Citrus Sinensis ID: 001316


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------1000------1010------1020------1030------1040------1050------1060------1070------1080------1090------1100--
MASSSRARSSSPFSYRKPVTPYSSTSSTSSSFMNNRLMPRSCSTSASSYFNSGNGLGSRSMTPSRSCSDSMYNSPRAPPVIFPSEELMAEPLDAPQRSGDSISVTIRFRPLSEREFQRGDEIAWYADGDKIVRNEYNPATAYAFDRVFGPHANSQEVYDVAARPVVKAAMEGVNGTVFAYGVTSSGKTHTMHGDQNSPGIIPLAIKDVFSIIQDTPGREFLLRVSYLEIYNEVINDLLDPTGQNLRVREDAQGTYVEGIKEEVVLSPGHALSFIAAGEEHRHVGSNNFNLLSSRSHTIFTLMIESSDHGDEYDGVIFSQLNLIDLAGSESSKTETTGLRRKEGSYINKSLLTLGTVIGKLSEGKASHVPYRDSKLTRLLQSSLSGHGHVSLICTVTPASSSMEETHNTLKFASRAKRVEIYASRNKIIDEKSLIKKYQREISSLKEELDQLKRGILVGVSHEELMTLRQKLEEGQVKMQSRLEEEEEAKAALMSRIQRLTKLILVSTKNTIPGLSDVPNHQRSHSVGEDDLDLLREGSLLLDGENQKDSTSSASGLASDLPSDFKHRRSSSKWNEEFSPTSSTVTESTQAGELISGSKHPIGGMTSDQMDLLVEQVKMLAGEIAFSSSNLKRLVDQSVNDPDGSKVQIQNLEREIQEKRRQMRILEQRIIENGEASMANASMVDMQQTVTRLMSQCNEKAFELEIKSADNRILQEQLQNKCSENKKLQEKVNLLEQQLACQNGDKSAGSSGQGTSDEYVDELRKKVQSQETENEKLKLEHVQLSEENSGLHVQNQKLAEEASYAKELASAAAVELKNLAGEVTKLSLQNAKLEKELLAARESMHSRGAAMQTVNGVNRKYSDGMKAGRKGRLSGRSTEISGVVSDDFDSWNLDPDDLKLELQARKQREAALEAALAEKEFLEDEYRKKVEESKRREEALENDLANMWVLVAKLKKEVGSVPELNTVERHSNGEDRVCDPKANETDCNTVLKDRHFLEVSKPADENSVERQVLDVPKPADETPKEEPLVARLKARMQEMKEKEQKYQGNGDPNSHMCKVCFESPTAAILLPCRHFCLCKSCSLACSECPICRTKISDRLFAFT
cccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEEccccHHHHHccccEEEEEcccEEEEEccccccccccccccccccccHHHHHHHcHHHHHHHHccccEEEEEEccccccccccccccccccccHHHHHHHHHHHHHcccccEEEEEEHHHHHHHccccccccccccccEEcccccccEEccccEEEEccHHHHHHHHHHHHHccccHHccccccccccccEEEEEEEEEccccccccEEEEEEEEEEcccccccccccccHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHcccccccccEEEEEEcccccccHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccHHHHHHccccccccccccccHHHcccccccccHHHHHHcccccccccccccccccccccHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHccccccccccHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHcccccccccccccccccccccccccccccccccccccccccc
cccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEEEcccHHHHHccccEEEEEcccEEEEccccccEEEEccEEEcccccHHHHHHHHcHHHHHHHHcccEEEEEEEccccccHHHHHcEcccccccEHHHHHHHHHHHcccccEEEEEEEEEEEEEccEEEEccccccccEcEEEcccccEEcccccEEEccHHHHHHHHHHHHHHHHcccccHHHHHHHcEEEEEEEEEEEEccccccEEEEEEEEEEEcccccccccccccccccccHHccHHHHHHHHHHHHHHHcccccccHHHcHHHHHcHHHHHccEEEEEEEEEccEHHHHHHHHHHHHHHHHHHccEEEEccEEEccHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccHHHHHHcccccccccccccccccccHcccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHcHHHccHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHccEEEEEcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHcccccccEccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccHHccccccccccccccEEccccHcHHccccccccEEEEEccccccccccccccHHHHHHHHHHHHHHHHHHHHcccccccccEEEEEEccccHEEEcccccEEccccccEEcccccccccccccEEEEcc
masssrarssspfsyrkpvtpysstsstsssfmnnrlmprscstsassyfnsgnglgsrsmtpsrscsdsmynsprappvifpseelmaepldapqrsgdsisvtirfrplserefqrgdeiawyadgdkivrneynpatayafdrvfgphansqevydVAARPVVKAAMEGVNGTVFAYGvtssgkthtmhgdqnspgiiplAIKDVFSIIQDTPGREFLLRVSYLEIYNEVINdlldptgqnlrvredaqgtyveGIKEevvlspghalsfiaageehrhvgsnnfnllssrSHTIFTLMIessdhgdeydgviFSQLNLidlagsessktettglrrkegsyINKSLLTLGTVIgklsegkashvpyrdskLTRLLQsslsghghvSLICtvtpasssmeeTHNTLKFASRAKRVEIYASRNKIIDEKSLIKKYQREISSLKEELDQLKRGILVGVSHEELMTLRQKLEEGQVKMQSRLEEEEEAKAALMSRIQRLTKLILVStkntipglsdvpnhqrshsvgeddldllregsllldgenqkdstssasglasdlpsdfkhrrssskwneefsptsstvtestqagelisgskhpiggmtsDQMDLLVEQVKMLAGEIafsssnlkrlvdqsvndpdgskvQIQNLEREIQEKRRQMRILEQRIIENGEASMANASMVDMQQTVTRLMSQCNEKAFELEIKSADNRILQEQLQNKCSENKKLQEKVNLLEQQLACqngdksagssgqgtsDEYVDELRKKVQSQETENEKLKLEHVQLseensglhvqnQKLAEEASYAKELASAAAVELKNLAGEVTKLSLQNAKLEKELLAARESMHSRGAAMQTVNGVnrkysdgmkagrkgrlsgrsteisgvvsddfdswnldpddLKLELQARKQREAALEAALAEKEFLEDEYRKKVEESKRREEALENDLANMWVLVAKLKKevgsvpelntverhsngedrvcdpkanetdcntvlkdrhflevskpadensverqvldvpkpadetpkeePLVARLKARMQEMKEKEQkyqgngdpnshmckvcfesptaaillpcrhfclckscslacsecpicrtkISDRLFAFT
masssrarssspfsyrkpvtpysstsstsssfMNNRLMPRSCSTSASSYFNSGNGLGSRSMTPSRSCSDSMYNSPRAPPVIFPSEELMAEPldapqrsgdsisvtirfrplserefqrgdeiawyadgdkiVRNEYNPATAYAFDRVFGPHANSQEVYDVAARPVVKAAMEGVNGTVFAYGVTSSGKTHTMHGDQNSPGIIPLAIKDVFSIIQDTPGREFLLRVSYLEIYNEVINdlldptgqnLRVREDAQGTYVEGIKEEVVLSPGHALSFIAAGEEHRHVGSNNFNLLSSRSHTIFTLMIESSDHGDEYDGVIFSQLNLIdlagsessktettglrrkegsyinksLLTLGTVIGKLSEGKASHVPYRDSKLTRLLQSSLSGHGHVSLICTVTPASSSMEETHNtlkfasrakrveiyasrnkiidekslIKKYQREISSLKEELDQLKRGILVGVSHEELMTLRQKLEEGQVKMQSRLEEEEEAKAALMSRIQRLTKLILVSTKntipglsdvpnhqrshsVGEDDLDLLREGSLLLdgenqkdstssasglasdlpsdfKHRRssskwneefsptsstvtestqageLISGSKHPIGGMTSDQMDLLVEQVKMLAGEIAFSSSNLKRLVDQsvndpdgskvqiqnLEREIQEKRRQMRILEQRIIengeasmanASMVDMQQTVTRLMSQCNEKAFELEIKSADNRILQEQLQNKCSENKKLQEKVNLLEQQLACqngdksagssgqgTSDEYVDELRKKVQSQETENEKLKLEHVQLSEENSGLHVQNQKLAEEASYAKELASAAAVELKNLAGEVTKLSLQNAKLEKELLAARESMHsrgaamqtvngvnrkysdgmkagrkgrlsgrsteisgvvsddfdswnlDPDDLKLELQARKQREAALEAALaekefledeyrkKVEESKRREEALENDLANMWVLVAKLKKevgsvpelntverhsngedrvcdpkanETDCNTVLKDRHFLevskpadensverqvldvpkpadetpkeeplVARLKARMQEMKEKEqkyqgngdpnSHMCKVCFESPTAAILLPCRHFCLCKSCSLACSECPICRTKISDRLFAFT
MasssrarsssPFSYRKPVTPYsstsstsssFMNNRLMPRSCSTSASSYFNSGNGLGSRSMTPSRSCSDSMYNSPRAPPVIFPSEELMAEPLDAPQRSGDSISVTIRFRPLSEREFQRGDEIAWYADGDKIVRNEYNPATAYAFDRVFGPHANSQEVYDVAARPVVKAAMEGVNGTVFAYGVTSSGKTHTMHGDQNSPGIIPLAIKDVFSIIQDTPGREFLLRVSYLEIYNEVINDLLDPTGQNLRVREDAQGTYVEGIKEEVVLSPGHALSFIAAGEEHRHVGSNNFNLLSSRSHTIFTLMIESSDHGDEYDGVIFSQLNLIDLAGSESSKTETTGLRRKEGSYINKSLLTLGTVIGKLSEGKASHVPYRDSKLTRLLQSSLSGHGHVSLICTVTPASSSMEETHNTLKFASRAKRVEIYASRNKIIDEKSLIKKYQREISSLKEELDQLKRGILVGVSHEELMTLRQKLEEGQVKMQSRLeeeeeAKAALMSRIQRLTKLILVSTKNTIPGLSDVPNHQRSHSVgeddldllregsllldgeNQKDSTSSASGLASDLPSDFKHRRSSSKWNEEFSPTSSTVTESTQAGELISGSKHPIGGMTSDQMDLLVEQVKMLAGEIAFSSSNLKRLVDQSVNDPDGSKVQIQNLEREIQEKRRQMRILEQRIIENGEASMANASMVDMQQTVTRLMSQCNEKAFELEIKSADNRILQEQLQNKCSENKKLQEKVNLLEQQLACQNGDKSAGSSGQGTSDEYVDELRKKVQSQETENEKLKLEHVQLSEENSGLHVQNQklaeeasyakelasaaavelkNLAGEVTKLSLQNAKLEKELLAARESMHSRGAAMQTVNGVNRKYSDGMKAGRKGRLSGRSTEISGVVSDDFDSWNLDPDDLKLELqarkqreaaleaalaekeFLEDeyrkkveeskrreeALENDLANMWVLVAKLKKEVGSVPELNTVERHSNGEDRVCDPKANETDCNTVLKDRHFLEVSKPADENSVERQVLDVPKPADETPKEEPLVARLKARMQEMKEKEQKYQGNGDPNSHMCKVCFESPTAAILLPCRHFCLCKSCSLACSECPICRTKISDRLFAFT
*******************************************************************************************************VTIRFRPLSEREFQRGDEIAWYADGDKIVRNEYNPATAYAFDRVFGPHANSQEVYDVAARPVVKAAMEGVNGTVFAYGVTSS************PGIIPLAIKDVFSIIQDTPGREFLLRVSYLEIYNEVINDLLDPTGQNLRVREDAQGTYVEGIKEEVVLSPGHALSFIAAGEEHRHVGSNNFNLLSSRSHTIFTLMIESSDHGDEYDGVIFSQLNLIDLA*****************SYINKSLLTLGTVIGKLSEG***HVPYR**KLTRLLQSSLSGHGHVSLICTVT**************FASRAKRVEIYASRNKIIDEKSLIKKYQREISSL**ELDQLKRGILVGVSHE********************************RIQRLTKLILVSTKNT****************************************************************************************************LLVEQVKMLAGEIAF****************************************************************************************************************************************************************************************************************************************************************************************************************************DLANMWVLVAKLKKEVG******************************VL****************************************************************MCKVCFESPTAAILLPCRHFCLCKSCSLACSECPICRTKISDRLFA**
*******************************************************************************************************VTIRFRPLSEREFQRGDEIAWYADGDKI****YNPATAYAFDRVFGPHANSQEVYDVAARPVVKAAMEGVNGTVFAYGVTSSGKTHTMHGDQNSPGIIPLAIKDVFSIIQDTPGREFLLRVSYLEIYNEVINDLLDPTGQNLRVREDAQGTYVEGIKEEVVLSPGHALSFIAAGEEHRHVGSNNFNLLSSRSHTIFTLMI***************QLNLIDLAGSESS**********EGSYINKSLLTLGTVIGKLSEGKASHVPYRDSKLTRLLQSSLSGHGHVSLICTVTPASSSMEETHNTLKFASRAKRVEIYASRNKIIDEKSLIKKYQREISSLK*************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************CFESPTAAILLPCRHFCLCKSCSLACSECPICRTKISDRLFAFT
*******************************FMNNRLMPRSCSTSASSYFNSGN*******************SPRAPPVIFPSEELMAEPLDAPQRSGDSISVTIRFRPLSEREFQRGDEIAWYADGDKIVRNEYNPATAYAFDRVFGPHANSQEVYDVAARPVVKAAMEGVNGTVFAYGVTSSGKTHTMHGDQNSPGIIPLAIKDVFSIIQDTPGREFLLRVSYLEIYNEVINDLLDPTGQNLRVREDAQGTYVEGIKEEVVLSPGHALSFIAAGEEHRHVGSNNFNLLSSRSHTIFTLMIESSDHGDEYDGVIFSQLNLIDLAGS*********LRRKEGSYINKSLLTLGTVIGKLSEGKASHVPYRDSKLTRLLQSSLSGHGHVSLICTVTPA********NTLKFASRAKRVEIYASRNKIIDEKSLIKKYQREISSLKEELDQLKRGILVGVSHEELMTLRQKLEEGQV**************ALMSRIQRLTKLILVSTKNTIPGLSDVPNHQRSHSVGEDDLDLLREGSLLLDG***********************************************GELISGSKHPIGGMTSDQMDLLVEQVKMLAGEIAFSSSNLKRLVDQSVNDPDGSKVQIQNLEREIQEKRRQMRILEQRIIENGEASMANASMVDMQQTVTRLMSQCNEKAFELEIKSADNRILQEQLQNKCSENKKLQEKVNLLEQQLAC***********************************LKLEHVQLSEENSGLHVQNQKLAEEASYAKELASAAAVELKNLAGEVTKLSLQNAKLEKELLAARESMHSRGAAMQTVNGVNRKYSDGMKAGRKGRLSGRSTEISGVVSDDFDSWNLDPDDLKLELQARKQREAALEAALAEKEFLEDEYR***********ALENDLANMWVLVAKLKKEVGSVPELNTVERHSNGEDRVCDPKANETDCNTVLKDRHFLEVSKPADENSVERQVLDVPKPADETPKEEPLVARLKARMQ**************PNSHMCKVCFESPTAAILLPCRHFCLCKSCSLACSECPICRTKISDRLFAFT
***************************************************************************************************DSISVTIRFRPLSEREFQRGDEIAWYADGDKIVRNEYNPATAYAFDRVFGPHANSQEVYDVAARPVVKAAMEGVNGTVFAYGVTSSGKTHTMHGDQNSPGIIPLAIKDVFSIIQDTPGREFLLRVSYLEIYNEVINDLLDPTGQNLRVREDAQGTYVEGIKEEVVLSPGHALSFIAAGEEHRHVGSNNFNLLSSRSHTIFTLMIESSDHGDEYDGVIFSQLNLIDLAG************RKEGSYINKSLLTLGTVIGKLSEGKASHVPYRDSKLTRLLQSSLSGHGHVSLICTVTPASSSMEETHNTLKFASRAKRVEIYASRNKIIDEKSLIKKYQREISSLKEELDQLKRGILVGVSHEELMTLRQKLEEGQVKMQSRLEEEEEAKAALMSRIQRLTKLILVSTKN**************************E*******************************************************************MTSDQMDLLVEQVKMLAGEIAFSSSNLKRLVDQSVNDPDGSKVQIQNLEREIQEKRRQMRILEQRIIENGEASMANASMVDMQQTVTRLMSQCNEKAFELEIKSADNRILQEQLQNKCSENKKLQEKVNLLEQQLACQN************SDEYVDELRKKVQSQETENEKLKLEHVQLSEENSGLHVQNQKLAEEASYAKELASAAAVELKNLAGEVTKLSLQNAKLEKELLAARE*******************************************DDFDSWNLDPDDLKLELQARKQREAALEAALAEKEFLEDEYRKKVEESKRREEALENDLANMWVLVAKLKKE**************************************FLEVSKPADENSVERQVLDVPKPADETPKEEPLVARLKARMQEMKEKEQKYQGNGDPNSHMCKVCFESPTAAILLPCRHFCLCKSCSLACSECPICRTKISDRLFAFT
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MASSSRARSSSPFSYRKPVTPYSSTSSTSSSFMNNRLMPRSCSTSASSYFNSGNGLGSRSMTPSRSCSDSMYNSPRAPPVIFPSEELMAEPLDAPQRSGDSISVTIRFRPLSEREFQRGDEIAWYADGDKIVRNEYNPATAYAFDRVFGPHANSQEVYDVAARPVVKAAMEGVNGTVFAYGVTSSGKTHTMHGDQNSPGIIPLAIKDVFSIIQDTPGREFLLRVSYLEIYNEVINDLLDPTGQNLRVREDAQGTYVEGIKEEVVLSPGHALSFIAAGEEHRHVGSNNFNLLSSRSHTIFTLMIESSDHGDEYDGVIFSQLNLIDLAGSESSKTETTGLRRKEGSYINKSLLTLGTVIGKLSEGKASHVPYRDSKLTRLLQSSLSGHGHVSLICTVTPASSSMEETHNTLKFASRAKRVEIYASRNKxxxxxxxxxxxxxxxxxxxxxxxxxxxxILVGVSHEELMTLxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxILVSTKNTIPGLSDVPNHQRSHSVGEDDLDLLREGSLLLDGENQKDSTSSASGLASDLPSDFKHRRSSSKWNEEFSPTSSTVTESTQAGELISGSKHPIGGMTSDQMDLLVEQVKMLAGEIAFSSSNLKRLVDQSVNDPDGSKVQxxxxxxxxxxxxxxxxxxxxxIIENGEASMANASMVDMQQTVTRLMSQCNEKAFELEIKSADxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxKSAGSSGQGTSDEYxxxxxxxxxxxxxxxxxxxxxxxxxxxxNSGLHVQNQKLAEEASYAKELASAAAVExxxxxxxxxxxxxxxxxxxxxxxxxxxxMHSRGAAMQTVNGVNRKYSDGMKAGRKGRLSGRSTEISGVVSDDFDSWNLDPDDLKLELQAxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxLANMWVLVAKLKKEVGSVPELNTVERHSNGEDRVCDPKANETDCNTVLKDRHFLEVSKPADENSVERQVLDVPKPADETPKEEPLxxxxxxxxxxxxxxxxxxxxxGDPNSHMCKVCFESPTAAILLPCRHFCLCKSCSLACSECPICRTKISDRLFAFT
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query1102 2.2.26 [Sep-21-2011]
Q6S001685 Kinesin-related protein 1 yes no 0.332 0.534 0.522 1e-102
Q54NP8 1922 Kinesin-related protein 4 no no 0.313 0.179 0.478 2e-89
Q6RT24 2474 Centromere-associated pro yes no 0.313 0.139 0.455 6e-85
Q4R628702 Kinesin-like protein KIF3 N/A no 0.313 0.492 0.434 1e-67
Q5R4H3702 Kinesin-like protein KIF3 yes no 0.313 0.492 0.434 1e-67
Q9Y496699 Kinesin-like protein KIF3 yes no 0.313 0.494 0.434 2e-67
P28741701 Kinesin-like protein KIF3 no no 0.313 0.493 0.431 3e-67
P46872699 Kinesin-II 85 kDa subunit no no 0.321 0.506 0.416 7e-67
O60282957 Kinesin heavy chain isofo no no 0.296 0.341 0.434 4e-66
Q2PQA9963 Kinesin-1 heavy chain OS= no no 0.289 0.331 0.433 9e-66
>sp|Q6S001|KIF11_DICDI Kinesin-related protein 11 OS=Dictyostelium discoideum GN=kif11 PE=3 SV=1 Back     alignment and function desciption
 Score =  374 bits (960), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 199/381 (52%), Positives = 272/381 (71%), Gaps = 15/381 (3%)

Query: 139 ATAYAFDRVFGPHANSQEVYDVAARPVVKAAMEGVNGTVFAYGVTSSGKTHTMHGD-QNS 197
           + +Y +D +F P  ++ EVYD  AR +VK+AMEG N ++ AYG+TSSGKT TM G  + +
Sbjct: 114 SNSYTYDHLFPPTCDNYEVYDTVARELVKSAMEGYNASIMAYGITSSGKTFTMTGSGKKN 173

Query: 198 PGIIPLAIKDVFSIIQDTPGREFLLRVSYLEIYNEVINDLLDPTGQN--LRVRED-AQGT 254
           PGIIPL+I+D+F+ IQ+   REFLLRVSYLEIYNE +NDLL    +N  L++ E    G 
Sbjct: 174 PGIIPLSIQDIFTYIQECKEREFLLRVSYLEIYNETVNDLLGVNQENFNLKIHEHPVTGV 233

Query: 255 YVEGIKEEVVLSPGHALSFIAAGEEHRHVGSNNFNLLSSRSHTIFTLMIESSDHGDEYDG 314
           YV G+KEE+VLS  H LS I+AGE HRHVGS ++NL SSRSHTIF ++IES +   E  G
Sbjct: 234 YVAGLKEEIVLSVEHVLSLISAGEAHRHVGSTSYNLQSSRSHTIFKMIIESKEVLPEGSG 293

Query: 315 -------VIFSQLNLIDLAGSE-SSKTETTGLRRKEGSYINKSLLTLGTVIGKLSEGKAS 366
                  V +S LNLIDLAGSE +S++  + +R KEGSYINKSLLTLGTVI KLSE    
Sbjct: 294 SGGLESPVRYSTLNLIDLAGSEKASESTISAIRNKEGSYINKSLLTLGTVISKLSEKDTG 353

Query: 367 HVPYRDSKLTRLLQSSLSGHGHVSLICTVTPASSSMEETHNTLKFASRAKRVEIYASRNK 426
           ++PYRDSKLTR+LQ+SLSG+  V++ICT+T AS++ EE+HNTLKFASRAK++   A  N+
Sbjct: 354 YIPYRDSKLTRVLQNSLSGNSRVAIICTITLASNNFEESHNTLKFASRAKKISNNAKVNE 413

Query: 427 IIDEKSLIKKYQREISSLKEELDQLKRGILVGVSHEELMTLRQKLEEGQVKMQSRLEEEE 486
           I+D+K+L+K+Y+ EI+ LK +L      +      +E +T ++K++    ++  +L + E
Sbjct: 414 ILDDKALLKQYRNEIAELKSKLSD---ALSTEKELQETLTEKEKMKITNQELLHKLVDAE 470

Query: 487 EAKAALMSRIQRLTKLILVST 507
           + ++ L S+I  L KLILVST
Sbjct: 471 KHRSLLESKINNLNKLILVST 491




Microtubule-associated force-producing protein that plays a role in organelle transport. Its motor activity is directed toward the microtubule's plus end.
Dictyostelium discoideum (taxid: 44689)
>sp|Q54NP8|KIF4_DICDI Kinesin-related protein 4 OS=Dictyostelium discoideum GN=kif4 PE=2 SV=1 Back     alignment and function description
>sp|Q6RT24|CENPE_MOUSE Centromere-associated protein E OS=Mus musculus GN=Cenpe PE=1 SV=1 Back     alignment and function description
>sp|Q4R628|KIF3A_MACFA Kinesin-like protein KIF3A OS=Macaca fascicularis GN=KIF3A PE=2 SV=1 Back     alignment and function description
>sp|Q5R4H3|KIF3A_PONAB Kinesin-like protein KIF3A OS=Pongo abelii GN=KIF3A PE=2 SV=1 Back     alignment and function description
>sp|Q9Y496|KIF3A_HUMAN Kinesin-like protein KIF3A OS=Homo sapiens GN=KIF3A PE=1 SV=4 Back     alignment and function description
>sp|P28741|KIF3A_MOUSE Kinesin-like protein KIF3A OS=Mus musculus GN=Kif3a PE=1 SV=2 Back     alignment and function description
>sp|P46872|KRP85_STRPU Kinesin-II 85 kDa subunit OS=Strongylocentrotus purpuratus GN=KRP85 PE=1 SV=1 Back     alignment and function description
>sp|O60282|KIF5C_HUMAN Kinesin heavy chain isoform 5C OS=Homo sapiens GN=KIF5C PE=1 SV=1 Back     alignment and function description
>sp|Q2PQA9|KINH_RAT Kinesin-1 heavy chain OS=Rattus norvegicus GN=Kif5b PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1102
2254277281079 PREDICTED: uncharacterized protein LOC10 0.957 0.977 0.799 0.0
2240804181067 predicted protein [Populus trichocarpa] 0.947 0.978 0.797 0.0
1478644021082 hypothetical protein VITISV_007231 [Viti 0.956 0.974 0.793 0.0
2241033431000 predicted protein [Populus trichocarpa] 0.894 0.986 0.826 0.0
2977447521046 unnamed protein product [Vitis vinifera] 0.926 0.976 0.786 0.0
3574734571107 Kinesin heavy chain-like protein [Medica 0.969 0.964 0.734 0.0
2555438191032 kinesin heavy chain, putative [Ricinus c 0.907 0.968 0.787 0.0
3565387241086 PREDICTED: uncharacterized protein LOC10 0.967 0.981 0.748 0.0
4494648541130 PREDICTED: chromosome-associated kinesin 0.970 0.946 0.739 0.0
2977978901055 hypothetical protein ARALYDRAFT_327857 [ 0.923 0.964 0.748 0.0
>gi|225427728|ref|XP_002265593.1| PREDICTED: uncharacterized protein LOC100253714 [Vitis vinifera] Back     alignment and taxonomy information
 Score = 1724 bits (4465), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 881/1102 (79%), Positives = 961/1102 (87%), Gaps = 47/1102 (4%)

Query: 12   PFSYRKPVTPYSSTSSTSSSFMNNRLMPRSCSTSASSYF-NSGNGLGSRSMTPSRSCSDS 70
            PF YRKP +   S+SS+SSSFMN +LMPRSCS+SASS+  NSGNGLGSRS+TPSR   DS
Sbjct: 13   PFHYRKPSS-PYSSSSSSSSFMNGKLMPRSCSSSASSFLNNSGNGLGSRSITPSRGRVDS 71

Query: 71   MYNSPRA----PPVIFPSEELMAEPLDAPQRSGDSISVTIRFRPLSEREFQRGDEIAWYA 126
            MY  PR      PV F S+EL+ E +D P RSGDSISVTIRFRPLSEREFQRGDEIAW+A
Sbjct: 72   MYAGPRGYGSRTPVAFASDELIGELIDVP-RSGDSISVTIRFRPLSEREFQRGDEIAWFA 130

Query: 127  DGDKIVRNEYNPATAYAFDRVFGPHANSQEVYDVAARPVVKAAMEGVNGTVFAYGVTSSG 186
            DGDKIVRNEYNPATAYAFDRVFGP   SQ+VYDVAARPVVKAAMEG+NGTVFAYGVTSSG
Sbjct: 131  DGDKIVRNEYNPATAYAFDRVFGPSTGSQDVYDVAARPVVKAAMEGINGTVFAYGVTSSG 190

Query: 187  KTHTMHGDQNSPGIIPLAIKDVFSIIQDTPGREFLLRVSYLEIYNEVINDLLDPTGQNLR 246
            KTHTMHGDQNSPGIIPLAIKDVFSIIQDTPGREFLLRVSYLEIYNEVINDLLDPTGQNLR
Sbjct: 191  KTHTMHGDQNSPGIIPLAIKDVFSIIQDTPGREFLLRVSYLEIYNEVINDLLDPTGQNLR 250

Query: 247  VREDAQGTYVEGIKEEVVLSPGHALSFIAAGEEHRHVGSNNFNLLSSRSHTIFTLMIESS 306
            VREDAQGTYVEGIKEEVVLSPGHALSFIAAGEEHRHVGSNNFNLLSSRSHTIFTLMIESS
Sbjct: 251  VREDAQGTYVEGIKEEVVLSPGHALSFIAAGEEHRHVGSNNFNLLSSRSHTIFTLMIESS 310

Query: 307  DHGDEYDGVIFSQLNLIDLAGSESSKTETTGLRRKEGSYINKSLLTLGTVIGKLSEGKAS 366
            +HGDEYDGVIFSQLNLIDLAGSESSKTETTGLRRKEGSYINKSLLTLGTVIGKLSEG+AS
Sbjct: 311  NHGDEYDGVIFSQLNLIDLAGSESSKTETTGLRRKEGSYINKSLLTLGTVIGKLSEGRAS 370

Query: 367  HVPYRDSKLTRLLQSSLSGHGHVSLICTVTPASSSMEETHNTLKFASRAKRVEIYASRNK 426
            HVPYRDSKLTRLLQSSLSGHGHVSLICTVTPASS+MEETHNTLKFASRAKRVEIYASRNK
Sbjct: 371  HVPYRDSKLTRLLQSSLSGHGHVSLICTVTPASSNMEETHNTLKFASRAKRVEIYASRNK 430

Query: 427  IIDEKSLIKKYQREISSLKEELDQLKRGILVGVSHEELMTLRQKLEEGQVKMQSRLEEEE 486
            IIDEKSLIKKYQREIS+LKEELDQL+RG+LVGVSHEE+++LRQ+LEEGQVKMQSRLEEEE
Sbjct: 431  IIDEKSLIKKYQREISTLKEELDQLRRGMLVGVSHEEIISLRQQLEEGQVKMQSRLEEEE 490

Query: 487  EAKAALMSRIQRLTKLILVSTKNTIPG-LSDVPNHQRSHSVGEDD-LDLLREGSLLLDGE 544
            EAKAALMSRIQRLTKLILVSTKNT+PG L D  +HQRSHSVGEDD LD++REG L  + E
Sbjct: 491  EAKAALMSRIQRLTKLILVSTKNTLPGCLGDAVSHQRSHSVGEDDKLDVIREGPLPAENE 550

Query: 545  NQKDSTSSASGLASDLPSDFKHRRSSSKWNEEFSPTSSTVTESTQAGELISGSKHPIGGM 604
            NQKDS SSA  + SDL  DF+HRRSSSKWNEE SP SST                  GGM
Sbjct: 551  NQKDSPSSALAIPSDLTCDFRHRRSSSKWNEELSPASST------------------GGM 592

Query: 605  T-SDQMDLLVEQVKMLAGEIAFSSSNLKRLVDQSVNDPDGSKVQIQNLEREIQEKRRQMR 663
            T SDQMDLLVEQVKMLAGEIAFS+S LKRL++QSVNDPDGSK QIQNLE E+QEK+RQMR
Sbjct: 593  TMSDQMDLLVEQVKMLAGEIAFSTSTLKRLMEQSVNDPDGSKTQIQNLEHELQEKKRQMR 652

Query: 664  ILEQRIIENGEASMANASMVDMQQTVTRLMSQCNEKAFELEIKSADNRILQEQLQNKCSE 723
            ILEQR++E GEAS ANASMVDMQQTV +LM+QC+EK FELEIK+ADNR+LQEQLQNKC+E
Sbjct: 653  ILEQRMMETGEASFANASMVDMQQTVMKLMTQCSEKGFELEIKTADNRVLQEQLQNKCAE 712

Query: 724  NKKLQEKVNLLEQQLACQNGDKSAGSSGQGTSDEYVDELRKKVQSQETENEKLKLEHVQL 783
            N +LQ+KV+LL+QQL+     K + SS QG S++Y+DEL+KKVQSQE ENEKLKLE VQ+
Sbjct: 713  NMELQQKVDLLQQQLSSGTVQKLSLSSEQGVSEDYIDELKKKVQSQEIENEKLKLEQVQI 772

Query: 784  SEENSGLHVQNQKLAEEASYAKELASAAAVELKNLAGEVTKLSLQNAKLEKELLAARESM 843
             EENSGL VQNQKL+EEASYAKELASAAAVELKNLAGEVTK+SLQN KLEKEL+AARE  
Sbjct: 773  LEENSGLRVQNQKLSEEASYAKELASAAAVELKNLAGEVTKISLQNTKLEKELIAARELA 832

Query: 844  HSRGAAMQTVNGVNRKYSDGMKAGRKGRLSGRSTEISGVVSDDFDSWNLDPDDLKLELQA 903
            HSRG+ +Q  N  NRKYSD  K GRKGRL GR+ +ISG V DDF+ WNLDPDDLK+ELQA
Sbjct: 833  HSRGSNLQASNNGNRKYSDSAKPGRKGRLPGRANDISGAVYDDFELWNLDPDDLKMELQA 892

Query: 904  RKQREAALEAALAEKEFLEDEYRKKVEESKRREEALENDLANMWVLVAKLKKEVGSVPEL 963
            RKQRE ALEAALA+KE +ED+YRKK+EE+K+RE ALENDLANMWVLVA+LKKE G++PE 
Sbjct: 893  RKQREMALEAALADKELVEDDYRKKLEEAKKRESALENDLANMWVLVAQLKKEGGAIPES 952

Query: 964  NTVERHSNGEDRVCD--PKANETDC-NTVLKDRHFLEVSKPADENSVERQVLDVPKPADE 1020
            NT ERH N  D V D  PK +++D  NTVLK                E QV DV +PA +
Sbjct: 953  NTDERHPNELDHVNDLNPKIDDSDSKNTVLK----------------EMQVPDVMRPAHD 996

Query: 1021 TPKEEPLVARLKARMQEMKEKEQKYQGNGDPNSHMCKVCFESPTAAILLPCRHFCLCKSC 1080
             PKEEPLVARLKARMQEMKEKEQKY GNGD NSH+CKVCFESPTAAILLPCRHFCLC+SC
Sbjct: 997  IPKEEPLVARLKARMQEMKEKEQKYLGNGDANSHICKVCFESPTAAILLPCRHFCLCRSC 1056

Query: 1081 SLACSECPICRTKISDRLFAFT 1102
            SLACSECPICRTKI+DR FAFT
Sbjct: 1057 SLACSECPICRTKIADRFFAFT 1078




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|224080418|ref|XP_002306132.1| predicted protein [Populus trichocarpa] gi|222849096|gb|EEE86643.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|147864402|emb|CAN80502.1| hypothetical protein VITISV_007231 [Vitis vinifera] Back     alignment and taxonomy information
>gi|224103343|ref|XP_002313019.1| predicted protein [Populus trichocarpa] gi|222849427|gb|EEE86974.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|297744752|emb|CBI38014.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|357473457|ref|XP_003607013.1| Kinesin heavy chain-like protein [Medicago truncatula] gi|355508068|gb|AES89210.1| Kinesin heavy chain-like protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|255543819|ref|XP_002512972.1| kinesin heavy chain, putative [Ricinus communis] gi|223547983|gb|EEF49475.1| kinesin heavy chain, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|356538724|ref|XP_003537851.1| PREDICTED: uncharacterized protein LOC100780424 [Glycine max] Back     alignment and taxonomy information
>gi|449464854|ref|XP_004150144.1| PREDICTED: chromosome-associated kinesin KIF4-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|297797890|ref|XP_002866829.1| hypothetical protein ARALYDRAFT_327857 [Arabidopsis lyrata subsp. lyrata] gi|297312665|gb|EFH43088.1| hypothetical protein ARALYDRAFT_327857 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1102
TAIR|locus:21201871055 AT4G39050 [Arabidopsis thalian 0.682 0.712 0.607 2.4e-268
TAIR|locus:20500441058 AT2G21380 [Arabidopsis thalian 0.687 0.716 0.594 9.1e-219
TAIR|locus:2036987890 AT1G21730 [Arabidopsis thalian 0.410 0.507 0.695 3.3e-195
TAIR|locus:2144103986 AT5G06670 [Arabidopsis thalian 0.397 0.444 0.665 3e-181
DICTYBASE|DDB_G0291039685 kif11 "kinesin-7" [Dictyosteli 0.332 0.534 0.519 3.1e-102
UNIPROTKB|O42263 2954 cenpe "Kinesin-related protein 0.315 0.117 0.479 1.9e-92
DICTYBASE|DDB_G0285101 1922 kif4 "kinesin-7" [Dictyosteliu 0.313 0.179 0.478 4.2e-88
UNIPROTKB|E1BQJ6 2616 E1BQJ6 "Uncharacterized protei 0.337 0.142 0.450 2.4e-86
RGD|1307115 1968 Cenpe "centromere protein E" [ 0.314 0.176 0.462 1.3e-84
UNIPROTKB|I3LRD3 2501 CENPE "Uncharacterized protein 0.356 0.157 0.416 6.8e-84
TAIR|locus:2120187 AT4G39050 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 2142 (759.1 bits), Expect = 2.4e-268, Sum P(3) = 2.4e-268
 Identities = 476/784 (60%), Positives = 563/784 (71%)

Query:    21 PYXXXXXXXXXFMNNRLMPRSCSTSASSYFNSGNGLGSRSMTPSRSCSDS-MYNSPR--- 76
             P           ++NRL+PRS STSASS   S  G+ SRSMTPSR+ SDS +  S     
Sbjct:    13 PPSPASSTSSSHLSNRLIPRSNSTSASSLITSAAGIASRSMTPSRTFSDSGLIGSGSFGI 72

Query:    77 APPVIFPSEELMAEPLDAPQRSG-DSISVTIRFRPLSEREFQRGDEIAWYADGDKIVRNE 135
               PV +PSEEL+ +P+D    S  DSISVT+RFRPLS+RE+QRGDE+AWY DGD +VR+E
Sbjct:    73 GSPVPYPSEELLGDPMDDTISSERDSISVTVRFRPLSDREYQRGDEVAWYPDGDTLVRHE 132

Query:   136 YNPATAYAFDRVFGPHANSQEVYDVAARPVVKAAMEGVNGTVFAYGVTSSGKTHTMHGDQ 195
             YNP TAYAFD+VFGP A + +VYDVAARPVVKAAMEGVNGTVFAYGVTSSGKTHTMHGDQ
Sbjct:   133 YNPLTAYAFDKVFGPQATTIDVYDVAARPVVKAAMEGVNGTVFAYGVTSSGKTHTMHGDQ 192

Query:   196 NSPGIIPLAIKDVFSIIQDTPGREFLLRVSYLEIYNEVINDLLDPTGQNLRVREDAQGTY 255
              SPGIIPLAIKDVFSIIQDTPGREFLLRVSYLEIYNEVINDLLDPTGQNLRVRED+QGTY
Sbjct:   193 ESPGIIPLAIKDVFSIIQDTPGREFLLRVSYLEIYNEVINDLLDPTGQNLRVREDSQGTY 252

Query:   256 VEGIKEEVVLSPGHALSFIAAGEEHRHVGSNNFNLLSSRSHTIFTLMIESSDHGDEYDGV 315
             VEGIKEEVVLSPGHALSFIAAGEEHRHVGSNNFNLLSSRSHTIFTLM+ESS  GDEYDGV
Sbjct:   253 VEGIKEEVVLSPGHALSFIAAGEEHRHVGSNNFNLLSSRSHTIFTLMVESSATGDEYDGV 312

Query:   316 IFSQLNLIDLAGSESSKTETTGLRRKEGSYINKSLLTLGTVIGKLSEGKASHVPYRDSKL 375
             IFSQLNLIDLAGSESSKTETTGLRRKEGSYINKSLLTLGTVIGKLSEGKA+H+PYRDSKL
Sbjct:   313 IFSQLNLIDLAGSESSKTETTGLRRKEGSYINKSLLTLGTVIGKLSEGKATHIPYRDSKL 372

Query:   376 TRLLQSSLSGHGHVSLICTVTPASSSMEETHNTLKFASRAKRVEIYASRNKIIDEKSLIK 435
             TRLLQSSLSGHGHVSLICT+TPASSS EETHNTLKFASRAK +EIYASRN+IIDEKSLIK
Sbjct:   373 TRLLQSSLSGHGHVSLICTITPASSSSEETHNTLKFASRAKSIEIYASRNQIIDEKSLIK 432

Query:   436 KYQREISSLKEELDQLKRGILVGVSHEELMTLRQKLEEGQVKMQSRLXXXXXAKAALMSR 495
             KYQREIS+LK ELDQL+RG+LVGVSHEELM+L+Q+LEEGQVKMQSRL     AKAALMSR
Sbjct:   433 KYQREISTLKLELDQLRRGMLVGVSHEELMSLKQQLEEGQVKMQSRLEEEEEAKAALMSR 492

Query:   496 IQRLTKLILVSTKNTIPGLS-DVPNHQRSHSVXXXXXXXXXXXXXXXXXXNQKDSTSSAS 554
             IQ+LTKLILVSTKN+IPG S D+P HQRS S                   +   S SS  
Sbjct:   493 IQKLTKLILVSTKNSIPGYSGDIPTHQRSLSAGKDDKFDSLLLES-----DNLGSPSSTL 547

Query:   555 GLASDLPSDFKHRRSSSKWNEEFSPTSSTVTESTQAGELISGSKHPIGGMTSDQMDLLVE 614
              L S+    F HRRSSSK N+E SP  +  T+     + I      +  M + ++     
Sbjct:   548 ALLSEGSLGFNHRRSSSKLNDENSP-GAEFTQGVMTPDEIDLLVEQVK-MLAGEIAFSTS 605

Query:   615 QVKMLAGEIAFSSSNLKRLVDQSVNDPDGSKVQIQNLEREIQEKRRQMRILEQRIIENGE 674
              +K L  +      N +  +     +    + Q++ LE+ I E   +  I    ++E  +
Sbjct:   606 TLKRLVDQSVNDPENSQTQIQNLEREIHEKQRQMRGLEQLIIESG-EASIANASLVEMQQ 664

Query:   675 ASMANASMVDMQQTVTRLMSQCNEKAFE-LEIKSADNRILQEQLQNKCSENKKLQEKVNL 733
               M+  +  + +     + S  N    E L+ K  +N+ L E++         L++++N 
Sbjct:   665 KVMSLMTQCNEKSFELEIKSADNCILQEQLQEKCTENKELHEKVN-------LLEQRLNA 717

Query:   734 LEQQLA---CQN----GDKSAGSSGQGTSDEYV-DELR-KKVQSQETENEKLKLEHVQLS 784
             +  + +   C N    G+ +     +  S E   +EL+ + VQ  E EN  L++++ +L+
Sbjct:   718 VSSEKSSPSCSNKAVSGEYADELKKKIQSQEIENEELKLEHVQIVE-ENSGLRVQNQKLA 776

Query:   785 EENS 788
             EE S
Sbjct:   777 EEAS 780


GO:0003777 "microtubule motor activity" evidence=IEA;ISS
GO:0005524 "ATP binding" evidence=IEA
GO:0007018 "microtubule-based movement" evidence=IEA
GO:0008270 "zinc ion binding" evidence=IEA
GO:0009507 "chloroplast" evidence=ISM
GO:0031347 "regulation of defense response" evidence=IMP
TAIR|locus:2050044 AT2G21380 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2036987 AT1G21730 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2144103 AT5G06670 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0291039 kif11 "kinesin-7" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
UNIPROTKB|O42263 cenpe "Kinesin-related protein" [Xenopus laevis (taxid:8355)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0285101 kif4 "kinesin-7" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
UNIPROTKB|E1BQJ6 E1BQJ6 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
RGD|1307115 Cenpe "centromere protein E" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|I3LRD3 CENPE "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1102
cd01374321 cd01374, KISc_CENP_E, Kinesin motor domain, CENP-E 1e-179
pfam00225326 pfam00225, Kinesin, Kinesin motor domain 1e-130
smart00129335 smart00129, KISc, Kinesin motor, catalytic domain 1e-119
cd00106328 cd00106, KISc, Kinesin motor domain 1e-118
cd01369325 cd01369, KISc_KHC_KIF5, Kinesin motor domain, kine 1e-102
cd01371333 cd01371, KISc_KIF3, Kinesin motor domain, kinesins 7e-95
cd01372341 cd01372, KISc_KIF4, Kinesin motor domain, KIF4-lik 7e-94
cd01370338 cd01370, KISc_KIP3_like, Kinesin motor domain, KIP 3e-92
cd01364352 cd01364, KISc_BimC_Eg5, Kinesin motor domain, BimC 5e-88
cd01365356 cd01365, KISc_KIF1A_KIF1B, Kinesin motor domain, K 3e-86
cd01366329 cd01366, KISc_C_terminal, Kinesin motor domain, KI 2e-85
cd01373337 cd01373, KISc_KLP2_like, Kinesin motor domain, KLP 2e-81
COG5059568 COG5059, KIP1, Kinesin-like protein [Cytoskeleton] 1e-74
cd01368345 cd01368, KISc_KIF23_like, Kinesin motor domain, KI 7e-74
cd01367322 cd01367, KISc_KIF2_like, Kinesin motor domain, KIF 3e-71
cd01376319 cd01376, KISc_KID_like, Kinesin motor domain, KIF2 4e-70
cd01375334 cd01375, KISc_KIF9_like, Kinesin motor domain, KIF 2e-68
PLN03188 1320 PLN03188, PLN03188, kinesin-12 family protein; Pro 6e-56
cd01363186 cd01363, Motor_domain, Myosin and Kinesin motor do 7e-23
pfam1392049 pfam13920, zf-C3HC4_3, Zinc finger, C3HC4 type (RI 2e-17
TIGR021681179 TIGR02168, SMC_prok_B, chromosome segregation prot 4e-10
cd01363186 cd01363, Motor_domain, Myosin and Kinesin motor do 9e-10
TIGR02168 1179 TIGR02168, SMC_prok_B, chromosome segregation prot 1e-09
pfam1392345 pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RI 1e-08
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 3e-08
COG11961163 COG1196, Smc, Chromosome segregation ATPases [Cell 1e-07
cd0016245 cd00162, RING, RING-finger (Really Interesting New 3e-07
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 9e-07
pfam1363946 pfam13639, zf-RING_2, Ring finger domain 4e-06
TIGR02169 1164 TIGR02169, SMC_prok_A, chromosome segregation prot 5e-06
TIGR02168 1179 TIGR02168, SMC_prok_B, chromosome segregation prot 1e-05
smart0018440 smart00184, RING, Ring finger 3e-05
TIGR02169 1164 TIGR02169, SMC_prok_A, chromosome segregation prot 1e-04
TIGR021691164 TIGR02169, SMC_prok_A, chromosome segregation prot 1e-04
TIGR021691164 TIGR02169, SMC_prok_A, chromosome segregation prot 1e-04
COG4372499 COG4372, COG4372, Uncharacterized protein conserve 2e-04
COG2433652 COG2433, COG2433, Uncharacterized conserved protei 4e-04
COG0419 908 COG0419, SbcC, ATPase involved in DNA repair [DNA 0.001
pfam03961450 pfam03961, DUF342, Protein of unknown function (DU 0.002
pfam05557 722 pfam05557, MAD, Mitotic checkpoint protein 0.003
TIGR02169 1164 TIGR02169, SMC_prok_A, chromosome segregation prot 0.004
>gnl|CDD|238670 cd01374, KISc_CENP_E, Kinesin motor domain, CENP-E/KIP2-like subgroup, involved in chromosome movement and/or spindle elongation during mitosis Back     alignment and domain information
 Score =  525 bits (1354), Expect = e-179
 Identities = 198/322 (61%), Positives = 238/322 (73%), Gaps = 5/322 (1%)

Query: 101 SISVTIRFRPLSEREFQRGDEIAWYADGDK-IVRNEYNPATAYAFDRVFGPHANSQEVYD 159
            I V++R RPL+ RE    +++AW  D D  I   E  P  ++ FDRVFG  + ++EVY+
Sbjct: 1   KIKVSVRVRPLNPRE-SDNEQVAWSIDNDNTISLEESTPGQSFTFDRVFGGESTNREVYE 59

Query: 160 VAARPVVKAAMEGVNGTVFAYGVTSSGKTHTMHGDQNSPGIIPLAIKDVFSIIQDTPGRE 219
             A+PVV++A+EG NGT+FAYG TSSGKT TM GD+  PGIIPLA++D+F  IQDTP RE
Sbjct: 60  RIAKPVVRSALEGYNGTIFAYGQTSSGKTFTMSGDEQEPGIIPLAVRDIFQRIQDTPDRE 119

Query: 220 FLLRVSYLEIYNEVINDLLDPTGQNLRVREDAQ-GTYVEGIKEEVVLSPGHALSFIAAGE 278
           FLLRVSYLEIYNE I DLL P+ Q LR+RED   G  V G+ EE+V SP H L  IA GE
Sbjct: 120 FLLRVSYLEIYNEKIKDLLSPSPQELRIREDPNKGVVVAGLTEEIVTSPEHLLQLIARGE 179

Query: 279 EHRHVGSNNFNLLSSRSHTIFTLMIESSDHGDEYDG-VIFSQLNLIDLAGSESSKTETTG 337
           ++RHVG  +FN  SSRSHTIF L IES + GD   G V  S LNLIDLAGSE +     G
Sbjct: 180 KNRHVGETDFNERSSRSHTIFQLTIESRERGDSESGTVRVSTLNLIDLAGSERASQTGAG 239

Query: 338 LRRKEGSYINKSLLTLGTVIGKLSEGKAS-HVPYRDSKLTRLLQSSLSGHGHVSLICTVT 396
            RRKEGS+INKSLLTLGTVI KLSEGK S H+PYRDSKLTR+LQ SLSG+   ++ICT++
Sbjct: 240 ERRKEGSFINKSLLTLGTVISKLSEGKNSGHIPYRDSKLTRILQPSLSGNARTAIICTIS 299

Query: 397 PASSSMEETHNTLKFASRAKRV 418
           PASS +EET NTLKFASRAK+V
Sbjct: 300 PASSHVEETLNTLKFASRAKKV 321


This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Kinesins are microtubule-dependent molecular motors that play important roles in intracellular transport and in cell division. In most kinesins, the motor domain is found at the N-terminus (N-type). N-type kinesins are (+) end-directed motors, i.e. they transport cargo towards the (+) end of the microtubule. Kinesin motor domains hydrolyze ATP at a rate of about 80 per second, and move along the microtubule at a speed of about 6400 Angstroms per second. To achieve that, kinesin head groups work in pairs. Upon replacing ADP with ATP, a kinesin motor domain increases its affinity for microtubule binding and locks in place. Also, the neck linker binds to the motor domain, which repositions the other head domain through the coiled-coil domain close to a second tubulin dimer, about 80 Angstroms along the microtubule. Meanwhile, ATP hydrolysis takes place, and when the second head domain binds to the microtubule, the first domain again replaces ADP with ATP, triggering a conformational change that pulls the first domain forward. Length = 321

>gnl|CDD|215803 pfam00225, Kinesin, Kinesin motor domain Back     alignment and domain information
>gnl|CDD|214526 smart00129, KISc, Kinesin motor, catalytic domain Back     alignment and domain information
>gnl|CDD|238054 cd00106, KISc, Kinesin motor domain Back     alignment and domain information
>gnl|CDD|238665 cd01369, KISc_KHC_KIF5, Kinesin motor domain, kinesin heavy chain (KHC) or KIF5-like subgroup Back     alignment and domain information
>gnl|CDD|238667 cd01371, KISc_KIF3, Kinesin motor domain, kinesins II or KIF3_like proteins Back     alignment and domain information
>gnl|CDD|238668 cd01372, KISc_KIF4, Kinesin motor domain, KIF4-like subfamily Back     alignment and domain information
>gnl|CDD|238666 cd01370, KISc_KIP3_like, Kinesin motor domain, KIP3-like subgroup Back     alignment and domain information
>gnl|CDD|238660 cd01364, KISc_BimC_Eg5, Kinesin motor domain, BimC/Eg5 spindle pole proteins, participate in spindle assembly and chromosome segregation during cell division Back     alignment and domain information
>gnl|CDD|238661 cd01365, KISc_KIF1A_KIF1B, Kinesin motor domain, KIF1_like proteins Back     alignment and domain information
>gnl|CDD|238662 cd01366, KISc_C_terminal, Kinesin motor domain, KIFC2/KIFC3/ncd-like carboxy-terminal kinesins Back     alignment and domain information
>gnl|CDD|238669 cd01373, KISc_KLP2_like, Kinesin motor domain, KLP2-like subgroup Back     alignment and domain information
>gnl|CDD|227392 COG5059, KIP1, Kinesin-like protein [Cytoskeleton] Back     alignment and domain information
>gnl|CDD|238664 cd01368, KISc_KIF23_like, Kinesin motor domain, KIF23-like subgroup Back     alignment and domain information
>gnl|CDD|238663 cd01367, KISc_KIF2_like, Kinesin motor domain, KIF2-like group Back     alignment and domain information
>gnl|CDD|238672 cd01376, KISc_KID_like, Kinesin motor domain, KIF22/Kid-like subgroup Back     alignment and domain information
>gnl|CDD|238671 cd01375, KISc_KIF9_like, Kinesin motor domain, KIF9-like subgroup; might play a role in cell shape remodeling Back     alignment and domain information
>gnl|CDD|215621 PLN03188, PLN03188, kinesin-12 family protein; Provisional Back     alignment and domain information
>gnl|CDD|238659 cd01363, Motor_domain, Myosin and Kinesin motor domain Back     alignment and domain information
>gnl|CDD|222454 pfam13920, zf-C3HC4_3, Zinc finger, C3HC4 type (RING finger) Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|238659 cd01363, Motor_domain, Myosin and Kinesin motor domain Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|206094 pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RING finger) Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|238093 cd00162, RING, RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|222279 pfam13639, zf-RING_2, Ring finger domain Back     alignment and domain information
>gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|214546 smart00184, RING, Ring finger Back     alignment and domain information
>gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>gnl|CDD|226809 COG4372, COG4372, Uncharacterized protein conserved in bacteria with the myosin-like domain [Function unknown] Back     alignment and domain information
>gnl|CDD|225288 COG2433, COG2433, Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|217817 pfam03961, DUF342, Protein of unknown function (DUF342) Back     alignment and domain information
>gnl|CDD|218636 pfam05557, MAD, Mitotic checkpoint protein Back     alignment and domain information
>gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 1102
KOG02431041 consensus Kinesin-like protein [Cytoskeleton] 100.0
KOG0245 1221 consensus Kinesin-like protein [Cytoskeleton] 100.0
PLN03188 1320 kinesin-12 family protein; Provisional 100.0
KOG4280574 consensus Kinesin-like protein [Cytoskeleton] 100.0
KOG0242675 consensus Kinesin-like protein [Cytoskeleton] 100.0
KOG0240607 consensus Kinesin (SMY1 subfamily) [Cytoskeleton] 100.0
KOG0241 1714 consensus Kinesin-like protein [Cytoskeleton] 100.0
cd01373337 KISc_KLP2_like Kinesin motor domain, KLP2-like sub 100.0
cd01370338 KISc_KIP3_like Kinesin motor domain, KIP3-like sub 100.0
cd01368345 KISc_KIF23_like Kinesin motor domain, KIF23-like s 100.0
cd01365356 KISc_KIF1A_KIF1B Kinesin motor domain, KIF1_like p 100.0
cd01374321 KISc_CENP_E Kinesin motor domain, CENP-E/KIP2-like 100.0
cd01371333 KISc_KIF3 Kinesin motor domain, kinesins II or KIF 100.0
cd01367322 KISc_KIF2_like Kinesin motor domain, KIF2-like gro 100.0
cd01364352 KISc_BimC_Eg5 Kinesin motor domain, BimC/Eg5 spind 100.0
cd01369325 KISc_KHC_KIF5 Kinesin motor domain, kinesin heavy 100.0
cd01376319 KISc_KID_like Kinesin motor domain, KIF22/Kid-like 100.0
cd01375334 KISc_KIF9_like Kinesin motor domain, KIF9-like sub 100.0
cd01372341 KISc_KIF4 Kinesin motor domain, KIF4-like subfamil 100.0
cd01366329 KISc_C_terminal Kinesin motor domain, KIFC2/KIFC3/ 100.0
KOG0239670 consensus Kinesin (KAR3 subfamily) [Cytoskeleton] 100.0
smart00129335 KISc Kinesin motor, catalytic domain. ATPase. Micr 100.0
cd00106328 KISc Kinesin motor domain. This catalytic (head) d 100.0
PF00225335 Kinesin: Kinesin motor domain; InterPro: IPR001752 100.0
KOG0244913 consensus Kinesin-like protein [Cytoskeleton] 100.0
KOG0246676 consensus Kinesin-like protein [Cytoskeleton] 100.0
KOG0247809 consensus Kinesin-like protein [Cytoskeleton] 100.0
COG5059568 KIP1 Kinesin-like protein [Cytoskeleton] 100.0
cd01363186 Motor_domain Myosin and Kinesin motor domain. Thes 100.0
KOG0978698 consensus E3 ubiquitin ligase involved in syntaxin 99.55
KOG0612 1317 consensus Rho-associated, coiled-coil containing p 99.47
KOG4265349 consensus Predicted E3 ubiquitin ligase [Posttrans 99.25
KOG417262 consensus Predicted E3 ubiquitin ligase [Posttrans 99.04
KOG4275350 consensus Predicted E3 ubiquitin ligase [Posttrans 98.88
KOG1571355 consensus Predicted E3 ubiquitin ligase [Posttrans 98.79
PF1392050 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); 98.78
KOG1100207 consensus Predicted E3 ubiquitin ligase [Posttrans 98.39
PF07888546 CALCOCO1: Calcium binding and coiled-coil domain ( 98.28
KOG0823 230 consensus Predicted E3 ubiquitin ligase [Posttrans 98.26
TIGR02169 1164 SMC_prok_A chromosome segregation protein SMC, pri 98.15
TIGR02169 1164 SMC_prok_A chromosome segregation protein SMC, pri 98.0
PLN03208 193 E3 ubiquitin-protein ligase RMA2; Provisional 97.96
TIGR02168 1179 SMC_prok_B chromosome segregation protein SMC, com 97.88
TIGR021681179 SMC_prok_B chromosome segregation protein SMC, com 97.87
KOG09961293 consensus Structural maintenance of chromosome pro 97.85
KOG4673 961 consensus Transcription factor TMF, TATA element m 97.85
KOG0320187 consensus Predicted E3 ubiquitin ligase [Posttrans 97.84
KOG0317293 consensus Predicted E3 ubiquitin ligase, integral 97.83
PF07888546 CALCOCO1: Calcium binding and coiled-coil domain ( 97.81
PF10174 775 Cast: RIM-binding protein of the cytomatrix active 97.78
KOG0161 1930 consensus Myosin class II heavy chain [Cytoskeleto 97.77
COG5059568 KIP1 Kinesin-like protein [Cytoskeleton] 97.69
KOG0963629 consensus Transcription factor/CCAAT displacement 97.65
KOG0971 1243 consensus Microtubule-associated protein dynactin 97.62
PHA02929238 N1R/p28-like protein; Provisional 97.61
PRK03918880 chromosome segregation protein; Provisional 97.6
COG11961163 Smc Chromosome segregation ATPases [Cell division 97.6
KOG2164 513 consensus Predicted E3 ubiquitin ligase [Posttrans 97.58
PF1463444 zf-RING_5: zinc-RING finger domain 97.52
PF1392339 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); 97.52
TIGR006061311 rad50 rad50. This family is based on the phylogeno 97.49
PRK02224880 chromosome segregation protein; Provisional 97.46
KOG0161 1930 consensus Myosin class II heavy chain [Cytoskeleto 97.46
COG11961163 Smc Chromosome segregation ATPases [Cell division 97.45
PF15070617 GOLGA2L5: Putative golgin subfamily A member 2-lik 97.45
PF09730717 BicD: Microtubule-associated protein Bicaudal-D; I 97.45
KOG0971 1243 consensus Microtubule-associated protein dynactin 97.43
COG1579239 Zn-ribbon protein, possibly nucleic acid-binding [ 97.43
PRK11637428 AmiB activator; Provisional 97.42
PF0882661 DMPK_coil: DMPK coiled coil domain like; InterPro: 97.42
KOG4674 1822 consensus Uncharacterized conserved coiled-coil pr 97.42
TIGR006061311 rad50 rad50. This family is based on the phylogeno 97.4
KOG09331174 consensus Structural maintenance of chromosome pro 97.39
PF12128 1201 DUF3584: Protein of unknown function (DUF3584); In 97.35
KOG0995581 consensus Centromere-associated protein HEC1 [Cell 97.34
PHA02562562 46 endonuclease subunit; Provisional 97.29
PRK02224880 chromosome segregation protein; Provisional 97.27
PRK04863 1486 mukB cell division protein MukB; Provisional 97.24
COG5574271 PEX10 RING-finger-containing E3 ubiquitin ligase [ 97.23
PF1363944 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 97.22
KOG0976 1265 consensus Rho/Rac1-interacting serine/threonine ki 97.18
PF09726697 Macoilin: Transmembrane protein; InterPro: IPR0191 97.18
TIGR00599 397 rad18 DNA repair protein rad18. This family is bas 97.18
KOG09941758 consensus Extracellular matrix glycoprotein Lamini 97.15
PHA02926242 zinc finger-like protein; Provisional 97.14
KOG09331174 consensus Structural maintenance of chromosome pro 97.08
KOG4674 1822 consensus Uncharacterized conserved coiled-coil pr 97.07
COG5185622 HEC1 Protein involved in chromosome segregation, i 97.06
PF14662193 CCDC155: Coiled-coil region of CCDC155 97.04
KOG1785 563 consensus Tyrosine kinase negative regulator CBL [ 97.04
KOG0977546 consensus Nuclear envelope protein lamin, intermed 97.04
smart0018439 RING Ring finger. E3 ubiquitin-protein ligase acti 96.95
cd0016245 RING RING-finger (Really Interesting New Gene) dom 96.92
PF12128 1201 DUF3584: Protein of unknown function (DUF3584); In 96.91
KOG4643 1195 consensus Uncharacterized coiled-coil protein [Fun 96.91
COG5432 391 RAD18 RING-finger-containing E3 ubiquitin ligase [ 96.9
KOG0996 1293 consensus Structural maintenance of chromosome pro 96.89
KOG0287 442 consensus Postreplication repair protein RAD18 [Re 96.86
COG4372499 Uncharacterized protein conserved in bacteria with 96.85
PRK11637428 AmiB activator; Provisional 96.84
PF15070 617 GOLGA2L5: Putative golgin subfamily A member 2-lik 96.83
PF1522742 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 96.82
PF1444755 Prok-RING_4: Prokaryotic RING finger family 4 96.81
PF00261237 Tropomyosin: Tropomyosin; InterPro: IPR000533 Trop 96.76
PRK03918 880 chromosome segregation protein; Provisional 96.75
PRK04863 1486 mukB cell division protein MukB; Provisional 96.73
KOG0612 1317 consensus Rho-associated, coiled-coil containing p 96.72
PF05701522 WEMBL: Weak chloroplast movement under blue light; 96.71
COG4942420 Membrane-bound metallopeptidase [Cell division and 96.71
PF0009741 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I 96.71
smart0050463 Ubox Modified RING finger domain. Modified RING fi 96.62
PF05701522 WEMBL: Weak chloroplast movement under blue light; 96.61
PF04849306 HAP1_N: HAP1 N-terminal conserved region; InterPro 96.6
KOG0250 1074 consensus DNA repair protein RAD18 (SMC family pro 96.58
KOG0977546 consensus Nuclear envelope protein lamin, intermed 96.55
KOG0980 980 consensus Actin-binding protein SLA2/Huntingtin-in 96.43
KOG4692489 consensus Predicted E3 ubiquitin ligase [Posttrans 96.42
KOG0976 1265 consensus Rho/Rac1-interacting serine/threonine ki 96.41
PF09755310 DUF2046: Uncharacterized conserved protein H4 (DUF 96.36
PF00038312 Filament: Intermediate filament protein; InterPro: 96.36
PF10174775 Cast: RIM-binding protein of the cytomatrix active 96.34
PHA02562562 46 endonuclease subunit; Provisional 96.31
KOG4643 1195 consensus Uncharacterized coiled-coil protein [Fun 96.28
KOG0946970 consensus ER-Golgi vesicle-tethering protein p115 96.28
PF1344543 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A. 96.21
PF09726697 Macoilin: Transmembrane protein; InterPro: IPR0191 96.2
COG5236 493 Uncharacterized conserved protein, contains RING Z 96.17
PF00261237 Tropomyosin: Tropomyosin; InterPro: IPR000533 Trop 96.16
KOG09941758 consensus Extracellular matrix glycoprotein Lamini 96.09
PF0864796 BRE1: BRE1 E3 ubiquitin ligase; InterPro: IPR01395 96.08
KOG0978698 consensus E3 ubiquitin ligase involved in syntaxin 95.99
PF09730 717 BicD: Microtubule-associated protein Bicaudal-D; I 95.99
PF1483565 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM 95.95
KOG0963629 consensus Transcription factor/CCAAT displacement 95.88
KOG1029 1118 consensus Endocytic adaptor protein intersectin [S 95.87
KOG0964 1200 consensus Structural maintenance of chromosome pro 95.87
TIGR03007498 pepcterm_ChnLen polysaccharide chain length determ 95.85
COG5152259 Uncharacterized conserved protein, contains RING a 95.84
KOG2177 386 consensus Predicted E3 ubiquitin ligase [Posttrans 95.81
PF05557 722 MAD: Mitotic checkpoint protein; InterPro: IPR0086 95.69
KOG1813313 consensus Predicted E3 ubiquitin ligase [Posttrans 95.67
COG5540374 RING-finger-containing ubiquitin ligase [Posttrans 95.61
PRK04778569 septation ring formation regulator EzrA; Provision 95.59
KOG1029 1118 consensus Endocytic adaptor protein intersectin [S 95.59
PRK09039343 hypothetical protein; Validated 95.55
KOG0999 772 consensus Microtubule-associated protein Bicaudal- 95.54
KOG0964 1200 consensus Structural maintenance of chromosome pro 95.54
KOG0250 1074 consensus DNA repair protein RAD18 (SMC family pro 95.49
KOG4593 716 consensus Mitotic checkpoint protein MAD1 [Cell cy 95.48
KOG0980 980 consensus Actin-binding protein SLA2/Huntingtin-in 95.42
PF05622713 HOOK: HOOK protein; InterPro: IPR008636 This famil 95.42
PF14915305 CCDC144C: CCDC144C protein coiled-coil region 95.35
PF06818202 Fez1: Fez1; InterPro: IPR009638 This family repres 95.32
KOG0239670 consensus Kinesin (KAR3 subfamily) [Cytoskeleton] 95.22
PF15066527 CAGE1: Cancer-associated gene protein 1 family 95.22
KOG4360596 consensus Uncharacterized coiled coil protein [Fun 95.19
PRK11281 1113 hypothetical protein; Provisional 95.19
PF05667594 DUF812: Protein of unknown function (DUF812); Inte 95.18
PF00038312 Filament: Intermediate filament protein; InterPro: 95.13
PRK09039343 hypothetical protein; Validated 95.12
KOG0249 916 consensus LAR-interacting protein and related prot 95.12
PF07926132 TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: 95.08
PF04849306 HAP1_N: HAP1 N-terminal conserved region; InterPro 94.9
PRK10929 1109 putative mechanosensitive channel protein; Provisi 94.79
COG4942420 Membrane-bound metallopeptidase [Cell division and 94.74
PF1267873 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 94.69
COG5243 491 HRD1 HRD ubiquitin ligase complex, ER membrane com 94.67
PRK11281 1113 hypothetical protein; Provisional 94.61
KOG0018 1141 consensus Structural maintenance of chromosome pro 94.59
PF09787511 Golgin_A5: Golgin subfamily A member 5; InterPro: 94.54
PF15619194 Lebercilin: Ciliary protein causing Leber congenit 94.41
PF12718143 Tropomyosin_1: Tropomyosin like; InterPro: IPR0005 94.27
PF09789319 DUF2353: Uncharacterized coiled-coil protein (DUF2 94.27
PF05622713 HOOK: HOOK protein; InterPro: IPR008636 This famil 94.24
KOG4360596 consensus Uncharacterized coiled coil protein [Fun 94.2
PF07058351 Myosin_HC-like: Myosin II heavy chain-like; InterP 94.2
KOG4687389 consensus Uncharacterized coiled-coil protein [Fun 94.16
COG1340294 Uncharacterized archaeal coiled-coil protein [Func 94.09
COG4372499 Uncharacterized protein conserved in bacteria with 94.08
PF06818202 Fez1: Fez1; InterPro: IPR009638 This family repres 94.06
KOG1853333 consensus LIS1-interacting protein NUDE [Cytoskele 94.02
KOG4673961 consensus Transcription factor TMF, TATA element m 94.0
COG1579239 Zn-ribbon protein, possibly nucleic acid-binding [ 93.99
PF05667594 DUF812: Protein of unknown function (DUF812); Inte 93.95
KOG0802 543 consensus E3 ubiquitin ligase [Posttranslational m 93.89
KOG2113394 consensus Predicted RNA binding protein, contains 93.82
PF05483786 SCP-1: Synaptonemal complex protein 1 (SCP-1); Int 93.78
PF07926132 TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: 93.75
PF06785401 UPF0242: Uncharacterised protein family (UPF0242); 93.71
KOG4159 398 consensus Predicted E3 ubiquitin ligase [Posttrans 93.7
KOG2879298 consensus Predicted E3 ubiquitin ligase [Posttrans 93.65
TIGR01843423 type_I_hlyD type I secretion membrane fusion prote 93.62
PF0456473 U-box: U-box domain; InterPro: IPR003613 Quality c 93.61
PRK10929 1109 putative mechanosensitive channel protein; Provisi 93.51
KOG0946970 consensus ER-Golgi vesicle-tethering protein p115 93.35
KOG0982502 consensus Centrosomal protein Nuf [Cell cycle cont 93.31
TIGR00634563 recN DNA repair protein RecN. All proteins in this 93.3
PF00308219 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013 93.3
PF15619194 Lebercilin: Ciliary protein causing Leber congenit 93.25
COG3096 1480 MukB Uncharacterized protein involved in chromosom 93.24
PF08614194 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR 93.24
COG5185622 HEC1 Protein involved in chromosome segregation, i 93.16
KOG0311 381 consensus Predicted E3 ubiquitin ligase [Posttrans 93.1
PRK01156895 chromosome segregation protein; Provisional 92.84
PF04641260 Rtf2: Rtf2 RING-finger 92.8
TIGR03017444 EpsF chain length determinant protein EpsF. Sequen 92.78
PF12325120 TMF_TATA_bd: TATA element modulatory factor 1 TATA 92.68
KOG09621294 consensus DNA repair protein RAD50, ABC-type ATPas 92.39
PF01576859 Myosin_tail_1: Myosin tail; InterPro: IPR002928 Mu 92.35
COG0556663 UvrB Helicase subunit of the DNA excision repair c 92.17
KOG4628348 consensus Predicted E3 ubiquitin ligase [Posttrans 92.05
PRK06893229 DNA replication initiation factor; Validated 91.87
KOG2129552 consensus Uncharacterized conserved protein H4 [Fu 91.81
PF06785401 UPF0242: Uncharacterised protein family (UPF0242); 91.76
KOG0249 916 consensus LAR-interacting protein and related prot 91.71
PRK14086617 dnaA chromosomal replication initiation protein; P 91.67
PRK06620214 hypothetical protein; Validated 91.66
PF01576 859 Myosin_tail_1: Myosin tail; InterPro: IPR002928 Mu 91.61
KOG0828636 consensus Predicted E3 ubiquitin ligase [Posttrans 91.53
KOG0999 772 consensus Microtubule-associated protein Bicaudal- 91.48
KOG1003205 consensus Actin filament-coating protein tropomyos 91.34
PF14662193 CCDC155: Coiled-coil region of CCDC155 91.32
PF14988206 DUF4515: Domain of unknown function (DUF4515) 91.18
COG2804500 PulE Type II secretory pathway, ATPase PulE/Tfp pi 91.16
TIGR01005754 eps_transp_fam exopolysaccharide transport protein 91.12
KOG0825 1134 consensus PHD Zn-finger protein [General function 91.12
KOG1001 674 consensus Helicase-like transcription factor HLTF/ 91.03
KOG0018 1141 consensus Structural maintenance of chromosome pro 90.97
KOG0979 1072 consensus Structural maintenance of chromosome pro 90.9
PF13851201 GAS: Growth-arrest specific micro-tubule binding 90.89
PF09789319 DUF2353: Uncharacterized coiled-coil protein (DUF2 90.87
COG3883265 Uncharacterized protein conserved in bacteria [Fun 90.86
PF10168717 Nup88: Nuclear pore component; InterPro: IPR019321 90.86
PF05483786 SCP-1: Synaptonemal complex protein 1 (SCP-1); Int 90.82
PF10212518 TTKRSYEDQ: Predicted coiled-coil domain-containing 90.8
PF15066527 CAGE1: Cancer-associated gene protein 1 family 90.8
PF12718143 Tropomyosin_1: Tropomyosin like; InterPro: IPR0005 90.65
COG3883265 Uncharacterized protein conserved in bacteria [Fun 90.65
TIGR03007498 pepcterm_ChnLen polysaccharide chain length determ 90.52
TIGR01005754 eps_transp_fam exopolysaccharide transport protein 90.49
PF03148384 Tektin: Tektin family; InterPro: IPR000435 Tektin 90.37
PF08172248 CASP_C: CASP C terminal; InterPro: IPR012955 This 89.97
KOG1039 344 consensus Predicted E3 ubiquitin ligase [Posttrans 89.88
PF06160560 EzrA: Septation ring formation regulator, EzrA ; I 89.86
TIGR03185650 DNA_S_dndD DNA sulfur modification protein DndD. T 89.83
PF08317325 Spc7: Spc7 kinetochore protein; InterPro: IPR01325 89.82
PF07111739 HCR: Alpha helical coiled-coil rod protein (HCR); 89.8
PRK10884206 SH3 domain-containing protein; Provisional 89.63
PRK10884206 SH3 domain-containing protein; Provisional 89.6
COG2805353 PilT Tfp pilus assembly protein, pilus retraction 89.59
KOG4807593 consensus F-actin binding protein, regulates actin 89.57
TIGR01000457 bacteriocin_acc bacteriocin secretion accessory pr 89.53
PF1286185 zf-Apc11: Anaphase-promoting complex subunit 11 RI 89.31
KOG1853333 consensus LIS1-interacting protein NUDE [Cytoskele 89.24
PF135141111 AAA_27: AAA domain 89.15
PRK10869553 recombination and repair protein; Provisional 88.86
KOG1814 445 consensus Predicted E3 ubiquitin ligase [Posttrans 88.51
KOG4302 660 consensus Microtubule-associated protein essential 88.41
PRK06835329 DNA replication protein DnaC; Validated 88.36
KOG3002 299 consensus Zn finger protein [General function pred 88.29
PF09728309 Taxilin: Myosin-like coiled-coil protein; InterPro 88.22
KOG0995581 consensus Centromere-associated protein HEC1 [Cell 88.21
PRK12377248 putative replication protein; Provisional 88.13
KOG0243 1041 consensus Kinesin-like protein [Cytoskeleton] 87.96
TIGR00634563 recN DNA repair protein RecN. All proteins in this 87.92
PRK08116268 hypothetical protein; Validated 87.9
PRK05642234 DNA replication initiation factor; Validated 87.66
PRK04778569 septation ring formation regulator EzrA; Provision 87.39
PF10481307 CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR0 87.37
KOG3039303 consensus Uncharacterized conserved protein [Funct 87.35
PRK08084235 DNA replication initiation factor; Provisional 87.3
COG0497557 RecN ATPase involved in DNA repair [DNA replicatio 87.27
TIGR02680 1353 conserved hypothetical protein TIGR02680. Members 87.19
PRK06526254 transposase; Provisional 87.02
PLN02939 977 transferase, transferring glycosyl groups 86.94
PRK14088440 dnaA chromosomal replication initiation protein; P 86.82
PF10473140 CENP-F_leu_zip: Leucine-rich repeats of kinetochor 86.79
PF05911 769 DUF869: Plant protein of unknown function (DUF869) 86.75
PF05557 722 MAD: Mitotic checkpoint protein; InterPro: IPR0086 86.71
PF12325120 TMF_TATA_bd: TATA element modulatory factor 1 TATA 86.61
PRK14087450 dnaA chromosomal replication initiation protein; P 86.59
TIGR01843423 type_I_hlyD type I secretion membrane fusion prote 86.56
PRK09087226 hypothetical protein; Validated 86.53
KOG4807593 consensus F-actin binding protein, regulates actin 86.14
TIGR00362405 DnaA chromosomal replication initiator protein Dna 85.97
PF00769246 ERM: Ezrin/radixin/moesin family; InterPro: IPR011 85.84
PRK00149450 dnaA chromosomal replication initiation protein; R 85.4
PF15035182 Rootletin: Ciliary rootlet component, centrosome c 85.21
PF15254861 CCDC14: Coiled-coil domain-containing protein 14 85.14
PRK07952244 DNA replication protein DnaC; Validated 85.09
PF10168717 Nup88: Nuclear pore component; InterPro: IPR019321 84.85
PLN03229762 acetyl-coenzyme A carboxylase carboxyl transferase 84.83
TIGR03420226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Me 84.77
PF0600572 DUF904: Protein of unknown function (DUF904); Inte 84.64
PF13514 1111 AAA_27: AAA domain 84.6
COG4477570 EzrA Negative regulator of septation ring formatio 84.19
PF1419769 Cep57_CLD_2: Centrosome localisation domain of PPC 84.13
KOG4809654 consensus Rab6 GTPase-interacting protein involved 84.04
PRK08903227 DnaA regulatory inactivator Hda; Validated 83.99
KOG1002 791 consensus Nucleotide excision repair protein RAD16 83.76
KOG2113 394 consensus Predicted RNA binding protein, contains 83.65
COG1340294 Uncharacterized archaeal coiled-coil protein [Func 83.37
COG0497557 RecN ATPase involved in DNA repair [DNA replicatio 83.24
PF13870177 DUF4201: Domain of unknown function (DUF4201) 83.04
PF08614194 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR 82.9
TIGR02928365 orc1/cdc6 family replication initiation protein. M 82.81
COG1474366 CDC6 Cdc6-related protein, AAA superfamily ATPase 82.8
PF10481307 CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR0 82.74
TIGR02680 1353 conserved hypothetical protein TIGR02680. Members 82.65
PF09787511 Golgin_A5: Golgin subfamily A member 5; InterPro: 82.56
COG2433652 Uncharacterized conserved protein [Function unknow 82.34
PF07058351 Myosin_HC-like: Myosin II heavy chain-like; InterP 82.3
PRK08181269 transposase; Validated 81.94
COG0593408 DnaA ATPase involved in DNA replication initiation 81.86
PRK1542279 septal ring assembly protein ZapB; Provisional 81.82
PRK00411394 cdc6 cell division control protein 6; Reviewed 81.67
PRK08939306 primosomal protein DnaI; Reviewed 81.66
PRK08727233 hypothetical protein; Validated 81.55
PF04851184 ResIII: Type III restriction enzyme, res subunit; 81.25
PF10186302 Atg14: UV radiation resistance protein and autopha 81.17
PF04012221 PspA_IM30: PspA/IM30 family; InterPro: IPR007157 T 80.9
PF03962188 Mnd1: Mnd1 family; InterPro: IPR005647 This family 80.79
PF04111314 APG6: Autophagy protein Apg6; InterPro: IPR007243 80.03
KOG0804493 consensus Cytoplasmic Zn-finger protein BRAP2 (BRC 80.01
>KOG0243 consensus Kinesin-like protein [Cytoskeleton] Back     alignment and domain information
Probab=100.00  E-value=2.1e-88  Score=819.36  Aligned_cols=401  Identities=36%  Similarity=0.598  Sum_probs=343.8

Q ss_pred             CCCCCCEEEEEEeCCCChhhhhcCCeEEEeeCC-CE-EEecCC--C--CCcceeeceecCCCCChhHHHhhhhHHHHHHH
Q 001316           96 QRSGDSISVTIRFRPLSEREFQRGDEIAWYADG-DK-IVRNEY--N--PATAYAFDRVFGPHANSQEVYDVAARPVVKAA  169 (1102)
Q Consensus        96 ~~~~~~I~V~vRvRP~~~~E~~~~~~~~~~~~~-~~-~~~~~~--~--~~~~f~FD~VF~~~~~q~~Vy~~~~~plV~~~  169 (1102)
                      ...+.||+|+|||||++.+|.......++..+| .+ |.+...  .  -.+.|+||+||||.+.|++||+.++.|+|..|
T Consensus        45 ~e~~~NIqVivRcRp~n~~E~~~~s~~VVs~~~~~kEV~v~~~~~sk~~~k~ftFDkVFGpes~Q~d~Y~~~v~p~i~eV  124 (1041)
T KOG0243|consen   45 KEKEVNIQVIVRCRPRNDRERKSKSSVVVSCDGIRKEVAVRQTIASKQIDKTFTFDKVFGPESQQEDLYDQAVSPIIKEV  124 (1041)
T ss_pred             CCCCCceEEEEEeCCCCchhhhcCCCeEEecCCCcceEEEecccccccccceeecceeeCcchhHHHHHHHHHHHHHHHH
Confidence            355679999999999999999888888877776 33 322221  1  36789999999999999999999999999999


Q ss_pred             hcCCceeEEeeccCCCCCccccCC--------CCCCCCchhhHHHHHHHHhhcCCCceeEEEeehhhhhcceeeecCCCC
Q 001316          170 MEGVNGTVFAYGVTSSGKTHTMHG--------DQNSPGIIPLAIKDVFSIIQDTPGREFLLRVSYLEIYNEVINDLLDPT  241 (1102)
Q Consensus       170 l~G~N~tIfaYGqTgSGKT~Tm~G--------~~~~~GIipr~~~~LF~~i~~~~~~~~~v~vS~lEIYnE~i~DLL~~~  241 (1102)
                      +.|||||||||||||+||||||.|        .+..+|||||++.+||+.+.... .+|.|+|||||+|||.|+|||+|.
T Consensus       125 l~GyNCTIFAYGQTGTGKTyTMeG~~~~~~g~l~~~aGIIPRal~~IFd~Le~~~-~EYsvKVSfLELYNEEl~DLLa~~  203 (1041)
T KOG0243|consen  125 LEGYNCTIFAYGQTGTGKTYTMEGGERKKNGELPSEAGIIPRALRQIFDTLEAQG-AEYSVKVSFLELYNEELTDLLASE  203 (1041)
T ss_pred             hccCCceEEEecCCCCCceeeeecCcccccCCCCccCCcchHHHHHHHHHHHhcC-CeEEEEEEehhhhhHHHHHhcCCc
Confidence            999999999999999999999999        56788999999999999998654 899999999999999999999886


Q ss_pred             C---CcceEEeCC------CCcEeeCceEEEeCChHHHHHHHHHHhhhcccCCCccccCCCCceeEEEEEEEEecCCCC-
Q 001316          242 G---QNLRVREDA------QGTYVEGIKEEVVLSPGHALSFIAAGEEHRHVGSNNFNLLSSRSHTIFTLMIESSDHGDE-  311 (1102)
Q Consensus       242 ~---~~l~ire~~------~g~~v~gl~e~~V~s~~e~~~ll~~g~~~R~~~~t~~N~~SSRSH~If~i~v~~~~~~~~-  311 (1102)
                      .   ..+.+.+++      +|++|.||.+++|.++.|++.+|.+|...|++++|.||.+|||||+||+|+|........ 
T Consensus       204 ~~~~~~~~~k~~~~~~~~kggV~vkGlEEi~V~~A~ei~klLekGs~kRrtAaTl~N~~SSRSHsIFsItvhike~t~~g  283 (1041)
T KOG0243|consen  204 DTSDKKLRIKDDSTIVDGKGGVIVKGLEEIIVTNADEIYKLLEKGSKKRRTAATLMNDQSSRSHSIFSITVHIKENTPEG  283 (1041)
T ss_pred             cccccccccccCCcccCCcCcEEEecceeeeecchhHHHHHHHhhhhHhHHHHHHhhhhccccceEEEEEEEEecCCCcc
Confidence            4   345555555      579999999999999999999999999999999999999999999999999987654433 


Q ss_pred             CCcEEEEEEEEeecCCCCC-cccccchhhhhhhHHHhhhHHHHHHHHHHhhcCCCCCccCCCCcchhhhhccCCCCccce
Q 001316          312 YDGVIFSQLNLIDLAGSES-SKTETTGLRRKEGSYINKSLLTLGTVIGKLSEGKASHVPYRDSKLTRLLQSSLSGHGHVS  390 (1102)
Q Consensus       312 ~~~~~~skL~lVDLAGSEr-~kt~~~g~r~kE~~~INkSL~aLg~vI~aL~~~k~~hvPYRdSkLTrLLqdsLgGnskt~  390 (1102)
                      .+.++.|||+||||||||. ..+|+.+.|.+|++.||+||+|||+||+||.++. .|||||+|||||||||||||.+||+
T Consensus       284 eelvK~GKLNLVDLAGSENI~RSGA~~~RArEAG~INqSLLTLGRVInALVe~s-~HIPYRESKLTRLLQDSLGGkTKT~  362 (1041)
T KOG0243|consen  284 EELVKIGKLNLVDLAGSENISRSGARNGRAREAGEINQSLLTLGRVINALVEHS-GHIPYRESKLTRLLQDSLGGKTKTC  362 (1041)
T ss_pred             hhhHhhcccceeeccccccccccccccchhHHhhhhhHHHHHHHHHHHHHHccC-CCCCchHHHHHHHHHHHhCCCceeE
Confidence            3557889999999999998 7789999999999999999999999999999964 5999999999999999999999999


Q ss_pred             EEEeeCCCCCCHHHHHHHHHHHHHhcccccccccccccCHHHHHHHHHHHHHHHHHHHHHHHcccccCCCHHHHHHHHHH
Q 001316          391 LICTVTPASSSMEETHNTLKFASRAKRVEIYASRNKIIDEKSLIKKYQREISSLKEELDQLKRGILVGVSHEELMTLRQK  470 (1102)
Q Consensus       391 ~I~~isP~~~~~~ETlsTLrfA~rak~I~~~~~~n~~~~~~~~i~~~~~ei~~Lk~el~~~~~~~~~~~~~~e~~~l~~~  470 (1102)
                      |||||||+..+++||++||.||.|||+|+|+|.+|..+..+.+++.|-.||.+||.+|...+....+...++.+......
T Consensus       363 iIATiSPa~~~lEETlSTLEYA~RAKnIkNKPevNQkl~K~~llKd~~~EIerLK~dl~AaReKnGvyisee~y~~~e~e  442 (1041)
T KOG0243|consen  363 IIATISPAKHNLEETLSTLEYAHRAKNIKNKPEVNQKLMKKTLLKDLYEEIERLKRDLAAAREKNGVYISEERYTQEEKE  442 (1041)
T ss_pred             EEEEeCCCcccHHHHHHHHHHHHHhhhccCCCccchHHHHHHHHHHHHHHHHHHHHHHHHhHhhCceEechHHHHHHHHH
Confidence            99999999999999999999999999999999999988899999999999999999999887766555666555322111


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q 001316          471 LEEGQVKMQSRLEEEEEAKAALMSRIQRLTKL  502 (1102)
Q Consensus       471 l~~~~~~~~~~l~~~~~~~~~l~~~~~~l~~l  502 (1102)
                          ...+..++++.+....++..++..++.+
T Consensus       443 ----~~~~~~~ieele~el~~~~~~l~~~~e~  470 (1041)
T KOG0243|consen  443 ----KKEMAEQIEELEEELENLEKQLKDLTEL  470 (1041)
T ss_pred             ----HHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence                1223334444445555555555555443



>KOG0245 consensus Kinesin-like protein [Cytoskeleton] Back     alignment and domain information
>PLN03188 kinesin-12 family protein; Provisional Back     alignment and domain information
>KOG4280 consensus Kinesin-like protein [Cytoskeleton] Back     alignment and domain information
>KOG0242 consensus Kinesin-like protein [Cytoskeleton] Back     alignment and domain information
>KOG0240 consensus Kinesin (SMY1 subfamily) [Cytoskeleton] Back     alignment and domain information
>KOG0241 consensus Kinesin-like protein [Cytoskeleton] Back     alignment and domain information
>cd01373 KISc_KLP2_like Kinesin motor domain, KLP2-like subgroup Back     alignment and domain information
>cd01370 KISc_KIP3_like Kinesin motor domain, KIP3-like subgroup Back     alignment and domain information
>cd01368 KISc_KIF23_like Kinesin motor domain, KIF23-like subgroup Back     alignment and domain information
>cd01365 KISc_KIF1A_KIF1B Kinesin motor domain, KIF1_like proteins Back     alignment and domain information
>cd01374 KISc_CENP_E Kinesin motor domain, CENP-E/KIP2-like subgroup, involved in chromosome movement and/or spindle elongation during mitosis Back     alignment and domain information
>cd01371 KISc_KIF3 Kinesin motor domain, kinesins II or KIF3_like proteins Back     alignment and domain information
>cd01367 KISc_KIF2_like Kinesin motor domain, KIF2-like group Back     alignment and domain information
>cd01364 KISc_BimC_Eg5 Kinesin motor domain, BimC/Eg5 spindle pole proteins, participate in spindle assembly and chromosome segregation during cell division Back     alignment and domain information
>cd01369 KISc_KHC_KIF5 Kinesin motor domain, kinesin heavy chain (KHC) or KIF5-like subgroup Back     alignment and domain information
>cd01376 KISc_KID_like Kinesin motor domain, KIF22/Kid-like subgroup Back     alignment and domain information
>cd01375 KISc_KIF9_like Kinesin motor domain, KIF9-like subgroup; might play a role in cell shape remodeling Back     alignment and domain information
>cd01372 KISc_KIF4 Kinesin motor domain, KIF4-like subfamily Back     alignment and domain information
>cd01366 KISc_C_terminal Kinesin motor domain, KIFC2/KIFC3/ncd-like carboxy-terminal kinesins Back     alignment and domain information
>KOG0239 consensus Kinesin (KAR3 subfamily) [Cytoskeleton] Back     alignment and domain information
>smart00129 KISc Kinesin motor, catalytic domain Back     alignment and domain information
>cd00106 KISc Kinesin motor domain Back     alignment and domain information
>PF00225 Kinesin: Kinesin motor domain; InterPro: IPR001752 Kinesin [, , ] is a microtubule-associated force-producing protein that may play a role in organelle transport Back     alignment and domain information
>KOG0244 consensus Kinesin-like protein [Cytoskeleton] Back     alignment and domain information
>KOG0246 consensus Kinesin-like protein [Cytoskeleton] Back     alignment and domain information
>KOG0247 consensus Kinesin-like protein [Cytoskeleton] Back     alignment and domain information
>COG5059 KIP1 Kinesin-like protein [Cytoskeleton] Back     alignment and domain information
>cd01363 Motor_domain Myosin and Kinesin motor domain Back     alignment and domain information
>KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0612 consensus Rho-associated, coiled-coil containing protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG4265 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4172 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4275 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1571 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A Back     alignment and domain information
>KOG1100 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT) Back     alignment and domain information
>KOG0823 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02169 SMC_prok_A chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>TIGR02169 SMC_prok_A chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional Back     alignment and domain information
>TIGR02168 SMC_prok_B chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>TIGR02168 SMC_prok_B chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>KOG0996 consensus Structural maintenance of chromosome protein 4 (chromosome condensation complex Condensin, subunit C) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG4673 consensus Transcription factor TMF, TATA element modulatory factor [Transcription] Back     alignment and domain information
>KOG0320 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0317 consensus Predicted E3 ubiquitin ligase, integral peroxisomal membrane protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT) Back     alignment and domain information
>PF10174 Cast: RIM-binding protein of the cytomatrix active zone; InterPro: IPR019323 This entry represents a family of proteins that form part of the CAZ (cytomatrix at the active zone) complex which is involved in determining the site of synaptic vesicle fusion [] Back     alignment and domain information
>KOG0161 consensus Myosin class II heavy chain [Cytoskeleton] Back     alignment and domain information
>COG5059 KIP1 Kinesin-like protein [Cytoskeleton] Back     alignment and domain information
>KOG0963 consensus Transcription factor/CCAAT displacement protein CDP1 [Transcription] Back     alignment and domain information
>KOG0971 consensus Microtubule-associated protein dynactin DCTN1/Glued [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton] Back     alignment and domain information
>PHA02929 N1R/p28-like protein; Provisional Back     alignment and domain information
>PRK03918 chromosome segregation protein; Provisional Back     alignment and domain information
>COG1196 Smc Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>KOG2164 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14634 zf-RING_5: zinc-RING finger domain Back     alignment and domain information
>PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A Back     alignment and domain information
>TIGR00606 rad50 rad50 Back     alignment and domain information
>PRK02224 chromosome segregation protein; Provisional Back     alignment and domain information
>KOG0161 consensus Myosin class II heavy chain [Cytoskeleton] Back     alignment and domain information
>COG1196 Smc Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>PF15070 GOLGA2L5: Putative golgin subfamily A member 2-like protein 5 Back     alignment and domain information
>PF09730 BicD: Microtubule-associated protein Bicaudal-D; InterPro: IPR018477 BicD proteins consist of three coiled-coiled domains and are involved in dynein-mediated minus end-directed transport from the Golgi apparatus to the endoplasmic reticulum (ER) [] Back     alignment and domain information
>KOG0971 consensus Microtubule-associated protein dynactin DCTN1/Glued [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton] Back     alignment and domain information
>COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] Back     alignment and domain information
>PRK11637 AmiB activator; Provisional Back     alignment and domain information
>PF08826 DMPK_coil: DMPK coiled coil domain like; InterPro: IPR014930 This domain is found in the myotonic dystrophy protein kinase (DMPK) and adopts a coiled coil structure Back     alignment and domain information
>KOG4674 consensus Uncharacterized conserved coiled-coil protein [Function unknown] Back     alignment and domain information
>TIGR00606 rad50 rad50 Back     alignment and domain information
>KOG0933 consensus Structural maintenance of chromosome protein 2 (chromosome condensation complex Condensin, subunit E) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF12128 DUF3584: Protein of unknown function (DUF3584); InterPro: IPR021979 This family consist of uncharacterised bacterial proteins Back     alignment and domain information
>KOG0995 consensus Centromere-associated protein HEC1 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PHA02562 46 endonuclease subunit; Provisional Back     alignment and domain information
>PRK02224 chromosome segregation protein; Provisional Back     alignment and domain information
>PRK04863 mukB cell division protein MukB; Provisional Back     alignment and domain information
>COG5574 PEX10 RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A Back     alignment and domain information
>KOG0976 consensus Rho/Rac1-interacting serine/threonine kinase Citron [Signal transduction mechanisms] Back     alignment and domain information
>PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes Back     alignment and domain information
>TIGR00599 rad18 DNA repair protein rad18 Back     alignment and domain information
>KOG0994 consensus Extracellular matrix glycoprotein Laminin subunit beta [Extracellular structures] Back     alignment and domain information
>PHA02926 zinc finger-like protein; Provisional Back     alignment and domain information
>KOG0933 consensus Structural maintenance of chromosome protein 2 (chromosome condensation complex Condensin, subunit E) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG4674 consensus Uncharacterized conserved coiled-coil protein [Function unknown] Back     alignment and domain information
>COG5185 HEC1 Protein involved in chromosome segregation, interacts with SMC proteins [Cell division and chromosome partitioning] Back     alignment and domain information
>PF14662 CCDC155: Coiled-coil region of CCDC155 Back     alignment and domain information
>KOG1785 consensus Tyrosine kinase negative regulator CBL [Defense mechanisms] Back     alignment and domain information
>KOG0977 consensus Nuclear envelope protein lamin, intermediate filament superfamily [Cell cycle control, cell division, chromosome partitioning; Nuclear structure] Back     alignment and domain information
>smart00184 RING Ring finger Back     alignment and domain information
>cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) Back     alignment and domain information
>PF12128 DUF3584: Protein of unknown function (DUF3584); InterPro: IPR021979 This family consist of uncharacterised bacterial proteins Back     alignment and domain information
>KOG4643 consensus Uncharacterized coiled-coil protein [Function unknown] Back     alignment and domain information
>COG5432 RAD18 RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0996 consensus Structural maintenance of chromosome protein 4 (chromosome condensation complex Condensin, subunit C) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0287 consensus Postreplication repair protein RAD18 [Replication, recombination and repair] Back     alignment and domain information
>COG4372 Uncharacterized protein conserved in bacteria with the myosin-like domain [Function unknown] Back     alignment and domain information
>PRK11637 AmiB activator; Provisional Back     alignment and domain information
>PF15070 GOLGA2L5: Putative golgin subfamily A member 2-like protein 5 Back     alignment and domain information
>PF15227 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A Back     alignment and domain information
>PF14447 Prok-RING_4: Prokaryotic RING finger family 4 Back     alignment and domain information
>PF00261 Tropomyosin: Tropomyosin; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells Back     alignment and domain information
>PRK03918 chromosome segregation protein; Provisional Back     alignment and domain information
>PRK04863 mukB cell division protein MukB; Provisional Back     alignment and domain information
>KOG0612 consensus Rho-associated, coiled-coil containing protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>PF05701 WEMBL: Weak chloroplast movement under blue light; InterPro: IPR008545 This family consists of several plant proteins of unknown function Back     alignment and domain information
>COG4942 Membrane-bound metallopeptidase [Cell division and chromosome partitioning] Back     alignment and domain information
>PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>smart00504 Ubox Modified RING finger domain Back     alignment and domain information
>PF05701 WEMBL: Weak chloroplast movement under blue light; InterPro: IPR008545 This family consists of several plant proteins of unknown function Back     alignment and domain information
>PF04849 HAP1_N: HAP1 N-terminal conserved region; InterPro: IPR006933 This family is defined by an N-terminal conserved region found in several huntingtin-associated protein 1 (HAP1) homologues Back     alignment and domain information
>KOG0250 consensus DNA repair protein RAD18 (SMC family protein) [Replication, recombination and repair] Back     alignment and domain information
>KOG0977 consensus Nuclear envelope protein lamin, intermediate filament superfamily [Cell cycle control, cell division, chromosome partitioning; Nuclear structure] Back     alignment and domain information
>KOG0980 consensus Actin-binding protein SLA2/Huntingtin-interacting protein Hip1 [Cytoskeleton] Back     alignment and domain information
>KOG4692 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0976 consensus Rho/Rac1-interacting serine/threonine kinase Citron [Signal transduction mechanisms] Back     alignment and domain information
>PF09755 DUF2046: Uncharacterized conserved protein H4 (DUF2046); InterPro: IPR019152 This is the conserved N-terminal 350 residues of a family of proteins of unknown function possibly containing a coiled-coil domain Back     alignment and domain information
>PF00038 Filament: Intermediate filament protein; InterPro: IPR016044 Intermediate filaments (IF) [, , ] are proteins which are primordial components of the cytoskeleton and the nuclear envelope Back     alignment and domain information
>PF10174 Cast: RIM-binding protein of the cytomatrix active zone; InterPro: IPR019323 This entry represents a family of proteins that form part of the CAZ (cytomatrix at the active zone) complex which is involved in determining the site of synaptic vesicle fusion [] Back     alignment and domain information
>PHA02562 46 endonuclease subunit; Provisional Back     alignment and domain information
>KOG4643 consensus Uncharacterized coiled-coil protein [Function unknown] Back     alignment and domain information
>KOG0946 consensus ER-Golgi vesicle-tethering protein p115 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13445 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A Back     alignment and domain information
>PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes Back     alignment and domain information
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>PF00261 Tropomyosin: Tropomyosin; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells Back     alignment and domain information
>KOG0994 consensus Extracellular matrix glycoprotein Laminin subunit beta [Extracellular structures] Back     alignment and domain information
>PF08647 BRE1: BRE1 E3 ubiquitin ligase; InterPro: IPR013956 BRE1 is an E3 ubiquitin ligase that has been shown to act as a transcriptional activator through direct activator interactions [] Back     alignment and domain information
>KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF09730 BicD: Microtubule-associated protein Bicaudal-D; InterPro: IPR018477 BicD proteins consist of three coiled-coiled domains and are involved in dynein-mediated minus end-directed transport from the Golgi apparatus to the endoplasmic reticulum (ER) [] Back     alignment and domain information
>PF14835 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM7_B Back     alignment and domain information
>KOG0963 consensus Transcription factor/CCAAT displacement protein CDP1 [Transcription] Back     alignment and domain information
>KOG1029 consensus Endocytic adaptor protein intersectin [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0964 consensus Structural maintenance of chromosome protein 3 (sister chromatid cohesion complex Cohesin, subunit SMC3) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>TIGR03007 pepcterm_ChnLen polysaccharide chain length determinant protein, PEP-CTERM locus subfamily Back     alignment and domain information
>COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only] Back     alignment and domain information
>KOG2177 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF05557 MAD: Mitotic checkpoint protein; InterPro: IPR008672 This family consists of several eukaryotic mitotic checkpoint (Mitotic arrest deficient or MAD) proteins Back     alignment and domain information
>KOG1813 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5540 RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK04778 septation ring formation regulator EzrA; Provisional Back     alignment and domain information
>KOG1029 consensus Endocytic adaptor protein intersectin [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK09039 hypothetical protein; Validated Back     alignment and domain information
>KOG0999 consensus Microtubule-associated protein Bicaudal-D [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0964 consensus Structural maintenance of chromosome protein 3 (sister chromatid cohesion complex Cohesin, subunit SMC3) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0250 consensus DNA repair protein RAD18 (SMC family protein) [Replication, recombination and repair] Back     alignment and domain information
>KOG4593 consensus Mitotic checkpoint protein MAD1 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0980 consensus Actin-binding protein SLA2/Huntingtin-interacting protein Hip1 [Cytoskeleton] Back     alignment and domain information
>PF05622 HOOK: HOOK protein; InterPro: IPR008636 This family consists of several HOOK1, 2 and 3 proteins from different eukaryotic organisms Back     alignment and domain information
>PF14915 CCDC144C: CCDC144C protein coiled-coil region Back     alignment and domain information
>PF06818 Fez1: Fez1; InterPro: IPR009638 This family represents the eukaryotic Fez1 protein Back     alignment and domain information
>KOG0239 consensus Kinesin (KAR3 subfamily) [Cytoskeleton] Back     alignment and domain information
>PF15066 CAGE1: Cancer-associated gene protein 1 family Back     alignment and domain information
>KOG4360 consensus Uncharacterized coiled coil protein [Function unknown] Back     alignment and domain information
>PRK11281 hypothetical protein; Provisional Back     alignment and domain information
>PF05667 DUF812: Protein of unknown function (DUF812); InterPro: IPR008530 This family consists of several eukaryotic proteins of unknown function Back     alignment and domain information
>PF00038 Filament: Intermediate filament protein; InterPro: IPR016044 Intermediate filaments (IF) [, , ] are proteins which are primordial components of the cytoskeleton and the nuclear envelope Back     alignment and domain information
>PRK09039 hypothetical protein; Validated Back     alignment and domain information
>KOG0249 consensus LAR-interacting protein and related proteins [General function prediction only] Back     alignment and domain information
>PF07926 TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: IPR012929 This domain is found in a number of proteins, including TPR protein (P12270 from SWISSPROT) and yeast myosin-like proteins 1 (MLP1, Q02455 from SWISSPROT) and 2 (MLP2, P40457 from SWISSPROT) Back     alignment and domain information
>PF04849 HAP1_N: HAP1 N-terminal conserved region; InterPro: IPR006933 This family is defined by an N-terminal conserved region found in several huntingtin-associated protein 1 (HAP1) homologues Back     alignment and domain information
>PRK10929 putative mechanosensitive channel protein; Provisional Back     alignment and domain information
>COG4942 Membrane-bound metallopeptidase [Cell division and chromosome partitioning] Back     alignment and domain information
>PF12678 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>COG5243 HRD1 HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK11281 hypothetical protein; Provisional Back     alignment and domain information
>KOG0018 consensus Structural maintenance of chromosome protein 1 (sister chromatid cohesion complex Cohesin, subunit SMC1) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF09787 Golgin_A5: Golgin subfamily A member 5; InterPro: IPR019177 This entry represents a family of proteins involved in maintaining Golgi structure Back     alignment and domain information
>PF15619 Lebercilin: Ciliary protein causing Leber congenital amaurosis disease Back     alignment and domain information
>PF12718 Tropomyosin_1: Tropomyosin like; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells Back     alignment and domain information
>PF09789 DUF2353: Uncharacterized coiled-coil protein (DUF2353); InterPro: IPR019179 Members of this family have been annotated as being coiled-coil domain-containing protein 149, however they currently have no known function Back     alignment and domain information
>PF05622 HOOK: HOOK protein; InterPro: IPR008636 This family consists of several HOOK1, 2 and 3 proteins from different eukaryotic organisms Back     alignment and domain information
>KOG4360 consensus Uncharacterized coiled coil protein [Function unknown] Back     alignment and domain information
>PF07058 Myosin_HC-like: Myosin II heavy chain-like; InterPro: IPR009768 This family represents a conserved region within a number of myosin II heavy chain-like proteins that seem to be specific to Arabidopsis thaliana Back     alignment and domain information
>KOG4687 consensus Uncharacterized coiled-coil protein [Function unknown] Back     alignment and domain information
>COG1340 Uncharacterized archaeal coiled-coil protein [Function unknown] Back     alignment and domain information
>COG4372 Uncharacterized protein conserved in bacteria with the myosin-like domain [Function unknown] Back     alignment and domain information
>PF06818 Fez1: Fez1; InterPro: IPR009638 This family represents the eukaryotic Fez1 protein Back     alignment and domain information
>KOG1853 consensus LIS1-interacting protein NUDE [Cytoskeleton] Back     alignment and domain information
>KOG4673 consensus Transcription factor TMF, TATA element modulatory factor [Transcription] Back     alignment and domain information
>COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] Back     alignment and domain information
>PF05667 DUF812: Protein of unknown function (DUF812); InterPro: IPR008530 This family consists of several eukaryotic proteins of unknown function Back     alignment and domain information
>KOG0802 consensus E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2113 consensus Predicted RNA binding protein, contains KH domain [General function prediction only] Back     alignment and domain information
>PF05483 SCP-1: Synaptonemal complex protein 1 (SCP-1); InterPro: IPR008827 Synaptonemal complex protein 1 (SCP-1) is the major component of the transverse filaments of the synaptonemal complex Back     alignment and domain information
>PF07926 TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: IPR012929 This domain is found in a number of proteins, including TPR protein (P12270 from SWISSPROT) and yeast myosin-like proteins 1 (MLP1, Q02455 from SWISSPROT) and 2 (MLP2, P40457 from SWISSPROT) Back     alignment and domain information
>PF06785 UPF0242: Uncharacterised protein family (UPF0242); InterPro: IPR009623 This is a group of proteins of unknown function Back     alignment and domain information
>KOG4159 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2879 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR01843 type_I_hlyD type I secretion membrane fusion protein, HlyD family Back     alignment and domain information
>PF04564 U-box: U-box domain; InterPro: IPR003613 Quality control of intracellular proteins is essential for cellular homeostasis Back     alignment and domain information
>PRK10929 putative mechanosensitive channel protein; Provisional Back     alignment and domain information
>KOG0946 consensus ER-Golgi vesicle-tethering protein p115 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0982 consensus Centrosomal protein Nuf [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton] Back     alignment and domain information
>TIGR00634 recN DNA repair protein RecN Back     alignment and domain information
>PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication Back     alignment and domain information
>PF15619 Lebercilin: Ciliary protein causing Leber congenital amaurosis disease Back     alignment and domain information
>COG3096 MukB Uncharacterized protein involved in chromosome partitioning [Cell division and chromosome partitioning] Back     alignment and domain information
>PF08614 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR013923 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells Back     alignment and domain information
>COG5185 HEC1 Protein involved in chromosome segregation, interacts with SMC proteins [Cell division and chromosome partitioning] Back     alignment and domain information
>KOG0311 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK01156 chromosome segregation protein; Provisional Back     alignment and domain information
>PF04641 Rtf2: Rtf2 RING-finger Back     alignment and domain information
>TIGR03017 EpsF chain length determinant protein EpsF Back     alignment and domain information
>PF12325 TMF_TATA_bd: TATA element modulatory factor 1 TATA binding; InterPro: IPR022091 This is the C-terminal conserved coiled coil region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes [] Back     alignment and domain information
>KOG0962 consensus DNA repair protein RAD50, ABC-type ATPase/SMC superfamily [Replication, recombination and repair] Back     alignment and domain information
>PF01576 Myosin_tail_1: Myosin tail; InterPro: IPR002928 Muscle contraction is caused by sliding between the thick and thin filaments of the myofibril Back     alignment and domain information
>COG0556 UvrB Helicase subunit of the DNA excision repair complex [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG4628 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK06893 DNA replication initiation factor; Validated Back     alignment and domain information
>KOG2129 consensus Uncharacterized conserved protein H4 [Function unknown] Back     alignment and domain information
>PF06785 UPF0242: Uncharacterised protein family (UPF0242); InterPro: IPR009623 This is a group of proteins of unknown function Back     alignment and domain information
>KOG0249 consensus LAR-interacting protein and related proteins [General function prediction only] Back     alignment and domain information
>PRK14086 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK06620 hypothetical protein; Validated Back     alignment and domain information
>PF01576 Myosin_tail_1: Myosin tail; InterPro: IPR002928 Muscle contraction is caused by sliding between the thick and thin filaments of the myofibril Back     alignment and domain information
>KOG0828 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0999 consensus Microtubule-associated protein Bicaudal-D [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1003 consensus Actin filament-coating protein tropomyosin [Cytoskeleton] Back     alignment and domain information
>PF14662 CCDC155: Coiled-coil region of CCDC155 Back     alignment and domain information
>PF14988 DUF4515: Domain of unknown function (DUF4515) Back     alignment and domain information
>COG2804 PulE Type II secretory pathway, ATPase PulE/Tfp pilus assembly pathway, ATPase PilB [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR01005 eps_transp_fam exopolysaccharide transport protein family Back     alignment and domain information
>KOG0825 consensus PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG1001 consensus Helicase-like transcription factor HLTF/DNA helicase RAD5, DEAD-box superfamily [Transcription; Replication, recombination and repair] Back     alignment and domain information
>KOG0018 consensus Structural maintenance of chromosome protein 1 (sister chromatid cohesion complex Cohesin, subunit SMC1) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0979 consensus Structural maintenance of chromosome protein SMC5/Spr18, SMC superfamily [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] Back     alignment and domain information
>PF13851 GAS: Growth-arrest specific micro-tubule binding Back     alignment and domain information
>PF09789 DUF2353: Uncharacterized coiled-coil protein (DUF2353); InterPro: IPR019179 Members of this family have been annotated as being coiled-coil domain-containing protein 149, however they currently have no known function Back     alignment and domain information
>COG3883 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs Back     alignment and domain information
>PF05483 SCP-1: Synaptonemal complex protein 1 (SCP-1); InterPro: IPR008827 Synaptonemal complex protein 1 (SCP-1) is the major component of the transverse filaments of the synaptonemal complex Back     alignment and domain information
>PF10212 TTKRSYEDQ: Predicted coiled-coil domain-containing protein; InterPro: IPR019348 This entry represents a C-terminal 500 residue region, which contains a conserved TTKRSYEDQ motif Back     alignment and domain information
>PF15066 CAGE1: Cancer-associated gene protein 1 family Back     alignment and domain information
>PF12718 Tropomyosin_1: Tropomyosin like; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells Back     alignment and domain information
>COG3883 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>TIGR03007 pepcterm_ChnLen polysaccharide chain length determinant protein, PEP-CTERM locus subfamily Back     alignment and domain information
>TIGR01005 eps_transp_fam exopolysaccharide transport protein family Back     alignment and domain information
>PF03148 Tektin: Tektin family; InterPro: IPR000435 Tektin heteropolymers form unique protofilaments of flagellar microtubules [] Back     alignment and domain information
>PF08172 CASP_C: CASP C terminal; InterPro: IPR012955 This domain is the C-terminal region of the CASP family of proteins Back     alignment and domain information
>KOG1039 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF06160 EzrA: Septation ring formation regulator, EzrA ; InterPro: IPR010379 During the bacterial cell cycle, the tubulin-like cell-division protein FtsZ polymerises into a ring structure that establishes the location of the nascent division site Back     alignment and domain information
>TIGR03185 DNA_S_dndD DNA sulfur modification protein DndD Back     alignment and domain information
>PF08317 Spc7: Spc7 kinetochore protein; InterPro: IPR013253 This entry consists of cell division proteins which are required for kinetochore-spindle association [] Back     alignment and domain information
>PF07111 HCR: Alpha helical coiled-coil rod protein (HCR); InterPro: IPR009800 This family consists of several mammalian alpha helical coiled-coil rod HCR proteins Back     alignment and domain information
>PRK10884 SH3 domain-containing protein; Provisional Back     alignment and domain information
>PRK10884 SH3 domain-containing protein; Provisional Back     alignment and domain information
>COG2805 PilT Tfp pilus assembly protein, pilus retraction ATPase PilT [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>KOG4807 consensus F-actin binding protein, regulates actin cytoskeletal organization [Cytoskeleton] Back     alignment and domain information
>TIGR01000 bacteriocin_acc bacteriocin secretion accessory protein Back     alignment and domain information
>PF12861 zf-Apc11: Anaphase-promoting complex subunit 11 RING-H2 finger Back     alignment and domain information
>KOG1853 consensus LIS1-interacting protein NUDE [Cytoskeleton] Back     alignment and domain information
>PF13514 AAA_27: AAA domain Back     alignment and domain information
>PRK10869 recombination and repair protein; Provisional Back     alignment and domain information
>KOG1814 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4302 consensus Microtubule-associated protein essential for anaphase spindle elongation [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton] Back     alignment and domain information
>PRK06835 DNA replication protein DnaC; Validated Back     alignment and domain information
>KOG3002 consensus Zn finger protein [General function prediction only] Back     alignment and domain information
>PF09728 Taxilin: Myosin-like coiled-coil protein; InterPro: IPR019132 Taxilin contains an extraordinarily long coiled-coil domain in its C-terminal half and is ubiquitously expressed Back     alignment and domain information
>KOG0995 consensus Centromere-associated protein HEC1 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK12377 putative replication protein; Provisional Back     alignment and domain information
>KOG0243 consensus Kinesin-like protein [Cytoskeleton] Back     alignment and domain information
>TIGR00634 recN DNA repair protein RecN Back     alignment and domain information
>PRK08116 hypothetical protein; Validated Back     alignment and domain information
>PRK05642 DNA replication initiation factor; Validated Back     alignment and domain information
>PRK04778 septation ring formation regulator EzrA; Provisional Back     alignment and domain information
>PF10481 CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR018463 Mitosin or centromere-associated protein-F (Cenp-F) is found bound across the centromere as one of the proteins of the outer layer of the kinetochore [] Back     alignment and domain information
>KOG3039 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK08084 DNA replication initiation factor; Provisional Back     alignment and domain information
>COG0497 RecN ATPase involved in DNA repair [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR02680 conserved hypothetical protein TIGR02680 Back     alignment and domain information
>PRK06526 transposase; Provisional Back     alignment and domain information
>PLN02939 transferase, transferring glycosyl groups Back     alignment and domain information
>PRK14088 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PF10473 CENP-F_leu_zip: Leucine-rich repeats of kinetochore protein Cenp-F/LEK1; InterPro: IPR019513 Cenp-F, a centromeric kinetochore, microtubule-binding protein consisting of two 1,600-amino acid-long coils, is essential for the full functioning of the mitotic checkpoint pathway [, ] Back     alignment and domain information
>PF05911 DUF869: Plant protein of unknown function (DUF869); InterPro: IPR008587 This family consists of a number of sequences found in plants Back     alignment and domain information
>PF05557 MAD: Mitotic checkpoint protein; InterPro: IPR008672 This family consists of several eukaryotic mitotic checkpoint (Mitotic arrest deficient or MAD) proteins Back     alignment and domain information
>PF12325 TMF_TATA_bd: TATA element modulatory factor 1 TATA binding; InterPro: IPR022091 This is the C-terminal conserved coiled coil region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes [] Back     alignment and domain information
>PRK14087 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>TIGR01843 type_I_hlyD type I secretion membrane fusion protein, HlyD family Back     alignment and domain information
>PRK09087 hypothetical protein; Validated Back     alignment and domain information
>KOG4807 consensus F-actin binding protein, regulates actin cytoskeletal organization [Cytoskeleton] Back     alignment and domain information
>TIGR00362 DnaA chromosomal replication initiator protein DnaA Back     alignment and domain information
>PF00769 ERM: Ezrin/radixin/moesin family; InterPro: IPR011259 The ERM family consists of three closely-related proteins, ezrin, radixin and moesin [] Back     alignment and domain information
>PRK00149 dnaA chromosomal replication initiation protein; Reviewed Back     alignment and domain information
>PF15035 Rootletin: Ciliary rootlet component, centrosome cohesion Back     alignment and domain information
>PF15254 CCDC14: Coiled-coil domain-containing protein 14 Back     alignment and domain information
>PRK07952 DNA replication protein DnaC; Validated Back     alignment and domain information
>PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs Back     alignment and domain information
>PLN03229 acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha; Provisional Back     alignment and domain information
>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda Back     alignment and domain information
>PF06005 DUF904: Protein of unknown function (DUF904); InterPro: IPR009252 Cell division protein ZapB is a non-essential, abundant cell division factor that is required for proper Z-ring formation Back     alignment and domain information
>PF13514 AAA_27: AAA domain Back     alignment and domain information
>COG4477 EzrA Negative regulator of septation ring formation [Cell division and chromosome partitioning] Back     alignment and domain information
>PF14197 Cep57_CLD_2: Centrosome localisation domain of PPC89 Back     alignment and domain information
>KOG4809 consensus Rab6 GTPase-interacting protein involved in endosome-to-TGN transport [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK08903 DnaA regulatory inactivator Hda; Validated Back     alignment and domain information
>KOG1002 consensus Nucleotide excision repair protein RAD16 [Replication, recombination and repair] Back     alignment and domain information
>KOG2113 consensus Predicted RNA binding protein, contains KH domain [General function prediction only] Back     alignment and domain information
>COG1340 Uncharacterized archaeal coiled-coil protein [Function unknown] Back     alignment and domain information
>COG0497 RecN ATPase involved in DNA repair [DNA replication, recombination, and repair] Back     alignment and domain information
>PF13870 DUF4201: Domain of unknown function (DUF4201) Back     alignment and domain information
>PF08614 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR013923 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells Back     alignment and domain information
>TIGR02928 orc1/cdc6 family replication initiation protein Back     alignment and domain information
>COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF10481 CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR018463 Mitosin or centromere-associated protein-F (Cenp-F) is found bound across the centromere as one of the proteins of the outer layer of the kinetochore [] Back     alignment and domain information
>TIGR02680 conserved hypothetical protein TIGR02680 Back     alignment and domain information
>PF09787 Golgin_A5: Golgin subfamily A member 5; InterPro: IPR019177 This entry represents a family of proteins involved in maintaining Golgi structure Back     alignment and domain information
>COG2433 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF07058 Myosin_HC-like: Myosin II heavy chain-like; InterPro: IPR009768 This family represents a conserved region within a number of myosin II heavy chain-like proteins that seem to be specific to Arabidopsis thaliana Back     alignment and domain information
>PRK08181 transposase; Validated Back     alignment and domain information
>COG0593 DnaA ATPase involved in DNA replication initiation [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK15422 septal ring assembly protein ZapB; Provisional Back     alignment and domain information
>PRK00411 cdc6 cell division control protein 6; Reviewed Back     alignment and domain information
>PRK08939 primosomal protein DnaI; Reviewed Back     alignment and domain information
>PRK08727 hypothetical protein; Validated Back     alignment and domain information
>PF04851 ResIII: Type III restriction enzyme, res subunit; InterPro: IPR006935 This entry represents a domain found in the N terminus of several proteins, including helicases, the R subunit (HsdR) of type I restriction endonucleases (3 Back     alignment and domain information
>PF10186 Atg14: UV radiation resistance protein and autophagy-related subunit 14; InterPro: IPR018791 Class III phosphatidylinositol 3-kinase (PI3-kinase) regulates multiple membrane trafficking Back     alignment and domain information
>PF04012 PspA_IM30: PspA/IM30 family; InterPro: IPR007157 This family includes PspA a protein that suppresses sigma54-dependent transcription Back     alignment and domain information
>PF03962 Mnd1: Mnd1 family; InterPro: IPR005647 This family of proteins includes meiotic nuclear division protein 1 (MND1) from Saccharomyces cerevisiae (Baker's yeast) Back     alignment and domain information
>PF04111 APG6: Autophagy protein Apg6; InterPro: IPR007243 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells Back     alignment and domain information
>KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1102
1t5c_A349 Crystal Structure Of The Motor Domain Of Human Kine 4e-73
1mkj_A349 Human Kinesin Motor Domain With Docked Neck Linker 9e-64
4atx_C340 Rigor Kinesin Motor Domain With An Ordered Neck-Lin 9e-64
1bg2_A325 Human Ubiquitous Kinesin Motor Domain Length = 325 1e-63
2y5w_A365 Crystal Structure Of Drosophila Melanogaster Kinesi 1e-61
3b6u_A372 Crystal Structure Of The Motor Domain Of Human Kine 3e-59
1goj_A355 Structure Of A Fast Kinesin: Implications For Atpas 8e-59
2vvg_A350 Crystal Structure Of The G.Intestinalis Kinesin 2 G 1e-56
3b6v_A395 Crystal Structure Of The Motor Domain Of Human Kine 3e-55
2wbe_C373 Kinesin-5-Tubulin Complex With Amppnp Length = 373 6e-54
3gbj_A354 Crystal Structure Of The Motor Domain Of Kinesin Ki 4e-52
4a14_A344 Human Kif7, A Kinesin Involved In Hedgehog Signalli 2e-51
2xt3_A344 Human Kif7, A Kinesin Involved In Hedgehog Signalli 5e-50
4aqv_C373 Model Of Human Kinesin-5 Motor Domain (3hqd) And Ma 7e-50
1ia0_K394 Kif1a Head-Microtubule Complex Structure In Atp-For 3e-49
4a1z_A368 Eg5-1 Length = 368 4e-49
3hqd_A369 Human Kinesin Eg5 Motor Domain In Complex With Ampp 4e-49
4a28_A368 Eg5-2 Length = 368 5e-49
1ii6_A368 Crystal Structure Of The Mitotic Kinesin Eg5 In Com 5e-49
1q0b_A367 Crystal Structure Of The Motor Protein Ksp In Compl 5e-49
1x88_A359 Human Eg5 Motor Domain Bound To Mg-Adp And Monastro 5e-49
4ap0_A370 The Mitotic Kinesin Eg5 In Complex With Mg-Adp And 6e-49
3zcw_A348 Eg5 - New Allosteric Binding Site Length = 348 1e-48
1i5s_A367 Crystal Structure Of The Kif1a Motor Domain Complex 2e-48
1i6i_A366 Crystal Structure Of The Kif1a Motor Domain Complex 4e-48
2owm_A443 Motor Domain Of Neurospora Crassa Kinesin-3 (Nckin3 4e-48
1vfv_A366 Crystal Structure Of The Kif1a Motor Domain Complex 5e-48
3bfn_A388 Crystal Structure Of The Motor Domain Of Human Kine 1e-47
3lre_A355 Crystal Structure Analysis Of Human Kinesin-8 Motor 3e-47
3nwn_A359 Crystal Structure Of The Human Kif9 Motor Domain In 2e-46
3h4s_A386 Structure Of The Complex Of A Mitotic Kinesin With 7e-46
1sdm_A369 Crystal Structure Of Kinesin-Like Calmodulin Bindin 3e-45
3u06_A412 Crystal Structure Of The Kinesin-14 Ncdg347d Length 4e-43
1v8j_A410 The Crystal Structure Of The Minimal Functional Dom 1e-42
1cz7_A406 The Crystal Structure Of A Minus-End Directed Micro 2e-42
2h58_A330 Crystal Structure Of The Kifc3 Motor Domain In Comp 3e-42
2ncd_A420 Ncd (Non-Claret Disjunctional) Dimer From D. Melano 3e-42
2heh_A387 Crystal Structure Of The Kif2c Motor Domain (Casp T 3e-42
3edl_D331 Kinesin13-Microtubule Ring Complex Length = 331 6e-42
1n6m_A409 Rotation Of The StalkNECK AND ONE HEAD IN A NEW CRY 1e-41
2kin_A238 Kinesin (Monomeric) From Rattus Norvegicus Length = 2e-41
3l1c_A383 Kinesin-14 Protein Ncd, T436s Mutant Length = 383 3e-41
2gry_A420 Crystal Structure Of The Human Kif2 Motor Domain In 5e-41
4h1g_A715 Structure Of Candida Albicans Kar3 Motor Domain Fus 2e-38
4gkr_A371 Structure Of The C-Terminal Motor Domain Of Kar3 Fr 2e-36
3t0q_A349 Motor Domain Structure Of The Kar3-Like Kinesin Fro 2e-35
2rep_A376 Crystal Structure Of The Motor Domain Of Human Kine 1e-34
4etp_A403 C-Terminal Motor And Motor Homology Domain Of Kar3v 3e-32
1f9t_A358 Crystal Structures Of Kinesin Mutants Reveal A Sign 5e-32
3kar_A346 The Motor Domain Of Kinesin-Like Protein Kar3, A Sa 5e-32
1f9w_A347 Crystal Structures Of Mutants Reveal A Signalling P 3e-31
1f9u_A347 Crystal Structures Of Mutants Reveal A Signalling P 4e-31
1f9v_A347 Crystal Structures Of Mutants Reveal A Signalling P 4e-31
3pxn_A344 Crystal Structure Of The Drosophila Kinesin Family 4e-31
3dc4_A344 Crystal Structure Of The Drosophila Kinesin Family 1e-30
1ry6_A360 Crystal Structure Of Internal Kinesin Motor Domain 2e-29
2kin_B100 Kinesin (Monomeric) From Rattus Norvegicus Length = 7e-14
3kin_B117 Kinesin (Dimeric) From Rattus Norvegicus Length = 1 3e-13
3eb5_A74 Structure Of The Ciap2 Ring Domain Length = 74 9e-06
2ecg_A75 Solution Structure Of The Ring Domain Of The Baculo 3e-05
4ic2_A74 Crystal Structure Of The Xiap Ring Domain Length = 3e-05
4ic3_A74 Crystal Structure Of The F495l Mutant Xiap Ring Dom 3e-05
3t6p_A345 Iap Antagonist-Induced Conformational Change In Cia 7e-05
4auq_B62 Structure Of Birc7-Ubch5b-Ub Complex. Length = 62 4e-04
>pdb|1T5C|A Chain A, Crystal Structure Of The Motor Domain Of Human Kinetochore Protein Cenp-E Length = 349 Back     alignment and structure

Iteration: 1

Score = 273 bits (698), Expect = 4e-73, Method: Compositional matrix adjust. Identities = 151/324 (46%), Positives = 209/324 (64%), Gaps = 10/324 (3%) Query: 101 SISVTIRFRPLSEREFQRGDEIAWYADGDKIVRNEYNPATAYAFDRVFGPHANSQEVYDV 160 +++V +R RPL+ RE G+ Y D V + + + ++ FDRVF + ++ VY+ Sbjct: 5 AVAVCVRVRPLNSREESLGETAQVYWKTDNNVIYQVDGSKSFNFDRVFHGNETTKNVYEE 64 Query: 161 AARPVVKAAMEGVNGTVFAYGVTSSGKTHTMHGDQNSPGIIPLAIKDVFSIIQDTPGREF 220 A P++ +A++G NGT+FAYG T+SGKT+TM G ++ G+IP AI D+F I+ P REF Sbjct: 65 IAAPIIDSAIQGYNGTIFAYGQTASGKTYTMMGSEDHLGVIPRAIHDIFQKIKKFPDREF 124 Query: 221 LLRVSYLEIYNEVINDLLDPTGQN--LRVREDA-QGTYVEGIKEEVVLSPGHALSFIAAG 277 LLRVSY+EIYNE I DLL T + L +RED + YV + EEVV + AL +I G Sbjct: 125 LLRVSYMEIYNETITDLLCGTQKMKPLIIREDVNRNVYVADLTEEVVYTSEMALKWITKG 184 Query: 278 EEHRHVGSNNFNLLSSRSHTIFTLMIESSDHGDEYD---GVIFSQLNLIDLAGSE-SSKT 333 E+ RH G N SSRSHTIF +++ES + G+ + V S LNL+DLAGSE +++T Sbjct: 185 EKSRHYGETKMNQRSSRSHTIFRMILESREKGEPSNCEGSVKVSHLNLVDLAGSERAAQT 244 Query: 334 ETTGLRRKEGSYINKSLLTLGTVIGKLSEGK-ASHVPYRDSKLTRLLQSSLSGHGHVSLI 392 G+R KEG IN+SL LG VI KLS+G+ + YRDSKLTR+LQ+SL G+ +I Sbjct: 245 GAAGVRLKEGCNINRSLFILGQVIKKLSDGQVGGFINYRDSKLTRILQNSLGGNAKTRII 304 Query: 393 CTVTPASSSMEETHNTLKFASRAK 416 CT+TP S +ET L+FAS AK Sbjct: 305 CTITPV--SFDETLTALQFASTAK 326
>pdb|1MKJ|A Chain A, Human Kinesin Motor Domain With Docked Neck Linker Length = 349 Back     alignment and structure
>pdb|4ATX|C Chain C, Rigor Kinesin Motor Domain With An Ordered Neck-Linker, Docked On Tubulin Dimer, Modelled Into The 8a Cryo-Em Map Of Doublecortin-Microtubules Decorated With Kinesin Length = 340 Back     alignment and structure
>pdb|1BG2|A Chain A, Human Ubiquitous Kinesin Motor Domain Length = 325 Back     alignment and structure
>pdb|2Y5W|A Chain A, Crystal Structure Of Drosophila Melanogaster Kinesin-1 Motor Domain Dimer Length = 365 Back     alignment and structure
>pdb|3B6U|A Chain A, Crystal Structure Of The Motor Domain Of Human Kinesin Family Member 3b In Complex With Adp Length = 372 Back     alignment and structure
>pdb|1GOJ|A Chain A, Structure Of A Fast Kinesin: Implications For Atpase Mechanism And Interactions With Microtubules Length = 355 Back     alignment and structure
>pdb|2VVG|A Chain A, Crystal Structure Of The G.Intestinalis Kinesin 2 Gikin2a Motor Domain Length = 350 Back     alignment and structure
>pdb|3B6V|A Chain A, Crystal Structure Of The Motor Domain Of Human Kinesin Family Member 3c In Complex With Adp Length = 395 Back     alignment and structure
>pdb|2WBE|C Chain C, Kinesin-5-Tubulin Complex With Amppnp Length = 373 Back     alignment and structure
>pdb|3GBJ|A Chain A, Crystal Structure Of The Motor Domain Of Kinesin Kif13b Bound With Adp Length = 354 Back     alignment and structure
>pdb|4A14|A Chain A, Human Kif7, A Kinesin Involved In Hedgehog Signalling Length = 344 Back     alignment and structure
>pdb|2XT3|A Chain A, Human Kif7, A Kinesin Involved In Hedgehog Signalling Length = 344 Back     alignment and structure
>pdb|4AQV|C Chain C, Model Of Human Kinesin-5 Motor Domain (3hqd) And Mammalian Tubulin Heterodimer (1jff) Docked Into The 9.7-angstrom Cryo-em Map Of Microtubule-bound Kinesin-5 Motor Domain In The Ampppnp State. Length = 373 Back     alignment and structure
>pdb|1IA0|K Chain K, Kif1a Head-Microtubule Complex Structure In Atp-Form Length = 394 Back     alignment and structure
>pdb|4A1Z|A Chain A, Eg5-1 Length = 368 Back     alignment and structure
>pdb|3HQD|A Chain A, Human Kinesin Eg5 Motor Domain In Complex With Amppnp And Mg2+ Length = 369 Back     alignment and structure
>pdb|4A28|A Chain A, Eg5-2 Length = 368 Back     alignment and structure
>pdb|1II6|A Chain A, Crystal Structure Of The Mitotic Kinesin Eg5 In Complex With Mg-Adp. Length = 368 Back     alignment and structure
>pdb|1Q0B|A Chain A, Crystal Structure Of The Motor Protein Ksp In Complex With Adp And Monastrol Length = 367 Back     alignment and structure
>pdb|1X88|A Chain A, Human Eg5 Motor Domain Bound To Mg-Adp And Monastrol Length = 359 Back     alignment and structure
>pdb|4AP0|A Chain A, The Mitotic Kinesin Eg5 In Complex With Mg-Adp And Ispinesib Length = 370 Back     alignment and structure
>pdb|3ZCW|A Chain A, Eg5 - New Allosteric Binding Site Length = 348 Back     alignment and structure
>pdb|1I5S|A Chain A, Crystal Structure Of The Kif1a Motor Domain Complexed With Mg-Adp Length = 367 Back     alignment and structure
>pdb|1I6I|A Chain A, Crystal Structure Of The Kif1a Motor Domain Complexed With Mg-Amppcp Length = 366 Back     alignment and structure
>pdb|2OWM|A Chain A, Motor Domain Of Neurospora Crassa Kinesin-3 (Nckin3) Length = 443 Back     alignment and structure
>pdb|1VFV|A Chain A, Crystal Structure Of The Kif1a Motor Domain Complexed With Mg-Amppnp Length = 366 Back     alignment and structure
>pdb|3BFN|A Chain A, Crystal Structure Of The Motor Domain Of Human Kinesin Family Member 22 Length = 388 Back     alignment and structure
>pdb|3LRE|A Chain A, Crystal Structure Analysis Of Human Kinesin-8 Motor Domain Length = 355 Back     alignment and structure
>pdb|3NWN|A Chain A, Crystal Structure Of The Human Kif9 Motor Domain In Complex With Adp Length = 359 Back     alignment and structure
>pdb|3H4S|A Chain A, Structure Of The Complex Of A Mitotic Kinesin With Its Calcium Binding Regulator Length = 386 Back     alignment and structure
>pdb|1SDM|A Chain A, Crystal Structure Of Kinesin-Like Calmodulin Binding Protein Length = 369 Back     alignment and structure
>pdb|3U06|A Chain A, Crystal Structure Of The Kinesin-14 Ncdg347d Length = 412 Back     alignment and structure
>pdb|1V8J|A Chain A, The Crystal Structure Of The Minimal Functional Domain Of The Microtubule Destabilizer Kif2c Complexed With Mg-adp Length = 410 Back     alignment and structure
>pdb|1CZ7|A Chain A, The Crystal Structure Of A Minus-End Directed Microtubule Motor Protein Ncd Reveals Variable Dimer Conformations Length = 406 Back     alignment and structure
>pdb|2H58|A Chain A, Crystal Structure Of The Kifc3 Motor Domain In Complex With Adp Length = 330 Back     alignment and structure
>pdb|2NCD|A Chain A, Ncd (Non-Claret Disjunctional) Dimer From D. Melanogaster Length = 420 Back     alignment and structure
>pdb|2HEH|A Chain A, Crystal Structure Of The Kif2c Motor Domain (Casp Target) Length = 387 Back     alignment and structure
>pdb|3EDL|D Chain D, Kinesin13-Microtubule Ring Complex Length = 331 Back     alignment and structure
>pdb|1N6M|A Chain A, Rotation Of The StalkNECK AND ONE HEAD IN A NEW CRYSTAL Structure Of The Kinesin Motor Protein, Ncd Length = 409 Back     alignment and structure
>pdb|2KIN|A Chain A, Kinesin (Monomeric) From Rattus Norvegicus Length = 238 Back     alignment and structure
>pdb|3L1C|A Chain A, Kinesin-14 Protein Ncd, T436s Mutant Length = 383 Back     alignment and structure
>pdb|2GRY|A Chain A, Crystal Structure Of The Human Kif2 Motor Domain In Complex With Adp Length = 420 Back     alignment and structure
>pdb|4H1G|A Chain A, Structure Of Candida Albicans Kar3 Motor Domain Fused To Maltose- Binding Protein Length = 715 Back     alignment and structure
>pdb|4GKR|A Chain A, Structure Of The C-Terminal Motor Domain Of Kar3 From Candida Glabrata Length = 371 Back     alignment and structure
>pdb|3T0Q|A Chain A, Motor Domain Structure Of The Kar3-Like Kinesin From Ashbya Gossypii Length = 349 Back     alignment and structure
>pdb|2REP|A Chain A, Crystal Structure Of The Motor Domain Of Human Kinesin Family Member C1 Length = 376 Back     alignment and structure
>pdb|4ETP|A Chain A, C-Terminal Motor And Motor Homology Domain Of Kar3vik1 Fused To A Synthetic Heterodimeric Coiled Coil Length = 403 Back     alignment and structure
>pdb|1F9T|A Chain A, Crystal Structures Of Kinesin Mutants Reveal A Signalling Pathway For Activation Of The Motor Atpase Length = 358 Back     alignment and structure
>pdb|3KAR|A Chain A, The Motor Domain Of Kinesin-Like Protein Kar3, A Saccharomyces Cerevisiae Kinesin-Related Protein Length = 346 Back     alignment and structure
>pdb|1F9W|A Chain A, Crystal Structures Of Mutants Reveal A Signalling Pathway For Activation Of The Kinesin Motor Atpase Length = 347 Back     alignment and structure
>pdb|1F9U|A Chain A, Crystal Structures Of Mutants Reveal A Signalling Pathway For Activation Of The Kinesin Motor Atpase Length = 347 Back     alignment and structure
>pdb|1F9V|A Chain A, Crystal Structures Of Mutants Reveal A Signalling Pathway For Activation Of The Kinesin Motor Atpase Length = 347 Back     alignment and structure
>pdb|3PXN|A Chain A, Crystal Structure Of The Drosophila Kinesin Family Member Kin10NOD IN Complex With Divalent Manganese And Adp Length = 344 Back     alignment and structure
>pdb|3DC4|A Chain A, Crystal Structure Of The Drosophila Kinesin Family Member Nod In Complex With Adp Length = 344 Back     alignment and structure
>pdb|1RY6|A Chain A, Crystal Structure Of Internal Kinesin Motor Domain Length = 360 Back     alignment and structure
>pdb|2KIN|B Chain B, Kinesin (Monomeric) From Rattus Norvegicus Length = 100 Back     alignment and structure
>pdb|3KIN|B Chain B, Kinesin (Dimeric) From Rattus Norvegicus Length = 117 Back     alignment and structure
>pdb|3EB5|A Chain A, Structure Of The Ciap2 Ring Domain Length = 74 Back     alignment and structure
>pdb|2ECG|A Chain A, Solution Structure Of The Ring Domain Of The Baculoviral Iap Repeat-Containing Protein 4 From Homo Sapiens Length = 75 Back     alignment and structure
>pdb|4IC2|A Chain A, Crystal Structure Of The Xiap Ring Domain Length = 74 Back     alignment and structure
>pdb|4IC3|A Chain A, Crystal Structure Of The F495l Mutant Xiap Ring Domain Length = 74 Back     alignment and structure
>pdb|3T6P|A Chain A, Iap Antagonist-Induced Conformational Change In Ciap1 Promotes E3 Ligase Activation Via Dimerization Length = 345 Back     alignment and structure
>pdb|4AUQ|B Chain B, Structure Of Birc7-Ubch5b-Ub Complex. Length = 62 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1102
1t5c_A349 CENP-E protein, centromeric protein E; kinesin mot 1e-166
2y65_A365 Kinesin, kinesin heavy chain; motor protein; HET: 1e-152
2nr8_A358 Kinesin-like protein KIF9; motor domain, ADP, stru 1e-147
1bg2_A325 Kinesin; motor protein, ATPase, microtubule associ 1e-141
1goj_A355 Kinesin, kinesin heavy chain; motor protein, ATPas 1e-133
3b6u_A372 Kinesin-like protein KIF3B; structural genomics co 1e-133
3bfn_A388 Kinesin-like protein KIF22; limited proteolysis, s 1e-130
4a14_A344 Kinesin, kinesin-like protein KIF7; motor protein, 1e-128
2vvg_A350 Kinesin-2; motor protein, nucleotide-binding, micr 1e-127
3lre_A355 Kinesin-like protein KIF18A; motor protein, nucleo 1e-124
3cob_A369 Kinesin heavy chain-like protein; motor, switch II 1e-123
1x88_A359 Kinesin-like protein KIF11; switch II, motor domai 1e-123
2wbe_C373 Bipolar kinesin KRP-130; EG5, KLP61F, tubulin, mit 1e-122
3gbj_A354 KIF13B protein; kinesin, motor domain, ADP, struct 1e-122
2zfi_A366 Kinesin-like protein KIF1A, kinesin heavy chain is 1e-121
2h58_A330 Kinesin-like protein KIFC3 variant; motor domain, 1e-118
2owm_A443 Nckin3-434, related to kinesin-like protein KIF1C; 1e-117
3dc4_A344 Kinesin-like protein NOD; catalytic domain, ATPase 1e-116
1ry6_A360 Internal kinesin; kinesin motor domain, nucleotide 1e-116
1f9v_A347 Kinesin-like protein KAR3; kinesin-related protein 1e-115
3u06_A412 Protein claret segregational; motor domain, stalk 1e-113
2heh_A387 KIF2C protein; kinesin, motor domain, ADP, structu 1e-111
4etp_A403 Kinesin-like protein KAR3; kinesin motor protein, 1e-111
3t0q_A349 AGR253WP; kinesin, alpha and beta proteins, P-loop 1e-111
1v8k_A410 Kinesin-like protein KIF2C; microtubule destabiliz 1e-111
2rep_A376 Kinesin-like protein KIFC1; structural genomics co 1e-108
3kin_B117 Kinesin heavy chain; motor protein, cytoskeleton; 6e-42
2kin_B100 Kinesin; motor protein, cytoskeleton; HET: ADP; 2. 3e-40
2yho_A79 E3 ubiquitin-protein ligase mylip; ligase, E2 liga 2e-20
2ecg_A75 Baculoviral IAP repeat-containing protein 4; BIRC4 3e-20
2ea5_A68 Cell growth regulator with ring finger domain prot 4e-20
3t6p_A345 Baculoviral IAP repeat-containing protein 2; ring, 3e-16
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-16
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-10
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-09
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 8e-07
2vje_B63 MDM4 protein; proto-oncogene, phosphorylation, alt 5e-14
2vje_A64 E3 ubiquitin-protein ligase MDM2; proto-oncogene, 6e-13
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 3e-12
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 2e-08
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 3e-07
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 1e-04
2d8t_A71 Dactylidin, ring finger protein 146; RNF146, ring 8e-08
2y1n_A389 E3 ubiquitin-protein ligase; ligase-transferase co 7e-07
1bor_A56 Transcription factor PML; proto-oncogene, nuclear 5e-06
2ecy_A66 TNF receptor-associated factor 3; metal binding pr 1e-05
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 1e-05
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 4e-05
3hct_A118 TNF receptor-associated factor 6; cross-brace, bet 2e-05
2csy_A81 Zinc finger protein 183-like 1; ring finger protei 2e-05
1chc_A68 Equine herpes virus-1 ring domain; viral protein; 5e-05
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 9e-05
2ecm_A55 Ring finger and CHY zinc finger domain- containing 1e-04
4epo_C149 E3 ubiquitin-protein ligase RNF8; coiled-coil, E3 1e-04
3k1f_M197 Transcription initiation factor IIB; RNA polymeras 1e-04
3k1f_M 197 Transcription initiation factor IIB; RNA polymeras 6e-04
1c1g_A284 Tropomyosin; contractIle protein; 7.00A {Sus scrof 2e-04
1c1g_A284 Tropomyosin; contractIle protein; 7.00A {Sus scrof 3e-04
1c1g_A284 Tropomyosin; contractIle protein; 7.00A {Sus scrof 3e-04
1c1g_A284 Tropomyosin; contractIle protein; 7.00A {Sus scrof 5e-04
2ea6_A69 Ring finger protein 4; RNF4, RES4-26, ring domain, 2e-04
3vkg_A 3245 Dynein heavy chain, cytoplasmic; AAA+ protein, mol 2e-04
2ecn_A70 Ring finger protein 141; RNF141, ring domain, zinc 3e-04
2djb_A72 Polycomb group ring finger protein 6; PCGF6, ring 3e-04
3knv_A141 TNF receptor-associated factor 2; cross-brace, alt 3e-04
3l11_A115 E3 ubiquitin-protein ligase RNF168; E3 ligase, rin 4e-04
2xeu_A64 Ring finger protein 4; transcription, zinc-finger, 7e-04
2kiz_A69 E3 ubiquitin-protein ligase arkadia; ring-H2 finge 7e-04
>1t5c_A CENP-E protein, centromeric protein E; kinesin motor-domain-ADP complex, stranded beta-sheet core with solvent exposed alpha-helices; HET: ADP PIN; 2.50A {Homo sapiens} Length = 349 Back     alignment and structure
 Score =  493 bits (1272), Expect = e-166
 Identities = 152/349 (43%), Positives = 217/349 (62%), Gaps = 10/349 (2%)

Query: 98  SGDSISVTIRFRPLSEREFQRGDEIAWYADGDKIVRNEYNPATAYAFDRVFGPHANSQEV 157
              +++V +R RPL+ RE   G+    Y   D  V  + + + ++ FDRVF  +  ++ V
Sbjct: 2   EEGAVAVCVRVRPLNSREESLGETAQVYWKTDNNVIYQVDGSKSFNFDRVFHGNETTKNV 61

Query: 158 YDVAARPVVKAAMEGVNGTVFAYGVTSSGKTHTMHGDQNSPGIIPLAIKDVFSIIQDTPG 217
           Y+  A P++ +A++G NGT+FAYG T+SGKT+TM G ++  G+IP AI D+F  I+  P 
Sbjct: 62  YEEIAAPIIDSAIQGYNGTIFAYGQTASGKTYTMMGSEDHLGVIPRAIHDIFQKIKKFPD 121

Query: 218 REFLLRVSYLEIYNEVINDLLDPT--GQNLRVREDA-QGTYVEGIKEEVVLSPGHALSFI 274
           REFLLRVSY+EIYNE I DLL  T   + L +RED  +  YV  + EEVV +   AL +I
Sbjct: 122 REFLLRVSYMEIYNETITDLLCGTQKMKPLIIREDVNRNVYVADLTEEVVYTSEMALKWI 181

Query: 275 AAGEEHRHVGSNNFNLLSSRSHTIFTLMIESSDHGDEYDG---VIFSQLNLIDLAGSE-S 330
             GE+ RH G    N  SSRSHTIF +++ES + G+  +    V  S LNL+DLAGSE +
Sbjct: 182 TKGEKSRHYGETKMNQRSSRSHTIFRMILESREKGEPSNCEGSVKVSHLNLVDLAGSERA 241

Query: 331 SKTETTGLRRKEGSYINKSLLTLGTVIGKLSEGK-ASHVPYRDSKLTRLLQSSLSGHGHV 389
           ++T   G+R KEG  IN+SL  LG VI KLS+G+    + YRDSKLTR+LQ+SL G+   
Sbjct: 242 AQTGAAGVRLKEGCNINRSLFILGQVIKKLSDGQVGGFINYRDSKLTRILQNSLGGNAKT 301

Query: 390 SLICTVTPASSSMEETHNTLKFASRAKRVEIYASRNKIIDEKSLIKKYQ 438
            +ICT+TP   S +ET   L+FAS AK ++     N++  ++     + 
Sbjct: 302 RIICTITPV--SFDETLTALQFASTAKYMKNTPYVNEVSTDELEHHHHH 348


>2y65_A Kinesin, kinesin heavy chain; motor protein; HET: ADP; 2.20A {Drosophila melanogaster} PDB: 2y5w_A* Length = 365 Back     alignment and structure
>1bg2_A Kinesin; motor protein, ATPase, microtubule associated; HET: ADP; 1.80A {Homo sapiens} SCOP: c.37.1.9 PDB: 2p4n_K* 1mkj_A* 2kin_A* 3kin_A* Length = 325 Back     alignment and structure
>1goj_A Kinesin, kinesin heavy chain; motor protein, ATPase; HET: ADP; 2.3A {Neurospora crassa} SCOP: c.37.1.9 Length = 355 Back     alignment and structure
>3b6u_A Kinesin-like protein KIF3B; structural genomics consortium, motor domain, ADP, SGC, ATP-binding, coiled coil, microtubule, motor protein; HET: ADP; 1.80A {Homo sapiens} PDB: 3b6v_A* Length = 372 Back     alignment and structure
>3bfn_A Kinesin-like protein KIF22; limited proteolysis, structural genomics consortium domain, ADP, SGC, ATP-binding, DNA-binding, microtubule, MO protein; HET: ADP; 2.30A {Homo sapiens} Length = 388 Back     alignment and structure
>4a14_A Kinesin, kinesin-like protein KIF7; motor protein, motor domain; HET: ADP; 1.60A {Homo sapiens} PDB: 2xt3_A* Length = 344 Back     alignment and structure
>2vvg_A Kinesin-2; motor protein, nucleotide-binding, microtubule, ATP-binding; HET: ADP; 1.60A {Giardia intestinalis} Length = 350 Back     alignment and structure
>3lre_A Kinesin-like protein KIF18A; motor protein, nucleotide binding, microtubule binding, ATP- cell projection, cytoskeleton, glycoprotein, microtubule; HET: ADP; 2.20A {Homo sapiens} Length = 355 Back     alignment and structure
>3cob_A Kinesin heavy chain-like protein; motor, switch II, loop L11, conformation, nucleotide, ATP-binding, microtubule, motor protein; HET: ADP; 2.20A {Solanum tuberosum} SCOP: c.37.1.9 PDB: 3cnz_A* 1sdm_A* 3h4s_A* Length = 369 Back     alignment and structure
>1x88_A Kinesin-like protein KIF11; switch II, motor domain, NECK linker, cell cycle; HET: ADP NAT; 1.80A {Homo sapiens} SCOP: c.37.1.9 PDB: 3hqd_A* 3ken_A* 2pg2_A* 1yrs_A* 2fme_A* 2g1q_A* 2gm1_A* 1ii6_A* 2uyi_A* 2uym_A* 2wog_A* 2x2r_A* 2x7c_A* 2x7d_A* 2x7e_A* 2xae_A* 3k3b_A* 3k5e_A* 3l9h_A* 1q0b_A* ... Length = 359 Back     alignment and structure
>2wbe_C Bipolar kinesin KRP-130; EG5, KLP61F, tubulin, mitosis, GTP-binding, motor protein, cell division, cell cycle, microtubule, ATP-binding; HET: GTP ANP GDP TA1; 9.40A {Drosophila melanogaster} Length = 373 Back     alignment and structure
>3gbj_A KIF13B protein; kinesin, motor domain, ADP, structural genomics, structural genomics consortium, SGC, ATP-binding, microtubule, motor protein; HET: ADP; 2.10A {Homo sapiens} Length = 354 Back     alignment and structure
>2zfi_A Kinesin-like protein KIF1A, kinesin heavy chain isoform 5C; alpha and beta protein, enzyme, ATPase, P-loop, motor protein, ATP-binding, coiled coil; HET: ADP; 1.55A {Mus musculus} SCOP: c.37.1.9 PDB: 1vfw_A* 1vfx_A* 1vfz_A* 1vfv_A* 2zfj_A* 2zfk_A* 2zfl_A* 2zfm_A* 1i5s_A* 1i6i_A* 2hxf_C* 1ia0_K* 2hxh_C* Length = 366 Back     alignment and structure
>2h58_A Kinesin-like protein KIFC3 variant; motor domain, ADP, structural genomics, structur Al genomics consortium, SGC; HET: ADP; 1.85A {Homo sapiens} Length = 330 Back     alignment and structure
>2owm_A Nckin3-434, related to kinesin-like protein KIF1C; motor domain, ADP, NECK linker, motor PR; HET: ADP; 3.25A {Neurospora crassa} Length = 443 Back     alignment and structure
>3dc4_A Kinesin-like protein NOD; catalytic domain, ATPase, microtubule, ADP, nucleotide-binding protein, ATP-binding, coiled coil, motor protein; HET: ADP; 1.90A {Drosophila melanogaster} PDB: 3dcb_A* 3dco_N* 3pxn_A* Length = 344 Back     alignment and structure
>1ry6_A Internal kinesin; kinesin motor domain, nucleotide-free, transport protein; 1.60A {Plasmodium falciparum} SCOP: c.37.1.9 Length = 360 Back     alignment and structure
>1f9v_A Kinesin-like protein KAR3; kinesin-related protein, motor protein, microtubinding proteinbule, contractIle protein; HET: ADP; 1.30A {Saccharomyces cerevisiae} SCOP: c.37.1.9 PDB: 1f9t_A* 1f9w_A* 1f9u_A* 3kar_A* Length = 347 Back     alignment and structure
>3u06_A Protein claret segregational; motor domain, stalk rotation, power stroke, kinesin-14, MICR binding, NCD, transport, molecular motor; HET: ADP GOL; 2.35A {Drosophila melanogaster} PDB: 2ncd_A* 1n6m_A* 1cz7_A* 3l1c_A* Length = 412 Back     alignment and structure
>2heh_A KIF2C protein; kinesin, motor domain, ADP, structural genomics, structural genomics consortium, SGC, structural protein; HET: ADP; 2.15A {Homo sapiens} PDB: 3edl_D* Length = 387 Back     alignment and structure
>4etp_A Kinesin-like protein KAR3; kinesin motor protein, kinesin motor homology domain, karyog mitosis, microtubules; HET: ADP EBC; 2.30A {Saccharomyces cerevisiae} Length = 403 Back     alignment and structure
>3t0q_A AGR253WP; kinesin, alpha and beta proteins, P-loop containing nucleosi triphosphate hydrolases, microtubule motor protein; HET: ADP; 2.35A {Ashbya gossypii} Length = 349 Back     alignment and structure
>1v8k_A Kinesin-like protein KIF2C; microtubule destabilizer, structural P; HET: ANP; 2.25A {Mus musculus} SCOP: c.37.1.9 PDB: 1v8j_A* 2gry_A* Length = 410 Back     alignment and structure
>2rep_A Kinesin-like protein KIFC1; structural genomics consortium, motor domain, ADP, binding, cell cycle, cell division, endosome, microtubule; HET: ADP; 2.60A {Homo sapiens} Length = 376 Back     alignment and structure
>3kin_B Kinesin heavy chain; motor protein, cytoskeleton; HET: ADP; 3.10A {Rattus norvegicus} SCOP: c.37.1.9 Length = 117 Back     alignment and structure
>2kin_B Kinesin; motor protein, cytoskeleton; HET: ADP; 2.00A {Rattus norvegicus} SCOP: c.37.1.9 Length = 100 Back     alignment and structure
>2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A Length = 79 Back     alignment and structure
>2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 75 Back     alignment and structure
>2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 68 Back     alignment and structure
>3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A Length = 345 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* Length = 63 Back     alignment and structure
>2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A Length = 64 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 71 Back     alignment and structure
>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Length = 389 Back     alignment and structure
>1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 56 Back     alignment and structure
>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 66 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 Back     alignment and structure
>3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Length = 118 Back     alignment and structure
>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81 Back     alignment and structure
>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Length = 68 Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Length = 170 Back     alignment and structure
>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Length = 55 Back     alignment and structure
>4epo_C E3 ubiquitin-protein ligase RNF8; coiled-coil, E3 ubiquitin ligase, protein binding complex; 4.80A {Homo sapiens} Length = 149 Back     alignment and structure
>3k1f_M Transcription initiation factor IIB; RNA polymerase II, TFIIB, transcription factor, DNA-binding, DNA-directed RNA polymerase; 4.30A {Saccharomyces cerevisiae} Length = 197 Back     alignment and structure
>3k1f_M Transcription initiation factor IIB; RNA polymerase II, TFIIB, transcription factor, DNA-binding, DNA-directed RNA polymerase; 4.30A {Saccharomyces cerevisiae} Length = 197 Back     alignment and structure
>1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Length = 284 Back     alignment and structure
>1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Length = 284 Back     alignment and structure
>1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Length = 284 Back     alignment and structure
>1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Length = 284 Back     alignment and structure
>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 69 Back     alignment and structure
>3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* 3vkh_C* Length = 3245 Back     alignment and structure
>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} Length = 141 Back     alignment and structure
>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, chromosomal protein, DNA repair, metal-binding; 2.12A {Homo sapiens} Length = 115 Back     alignment and structure
>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Length = 64 Back     alignment and structure
>2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} Length = 69 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query1102
2y65_A365 Kinesin, kinesin heavy chain; motor protein; HET: 100.0
3cob_A369 Kinesin heavy chain-like protein; motor, switch II 100.0
3b6u_A372 Kinesin-like protein KIF3B; structural genomics co 100.0
2vvg_A350 Kinesin-2; motor protein, nucleotide-binding, micr 100.0
1goj_A355 Kinesin, kinesin heavy chain; motor protein, ATPas 100.0
3bfn_A388 Kinesin-like protein KIF22; limited proteolysis, s 100.0
1t5c_A349 CENP-E protein, centromeric protein E; kinesin mot 100.0
2owm_A443 Nckin3-434, related to kinesin-like protein KIF1C; 100.0
2zfi_A366 Kinesin-like protein KIF1A, kinesin heavy chain is 100.0
1bg2_A325 Kinesin; motor protein, ATPase, microtubule associ 100.0
3lre_A355 Kinesin-like protein KIF18A; motor protein, nucleo 100.0
1x88_A359 Kinesin-like protein KIF11; switch II, motor domai 100.0
2wbe_C373 Bipolar kinesin KRP-130; EG5, KLP61F, tubulin, mit 100.0
4a14_A344 Kinesin, kinesin-like protein KIF7; motor protein, 100.0
3gbj_A354 KIF13B protein; kinesin, motor domain, ADP, struct 100.0
3nwn_A359 Kinesin-like protein KIF9; motor domain, ADP, stru 100.0
2h58_A330 Kinesin-like protein KIFC3 variant; motor domain, 100.0
2nr8_A358 Kinesin-like protein KIF9; motor domain, ADP, stru 100.0
3t0q_A349 AGR253WP; kinesin, alpha and beta proteins, P-loop 100.0
2rep_A376 Kinesin-like protein KIFC1; structural genomics co 100.0
1f9v_A347 Kinesin-like protein KAR3; kinesin-related protein 100.0
1ry6_A360 Internal kinesin; kinesin motor domain, nucleotide 100.0
2heh_A387 KIF2C protein; kinesin, motor domain, ADP, structu 100.0
3u06_A412 Protein claret segregational; motor domain, stalk 100.0
1v8k_A410 Kinesin-like protein KIF2C; microtubule destabiliz 100.0
4etp_A403 Kinesin-like protein KAR3; kinesin motor protein, 100.0
3dc4_A344 Kinesin-like protein NOD; catalytic domain, ATPase 100.0
4h1g_A715 Maltose binding protein-cakar3 motor domain fusio; 100.0
2kin_B100 Kinesin; motor protein, cytoskeleton; HET: ADP; 2. 99.96
3kin_B117 Kinesin heavy chain; motor protein, cytoskeleton; 99.94
2o0a_A298 S.cerevisiae chromosome XVI reading frame ORF YPL2 99.89
2ea5_A68 Cell growth regulator with ring finger domain prot 99.19
2yho_A79 E3 ubiquitin-protein ligase mylip; ligase, E2 liga 99.14
2vje_B63 MDM4 protein; proto-oncogene, phosphorylation, alt 99.07
4ic3_A74 E3 ubiquitin-protein ligase XIAP; ring domain, zin 99.05
2ecg_A75 Baculoviral IAP repeat-containing protein 4; BIRC4 99.0
2vje_A64 E3 ubiquitin-protein ligase MDM2; proto-oncogene, 98.97
3t6p_A345 Baculoviral IAP repeat-containing protein 2; ring, 98.73
4ayc_A138 E3 ubiquitin-protein ligase RNF8; DNA damage, K63 98.28
1chc_A68 Equine herpes virus-1 ring domain; viral protein; 98.15
2ecn_A70 Ring finger protein 141; RNF141, ring domain, zinc 98.15
2d8t_A71 Dactylidin, ring finger protein 146; RNF146, ring 98.14
2ysl_A73 Tripartite motif-containing protein 31; ring-type 98.11
2csy_A81 Zinc finger protein 183-like 1; ring finger protei 98.1
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 98.05
1c1g_A284 Tropomyosin; contractIle protein; 7.00A {Sus scrof 98.05
2y1n_A389 E3 ubiquitin-protein ligase; ligase-transferase co 98.04
2xeu_A64 Ring finger protein 4; transcription, zinc-finger, 98.03
2ecm_A55 Ring finger and CHY zinc finger domain- containing 98.02
2ea6_A69 Ring finger protein 4; RNF4, RES4-26, ring domain, 98.02
2egp_A79 Tripartite motif-containing protein 34; ZF-C3HC4 d 97.99
3ng2_A71 RNF4, snurf, ring finger protein 4; ring domain, E 97.99
2ct2_A88 Tripartite motif protein 32; zinc-finger protein H 97.97
2ecw_A85 Tripartite motif-containing protein 30; metal bind 97.97
2kiz_A69 E3 ubiquitin-protein ligase arkadia; ring-H2 finge 97.96
2djb_A72 Polycomb group ring finger protein 6; PCGF6, ring 97.95
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 97.93
1bor_A56 Transcription factor PML; proto-oncogene, nuclear 97.92
3fl2_A124 E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA 97.92
1c1g_A284 Tropomyosin; contractIle protein; 7.00A {Sus scrof 97.91
2ecv_A85 Tripartite motif-containing protein 5; metal bindi 97.91
2ecy_A66 TNF receptor-associated factor 3; metal binding pr 97.91
1e4u_A78 Transcriptional repressor NOT4; gene regulation, t 97.89
1iym_A55 EL5; ring-H2 finger, ubiquitin ligase, DNA binding 97.88
2l0b_A91 E3 ubiquitin-protein ligase praja-1; zinc finger, 97.87
1jm7_A112 BRCA1, breast cancer type 1 susceptibility protein 97.85
2yur_A74 Retinoblastoma-binding protein 6; P53-associated c 97.85
2ect_A78 Ring finger protein 126; metal binding protein, st 97.83
2ep4_A74 Ring finger protein 24; zinc binding, ubiquitin, E 97.82
1x4j_A75 Ring finger protein 38; structural genomics, NPPSF 97.82
3ztg_A92 E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR 97.79
1g25_A65 CDK-activating kinase assembly factor MAT1; ring f 97.75
3l11_A115 E3 ubiquitin-protein ligase RNF168; E3 ligase, rin 97.74
3lrq_A100 E3 ubiquitin-protein ligase TRIM37; structural gen 97.73
1z6u_A150 NP95-like ring finger protein isoform B; structura 97.72
1t1h_A78 Gspef-atpub14, armadillo repeat containing protein 97.69
2ckl_B165 Ubiquitin ligase protein RING2; BMI1, RING1B, poly 97.67
2y43_A99 E3 ubiquitin-protein ligase RAD18; DNA repair, met 97.66
2ckl_A108 Polycomb group ring finger protein 4; BMI1, RING1B 97.64
2ysj_A63 Tripartite motif-containing protein 31; ring-type 97.59
1jm7_B117 BARD1, BRCA1-associated ring domain protein 1; rin 97.58
2ecj_A58 Tripartite motif-containing protein 39; TRIM39, ri 97.57
3hct_A118 TNF receptor-associated factor 6; cross-brace, bet 97.51
1wt6_A81 Myotonin-protein kinase; coiled-coil, kinase activ 97.49
1v87_A114 Deltex protein 2; ring-H2 domain, zinc-binding dom 97.42
1rmd_A116 RAG1; V(D)J recombination, antibody, MAD, ring fin 97.32
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 97.29
3na7_A256 HP0958; flagellar biogenesis, flagellum export, C4 97.22
2kre_A100 Ubiquitin conjugation factor E4 B; U-box domain, E 97.2
2ecl_A81 Ring-box protein 2; RNF7, ring domian, zinc-bindin 97.19
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 97.18
2kr4_A85 Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri 97.16
1wgm_A98 Ubiquitin conjugation factor E4A; ubiquitinating e 97.14
3knv_A141 TNF receptor-associated factor 2; cross-brace, alt 97.13
2f42_A179 STIP1 homology and U-box containing protein 1; cha 97.1
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 97.05
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 96.82
3vkg_A 3245 Dynein heavy chain, cytoplasmic; AAA+ protein, mol 96.81
3dpl_R106 Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST 96.72
2v71_A189 Nuclear distribution protein NUDE-like 1; developm 96.61
4a0k_B117 E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi 96.4
2yu4_A94 E3 SUMO-protein ligase NSE2; SP-ring domain, struc 96.35
3na7_A256 HP0958; flagellar biogenesis, flagellum export, C4 95.98
1wim_A94 KIAA0161 protein; ring finger domain, UBCM4-intera 95.88
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 95.86
3htk_C267 E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- 95.68
2d8s_A80 Cellular modulator of immune recognition; C-MIR, m 95.62
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 95.57
3vk6_A101 E3 ubiquitin-protein ligase hakai; HYB, phosphotyr 95.18
3vkg_A 3245 Dynein heavy chain, cytoplasmic; AAA+ protein, mol 95.03
2efr_A155 General control protein GCN4 and tropomyosin 1 Al; 94.66
3o0z_A168 RHO-associated protein kinase 1; coiled-coil, tran 94.11
2ocy_A154 RAB guanine nucleotide exchange factor SEC2; RAB, 93.95
2bay_A61 PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin l 93.4
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 93.0
3ec2_A180 DNA replication protein DNAC; helicase loader, rep 92.8
2v71_A189 Nuclear distribution protein NUDE-like 1; developm 92.61
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 92.56
3nmd_A72 CGMP dependent protein kinase; leucine zipper, coi 92.0
3o0z_A168 RHO-associated protein kinase 1; coiled-coil, tran 91.6
2w58_A202 DNAI, primosome component (helicase loader); ATP-b 91.25
2qgz_A308 Helicase loader, putative primosome component; str 90.39
4gkw_A167 Spindle assembly abnormal protein 6; double helix, 90.21
3s9g_A104 Protein hexim1; cyclin T-binding domain (TBD), cyc 88.49
2ocy_A154 RAB guanine nucleotide exchange factor SEC2; RAB, 87.24
3i00_A120 HIP-I, huntingtin-interacting protein 1; transcrip 86.5
3s4r_A93 Vimentin; alpha-helix, cytoskeleton, intermediate 86.42
3t15_A293 Ribulose bisphosphate carboxylase/oxygenase activ 86.03
4gkw_A167 Spindle assembly abnormal protein 6; double helix, 85.97
2jee_A81 YIIU; FTSZ, septum, coiled-coil, cell division, ce 85.85
2v4h_A110 NF-kappa-B essential modulator; transcription, met 85.48
3k1l_B381 Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A 84.82
3u1c_A101 Tropomyosin alpha-1 chain; anti-parallel coiled co 83.69
4b4t_M434 26S protease regulatory subunit 6A; hydrolase, AAA 83.25
1vyx_A60 ORF K3, K3RING; zinc-binding protein, ring domain, 82.75
2bjv_A265 PSP operon transcriptional activator; AAA, transcr 82.69
4etp_B333 Spindle POLE BODY-associated protein VIK1; kinesin 82.41
2jee_A81 YIIU; FTSZ, septum, coiled-coil, cell division, ce 82.4
2r62_A268 Cell division protease FTSH homolog; ATPase domain 82.18
3hnw_A138 Uncharacterized protein; coiled-coil, structural g 82.1
3s84_A273 Apolipoprotein A-IV; four helix bundle, transport 81.94
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 81.17
3tnu_B129 Keratin, type II cytoskeletal 5; coiled-coil, stru 81.13
4b4t_K428 26S protease regulatory subunit 6B homolog; hydrol 80.78
1jbk_A195 CLPB protein; beta barrel, chaperone; 1.80A {Esche 80.65
>2y65_A Kinesin, kinesin heavy chain; motor protein; HET: ADP; 2.20A {Drosophila melanogaster} PDB: 2y5w_A* Back     alignment and structure
Probab=100.00  E-value=1.4e-88  Score=776.59  Aligned_cols=343  Identities=41%  Similarity=0.633  Sum_probs=292.6

Q ss_pred             CCCCCEEEEEEeCCCChhhhhcCCeEEEeeC----CCEEEecCCCCCcceeeceecCCCCChhHHHhhhhHHHHHHHhcC
Q 001316           97 RSGDSISVTIRFRPLSEREFQRGDEIAWYAD----GDKIVRNEYNPATAYAFDRVFGPHANSQEVYDVAARPVVKAAMEG  172 (1102)
Q Consensus        97 ~~~~~I~V~vRvRP~~~~E~~~~~~~~~~~~----~~~~~~~~~~~~~~f~FD~VF~~~~~q~~Vy~~~~~plV~~~l~G  172 (1102)
                      ..+++|+|+||+||++++|...+...++..+    ...+...    .+.|.||+||+++++|++||+.++.|+|+++|+|
T Consensus         8 ~~~~~i~V~vRvRP~~~~E~~~~~~~~v~~~~~~~~~~i~~~----~~~f~FD~Vf~~~~~Q~~Vy~~~~~plv~~~l~G   83 (365)
T 2y65_A            8 PAEDSIKVVCRFRPLNDSEEKAGSKFVVKFPNNVEENCISIA----GKVYLFDKVFKPNASQEKVYNEAAKSIVTDVLAG   83 (365)
T ss_dssp             CCEEECEEEEEECCCCHHHHHTTCCBCEECCSSSTTCEEEET----TEEEECSEEECTTCCHHHHHHHHTHHHHHHHHTT
T ss_pred             CCCCCeEEEEEcCcCChhHhccCCceEEEeCCCCCCcEEEEC----CEEEeCceEecCCCCHHHHHHHhhhhHHHHHhCC
Confidence            4578999999999999999887766544433    2344332    4689999999999999999999999999999999


Q ss_pred             CceeEEeeccCCCCCccccCCCCC---CCCchhhHHHHHHHHhhcC-CCceeEEEeehhhhhcceeeecCCCCCCcceEE
Q 001316          173 VNGTVFAYGVTSSGKTHTMHGDQN---SPGIIPLAIKDVFSIIQDT-PGREFLLRVSYLEIYNEVINDLLDPTGQNLRVR  248 (1102)
Q Consensus       173 ~N~tIfaYGqTgSGKT~Tm~G~~~---~~GIipr~~~~LF~~i~~~-~~~~~~v~vS~lEIYnE~i~DLL~~~~~~l~ir  248 (1102)
                      ||+||||||||||||||||+|+..   .+|||||++++||..+... .+..|.|+|||+|||||+|+|||++....+.|+
T Consensus        84 ~n~tifAYGqTGSGKTyTm~G~~~~~~~~Giipr~~~~lF~~i~~~~~~~~~~v~vS~~EIYnE~i~DLL~~~~~~l~i~  163 (365)
T 2y65_A           84 YNGTIFAYGQTSSGKTHTMEGVIGDSVKQGIIPRIVNDIFNHIYAMEVNLEFHIKVSYYEIYMDKIRDLLDVSKVNLSVH  163 (365)
T ss_dssp             CCEEEEEECSTTSSHHHHHTBSTTCTTTBCHHHHHHHHHHHHHHHCCSCEEEEEEEEEEEEETTEEEETTCTTCCSBCEE
T ss_pred             CceEEEeecCCCCCCceEEecCCCCcccCChHHHHHHHHHHHHHhccCCceEEEEEEEEEEECCeeeecccCCcCCceEE
Confidence            999999999999999999999654   5699999999999999764 456899999999999999999999998899999


Q ss_pred             eCC-CCcEeeCceEEEeCChHHHHHHHHHHhhhcccCCCccccCCCCceeEEEEEEEEecCCCCCCcEEEEEEEEeecCC
Q 001316          249 EDA-QGTYVEGIKEEVVLSPGHALSFIAAGEEHRHVGSNNFNLLSSRSHTIFTLMIESSDHGDEYDGVIFSQLNLIDLAG  327 (1102)
Q Consensus       249 e~~-~g~~v~gl~e~~V~s~~e~~~ll~~g~~~R~~~~t~~N~~SSRSH~If~i~v~~~~~~~~~~~~~~skL~lVDLAG  327 (1102)
                      +++ .|++|.|++++.|.|++|++.+|..|..+|++++|.||..|||||+||+|+|.+.....  .....|+|+||||||
T Consensus       164 e~~~~~~~v~gl~~~~V~s~~e~~~ll~~g~~~R~~~~T~~N~~SSRSH~if~i~v~~~~~~~--~~~~~skL~lVDLAG  241 (365)
T 2y65_A          164 EDKNRVPYVKGATERFVSSPEDVFEVIEEGKSNRHIAVTNMNEHSSRSHSVFLINVKQENLEN--QKKLSGKLYLVDLAG  241 (365)
T ss_dssp             ECSSSCEEETTCCCEEECSHHHHHHHHHHHHHHHTTTCSCHHHHHHTSEEEEEEEEEEEETTT--CCEEEEEEEEEECCC
T ss_pred             ECCCCCEEecCCEEEecCCHHHHHHHHHHHHhhcccccccCCCCCCCceEEEEEEEEEEecCC--CCEeEEEEEEEECCC
Confidence            998 57899999999999999999999999999999999999999999999999999876433  346789999999999


Q ss_pred             CCC-cccccchhhhhhhHHHhhhHHHHHHHHHHhhcCCCCCccCCCCcchhhhhccCCCCccceEEEeeCCCCCCHHHHH
Q 001316          328 SES-SKTETTGLRRKEGSYINKSLLTLGTVIGKLSEGKASHVPYRDSKLTRLLQSSLSGHGHVSLICTVTPASSSMEETH  406 (1102)
Q Consensus       328 SEr-~kt~~~g~r~kE~~~INkSL~aLg~vI~aL~~~k~~hvPYRdSkLTrLLqdsLgGnskt~~I~~isP~~~~~~ETl  406 (1102)
                      ||| .++++.|.|++|+.+||+||++||+||.+|++++..|||||||||||||||+|||||+|+|||||||+..+++||+
T Consensus       242 SEr~~~t~~~g~rl~E~~~INkSL~aLg~vI~aL~~~~~~hvPyRdSkLT~lLqdsLgGnskt~mI~~isP~~~~~~ETl  321 (365)
T 2y65_A          242 SEKVSKTGAEGTVLDEAKNINKSLSALGNVISALADGNKTHIPYRDSKLTRILQESLGGNARTTIVICCSPASFNESETK  321 (365)
T ss_dssp             CCC----------------CCHHHHHHHHHHHHHHHCCCSCCCGGGCHHHHHTGGGTTSSSEEEEEEEECCBGGGHHHHH
T ss_pred             CCcchhcCCcchhHHHHHHHHHHHHHHHHHHHHHhcCCCCCCccccCHHHHHHHhhcCCCccEEEEEEecCccCCHHHHH
Confidence            999 5689999999999999999999999999999987789999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHhcccccccccccccCHHHHHHHHHHHHHHHH
Q 001316          407 NTLKFASRAKRVEIYASRNKIIDEKSLIKKYQREISSLK  445 (1102)
Q Consensus       407 sTLrfA~rak~I~~~~~~n~~~~~~~~i~~~~~ei~~Lk  445 (1102)
                      +||+||+|||+|+|.|.+|+..+.+.++++|++|+..|+
T Consensus       322 ~TL~fA~rak~I~n~~~~n~~~~~~~~~~~~~~e~~~~~  360 (365)
T 2y65_A          322 STLDFGRRAKTVKNVVCVNEELTAEEWKRRYEKEKEKNA  360 (365)
T ss_dssp             HHHHHHHHHTTCEEECCCEEECCSHHHHHC---------
T ss_pred             HHHHHHHHHhcccCcceeCCCCCHHHHHHHHHHHHHHHH
Confidence            999999999999999999999888888888888887665



>3cob_A Kinesin heavy chain-like protein; motor, switch II, loop L11, conformation, nucleotide, ATP-binding, microtubule, motor protein; HET: ADP; 2.20A {Solanum tuberosum} SCOP: c.37.1.9 PDB: 3cnz_A* 1sdm_A* 3h4s_A* Back     alignment and structure
>3b6u_A Kinesin-like protein KIF3B; structural genomics consortium, motor domain, ADP, SGC, ATP-binding, coiled coil, microtubule, motor protein; HET: ADP; 1.80A {Homo sapiens} PDB: 3b6v_A* Back     alignment and structure
>2vvg_A Kinesin-2; motor protein, nucleotide-binding, microtubule, ATP-binding; HET: ADP; 1.60A {Giardia intestinalis} Back     alignment and structure
>1goj_A Kinesin, kinesin heavy chain; motor protein, ATPase; HET: ADP; 2.3A {Neurospora crassa} SCOP: c.37.1.9 Back     alignment and structure
>3bfn_A Kinesin-like protein KIF22; limited proteolysis, structural genomics consortium domain, ADP, SGC, ATP-binding, DNA-binding, microtubule, MO protein; HET: ADP; 2.30A {Homo sapiens} Back     alignment and structure
>1t5c_A CENP-E protein, centromeric protein E; kinesin motor-domain-ADP complex, stranded beta-sheet core with solvent exposed alpha-helices; HET: ADP PIN; 2.50A {Homo sapiens} Back     alignment and structure
>2owm_A Nckin3-434, related to kinesin-like protein KIF1C; motor domain, ADP, NECK linker, motor PR; HET: ADP; 3.25A {Neurospora crassa} Back     alignment and structure
>2zfi_A Kinesin-like protein KIF1A, kinesin heavy chain isoform 5C; alpha and beta protein, enzyme, ATPase, P-loop, motor protein, ATP-binding, coiled coil; HET: ADP; 1.55A {Mus musculus} SCOP: c.37.1.9 PDB: 1vfw_A* 1vfx_A* 1vfz_A* 1vfv_A* 2zfj_A* 2zfk_A* 2zfl_A* 2zfm_A* 1i5s_A* 1i6i_A* 2hxf_C* 1ia0_K* 2hxh_C* Back     alignment and structure
>1bg2_A Kinesin; motor protein, ATPase, microtubule associated; HET: ADP; 1.80A {Homo sapiens} SCOP: c.37.1.9 PDB: 2p4n_K* 1mkj_A* 2kin_A* 3kin_A* Back     alignment and structure
>3lre_A Kinesin-like protein KIF18A; motor protein, nucleotide binding, microtubule binding, ATP- cell projection, cytoskeleton, glycoprotein, microtubule; HET: ADP; 2.20A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>1x88_A Kinesin-like protein KIF11; switch II, motor domain, NECK linker, cell cycle; HET: ADP NAT; 1.80A {Homo sapiens} SCOP: c.37.1.9 PDB: 3hqd_A* 3ken_A* 2pg2_A* 1yrs_A* 2fme_A* 2g1q_A* 2gm1_A* 1ii6_A* 2uyi_A* 2uym_A* 2wog_A* 2x2r_A* 2x7c_A* 2x7d_A* 2x7e_A* 2xae_A* 3k3b_A* 3k5e_A* 3l9h_A* 1q0b_A* ... Back     alignment and structure
>2wbe_C Bipolar kinesin KRP-130; EG5, KLP61F, tubulin, mitosis, GTP-binding, motor protein, cell division, cell cycle, microtubule, ATP-binding; HET: GTP ANP GDP TA1; 9.40A {Drosophila melanogaster} Back     alignment and structure
>4a14_A Kinesin, kinesin-like protein KIF7; motor protein, motor domain; HET: ADP; 1.60A {Homo sapiens} SCOP: c.37.1.0 PDB: 2xt3_A* Back     alignment and structure
>3gbj_A KIF13B protein; kinesin, motor domain, ADP, structural genomics, structural genomics consortium, SGC, ATP-binding, microtubule, motor protein; HET: ADP; 2.10A {Homo sapiens} SCOP: c.37.1.9 Back     alignment and structure
>3nwn_A Kinesin-like protein KIF9; motor domain, ADP, structural genomics, structural consortium, SGC, contractIle protein; HET: ADP; 2.00A {Homo sapiens} Back     alignment and structure
>2h58_A Kinesin-like protein KIFC3 variant; motor domain, ADP, structural genomics, structur Al genomics consortium, SGC; HET: ADP; 1.85A {Homo sapiens} Back     alignment and structure
>3t0q_A AGR253WP; kinesin, alpha and beta proteins, P-loop containing nucleosi triphosphate hydrolases, microtubule motor protein; HET: ADP; 2.35A {Ashbya gossypii} Back     alignment and structure
>2rep_A Kinesin-like protein KIFC1; structural genomics consortium, motor domain, ADP, binding, cell cycle, cell division, endosome, microtubule; HET: ADP; 2.60A {Homo sapiens} Back     alignment and structure
>1f9v_A Kinesin-like protein KAR3; kinesin-related protein, motor protein, microtubinding proteinbule, contractIle protein; HET: ADP; 1.30A {Saccharomyces cerevisiae} SCOP: c.37.1.9 PDB: 1f9t_A* 1f9w_A* 1f9u_A* 3kar_A* Back     alignment and structure
>1ry6_A Internal kinesin; kinesin motor domain, nucleotide-free, transport protein; 1.60A {Plasmodium falciparum} SCOP: c.37.1.9 Back     alignment and structure
>2heh_A KIF2C protein; kinesin, motor domain, ADP, structural genomics, structural genomics consortium, SGC, structural protein; HET: ADP; 2.15A {Homo sapiens} PDB: 3edl_D* Back     alignment and structure
>3u06_A Protein claret segregational; motor domain, stalk rotation, power stroke, kinesin-14, MICR binding, NCD, transport, molecular motor; HET: ADP GOL; 2.35A {Drosophila melanogaster} PDB: 2ncd_A* 1n6m_A* 1cz7_A* 3l1c_A* Back     alignment and structure
>1v8k_A Kinesin-like protein KIF2C; microtubule destabilizer, structural P; HET: ANP; 2.25A {Mus musculus} SCOP: c.37.1.9 PDB: 1v8j_A* 2gry_A* Back     alignment and structure
>4etp_A Kinesin-like protein KAR3; kinesin motor protein, kinesin motor homology domain, karyog mitosis, microtubules; HET: ADP EBC; 2.30A {Saccharomyces cerevisiae} Back     alignment and structure
>3dc4_A Kinesin-like protein NOD; catalytic domain, ATPase, microtubule, ADP, nucleotide-binding protein, ATP-binding, coiled coil, motor protein; HET: ADP; 1.90A {Drosophila melanogaster} PDB: 3dcb_A* 3dco_N* 3pxn_A* Back     alignment and structure
>4h1g_A Maltose binding protein-cakar3 motor domain fusio; kinesin motor domain, motor protein, chimera; HET: MTT ADP EDO; 2.15A {Escherichia coli} Back     alignment and structure
>2kin_B Kinesin; motor protein, cytoskeleton; HET: ADP; 2.00A {Rattus norvegicus} SCOP: c.37.1.9 Back     alignment and structure
>3kin_B Kinesin heavy chain; motor protein, cytoskeleton; HET: ADP; 3.10A {Rattus norvegicus} SCOP: c.37.1.9 Back     alignment and structure
>2o0a_A S.cerevisiae chromosome XVI reading frame ORF YPL253C; VIK1, motor homology domain, kinesin, motor domain, microtubule-binding; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A Back     alignment and structure
>2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* Back     alignment and structure
>4ic3_A E3 ubiquitin-protein ligase XIAP; ring domain, zinc-finger, E3 ligase; 1.78A {Homo sapiens} PDB: 4ic2_A Back     alignment and structure
>2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A Back     alignment and structure
>3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A 4auq_B Back     alignment and structure
>4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C Back     alignment and structure
>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Back     alignment and structure
>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Back     alignment and structure
>1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Back     alignment and structure
>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Back     alignment and structure
>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Back     alignment and structure
>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Back     alignment and structure
>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} Back     alignment and structure
>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Back     alignment and structure
>2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Back     alignment and structure
>1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Back     alignment and structure
>1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Back     alignment and structure
>2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B Back     alignment and structure
>1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 Back     alignment and structure
>2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} Back     alignment and structure
>1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Back     alignment and structure
>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Back     alignment and structure
>1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens} Back     alignment and structure
>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Back     alignment and structure
>1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Back     alignment and structure
>1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 Back     alignment and structure
>2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Back     alignment and structure
>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Back     alignment and structure
>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Back     alignment and structure
>2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Back     alignment and structure
>1wt6_A Myotonin-protein kinase; coiled-coil, kinase activation, DMPK, molecular replacement, transferase; 1.60A {Homo sapiens} Back     alignment and structure
>1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 Back     alignment and structure
>1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>3na7_A HP0958; flagellar biogenesis, flagellum export, C4 Zn-ribbon, coiled post-transcriptional, gene regulation, chaperone; HET: EPE; 2.20A {Helicobacter pylori} Back     alignment and structure
>2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B Back     alignment and structure
>2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} Back     alignment and structure
>1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2 Back     alignment and structure
>3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} Back     alignment and structure
>2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* Back     alignment and structure
>3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 4f52_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A Back     alignment and structure
>2v71_A Nuclear distribution protein NUDE-like 1; developmental protein, nuclear protein, neurogenesis, cytosk LIS1 binding, differentiation; 2.24A {Rattus norvegicus} Back     alignment and structure
>4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} Back     alignment and structure
>2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3na7_A HP0958; flagellar biogenesis, flagellum export, C4 Zn-ribbon, coiled post-transcriptional, gene regulation, chaperone; HET: EPE; 2.20A {Helicobacter pylori} Back     alignment and structure
>1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Back     alignment and structure
>3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} Back     alignment and structure
>2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Back     alignment and structure
>3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus} Back     alignment and structure
>3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* Back     alignment and structure
>2efr_A General control protein GCN4 and tropomyosin 1 Al; destabilizing cluster, hydrophobic core, contractIle protein; 1.80A {Saccharomyces cerevisiae} PDB: 2efs_A 2d3e_A Back     alignment and structure
>3o0z_A RHO-associated protein kinase 1; coiled-coil, transferase; HET: MSE; 2.33A {Homo sapiens} Back     alignment and structure
>2ocy_A RAB guanine nucleotide exchange factor SEC2; RAB, GEF, guanine exchange factor, coiled-coil, endocytosis/exocytosis complex; 3.30A {Saccharomyces cerevisiae} SCOP: h.1.33.1 Back     alignment and structure
>2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Back     alignment and structure
>2v71_A Nuclear distribution protein NUDE-like 1; developmental protein, nuclear protein, neurogenesis, cytosk LIS1 binding, differentiation; 2.24A {Rattus norvegicus} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3nmd_A CGMP dependent protein kinase; leucine zipper, coiled-coil, structural genomics, berkeley S genomics center, BSGC, dimerization; HET: MSE; 2.27A {Homo sapiens} Back     alignment and structure
>3o0z_A RHO-associated protein kinase 1; coiled-coil, transferase; HET: MSE; 2.33A {Homo sapiens} Back     alignment and structure
>2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} Back     alignment and structure
>2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} Back     alignment and structure
>4gkw_A Spindle assembly abnormal protein 6; double helix, SAS-5, centriole, structural protein; 3.30A {Caenorhabditis elegans} Back     alignment and structure
>3s9g_A Protein hexim1; cyclin T-binding domain (TBD), cyclin T1/P-TEFB/7SK snRNA, N transcription; 2.10A {Homo sapiens} PDB: 2gd7_A Back     alignment and structure
>2ocy_A RAB guanine nucleotide exchange factor SEC2; RAB, GEF, guanine exchange factor, coiled-coil, endocytosis/exocytosis complex; 3.30A {Saccharomyces cerevisiae} SCOP: h.1.33.1 Back     alignment and structure
>3i00_A HIP-I, huntingtin-interacting protein 1; transcription; 2.30A {Homo sapiens} PDB: 2qa7_A Back     alignment and structure
>3s4r_A Vimentin; alpha-helix, cytoskeleton, intermediate filament, structural; 2.45A {Homo sapiens} PDB: 3ssu_A Back     alignment and structure
>3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A Back     alignment and structure
>4gkw_A Spindle assembly abnormal protein 6; double helix, SAS-5, centriole, structural protein; 3.30A {Caenorhabditis elegans} Back     alignment and structure
>2jee_A YIIU; FTSZ, septum, coiled-coil, cell division, cell cycle, hypothetical protein; 2.8A {Escherichia coli} Back     alignment and structure
>2v4h_A NF-kappa-B essential modulator; transcription, metal-binding, NEMO - IKK gamma - NFKB pathwa darpin, transcription regulation; 2.9A {Mus musculus} Back     alignment and structure
>3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} Back     alignment and structure
>3u1c_A Tropomyosin alpha-1 chain; anti-parallel coiled coil, contractIle protein; 1.80A {Gallus gallus} PDB: 3u1a_A Back     alignment and structure
>4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3 Back     alignment and structure
>2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A* Back     alignment and structure
>4etp_B Spindle POLE BODY-associated protein VIK1; kinesin motor protein, kinesin motor homology domain, karyog mitosis, microtubules; HET: ADP EBC; 2.30A {Saccharomyces cerevisiae} Back     alignment and structure
>2jee_A YIIU; FTSZ, septum, coiled-coil, cell division, cell cycle, hypothetical protein; 2.8A {Escherichia coli} Back     alignment and structure
>2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* Back     alignment and structure
>3hnw_A Uncharacterized protein; coiled-coil, structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 2.20A {Eubacterium eligens} Back     alignment and structure
>3s84_A Apolipoprotein A-IV; four helix bundle, transport protein; 2.40A {Homo sapiens} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3tnu_B Keratin, type II cytoskeletal 5; coiled-coil, structural support, cytosolic protein; 3.00A {Homo sapiens} Back     alignment and structure
>4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 1102
d1goja_354 c.37.1.9 (A:) Kinesin {Neurospora crassa [TaxId: 5 3e-79
d1bg2a_323 c.37.1.9 (A:) Kinesin {Human (Homo sapiens) [TaxId 6e-79
d2zfia1349 c.37.1.9 (A:4-352) Kinesin {Mouse (Mus musculus), 4e-74
d1ry6a_330 c.37.1.9 (A:) Kinesin {Malaria parasite (Plasmodiu 5e-72
d1x88a1345 c.37.1.9 (A:18-362) Kinesin {Human (Homo sapiens), 1e-70
d1v8ka_362 c.37.1.9 (A:) Kinesin {Mouse (Mus musculus), kif2c 4e-69
d1sdma_364 c.37.1.9 (A:) Kinesin heavy chain-like protein {Po 1e-65
d1f9va_342 c.37.1.9 (A:) Kinesin motor Ncd (non-claret disjun 8e-65
d2ncda_368 c.37.1.9 (A:) Kinesin motor Ncd (non-claret disjun 2e-61
d1fbva479 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [Ta 7e-10
d1bora_56 g.44.1.1 (A:) Acute promyelocytic leukaemia proto- 6e-08
d1chca_68 g.44.1.1 (A:) Immediate early protein, IEEHV {Equi 1e-06
d1rmda286 g.44.1.1 (A:1-86) V(D)J recombination activating p 6e-05
d1jm7a_103 g.44.1.1 (A:) brca1 RING domain {Human (Homo sapie 2e-04
d1ur6b_52 g.44.1.1 (B:) Not-4 N-terminal RING finger domain 4e-04
d1iyma_55 g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sati 0.002
d1vyxa_60 g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal do 0.003
d1g25a_65 g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapi 0.003
>d1goja_ c.37.1.9 (A:) Kinesin {Neurospora crassa [TaxId: 5141]} Length = 354 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Motor proteins
domain: Kinesin
species: Neurospora crassa [TaxId: 5141]
 Score =  261 bits (668), Expect = 3e-79
 Identities = 137/358 (38%), Positives = 193/358 (53%), Gaps = 14/358 (3%)

Query: 98  SGDSISVTIRFRPLSEREFQRGDEIAWYADG-DKIVRNEYNPATAYAFDRVFGPHANSQE 156
           S +SI V  RFRP +  E + G +      G D    +      ++ FDRVF       +
Sbjct: 3   SANSIKVVARFRPQNRVEIESGGQPIVTFQGPDTCTVDSKEAQGSFTFDRVFDMSCKQSD 62

Query: 157 VYDVAARPVVKAAMEGVNGTVFAYGVTSSGKTHTMH----GDQNSPGIIPLAIKDVF-SI 211
           ++D + +P V   + G NGTVFAYG T +GK++TM      D +  G+IP  ++ +F SI
Sbjct: 63  IFDFSIKPTVDDILNGYNGTVFAYGQTGAGKSYTMMGTSIDDPDGRGVIPRIVEQIFTSI 122

Query: 212 IQDTPGREFLLRVSYLEIYNEVINDLLDPTGQNLRVREDA-QGTYVEGIKEEVVLSPGHA 270
           +      E+ +RVSY+EIY E I DLL P   NL V E+  +G YV+G+ E  V S    
Sbjct: 123 LSSAANIEYTVRVSYMEIYMERIRDLLAPQNDNLPVHEEKNRGVYVKGLLEIYVSSVQEV 182

Query: 271 LSFIAAGEEHRHVGSNNFNLLSSRSHTIFTLMIESSDHGDEYDGVIFSQLNLIDLAGSE- 329
              +  G   R V + N N  SSRSH+IF + I   +           QL L+DLAGSE 
Sbjct: 183 YEVMRRGGNARAVAATNMNQESSRSHSIFVITITQKNVET--GSAKSGQLFLVDLAGSEK 240

Query: 330 SSKTETTGLRRKEGSYINKSLLTLGTVIGKLSEGKASHVPYRDSKLTRLLQSSLSGHGHV 389
             KT  +G   +E   INKSL  LG VI  L++GK+SHVPYRDSKLTR+LQ SL G+   
Sbjct: 241 VGKTGASGQTLEEAKKINKSLSALGMVINALTDGKSSHVPYRDSKLTRILQESLGGNSRT 300

Query: 390 SLICTVTPASSSMEETHNTLKFASRAKRVEIYASRNKIIDEKSLIKKYQREISSLKEE 447
           +LI   +P+S +  ET +TL+F  RAK ++  A  N  +    L    ++ ++  K +
Sbjct: 301 TLIINCSPSSYNDAETLSTLRFGMRAKSIKNKAKVNAELSPAEL----KQMLAKAKTQ 354


>d1bg2a_ c.37.1.9 (A:) Kinesin {Human (Homo sapiens) [TaxId: 9606]} Length = 323 Back     information, alignment and structure
>d2zfia1 c.37.1.9 (A:4-352) Kinesin {Mouse (Mus musculus), kif1a [TaxId: 10090]} Length = 349 Back     information, alignment and structure
>d1ry6a_ c.37.1.9 (A:) Kinesin {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Length = 330 Back     information, alignment and structure
>d1x88a1 c.37.1.9 (A:18-362) Kinesin {Human (Homo sapiens), mitotic kinesin eg5 [TaxId: 9606]} Length = 345 Back     information, alignment and structure
>d1v8ka_ c.37.1.9 (A:) Kinesin {Mouse (Mus musculus), kif2c [TaxId: 10090]} Length = 362 Back     information, alignment and structure
>d1sdma_ c.37.1.9 (A:) Kinesin heavy chain-like protein {Potato (Solanum tuberosum) [TaxId: 4113]} Length = 364 Back     information, alignment and structure
>d1f9va_ c.37.1.9 (A:) Kinesin motor Ncd (non-claret disjunctional) {Baker's yeast (Saccharomyces cerevisiae), Kar [TaxId: 4932]} Length = 342 Back     information, alignment and structure
>d2ncda_ c.37.1.9 (A:) Kinesin motor Ncd (non-claret disjunctional) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 368 Back     information, alignment and structure
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Length = 56 Back     information, alignment and structure
>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Length = 68 Back     information, alignment and structure
>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure
>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Length = 52 Back     information, alignment and structure
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Length = 55 Back     information, alignment and structure
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Length = 60 Back     information, alignment and structure
>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query1102
d1sdma_364 Kinesin heavy chain-like protein {Potato (Solanum 100.0
d1goja_354 Kinesin {Neurospora crassa [TaxId: 5141]} 100.0
d1v8ka_362 Kinesin {Mouse (Mus musculus), kif2c [TaxId: 10090 100.0
d2zfia1349 Kinesin {Mouse (Mus musculus), kif1a [TaxId: 10090 100.0
d1x88a1345 Kinesin {Human (Homo sapiens), mitotic kinesin eg5 100.0
d1bg2a_323 Kinesin {Human (Homo sapiens) [TaxId: 9606]} 100.0
d2ncda_368 Kinesin motor Ncd (non-claret disjunctional) {Frui 100.0
d1f9va_342 Kinesin motor Ncd (non-claret disjunctional) {Bake 100.0
d1ry6a_330 Kinesin {Malaria parasite (Plasmodium falciparum) 100.0
d1fbva479 CBL {Human (Homo sapiens) [TaxId: 9606]} 98.38
d1bora_56 Acute promyelocytic leukaemia proto-oncoprotein PM 98.23
d1chca_68 Immediate early protein, IEEHV {Equine herpesvirus 98.19
d1rmda286 V(D)J recombination activating protein 1 (RAG1), d 98.05
d1jm7a_103 brca1 RING domain {Human (Homo sapiens) [TaxId: 96 98.03
d1g25a_65 TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9 97.86
d1jm7b_97 bard1 RING domain {Human (Homo sapiens) [TaxId: 96 97.78
d1iyma_55 EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 97.77
d1ur6b_52 Not-4 N-terminal RING finger domain {Human (Homo s 97.73
d2baya156 Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac 97.52
d2c2la280 STIP1 homology and U box-containing protein 1, STU 97.49
d1v87a_114 Deltex protein 2 RING-H2 domain {Mouse (Mus muscul 97.3
d1t1ha_78 E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi 97.26
d3dplr188 RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase 97.07
d1wgma_98 Ubiquitin conjugation factor E4A {Human (Homo sapi 96.9
d1vyxa_60 IE1B protein (ORF K3), N-terminal domain {Kaposi's 96.66
d1wima_94 UbcM4-interacting protein 4 (KIAA0161) {Human (Hom 95.28
d1l8qa2213 Chromosomal replication initiation factor DnaA {Aq 93.31
d1w5sa2287 CDC6-like protein APE0152, N-terminal domain {Aero 90.47
d1r7ra3265 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 89.89
d1gvnb_273 Plasmid maintenance system epsilon/zeta, toxin zet 83.42
d1fnna2276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 81.25
>d1sdma_ c.37.1.9 (A:) Kinesin heavy chain-like protein {Potato (Solanum tuberosum) [TaxId: 4113]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Motor proteins
domain: Kinesin heavy chain-like protein
species: Potato (Solanum tuberosum) [TaxId: 4113]
Probab=100.00  E-value=3.6e-79  Score=701.05  Aligned_cols=342  Identities=34%  Similarity=0.532  Sum_probs=294.2

Q ss_pred             CEEEEEEeCCCChhhhhcCCeEE-EeeCCCEEEe-cCCCCCcceeeceecCCCCChhHHHhhhhHHHHHHHhcCCceeEE
Q 001316          101 SISVTIRFRPLSEREFQRGDEIA-WYADGDKIVR-NEYNPATAYAFDRVFGPHANSQEVYDVAARPVVKAAMEGVNGTVF  178 (1102)
Q Consensus       101 ~I~V~vRvRP~~~~E~~~~~~~~-~~~~~~~~~~-~~~~~~~~f~FD~VF~~~~~q~~Vy~~~~~plV~~~l~G~N~tIf  178 (1102)
                      .|+|+|||||+.+.|...+...+ ...++.++.. ......+.|.||+||+++++|++||+.+ .|+|+++++|||+|||
T Consensus         1 rIkV~vRvRP~~~~E~~~~~~~~v~~~~~~~~~~~~~~~~~~~f~FD~vf~~~~~q~~vy~~v-~~lv~~~l~G~n~~i~   79 (364)
T d1sdma_           1 KIRVYCRLRPLCEKEIIAKERNAIRSVDEFTVEHLWKDDKAKQHMYDRVFDGNATQDDVFEDT-KYLVQSAVDGYNVCIF   79 (364)
T ss_dssp             CCEEEEEECCCCHHHHHTTCCBCEEECSTTEEEEECSSSSEEEEECSEEECTTCCHHHHHHTT-THHHHHHHTTCEEEEE
T ss_pred             CeEEEEEcCCCChhhcccCCCCeEEeCCCCeEEecCCCCCceEEECCeecCCCCCHHHHHHHH-HHHHHHHhcCCceeee
Confidence            48999999999999987665443 3455555443 3444567899999999999999999975 7999999999999999


Q ss_pred             eeccCCCCCccccCCCCCCCCchhhHHHHHHHHhhcCC-CceeEEEeehhhhhcceeeecCCCCC---CcceEEeCC-CC
Q 001316          179 AYGVTSSGKTHTMHGDQNSPGIIPLAIKDVFSIIQDTP-GREFLLRVSYLEIYNEVINDLLDPTG---QNLRVREDA-QG  253 (1102)
Q Consensus       179 aYGqTgSGKT~Tm~G~~~~~GIipr~~~~LF~~i~~~~-~~~~~v~vS~lEIYnE~i~DLL~~~~---~~l~ire~~-~g  253 (1102)
                      |||||||||||||+|+..++|||||++.+||..+.... ...|.|++||+|||||.|||||.|..   ..+.+++++ .|
T Consensus        80 aYGqTGSGKTyTm~G~~~~~Giipr~~~~lf~~i~~~~~~~~~~v~~S~~EIyne~i~DLL~~~~~~~~~l~~~~~~~~~  159 (364)
T d1sdma_          80 AYGQTGSGKTFTIYGADSNPGLTPRAMSELFRIMKKDSNKFSFSLKAYMVELYQDTLVDLLLPKQAKRLKLDIKKDSKGM  159 (364)
T ss_dssp             EECSTTSSHHHHHTBCSSSBCHHHHHHHHHHHHHHHGGGTEEEEEEEEEEEESSSCEEETTSCTTSCCCCCEEEECTTSC
T ss_pred             ccccCCCCcccccccCccccchhHHHHHHHHhhhhhccccccceEEEEEEEEeccccccccCcccccccccceeecccCc
Confidence            99999999999999999999999999999999997654 46899999999999999999998754   467899998 67


Q ss_pred             cEeeCceEEEeCChHHHHHHHHHHhhhcccCCCccccCCCCceeEEEEEEEEecCCCCCCcEEEEEEEEeecCCCCC-cc
Q 001316          254 TYVEGIKEEVVLSPGHALSFIAAGEEHRHVGSNNFNLLSSRSHTIFTLMIESSDHGDEYDGVIFSQLNLIDLAGSES-SK  332 (1102)
Q Consensus       254 ~~v~gl~e~~V~s~~e~~~ll~~g~~~R~~~~t~~N~~SSRSH~If~i~v~~~~~~~~~~~~~~skL~lVDLAGSEr-~k  332 (1102)
                      ++|.|++++.|.++++++.+|..|..+|.+++|.+|..|||||+||+|.|.+...+.  .....++|+||||||||| .+
T Consensus       160 ~~v~~l~~~~v~s~~~~~~~l~~g~~~R~~~~t~~n~~ssRsH~i~~i~v~~~~~~~--~~~~~~kl~~vDLAGsEr~~~  237 (364)
T d1sdma_         160 VSVENVTVVSISTYEELKTIIQRGSEQRHTTGTLMNEQSSRSHLIVSVIIESTNLQT--QAIARGKLSFVDLAGSERVKK  237 (364)
T ss_dssp             EEEETCCCEEECSHHHHHHHHHHHHHHHCCCSSCTTCHHHHSEEEEEEEEEEEETTT--CCEEEEEEEEEECCCCSCCCC
T ss_pred             cccccceeeeeCCHHHHHHHhhccceeeccccccccccccccceEEEEEEEEeccCc--ceeeeEEEEeechhhcccccc
Confidence            899999999999999999999999999999999999999999999999999876543  456789999999999999 56


Q ss_pred             cccchhhhhhhHHHhhhHHHHHHHHHHhhcCCCCCccCCCCcchhhhhccCCCCccceEEEeeCCCCCCHHHHHHHHHHH
Q 001316          333 TETTGLRRKEGSYINKSLLTLGTVIGKLSEGKASHVPYRDSKLTRLLQSSLSGHGHVSLICTVTPASSSMEETHNTLKFA  412 (1102)
Q Consensus       333 t~~~g~r~kE~~~INkSL~aLg~vI~aL~~~k~~hvPYRdSkLTrLLqdsLgGnskt~~I~~isP~~~~~~ETlsTLrfA  412 (1102)
                      +++.|.+++|+.+||+||++||+||.+|+++. .||||||||||+||+|+|||||+|+|||||||+..+++||++||+||
T Consensus       238 ~~~~g~~~~E~~~iN~SL~~L~~vi~aL~~~~-~~ipyR~SkLT~lL~d~Lggns~t~~I~~isp~~~~~~eTl~TL~fa  316 (364)
T d1sdma_         238 SGSAGNQLKEAQSINKSLSALGDVISALSSGN-QHIPYRNHKLTMLMSDSLGGNAKTLMFVNISPAESNLDETHNSLTYA  316 (364)
T ss_dssp             ---------CCCTTCHHHHHHHHHHHHHHHTC-SCCCGGGCHHHHHTTTTTTSSSEEEEEEEECCBGGGHHHHHHHHHHH
T ss_pred             ccccCceeeeccccccchhhHHHHHHHHHcCC-CcCCchhhhhhHHHHhhcCCCceEEEEEEeCCCcchHHHHHHHHHHH
Confidence            88999999999999999999999999999865 59999999999999999999999999999999999999999999999


Q ss_pred             HHhcccccccccccccCHHHHHHHHHHHHHHHHHHHH
Q 001316          413 SRAKRVEIYASRNKIIDEKSLIKKYQREISSLKEELD  449 (1102)
Q Consensus       413 ~rak~I~~~~~~n~~~~~~~~i~~~~~ei~~Lk~el~  449 (1102)
                      +|||+|+|.|.+|+..+   .+.+|+++|..|++++.
T Consensus       317 ~~ak~i~n~p~~n~~~~---~~~~l~~~i~~l~~~~~  350 (364)
T d1sdma_         317 SRVRSIVNDPSKNVSSK---EVARLKKLVSYWKEQAG  350 (364)
T ss_dssp             HHHTTCCCCCCCCEECH---HHHHHHTTTTCC-----
T ss_pred             HHHhhcccCCcccCCHH---HHHHHHHHHHHHHHHHH
Confidence            99999999999997542   35667777777776654



>d1goja_ c.37.1.9 (A:) Kinesin {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d1v8ka_ c.37.1.9 (A:) Kinesin {Mouse (Mus musculus), kif2c [TaxId: 10090]} Back     information, alignment and structure
>d2zfia1 c.37.1.9 (A:4-352) Kinesin {Mouse (Mus musculus), kif1a [TaxId: 10090]} Back     information, alignment and structure
>d1x88a1 c.37.1.9 (A:18-362) Kinesin {Human (Homo sapiens), mitotic kinesin eg5 [TaxId: 9606]} Back     information, alignment and structure
>d1bg2a_ c.37.1.9 (A:) Kinesin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ncda_ c.37.1.9 (A:) Kinesin motor Ncd (non-claret disjunctional) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1f9va_ c.37.1.9 (A:) Kinesin motor Ncd (non-claret disjunctional) {Baker's yeast (Saccharomyces cerevisiae), Kar [TaxId: 4932]} Back     information, alignment and structure
>d1ry6a_ c.37.1.9 (A:) Kinesin {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Back     information, alignment and structure
>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Back     information, alignment and structure
>d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure