back information, alignment and structure |
|---|
| >d1ps9a3 c.4.1.1 (A:331-465,A:628-671) 2,4-dienoyl-CoA reductase, middle domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1p77a1 c.2.1.7 (A:102-272) Shikimate 5-dehydrogenase AroE {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d2f1ka2 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {Synechocystis sp. pcc 6803 [TaxId: 1148]} | Back information, alignment and structure |
|---|
| >d1f8fa2 c.2.1.1 (A:163-336) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} | Back information, alignment and structure |
|---|
| >d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} | Back information, alignment and structure |
|---|
| >d1j4aa1 c.2.1.4 (A:104-300) D-lactate dehydrogenase {Lactobacillus helveticus [TaxId: 1587]} | Back information, alignment and structure |
|---|
| >d1t2da1 c.2.1.5 (A:1-150) Lactate dehydrogenase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1mx3a1 c.2.1.4 (A:126-318) Transcription corepressor CtbP {Human (Homo sapiens), Ctbp1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2naca1 c.2.1.4 (A:148-335) Formate dehydrogenase {Pseudomonas sp., strain 101 [TaxId: 306]} | Back information, alignment and structure |
|---|
| >d1lvla2 c.3.1.5 (A:151-265) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d1dxya1 c.2.1.4 (A:101-299) D-2-hydroxyisocaproate dehydrogenase {Lactobacillus casei [TaxId: 1582]} | Back information, alignment and structure |
|---|
| >d1guza1 c.2.1.5 (A:1-142) Malate dehydrogenase {Chlorobium vibrioforme [TaxId: 1098]} | Back information, alignment and structure |
|---|
| >d1guza1 c.2.1.5 (A:1-142) Malate dehydrogenase {Chlorobium vibrioforme [TaxId: 1098]} | Back information, alignment and structure |
|---|
| >d1nhpa2 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d1a5za1 c.2.1.5 (A:22-163) Lactate dehydrogenase {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} | Back information, alignment and structure |
|---|
| >d1xhca2 c.3.1.5 (A:104-225) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1feca2 c.3.1.5 (A:170-286) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} | Back information, alignment and structure |
|---|
| >d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d3grsa2 c.3.1.5 (A:166-290) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ojta2 c.3.1.5 (A:276-400) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} | Back information, alignment and structure |
|---|
| >d1luaa1 c.2.1.7 (A:98-288) Methylene-tetrahydromethanopterin dehydrogenase {Methylobacterium extorquens [TaxId: 408]} | Back information, alignment and structure |
|---|
| >d2jhfa2 c.2.1.1 (A:164-339) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]} | Back information, alignment and structure |
|---|
| >d1vm6a3 c.2.1.3 (A:1-96,A:183-214) Dihydrodipicolinate reductase {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1p77a1 c.2.1.7 (A:102-272) Shikimate 5-dehydrogenase AroE {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1p0fa2 c.2.1.1 (A:1164-1337) Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 8403]} | Back information, alignment and structure |
|---|
| >d1e3ia2 c.2.1.1 (A:168-341) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ojua1 c.2.1.5 (A:22-163) Malate dehydrogenase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1f0ya2 c.2.1.6 (A:12-203) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} | Back information, alignment and structure |
|---|
| >d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uxja1 c.2.1.5 (A:2-143) Malate dehydrogenase {Chloroflexus aurantiacus [TaxId: 1108]} | Back information, alignment and structure |
|---|
| >d1vpda2 c.2.1.6 (A:3-163) Hydroxyisobutyrate dehydrogenase {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1jqba2 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} | Back information, alignment and structure |
|---|
| >d1sc6a1 c.2.1.4 (A:108-295) Phosphoglycerate dehydrogenase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1p3da1 c.5.1.1 (A:11-106) UDP-N-acetylmuramate-alanine ligase MurC {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1hyha1 c.2.1.5 (A:21-166) L-2-hydroxyisocapronate dehydrogenase, L-HICDH {Lactobacillus confusus [TaxId: 1583]} | Back information, alignment and structure |
|---|
| >d1q1ra2 c.3.1.5 (A:115-247) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d1gdha1 c.2.1.4 (A:101-291) D-glycerate dehydrogenase {Hyphomicrobium methylovorum [TaxId: 84]} | Back information, alignment and structure |
|---|
| >d1id1a_ c.2.1.9 (A:) Rck domain from putative potassium channel Kch {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1i36a2 c.2.1.6 (A:1-152) Conserved hypothetical protein MTH1747 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d2bkaa1 c.2.1.2 (A:5-236) TAT-interacting protein TIP30 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vpda2 c.2.1.6 (A:3-163) Hydroxyisobutyrate dehydrogenase {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1ks9a2 c.2.1.6 (A:1-167) Ketopantoate reductase PanE {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1wdka3 c.2.1.6 (A:311-496) Fatty oxidation complex alpha subunit, middle domain {Pseudomonas fragi [TaxId: 296]} | Back information, alignment and structure |
|---|
| >d1mo9a2 c.3.1.5 (A:193-313) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} | Back information, alignment and structure |
|---|
| >d1a5za1 c.2.1.5 (A:22-163) Lactate dehydrogenase {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2pgda2 c.2.1.6 (A:1-176) 6-phosphogluconate dehydrogenase {Sheep (Ovis orientalis aries) [TaxId: 9940]} | Back information, alignment and structure |
|---|
| >d1pgja2 c.2.1.6 (A:1-178) 6-phosphogluconate dehydrogenase {Trypanosoma brucei [TaxId: 5691]} | Back information, alignment and structure |
|---|
| >d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} | Back information, alignment and structure |
|---|
| >d1xhla_ c.2.1.2 (A:) Hypothetical protein F25D1.5 {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1zema1 c.2.1.2 (A:3-262) Xylitol dehydrogenase {Gluconobacter oxydans [TaxId: 442]} | Back information, alignment and structure |
|---|
| >d1yxma1 c.2.1.2 (A:7-303) Peroxisomal trans 2-enoyl CoA reductase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3cuma2 c.2.1.6 (A:1-162) Hydroxyisobutyrate dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d2ldxa1 c.2.1.5 (A:1-159) Lactate dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1yqga2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Neisseria meningitidis, serogroup B [TaxId: 487]} | Back information, alignment and structure |
|---|
| >d1o6za1 c.2.1.5 (A:22-162) Malate dehydrogenase {Archaeon Haloarcula marismortui [TaxId: 2238]} | Back information, alignment and structure |
|---|
| >d1gtea4 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine dehydrogenase, domain 2 {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1luaa1 c.2.1.7 (A:98-288) Methylene-tetrahydromethanopterin dehydrogenase {Methylobacterium extorquens [TaxId: 408]} | Back information, alignment and structure |
|---|
| >d1gtea4 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine dehydrogenase, domain 2 {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d2b69a1 c.2.1.2 (A:4-315) UDP-glucuronate decarboxylase 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hyea1 c.2.1.5 (A:1-145) MJ0490, lactate/malate dehydrogenase {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1xkqa_ c.2.1.2 (A:) Hypothetical protein R05D8.7 {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1llda1 c.2.1.5 (A:7-149) Lactate dehydrogenase {Bifidobacterium longum, strain am101-2 [TaxId: 216816]} | Back information, alignment and structure |
|---|
| >d1hdoa_ c.2.1.2 (A:) Biliverdin IX beta reductase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dxla2 c.3.1.5 (A:153-275) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} | Back information, alignment and structure |
|---|
| >d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1ps9a3 c.4.1.1 (A:331-465,A:628-671) 2,4-dienoyl-CoA reductase, middle domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1spxa_ c.2.1.2 (A:) Glucose dehydrogenase (5l265) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1y6ja1 c.2.1.5 (A:7-148) Lactate dehydrogenase {Clostridium thermocellum [TaxId: 1515]} | Back information, alignment and structure |
|---|
| >d2gdza1 c.2.1.2 (A:3-256) 15-hydroxyprostaglandin dehydrogenase, PGDH {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1sbya1 c.2.1.2 (A:1-254) Drosophila alcohol dehydrogenase {Fly (Drosophila lebanonensis) [TaxId: 7225]} | Back information, alignment and structure |
|---|
| >d1ez4a1 c.2.1.5 (A:16-162) Lactate dehydrogenase {Lactobacillus pentosus [TaxId: 1589]} | Back information, alignment and structure |
|---|
| >d1nvta1 c.2.1.7 (A:111-287) Shikimate 5-dehydrogenase AroE {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d2ag5a1 c.2.1.2 (A:1-245) Dehydrogenase/reductase SDR family member 6, DHRS6 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1e3ia2 c.2.1.1 (A:168-341) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1t4ba1 c.2.1.3 (A:1-133,A:355-367) Aspartate beta-semialdehyde dehydrogenase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1fmca_ c.2.1.2 (A:) 7-alpha-hydroxysteroid dehydrogenase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1iy8a_ c.2.1.2 (A:) Levodione reductase {Corynebacterium aquaticum [TaxId: 144185]} | Back information, alignment and structure |
|---|
| >d2vapa1 c.32.1.1 (A:23-231) Cell-division protein FtsZ {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1i0za1 c.2.1.5 (A:1-160) Lactate dehydrogenase {Human (Homo sapiens), heart isoform (H chain) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1m6ia2 c.3.1.5 (A:264-400) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2jhfa2 c.2.1.1 (A:164-339) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]} | Back information, alignment and structure |
|---|
| >d2cmda1 c.2.1.5 (A:1-145) Malate dehydrogenase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ojua1 c.2.1.5 (A:22-163) Malate dehydrogenase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1ldna1 c.2.1.5 (A:15-162) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1fcda1 c.3.1.5 (A:1-114,A:256-327) Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit {Purple phototrophic bacterium (Chromatium vinosum) [TaxId: 1049]} | Back information, alignment and structure |
|---|
| >d1h2ba2 c.2.1.1 (A:155-326) Alcohol dehydrogenase {Archaeon Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d1uxja1 c.2.1.5 (A:2-143) Malate dehydrogenase {Chloroflexus aurantiacus [TaxId: 1108]} | Back information, alignment and structure |
|---|
| >d2bgka1 c.2.1.2 (A:11-278) Rhizome secoisolariciresinol dehydrogenase {Mayapple (Podophyllum peltatum) [TaxId: 35933]} | Back information, alignment and structure |
|---|
| >d1k2wa_ c.2.1.2 (A:) Sorbitol dehydrogenase {Rhodobacter sphaeroides [TaxId: 1063]} | Back information, alignment and structure |
|---|
| >d1zk4a1 c.2.1.2 (A:1-251) R-specific alcohol dehydrogenase {Lactobacillus brevis [TaxId: 1580]} | Back information, alignment and structure |
|---|
| >d1u8xx1 c.2.1.5 (X:3-169) Maltose-6'-phosphate glucosidase GlvA {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1ae1a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), I [TaxId: 4076]} | Back information, alignment and structure |
|---|
| >d1txga2 c.2.1.6 (A:1-180) Glycerol-3- phosphate dehydrogenase {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d2fzwa2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1j6ua1 c.5.1.1 (A:0-88) UDP-N-acetylmuramate-alanine ligase MurC {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1w5fa1 c.32.1.1 (A:22-215) Cell-division protein FtsZ {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1vl8a_ c.2.1.2 (A:) Gluconate 5-dehydrogenase {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1w6ua_ c.2.1.2 (A:) 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {Human (Homo sapiens), [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1up7a1 c.2.1.5 (A:1-162) 6-phospho-beta-glucosidase {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1aoga2 c.3.1.5 (A:170-286) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} | Back information, alignment and structure |
|---|
| >d1f8fa2 c.2.1.1 (A:163-336) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} | Back information, alignment and structure |
|---|
| >d1pj5a2 c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine oxidase {Arthrobacter globiformis [TaxId: 1665]} | Back information, alignment and structure |
|---|
| >d1id1a_ c.2.1.9 (A:) Rck domain from putative potassium channel Kch {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2cvza2 c.2.1.6 (A:2-157) Hydroxyisobutyrate dehydrogenase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1ofua1 c.32.1.1 (A:11-208) Cell-division protein FtsZ {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1mlda1 c.2.1.5 (A:1-144) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1yb1a_ c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase type XI {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ygya1 c.2.1.4 (A:99-282) Phosphoglycerate dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1xq1a_ c.2.1.2 (A:) Tropinone reductase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d2pv7a2 c.2.1.6 (A:92-243) Prephenate dehydrogenase TyrA {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1cdoa2 c.2.1.1 (A:165-339) Alcohol dehydrogenase {Cod (Gadus callarias) [TaxId: 8053]} | Back information, alignment and structure |
|---|
| >d1geea_ c.2.1.2 (A:) Glucose dehydrogenase {Bacillus megaterium [TaxId: 1404]} | Back information, alignment and structure |
|---|
| >d1yqga2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Neisseria meningitidis, serogroup B [TaxId: 487]} | Back information, alignment and structure |
|---|
| >d1o6za1 c.2.1.5 (A:22-162) Malate dehydrogenase {Archaeon Haloarcula marismortui [TaxId: 2238]} | Back information, alignment and structure |
|---|
| >d1c0pa1 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxidase, N-terminal domain {Rhodotorula gracilis [TaxId: 5286]} | Back information, alignment and structure |
|---|
| >d1d1ta2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1p0fa2 c.2.1.1 (A:1164-1337) Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 8403]} | Back information, alignment and structure |
|---|
| >d1xhca2 c.3.1.5 (A:104-225) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1obba1 c.2.1.5 (A:2-172) Alpha-glucosidase AglA {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2ae2a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), II [TaxId: 4076]} | Back information, alignment and structure |
|---|
| >d2hjsa1 c.2.1.3 (A:3-129,A:320-336) Usg-1 protein homolog PA3116 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1u8xx1 c.2.1.5 (X:3-169) Maltose-6'-phosphate glucosidase GlvA {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2g5ca2 c.2.1.6 (A:30-200) Prephenate dehydrogenase TyrA {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1xhla_ c.2.1.2 (A:) Hypothetical protein F25D1.5 {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1zema1 c.2.1.2 (A:3-262) Xylitol dehydrogenase {Gluconobacter oxydans [TaxId: 442]} | Back information, alignment and structure |
|---|
| >d1wdka3 c.2.1.6 (A:311-496) Fatty oxidation complex alpha subunit, middle domain {Pseudomonas fragi [TaxId: 296]} | Back information, alignment and structure |
|---|
| >d2c07a1 c.2.1.2 (A:54-304) beta-keto acyl carrier protein reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1f0ya2 c.2.1.6 (A:12-203) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1obba1 c.2.1.5 (A:2-172) Alpha-glucosidase AglA {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2pv7a2 c.2.1.6 (A:92-243) Prephenate dehydrogenase TyrA {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1ydea1 c.2.1.2 (A:4-253) Retinal dehydrogenase/reductase 3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1i36a2 c.2.1.6 (A:1-152) Conserved hypothetical protein MTH1747 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d1y6ja1 c.2.1.5 (A:7-148) Lactate dehydrogenase {Clostridium thermocellum [TaxId: 1515]} | Back information, alignment and structure |
|---|
| >d1ebda2 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1db3a_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1pj5a2 c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine oxidase {Arthrobacter globiformis [TaxId: 1665]} | Back information, alignment and structure |
|---|
| >d1vm6a3 c.2.1.3 (A:1-96,A:183-214) Dihydrodipicolinate reductase {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1pgja2 c.2.1.6 (A:1-178) 6-phosphogluconate dehydrogenase {Trypanosoma brucei [TaxId: 5691]} | Back information, alignment and structure |
|---|
| >d1bdba_ c.2.1.2 (A:) Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Pseudomonas sp., lb400 [TaxId: 306]} | Back information, alignment and structure |
|---|
| >d1xkqa_ c.2.1.2 (A:) Hypothetical protein R05D8.7 {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1xhca1 c.3.1.5 (A:1-103,A:226-289) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1q1ra1 c.3.1.5 (A:2-114,A:248-319) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d2ew8a1 c.2.1.2 (A:3-249) (s)-1-phenylethanol dehydrogenase {Azoarcus sp. ebn1 [TaxId: 76114]} | Back information, alignment and structure |
|---|
| >d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1g0oa_ c.2.1.2 (A:) 1,3,8-trihydroxynaphtalene reductase (THNR, naphtol reductase) {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} | Back information, alignment and structure |
|---|
| >d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} | Back information, alignment and structure |
|---|
| >d1pr9a_ c.2.1.2 (A:) Carbonyl reductase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1txga2 c.2.1.6 (A:1-180) Glycerol-3- phosphate dehydrogenase {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1nhpa2 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d1spxa_ c.2.1.2 (A:) Glucose dehydrogenase (5l265) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1hdoa_ c.2.1.2 (A:) Biliverdin IX beta reductase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x1ta1 c.2.1.2 (A:1-260) D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas fragi [TaxId: 296]} | Back information, alignment and structure |
|---|
| >d1y7ta1 c.2.1.5 (A:0-153) Malate dehydrogenase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2b69a1 c.2.1.2 (A:4-315) UDP-glucuronate decarboxylase 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ryia1 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} | Back information, alignment and structure |
|---|
| >d1c1da1 c.2.1.7 (A:149-349) Phenylalanine dehydrogenase {Rhodococcus sp., M4 [TaxId: 1831]} | Back information, alignment and structure |
|---|
| >d1pjca1 c.2.1.4 (A:136-303) L-alanine dehydrogenase {Phormidium lapideum [TaxId: 32060]} | Back information, alignment and structure |
|---|
| >d1y1pa1 c.2.1.2 (A:2-343) Aldehyde reductase II {Sporobolomyces salmonicolor [TaxId: 5005]} | Back information, alignment and structure |
|---|
| >d1cyda_ c.2.1.2 (A:) Carbonyl reductase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1djqa3 c.4.1.1 (A:341-489,A:646-729) Trimethylamine dehydrogenase, middle domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} | Back information, alignment and structure |
|---|
| >d1qyda_ c.2.1.2 (A:) Pinoresinol-lariciresinol reductase {Giant arborvitae (Thuja plicata) [TaxId: 3316]} | Back information, alignment and structure |
|---|
| >d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1k0ia1 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1yxma1 c.2.1.2 (A:7-303) Peroxisomal trans 2-enoyl CoA reductase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gega_ c.2.1.2 (A:) meso-2,3-butanediol dehydrogenase {Klebsiella pneumoniae [TaxId: 573]} | Back information, alignment and structure |
|---|
| >d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} | Back information, alignment and structure |
|---|
| >d1qp8a1 c.2.1.4 (A:83-263) Putative formate dehydrogenase {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} | Back information, alignment and structure |
|---|
| >d1jaya_ c.2.1.6 (A:) Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1c0pa1 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxidase, N-terminal domain {Rhodotorula gracilis [TaxId: 5286]} | Back information, alignment and structure |
|---|
| >d1uufa2 c.2.1.1 (A:145-312) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d5mdha1 c.2.1.5 (A:1-154) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1hdca_ c.2.1.2 (A:) 3-alpha,20-beta-hydroxysteroid dehydrogenase {Streptomyces hydrogenans [TaxId: 1905]} | Back information, alignment and structure |
|---|
| >d2ahra2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d1fcda1 c.3.1.5 (A:1-114,A:256-327) Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit {Purple phototrophic bacterium (Chromatium vinosum) [TaxId: 1049]} | Back information, alignment and structure |
|---|
| >d1yl7a1 c.2.1.3 (A:2-105,A:215-245) Dihydrodipicolinate reductase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} | Back information, alignment and structure |
|---|
| >d1s6ya1 c.2.1.5 (A:4-172) 6-phospho-beta-glucosidase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1lvla2 c.3.1.5 (A:151-265) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d1h6va2 c.3.1.5 (A:171-292) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1n1ea2 c.2.1.6 (A:9-197) Glycerol-3- phosphate dehydrogenase {Trypanosome (Leishmania mexicana) [TaxId: 5665]} | Back information, alignment and structure |
|---|
| >d1jvba2 c.2.1.1 (A:144-313) Alcohol dehydrogenase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1wmaa1 c.2.1.2 (A:2-276) Carbonyl reductase/20beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1d7ya1 c.3.1.5 (A:5-115,A:237-308) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} | Back information, alignment and structure |
|---|
| >d7mdha1 c.2.1.5 (A:23-197) Malate dehydrogenase {Sorghum (Sorghum vulgare), chloroplast [TaxId: 4558]} | Back information, alignment and structure |
|---|
| >d2fy8a1 c.2.1.9 (A:116-244) Potassium channel-related protein MthK {Archaeon Methanothermobacter thermautotrophicus [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d1q1ra2 c.3.1.5 (A:115-247) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d2rhca1 c.2.1.2 (A:5-261) beta-keto acyl carrier protein reductase {Streptomyces coelicolor [TaxId: 1902]} | Back information, alignment and structure |
|---|
| >d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} | Back information, alignment and structure |
|---|
| >d1q7ba_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1mb4a1 c.2.1.3 (A:1-132,A:355-369) Aspartate beta-semialdehyde dehydrogenase {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d1r6da_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptomyces venezuelae [TaxId: 54571]} | Back information, alignment and structure |
|---|
| >d1sbya1 c.2.1.2 (A:1-254) Drosophila alcohol dehydrogenase {Fly (Drosophila lebanonensis) [TaxId: 7225]} | Back information, alignment and structure |
|---|
| >d2fzwa2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1up7a1 c.2.1.5 (A:1-162) 6-phospho-beta-glucosidase {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1fmca_ c.2.1.2 (A:) 7-alpha-hydroxysteroid dehydrogenase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d3grsa2 c.3.1.5 (A:166-290) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2a4ka1 c.2.1.2 (A:2-242) beta-keto acyl carrier protein reductase {Thermus thermophilus, TTHB020 [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} | Back information, alignment and structure |
|---|
| >d1nffa_ c.2.1.2 (A:) Putative oxidoreductase Rv2002 {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1zk4a1 c.2.1.2 (A:1-251) R-specific alcohol dehydrogenase {Lactobacillus brevis [TaxId: 1580]} | Back information, alignment and structure |
|---|
| >d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} | Back information, alignment and structure |
|---|
| >d1ja9a_ c.2.1.2 (A:) 1,3,6,8-tetrahydroxynaphthalene reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} | Back information, alignment and structure |
|---|
| >d1ydwa1 c.2.1.3 (A:6-133,A:305-360) Probable oxidoreductase At4g09670 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1uufa2 c.2.1.1 (A:145-312) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ek6a_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jvba2 c.2.1.1 (A:144-313) Alcohol dehydrogenase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d2bi7a1 c.4.1.3 (A:2-247,A:317-384) UDP-galactopyranose mutase, N-terminal domain {Klebsiella pneumoniae [TaxId: 573]} | Back information, alignment and structure |
|---|
| >d1orra_ c.2.1.2 (A:) CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: 90370]} | Back information, alignment and structure |
|---|
| >d2bgka1 c.2.1.2 (A:11-278) Rhizome secoisolariciresinol dehydrogenase {Mayapple (Podophyllum peltatum) [TaxId: 35933]} | Back information, alignment and structure |
|---|
| >d1j4aa1 c.2.1.4 (A:104-300) D-lactate dehydrogenase {Lactobacillus helveticus [TaxId: 1587]} | Back information, alignment and structure |
|---|
| >d1rq2a1 c.32.1.1 (A:8-205) Cell-division protein FtsZ {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1djqa3 c.4.1.1 (A:341-489,A:646-729) Trimethylamine dehydrogenase, middle domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} | Back information, alignment and structure |
|---|
| >d1i24a_ c.2.1.2 (A:) Sulfolipid biosynthesis protein SQD1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1e6ua_ c.2.1.2 (A:) GDP-4-keto-6-deoxy-d-mannose epimerase/reductase (GDP-fucose synthetase) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1vl8a_ c.2.1.2 (A:) Gluconate 5-dehydrogenase {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1vl6a1 c.2.1.7 (A:155-376) Malate oxidoreductase (malic enzyme) {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1cjca2 c.4.1.1 (A:6-106,A:332-460) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d2gdza1 c.2.1.2 (A:3-256) 15-hydroxyprostaglandin dehydrogenase, PGDH {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z45a2 c.2.1.2 (A:11-357) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1h5qa_ c.2.1.2 (A:) Mannitol dehydrogenase {Mushroom (Agaricus bisporus) [TaxId: 5341]} | Back information, alignment and structure |
|---|
| >d1sb8a_ c.2.1.2 (A:) UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1gz6a_ c.2.1.2 (A:) (3R)-hydroxyacyl-CoA dehydrogenase domain of estradiol 17 beta-Dehydrogenase 4 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} | Back information, alignment and structure |
|---|
| >d1w6ua_ c.2.1.2 (A:) 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {Human (Homo sapiens), [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1k0ia1 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1yb1a_ c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase type XI {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2naca1 c.2.1.4 (A:148-335) Formate dehydrogenase {Pseudomonas sp., strain 101 [TaxId: 306]} | Back information, alignment and structure |
|---|
| >d1geea_ c.2.1.2 (A:) Glucose dehydrogenase {Bacillus megaterium [TaxId: 1404]} | Back information, alignment and structure |
|---|
| >d1cjca2 c.4.1.1 (A:6-106,A:332-460) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d2c07a1 c.2.1.2 (A:54-304) beta-keto acyl carrier protein reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1kewa_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]} | Back information, alignment and structure |
|---|
| >d1w5fa1 c.32.1.1 (A:22-215) Cell-division protein FtsZ {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1s6ya1 c.2.1.5 (A:4-172) 6-phospho-beta-glucosidase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1ydwa1 c.2.1.3 (A:6-133,A:305-360) Probable oxidoreductase At4g09670 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d3c96a1 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|