Citrus Sinensis ID: 001316
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 1102 | ||||||
| 225427728 | 1079 | PREDICTED: uncharacterized protein LOC10 | 0.957 | 0.977 | 0.799 | 0.0 | |
| 224080418 | 1067 | predicted protein [Populus trichocarpa] | 0.947 | 0.978 | 0.797 | 0.0 | |
| 147864402 | 1082 | hypothetical protein VITISV_007231 [Viti | 0.956 | 0.974 | 0.793 | 0.0 | |
| 224103343 | 1000 | predicted protein [Populus trichocarpa] | 0.894 | 0.986 | 0.826 | 0.0 | |
| 297744752 | 1046 | unnamed protein product [Vitis vinifera] | 0.926 | 0.976 | 0.786 | 0.0 | |
| 357473457 | 1107 | Kinesin heavy chain-like protein [Medica | 0.969 | 0.964 | 0.734 | 0.0 | |
| 255543819 | 1032 | kinesin heavy chain, putative [Ricinus c | 0.907 | 0.968 | 0.787 | 0.0 | |
| 356538724 | 1086 | PREDICTED: uncharacterized protein LOC10 | 0.967 | 0.981 | 0.748 | 0.0 | |
| 449464854 | 1130 | PREDICTED: chromosome-associated kinesin | 0.970 | 0.946 | 0.739 | 0.0 | |
| 297797890 | 1055 | hypothetical protein ARALYDRAFT_327857 [ | 0.923 | 0.964 | 0.748 | 0.0 |
| >gi|225427728|ref|XP_002265593.1| PREDICTED: uncharacterized protein LOC100253714 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 1724 bits (4465), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 881/1102 (79%), Positives = 961/1102 (87%), Gaps = 47/1102 (4%)
Query: 12 PFSYRKPVTPYSSTSSTSSSFMNNRLMPRSCSTSASSYF-NSGNGLGSRSMTPSRSCSDS 70
PF YRKP + S+SS+SSSFMN +LMPRSCS+SASS+ NSGNGLGSRS+TPSR DS
Sbjct: 13 PFHYRKPSS-PYSSSSSSSSFMNGKLMPRSCSSSASSFLNNSGNGLGSRSITPSRGRVDS 71
Query: 71 MYNSPRA----PPVIFPSEELMAEPLDAPQRSGDSISVTIRFRPLSEREFQRGDEIAWYA 126
MY PR PV F S+EL+ E +D P RSGDSISVTIRFRPLSEREFQRGDEIAW+A
Sbjct: 72 MYAGPRGYGSRTPVAFASDELIGELIDVP-RSGDSISVTIRFRPLSEREFQRGDEIAWFA 130
Query: 127 DGDKIVRNEYNPATAYAFDRVFGPHANSQEVYDVAARPVVKAAMEGVNGTVFAYGVTSSG 186
DGDKIVRNEYNPATAYAFDRVFGP SQ+VYDVAARPVVKAAMEG+NGTVFAYGVTSSG
Sbjct: 131 DGDKIVRNEYNPATAYAFDRVFGPSTGSQDVYDVAARPVVKAAMEGINGTVFAYGVTSSG 190
Query: 187 KTHTMHGDQNSPGIIPLAIKDVFSIIQDTPGREFLLRVSYLEIYNEVINDLLDPTGQNLR 246
KTHTMHGDQNSPGIIPLAIKDVFSIIQDTPGREFLLRVSYLEIYNEVINDLLDPTGQNLR
Sbjct: 191 KTHTMHGDQNSPGIIPLAIKDVFSIIQDTPGREFLLRVSYLEIYNEVINDLLDPTGQNLR 250
Query: 247 VREDAQGTYVEGIKEEVVLSPGHALSFIAAGEEHRHVGSNNFNLLSSRSHTIFTLMIESS 306
VREDAQGTYVEGIKEEVVLSPGHALSFIAAGEEHRHVGSNNFNLLSSRSHTIFTLMIESS
Sbjct: 251 VREDAQGTYVEGIKEEVVLSPGHALSFIAAGEEHRHVGSNNFNLLSSRSHTIFTLMIESS 310
Query: 307 DHGDEYDGVIFSQLNLIDLAGSESSKTETTGLRRKEGSYINKSLLTLGTVIGKLSEGKAS 366
+HGDEYDGVIFSQLNLIDLAGSESSKTETTGLRRKEGSYINKSLLTLGTVIGKLSEG+AS
Sbjct: 311 NHGDEYDGVIFSQLNLIDLAGSESSKTETTGLRRKEGSYINKSLLTLGTVIGKLSEGRAS 370
Query: 367 HVPYRDSKLTRLLQSSLSGHGHVSLICTVTPASSSMEETHNTLKFASRAKRVEIYASRNK 426
HVPYRDSKLTRLLQSSLSGHGHVSLICTVTPASS+MEETHNTLKFASRAKRVEIYASRNK
Sbjct: 371 HVPYRDSKLTRLLQSSLSGHGHVSLICTVTPASSNMEETHNTLKFASRAKRVEIYASRNK 430
Query: 427 IIDEKSLIKKYQREISSLKEELDQLKRGILVGVSHEELMTLRQKLEEGQVKMQSRLEEEE 486
IIDEKSLIKKYQREIS+LKEELDQL+RG+LVGVSHEE+++LRQ+LEEGQVKMQSRLEEEE
Sbjct: 431 IIDEKSLIKKYQREISTLKEELDQLRRGMLVGVSHEEIISLRQQLEEGQVKMQSRLEEEE 490
Query: 487 EAKAALMSRIQRLTKLILVSTKNTIPG-LSDVPNHQRSHSVGEDD-LDLLREGSLLLDGE 544
EAKAALMSRIQRLTKLILVSTKNT+PG L D +HQRSHSVGEDD LD++REG L + E
Sbjct: 491 EAKAALMSRIQRLTKLILVSTKNTLPGCLGDAVSHQRSHSVGEDDKLDVIREGPLPAENE 550
Query: 545 NQKDSTSSASGLASDLPSDFKHRRSSSKWNEEFSPTSSTVTESTQAGELISGSKHPIGGM 604
NQKDS SSA + SDL DF+HRRSSSKWNEE SP SST GGM
Sbjct: 551 NQKDSPSSALAIPSDLTCDFRHRRSSSKWNEELSPASST------------------GGM 592
Query: 605 T-SDQMDLLVEQVKMLAGEIAFSSSNLKRLVDQSVNDPDGSKVQIQNLEREIQEKRRQMR 663
T SDQMDLLVEQVKMLAGEIAFS+S LKRL++QSVNDPDGSK QIQNLE E+QEK+RQMR
Sbjct: 593 TMSDQMDLLVEQVKMLAGEIAFSTSTLKRLMEQSVNDPDGSKTQIQNLEHELQEKKRQMR 652
Query: 664 ILEQRIIENGEASMANASMVDMQQTVTRLMSQCNEKAFELEIKSADNRILQEQLQNKCSE 723
ILEQR++E GEAS ANASMVDMQQTV +LM+QC+EK FELEIK+ADNR+LQEQLQNKC+E
Sbjct: 653 ILEQRMMETGEASFANASMVDMQQTVMKLMTQCSEKGFELEIKTADNRVLQEQLQNKCAE 712
Query: 724 NKKLQEKVNLLEQQLACQNGDKSAGSSGQGTSDEYVDELRKKVQSQETENEKLKLEHVQL 783
N +LQ+KV+LL+QQL+ K + SS QG S++Y+DEL+KKVQSQE ENEKLKLE VQ+
Sbjct: 713 NMELQQKVDLLQQQLSSGTVQKLSLSSEQGVSEDYIDELKKKVQSQEIENEKLKLEQVQI 772
Query: 784 SEENSGLHVQNQKLAEEASYAKELASAAAVELKNLAGEVTKLSLQNAKLEKELLAARESM 843
EENSGL VQNQKL+EEASYAKELASAAAVELKNLAGEVTK+SLQN KLEKEL+AARE
Sbjct: 773 LEENSGLRVQNQKLSEEASYAKELASAAAVELKNLAGEVTKISLQNTKLEKELIAARELA 832
Query: 844 HSRGAAMQTVNGVNRKYSDGMKAGRKGRLSGRSTEISGVVSDDFDSWNLDPDDLKLELQA 903
HSRG+ +Q N NRKYSD K GRKGRL GR+ +ISG V DDF+ WNLDPDDLK+ELQA
Sbjct: 833 HSRGSNLQASNNGNRKYSDSAKPGRKGRLPGRANDISGAVYDDFELWNLDPDDLKMELQA 892
Query: 904 RKQREAALEAALAEKEFLEDEYRKKVEESKRREEALENDLANMWVLVAKLKKEVGSVPEL 963
RKQRE ALEAALA+KE +ED+YRKK+EE+K+RE ALENDLANMWVLVA+LKKE G++PE
Sbjct: 893 RKQREMALEAALADKELVEDDYRKKLEEAKKRESALENDLANMWVLVAQLKKEGGAIPES 952
Query: 964 NTVERHSNGEDRVCD--PKANETDC-NTVLKDRHFLEVSKPADENSVERQVLDVPKPADE 1020
NT ERH N D V D PK +++D NTVLK E QV DV +PA +
Sbjct: 953 NTDERHPNELDHVNDLNPKIDDSDSKNTVLK----------------EMQVPDVMRPAHD 996
Query: 1021 TPKEEPLVARLKARMQEMKEKEQKYQGNGDPNSHMCKVCFESPTAAILLPCRHFCLCKSC 1080
PKEEPLVARLKARMQEMKEKEQKY GNGD NSH+CKVCFESPTAAILLPCRHFCLC+SC
Sbjct: 997 IPKEEPLVARLKARMQEMKEKEQKYLGNGDANSHICKVCFESPTAAILLPCRHFCLCRSC 1056
Query: 1081 SLACSECPICRTKISDRLFAFT 1102
SLACSECPICRTKI+DR FAFT
Sbjct: 1057 SLACSECPICRTKIADRFFAFT 1078
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|224080418|ref|XP_002306132.1| predicted protein [Populus trichocarpa] gi|222849096|gb|EEE86643.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|147864402|emb|CAN80502.1| hypothetical protein VITISV_007231 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|224103343|ref|XP_002313019.1| predicted protein [Populus trichocarpa] gi|222849427|gb|EEE86974.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|297744752|emb|CBI38014.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|357473457|ref|XP_003607013.1| Kinesin heavy chain-like protein [Medicago truncatula] gi|355508068|gb|AES89210.1| Kinesin heavy chain-like protein [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|255543819|ref|XP_002512972.1| kinesin heavy chain, putative [Ricinus communis] gi|223547983|gb|EEF49475.1| kinesin heavy chain, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|356538724|ref|XP_003537851.1| PREDICTED: uncharacterized protein LOC100780424 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|449464854|ref|XP_004150144.1| PREDICTED: chromosome-associated kinesin KIF4-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|297797890|ref|XP_002866829.1| hypothetical protein ARALYDRAFT_327857 [Arabidopsis lyrata subsp. lyrata] gi|297312665|gb|EFH43088.1| hypothetical protein ARALYDRAFT_327857 [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 1102 | ||||||
| TAIR|locus:2120187 | 1055 | AT4G39050 [Arabidopsis thalian | 0.682 | 0.712 | 0.607 | 2.4e-268 | |
| TAIR|locus:2050044 | 1058 | AT2G21380 [Arabidopsis thalian | 0.687 | 0.716 | 0.594 | 9.1e-219 | |
| TAIR|locus:2036987 | 890 | AT1G21730 [Arabidopsis thalian | 0.410 | 0.507 | 0.695 | 3.3e-195 | |
| TAIR|locus:2144103 | 986 | AT5G06670 [Arabidopsis thalian | 0.397 | 0.444 | 0.665 | 3e-181 | |
| DICTYBASE|DDB_G0291039 | 685 | kif11 "kinesin-7" [Dictyosteli | 0.332 | 0.534 | 0.519 | 3.1e-102 | |
| UNIPROTKB|O42263 | 2954 | cenpe "Kinesin-related protein | 0.315 | 0.117 | 0.479 | 1.9e-92 | |
| DICTYBASE|DDB_G0285101 | 1922 | kif4 "kinesin-7" [Dictyosteliu | 0.313 | 0.179 | 0.478 | 4.2e-88 | |
| UNIPROTKB|E1BQJ6 | 2616 | E1BQJ6 "Uncharacterized protei | 0.337 | 0.142 | 0.450 | 2.4e-86 | |
| RGD|1307115 | 1968 | Cenpe "centromere protein E" [ | 0.314 | 0.176 | 0.462 | 1.3e-84 | |
| UNIPROTKB|I3LRD3 | 2501 | CENPE "Uncharacterized protein | 0.356 | 0.157 | 0.416 | 6.8e-84 |
| TAIR|locus:2120187 AT4G39050 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 2142 (759.1 bits), Expect = 2.4e-268, Sum P(3) = 2.4e-268
Identities = 476/784 (60%), Positives = 563/784 (71%)
Query: 21 PYXXXXXXXXXFMNNRLMPRSCSTSASSYFNSGNGLGSRSMTPSRSCSDS-MYNSPR--- 76
P ++NRL+PRS STSASS S G+ SRSMTPSR+ SDS + S
Sbjct: 13 PPSPASSTSSSHLSNRLIPRSNSTSASSLITSAAGIASRSMTPSRTFSDSGLIGSGSFGI 72
Query: 77 APPVIFPSEELMAEPLDAPQRSG-DSISVTIRFRPLSEREFQRGDEIAWYADGDKIVRNE 135
PV +PSEEL+ +P+D S DSISVT+RFRPLS+RE+QRGDE+AWY DGD +VR+E
Sbjct: 73 GSPVPYPSEELLGDPMDDTISSERDSISVTVRFRPLSDREYQRGDEVAWYPDGDTLVRHE 132
Query: 136 YNPATAYAFDRVFGPHANSQEVYDVAARPVVKAAMEGVNGTVFAYGVTSSGKTHTMHGDQ 195
YNP TAYAFD+VFGP A + +VYDVAARPVVKAAMEGVNGTVFAYGVTSSGKTHTMHGDQ
Sbjct: 133 YNPLTAYAFDKVFGPQATTIDVYDVAARPVVKAAMEGVNGTVFAYGVTSSGKTHTMHGDQ 192
Query: 196 NSPGIIPLAIKDVFSIIQDTPGREFLLRVSYLEIYNEVINDLLDPTGQNLRVREDAQGTY 255
SPGIIPLAIKDVFSIIQDTPGREFLLRVSYLEIYNEVINDLLDPTGQNLRVRED+QGTY
Sbjct: 193 ESPGIIPLAIKDVFSIIQDTPGREFLLRVSYLEIYNEVINDLLDPTGQNLRVREDSQGTY 252
Query: 256 VEGIKEEVVLSPGHALSFIAAGEEHRHVGSNNFNLLSSRSHTIFTLMIESSDHGDEYDGV 315
VEGIKEEVVLSPGHALSFIAAGEEHRHVGSNNFNLLSSRSHTIFTLM+ESS GDEYDGV
Sbjct: 253 VEGIKEEVVLSPGHALSFIAAGEEHRHVGSNNFNLLSSRSHTIFTLMVESSATGDEYDGV 312
Query: 316 IFSQLNLIDLAGSESSKTETTGLRRKEGSYINKSLLTLGTVIGKLSEGKASHVPYRDSKL 375
IFSQLNLIDLAGSESSKTETTGLRRKEGSYINKSLLTLGTVIGKLSEGKA+H+PYRDSKL
Sbjct: 313 IFSQLNLIDLAGSESSKTETTGLRRKEGSYINKSLLTLGTVIGKLSEGKATHIPYRDSKL 372
Query: 376 TRLLQSSLSGHGHVSLICTVTPASSSMEETHNTLKFASRAKRVEIYASRNKIIDEKSLIK 435
TRLLQSSLSGHGHVSLICT+TPASSS EETHNTLKFASRAK +EIYASRN+IIDEKSLIK
Sbjct: 373 TRLLQSSLSGHGHVSLICTITPASSSSEETHNTLKFASRAKSIEIYASRNQIIDEKSLIK 432
Query: 436 KYQREISSLKEELDQLKRGILVGVSHEELMTLRQKLEEGQVKMQSRLXXXXXAKAALMSR 495
KYQREIS+LK ELDQL+RG+LVGVSHEELM+L+Q+LEEGQVKMQSRL AKAALMSR
Sbjct: 433 KYQREISTLKLELDQLRRGMLVGVSHEELMSLKQQLEEGQVKMQSRLEEEEEAKAALMSR 492
Query: 496 IQRLTKLILVSTKNTIPGLS-DVPNHQRSHSVXXXXXXXXXXXXXXXXXXNQKDSTSSAS 554
IQ+LTKLILVSTKN+IPG S D+P HQRS S + S SS
Sbjct: 493 IQKLTKLILVSTKNSIPGYSGDIPTHQRSLSAGKDDKFDSLLLES-----DNLGSPSSTL 547
Query: 555 GLASDLPSDFKHRRSSSKWNEEFSPTSSTVTESTQAGELISGSKHPIGGMTSDQMDLLVE 614
L S+ F HRRSSSK N+E SP + T+ + I + M + ++
Sbjct: 548 ALLSEGSLGFNHRRSSSKLNDENSP-GAEFTQGVMTPDEIDLLVEQVK-MLAGEIAFSTS 605
Query: 615 QVKMLAGEIAFSSSNLKRLVDQSVNDPDGSKVQIQNLEREIQEKRRQMRILEQRIIENGE 674
+K L + N + + + + Q++ LE+ I E + I ++E +
Sbjct: 606 TLKRLVDQSVNDPENSQTQIQNLEREIHEKQRQMRGLEQLIIESG-EASIANASLVEMQQ 664
Query: 675 ASMANASMVDMQQTVTRLMSQCNEKAFE-LEIKSADNRILQEQLQNKCSENKKLQEKVNL 733
M+ + + + + S N E L+ K +N+ L E++ L++++N
Sbjct: 665 KVMSLMTQCNEKSFELEIKSADNCILQEQLQEKCTENKELHEKVN-------LLEQRLNA 717
Query: 734 LEQQLA---CQN----GDKSAGSSGQGTSDEYV-DELR-KKVQSQETENEKLKLEHVQLS 784
+ + + C N G+ + + S E +EL+ + VQ E EN L++++ +L+
Sbjct: 718 VSSEKSSPSCSNKAVSGEYADELKKKIQSQEIENEELKLEHVQIVE-ENSGLRVQNQKLA 776
Query: 785 EENS 788
EE S
Sbjct: 777 EEAS 780
|
|
| TAIR|locus:2050044 AT2G21380 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2036987 AT1G21730 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2144103 AT5G06670 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| DICTYBASE|DDB_G0291039 kif11 "kinesin-7" [Dictyostelium discoideum (taxid:44689)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|O42263 cenpe "Kinesin-related protein" [Xenopus laevis (taxid:8355)] | Back alignment and assigned GO terms |
|---|
| DICTYBASE|DDB_G0285101 kif4 "kinesin-7" [Dictyostelium discoideum (taxid:44689)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1BQJ6 E1BQJ6 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| RGD|1307115 Cenpe "centromere protein E" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|I3LRD3 CENPE "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 1102 | |||
| cd01374 | 321 | cd01374, KISc_CENP_E, Kinesin motor domain, CENP-E | 1e-179 | |
| pfam00225 | 326 | pfam00225, Kinesin, Kinesin motor domain | 1e-130 | |
| smart00129 | 335 | smart00129, KISc, Kinesin motor, catalytic domain | 1e-119 | |
| cd00106 | 328 | cd00106, KISc, Kinesin motor domain | 1e-118 | |
| cd01369 | 325 | cd01369, KISc_KHC_KIF5, Kinesin motor domain, kine | 1e-102 | |
| cd01371 | 333 | cd01371, KISc_KIF3, Kinesin motor domain, kinesins | 7e-95 | |
| cd01372 | 341 | cd01372, KISc_KIF4, Kinesin motor domain, KIF4-lik | 7e-94 | |
| cd01370 | 338 | cd01370, KISc_KIP3_like, Kinesin motor domain, KIP | 3e-92 | |
| cd01364 | 352 | cd01364, KISc_BimC_Eg5, Kinesin motor domain, BimC | 5e-88 | |
| cd01365 | 356 | cd01365, KISc_KIF1A_KIF1B, Kinesin motor domain, K | 3e-86 | |
| cd01366 | 329 | cd01366, KISc_C_terminal, Kinesin motor domain, KI | 2e-85 | |
| cd01373 | 337 | cd01373, KISc_KLP2_like, Kinesin motor domain, KLP | 2e-81 | |
| COG5059 | 568 | COG5059, KIP1, Kinesin-like protein [Cytoskeleton] | 1e-74 | |
| cd01368 | 345 | cd01368, KISc_KIF23_like, Kinesin motor domain, KI | 7e-74 | |
| cd01367 | 322 | cd01367, KISc_KIF2_like, Kinesin motor domain, KIF | 3e-71 | |
| cd01376 | 319 | cd01376, KISc_KID_like, Kinesin motor domain, KIF2 | 4e-70 | |
| cd01375 | 334 | cd01375, KISc_KIF9_like, Kinesin motor domain, KIF | 2e-68 | |
| PLN03188 | 1320 | PLN03188, PLN03188, kinesin-12 family protein; Pro | 6e-56 | |
| cd01363 | 186 | cd01363, Motor_domain, Myosin and Kinesin motor do | 7e-23 | |
| pfam13920 | 49 | pfam13920, zf-C3HC4_3, Zinc finger, C3HC4 type (RI | 2e-17 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 4e-10 | |
| cd01363 | 186 | cd01363, Motor_domain, Myosin and Kinesin motor do | 9e-10 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 1e-09 | |
| pfam13923 | 45 | pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RI | 1e-08 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 3e-08 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 1e-07 | |
| cd00162 | 45 | cd00162, RING, RING-finger (Really Interesting New | 3e-07 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 9e-07 | |
| pfam13639 | 46 | pfam13639, zf-RING_2, Ring finger domain | 4e-06 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 5e-06 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 1e-05 | |
| smart00184 | 40 | smart00184, RING, Ring finger | 3e-05 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 1e-04 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 1e-04 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 1e-04 | |
| COG4372 | 499 | COG4372, COG4372, Uncharacterized protein conserve | 2e-04 | |
| COG2433 | 652 | COG2433, COG2433, Uncharacterized conserved protei | 4e-04 | |
| COG0419 | 908 | COG0419, SbcC, ATPase involved in DNA repair [DNA | 0.001 | |
| pfam03961 | 450 | pfam03961, DUF342, Protein of unknown function (DU | 0.002 | |
| pfam05557 | 722 | pfam05557, MAD, Mitotic checkpoint protein | 0.003 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 0.004 |
| >gnl|CDD|238670 cd01374, KISc_CENP_E, Kinesin motor domain, CENP-E/KIP2-like subgroup, involved in chromosome movement and/or spindle elongation during mitosis | Back alignment and domain information |
|---|
Score = 525 bits (1354), Expect = e-179
Identities = 198/322 (61%), Positives = 238/322 (73%), Gaps = 5/322 (1%)
Query: 101 SISVTIRFRPLSEREFQRGDEIAWYADGDK-IVRNEYNPATAYAFDRVFGPHANSQEVYD 159
I V++R RPL+ RE +++AW D D I E P ++ FDRVFG + ++EVY+
Sbjct: 1 KIKVSVRVRPLNPRE-SDNEQVAWSIDNDNTISLEESTPGQSFTFDRVFGGESTNREVYE 59
Query: 160 VAARPVVKAAMEGVNGTVFAYGVTSSGKTHTMHGDQNSPGIIPLAIKDVFSIIQDTPGRE 219
A+PVV++A+EG NGT+FAYG TSSGKT TM GD+ PGIIPLA++D+F IQDTP RE
Sbjct: 60 RIAKPVVRSALEGYNGTIFAYGQTSSGKTFTMSGDEQEPGIIPLAVRDIFQRIQDTPDRE 119
Query: 220 FLLRVSYLEIYNEVINDLLDPTGQNLRVREDAQ-GTYVEGIKEEVVLSPGHALSFIAAGE 278
FLLRVSYLEIYNE I DLL P+ Q LR+RED G V G+ EE+V SP H L IA GE
Sbjct: 120 FLLRVSYLEIYNEKIKDLLSPSPQELRIREDPNKGVVVAGLTEEIVTSPEHLLQLIARGE 179
Query: 279 EHRHVGSNNFNLLSSRSHTIFTLMIESSDHGDEYDG-VIFSQLNLIDLAGSESSKTETTG 337
++RHVG +FN SSRSHTIF L IES + GD G V S LNLIDLAGSE + G
Sbjct: 180 KNRHVGETDFNERSSRSHTIFQLTIESRERGDSESGTVRVSTLNLIDLAGSERASQTGAG 239
Query: 338 LRRKEGSYINKSLLTLGTVIGKLSEGKAS-HVPYRDSKLTRLLQSSLSGHGHVSLICTVT 396
RRKEGS+INKSLLTLGTVI KLSEGK S H+PYRDSKLTR+LQ SLSG+ ++ICT++
Sbjct: 240 ERRKEGSFINKSLLTLGTVISKLSEGKNSGHIPYRDSKLTRILQPSLSGNARTAIICTIS 299
Query: 397 PASSSMEETHNTLKFASRAKRV 418
PASS +EET NTLKFASRAK+V
Sbjct: 300 PASSHVEETLNTLKFASRAKKV 321
|
This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Kinesins are microtubule-dependent molecular motors that play important roles in intracellular transport and in cell division. In most kinesins, the motor domain is found at the N-terminus (N-type). N-type kinesins are (+) end-directed motors, i.e. they transport cargo towards the (+) end of the microtubule. Kinesin motor domains hydrolyze ATP at a rate of about 80 per second, and move along the microtubule at a speed of about 6400 Angstroms per second. To achieve that, kinesin head groups work in pairs. Upon replacing ADP with ATP, a kinesin motor domain increases its affinity for microtubule binding and locks in place. Also, the neck linker binds to the motor domain, which repositions the other head domain through the coiled-coil domain close to a second tubulin dimer, about 80 Angstroms along the microtubule. Meanwhile, ATP hydrolysis takes place, and when the second head domain binds to the microtubule, the first domain again replaces ADP with ATP, triggering a conformational change that pulls the first domain forward. Length = 321 |
| >gnl|CDD|215803 pfam00225, Kinesin, Kinesin motor domain | Back alignment and domain information |
|---|
| >gnl|CDD|214526 smart00129, KISc, Kinesin motor, catalytic domain | Back alignment and domain information |
|---|
| >gnl|CDD|238054 cd00106, KISc, Kinesin motor domain | Back alignment and domain information |
|---|
| >gnl|CDD|238665 cd01369, KISc_KHC_KIF5, Kinesin motor domain, kinesin heavy chain (KHC) or KIF5-like subgroup | Back alignment and domain information |
|---|
| >gnl|CDD|238667 cd01371, KISc_KIF3, Kinesin motor domain, kinesins II or KIF3_like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|238668 cd01372, KISc_KIF4, Kinesin motor domain, KIF4-like subfamily | Back alignment and domain information |
|---|
| >gnl|CDD|238666 cd01370, KISc_KIP3_like, Kinesin motor domain, KIP3-like subgroup | Back alignment and domain information |
|---|
| >gnl|CDD|238660 cd01364, KISc_BimC_Eg5, Kinesin motor domain, BimC/Eg5 spindle pole proteins, participate in spindle assembly and chromosome segregation during cell division | Back alignment and domain information |
|---|
| >gnl|CDD|238661 cd01365, KISc_KIF1A_KIF1B, Kinesin motor domain, KIF1_like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|238662 cd01366, KISc_C_terminal, Kinesin motor domain, KIFC2/KIFC3/ncd-like carboxy-terminal kinesins | Back alignment and domain information |
|---|
| >gnl|CDD|238669 cd01373, KISc_KLP2_like, Kinesin motor domain, KLP2-like subgroup | Back alignment and domain information |
|---|
| >gnl|CDD|227392 COG5059, KIP1, Kinesin-like protein [Cytoskeleton] | Back alignment and domain information |
|---|
| >gnl|CDD|238664 cd01368, KISc_KIF23_like, Kinesin motor domain, KIF23-like subgroup | Back alignment and domain information |
|---|
| >gnl|CDD|238663 cd01367, KISc_KIF2_like, Kinesin motor domain, KIF2-like group | Back alignment and domain information |
|---|
| >gnl|CDD|238672 cd01376, KISc_KID_like, Kinesin motor domain, KIF22/Kid-like subgroup | Back alignment and domain information |
|---|
| >gnl|CDD|238671 cd01375, KISc_KIF9_like, Kinesin motor domain, KIF9-like subgroup; might play a role in cell shape remodeling | Back alignment and domain information |
|---|
| >gnl|CDD|215621 PLN03188, PLN03188, kinesin-12 family protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|238659 cd01363, Motor_domain, Myosin and Kinesin motor domain | Back alignment and domain information |
|---|
| >gnl|CDD|222454 pfam13920, zf-C3HC4_3, Zinc finger, C3HC4 type (RING finger) | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|238659 cd01363, Motor_domain, Myosin and Kinesin motor domain | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|206094 pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RING finger) | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|238093 cd00162, RING, RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|222279 pfam13639, zf-RING_2, Ring finger domain | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|214546 smart00184, RING, Ring finger | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|226809 COG4372, COG4372, Uncharacterized protein conserved in bacteria with the myosin-like domain [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|225288 COG2433, COG2433, Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|217817 pfam03961, DUF342, Protein of unknown function (DUF342) | Back alignment and domain information |
|---|
| >gnl|CDD|218636 pfam05557, MAD, Mitotic checkpoint protein | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 1102 | |||
| KOG0243 | 1041 | consensus Kinesin-like protein [Cytoskeleton] | 100.0 | |
| KOG0245 | 1221 | consensus Kinesin-like protein [Cytoskeleton] | 100.0 | |
| PLN03188 | 1320 | kinesin-12 family protein; Provisional | 100.0 | |
| KOG4280 | 574 | consensus Kinesin-like protein [Cytoskeleton] | 100.0 | |
| KOG0242 | 675 | consensus Kinesin-like protein [Cytoskeleton] | 100.0 | |
| KOG0240 | 607 | consensus Kinesin (SMY1 subfamily) [Cytoskeleton] | 100.0 | |
| KOG0241 | 1714 | consensus Kinesin-like protein [Cytoskeleton] | 100.0 | |
| cd01373 | 337 | KISc_KLP2_like Kinesin motor domain, KLP2-like sub | 100.0 | |
| cd01370 | 338 | KISc_KIP3_like Kinesin motor domain, KIP3-like sub | 100.0 | |
| cd01368 | 345 | KISc_KIF23_like Kinesin motor domain, KIF23-like s | 100.0 | |
| cd01365 | 356 | KISc_KIF1A_KIF1B Kinesin motor domain, KIF1_like p | 100.0 | |
| cd01374 | 321 | KISc_CENP_E Kinesin motor domain, CENP-E/KIP2-like | 100.0 | |
| cd01371 | 333 | KISc_KIF3 Kinesin motor domain, kinesins II or KIF | 100.0 | |
| cd01367 | 322 | KISc_KIF2_like Kinesin motor domain, KIF2-like gro | 100.0 | |
| cd01364 | 352 | KISc_BimC_Eg5 Kinesin motor domain, BimC/Eg5 spind | 100.0 | |
| cd01369 | 325 | KISc_KHC_KIF5 Kinesin motor domain, kinesin heavy | 100.0 | |
| cd01376 | 319 | KISc_KID_like Kinesin motor domain, KIF22/Kid-like | 100.0 | |
| cd01375 | 334 | KISc_KIF9_like Kinesin motor domain, KIF9-like sub | 100.0 | |
| cd01372 | 341 | KISc_KIF4 Kinesin motor domain, KIF4-like subfamil | 100.0 | |
| cd01366 | 329 | KISc_C_terminal Kinesin motor domain, KIFC2/KIFC3/ | 100.0 | |
| KOG0239 | 670 | consensus Kinesin (KAR3 subfamily) [Cytoskeleton] | 100.0 | |
| smart00129 | 335 | KISc Kinesin motor, catalytic domain. ATPase. Micr | 100.0 | |
| cd00106 | 328 | KISc Kinesin motor domain. This catalytic (head) d | 100.0 | |
| PF00225 | 335 | Kinesin: Kinesin motor domain; InterPro: IPR001752 | 100.0 | |
| KOG0244 | 913 | consensus Kinesin-like protein [Cytoskeleton] | 100.0 | |
| KOG0246 | 676 | consensus Kinesin-like protein [Cytoskeleton] | 100.0 | |
| KOG0247 | 809 | consensus Kinesin-like protein [Cytoskeleton] | 100.0 | |
| COG5059 | 568 | KIP1 Kinesin-like protein [Cytoskeleton] | 100.0 | |
| cd01363 | 186 | Motor_domain Myosin and Kinesin motor domain. Thes | 100.0 | |
| KOG0978 | 698 | consensus E3 ubiquitin ligase involved in syntaxin | 99.55 | |
| KOG0612 | 1317 | consensus Rho-associated, coiled-coil containing p | 99.47 | |
| KOG4265 | 349 | consensus Predicted E3 ubiquitin ligase [Posttrans | 99.25 | |
| KOG4172 | 62 | consensus Predicted E3 ubiquitin ligase [Posttrans | 99.04 | |
| KOG4275 | 350 | consensus Predicted E3 ubiquitin ligase [Posttrans | 98.88 | |
| KOG1571 | 355 | consensus Predicted E3 ubiquitin ligase [Posttrans | 98.79 | |
| PF13920 | 50 | zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); | 98.78 | |
| KOG1100 | 207 | consensus Predicted E3 ubiquitin ligase [Posttrans | 98.39 | |
| PF07888 | 546 | CALCOCO1: Calcium binding and coiled-coil domain ( | 98.28 | |
| KOG0823 | 230 | consensus Predicted E3 ubiquitin ligase [Posttrans | 98.26 | |
| TIGR02169 | 1164 | SMC_prok_A chromosome segregation protein SMC, pri | 98.15 | |
| TIGR02169 | 1164 | SMC_prok_A chromosome segregation protein SMC, pri | 98.0 | |
| PLN03208 | 193 | E3 ubiquitin-protein ligase RMA2; Provisional | 97.96 | |
| TIGR02168 | 1179 | SMC_prok_B chromosome segregation protein SMC, com | 97.88 | |
| TIGR02168 | 1179 | SMC_prok_B chromosome segregation protein SMC, com | 97.87 | |
| KOG0996 | 1293 | consensus Structural maintenance of chromosome pro | 97.85 | |
| KOG4673 | 961 | consensus Transcription factor TMF, TATA element m | 97.85 | |
| KOG0320 | 187 | consensus Predicted E3 ubiquitin ligase [Posttrans | 97.84 | |
| KOG0317 | 293 | consensus Predicted E3 ubiquitin ligase, integral | 97.83 | |
| PF07888 | 546 | CALCOCO1: Calcium binding and coiled-coil domain ( | 97.81 | |
| PF10174 | 775 | Cast: RIM-binding protein of the cytomatrix active | 97.78 | |
| KOG0161 | 1930 | consensus Myosin class II heavy chain [Cytoskeleto | 97.77 | |
| COG5059 | 568 | KIP1 Kinesin-like protein [Cytoskeleton] | 97.69 | |
| KOG0963 | 629 | consensus Transcription factor/CCAAT displacement | 97.65 | |
| KOG0971 | 1243 | consensus Microtubule-associated protein dynactin | 97.62 | |
| PHA02929 | 238 | N1R/p28-like protein; Provisional | 97.61 | |
| PRK03918 | 880 | chromosome segregation protein; Provisional | 97.6 | |
| COG1196 | 1163 | Smc Chromosome segregation ATPases [Cell division | 97.6 | |
| KOG2164 | 513 | consensus Predicted E3 ubiquitin ligase [Posttrans | 97.58 | |
| PF14634 | 44 | zf-RING_5: zinc-RING finger domain | 97.52 | |
| PF13923 | 39 | zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); | 97.52 | |
| TIGR00606 | 1311 | rad50 rad50. This family is based on the phylogeno | 97.49 | |
| PRK02224 | 880 | chromosome segregation protein; Provisional | 97.46 | |
| KOG0161 | 1930 | consensus Myosin class II heavy chain [Cytoskeleto | 97.46 | |
| COG1196 | 1163 | Smc Chromosome segregation ATPases [Cell division | 97.45 | |
| PF15070 | 617 | GOLGA2L5: Putative golgin subfamily A member 2-lik | 97.45 | |
| PF09730 | 717 | BicD: Microtubule-associated protein Bicaudal-D; I | 97.45 | |
| KOG0971 | 1243 | consensus Microtubule-associated protein dynactin | 97.43 | |
| COG1579 | 239 | Zn-ribbon protein, possibly nucleic acid-binding [ | 97.43 | |
| PRK11637 | 428 | AmiB activator; Provisional | 97.42 | |
| PF08826 | 61 | DMPK_coil: DMPK coiled coil domain like; InterPro: | 97.42 | |
| KOG4674 | 1822 | consensus Uncharacterized conserved coiled-coil pr | 97.42 | |
| TIGR00606 | 1311 | rad50 rad50. This family is based on the phylogeno | 97.4 | |
| KOG0933 | 1174 | consensus Structural maintenance of chromosome pro | 97.39 | |
| PF12128 | 1201 | DUF3584: Protein of unknown function (DUF3584); In | 97.35 | |
| KOG0995 | 581 | consensus Centromere-associated protein HEC1 [Cell | 97.34 | |
| PHA02562 | 562 | 46 endonuclease subunit; Provisional | 97.29 | |
| PRK02224 | 880 | chromosome segregation protein; Provisional | 97.27 | |
| PRK04863 | 1486 | mukB cell division protein MukB; Provisional | 97.24 | |
| COG5574 | 271 | PEX10 RING-finger-containing E3 ubiquitin ligase [ | 97.23 | |
| PF13639 | 44 | zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C | 97.22 | |
| KOG0976 | 1265 | consensus Rho/Rac1-interacting serine/threonine ki | 97.18 | |
| PF09726 | 697 | Macoilin: Transmembrane protein; InterPro: IPR0191 | 97.18 | |
| TIGR00599 | 397 | rad18 DNA repair protein rad18. This family is bas | 97.18 | |
| KOG0994 | 1758 | consensus Extracellular matrix glycoprotein Lamini | 97.15 | |
| PHA02926 | 242 | zinc finger-like protein; Provisional | 97.14 | |
| KOG0933 | 1174 | consensus Structural maintenance of chromosome pro | 97.08 | |
| KOG4674 | 1822 | consensus Uncharacterized conserved coiled-coil pr | 97.07 | |
| COG5185 | 622 | HEC1 Protein involved in chromosome segregation, i | 97.06 | |
| PF14662 | 193 | CCDC155: Coiled-coil region of CCDC155 | 97.04 | |
| KOG1785 | 563 | consensus Tyrosine kinase negative regulator CBL [ | 97.04 | |
| KOG0977 | 546 | consensus Nuclear envelope protein lamin, intermed | 97.04 | |
| smart00184 | 39 | RING Ring finger. E3 ubiquitin-protein ligase acti | 96.95 | |
| cd00162 | 45 | RING RING-finger (Really Interesting New Gene) dom | 96.92 | |
| PF12128 | 1201 | DUF3584: Protein of unknown function (DUF3584); In | 96.91 | |
| KOG4643 | 1195 | consensus Uncharacterized coiled-coil protein [Fun | 96.91 | |
| COG5432 | 391 | RAD18 RING-finger-containing E3 ubiquitin ligase [ | 96.9 | |
| KOG0996 | 1293 | consensus Structural maintenance of chromosome pro | 96.89 | |
| KOG0287 | 442 | consensus Postreplication repair protein RAD18 [Re | 96.86 | |
| COG4372 | 499 | Uncharacterized protein conserved in bacteria with | 96.85 | |
| PRK11637 | 428 | AmiB activator; Provisional | 96.84 | |
| PF15070 | 617 | GOLGA2L5: Putative golgin subfamily A member 2-lik | 96.83 | |
| PF15227 | 42 | zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: | 96.82 | |
| PF14447 | 55 | Prok-RING_4: Prokaryotic RING finger family 4 | 96.81 | |
| PF00261 | 237 | Tropomyosin: Tropomyosin; InterPro: IPR000533 Trop | 96.76 | |
| PRK03918 | 880 | chromosome segregation protein; Provisional | 96.75 | |
| PRK04863 | 1486 | mukB cell division protein MukB; Provisional | 96.73 | |
| KOG0612 | 1317 | consensus Rho-associated, coiled-coil containing p | 96.72 | |
| PF05701 | 522 | WEMBL: Weak chloroplast movement under blue light; | 96.71 | |
| COG4942 | 420 | Membrane-bound metallopeptidase [Cell division and | 96.71 | |
| PF00097 | 41 | zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I | 96.71 | |
| smart00504 | 63 | Ubox Modified RING finger domain. Modified RING fi | 96.62 | |
| PF05701 | 522 | WEMBL: Weak chloroplast movement under blue light; | 96.61 | |
| PF04849 | 306 | HAP1_N: HAP1 N-terminal conserved region; InterPro | 96.6 | |
| KOG0250 | 1074 | consensus DNA repair protein RAD18 (SMC family pro | 96.58 | |
| KOG0977 | 546 | consensus Nuclear envelope protein lamin, intermed | 96.55 | |
| KOG0980 | 980 | consensus Actin-binding protein SLA2/Huntingtin-in | 96.43 | |
| KOG4692 | 489 | consensus Predicted E3 ubiquitin ligase [Posttrans | 96.42 | |
| KOG0976 | 1265 | consensus Rho/Rac1-interacting serine/threonine ki | 96.41 | |
| PF09755 | 310 | DUF2046: Uncharacterized conserved protein H4 (DUF | 96.36 | |
| PF00038 | 312 | Filament: Intermediate filament protein; InterPro: | 96.36 | |
| PF10174 | 775 | Cast: RIM-binding protein of the cytomatrix active | 96.34 | |
| PHA02562 | 562 | 46 endonuclease subunit; Provisional | 96.31 | |
| KOG4643 | 1195 | consensus Uncharacterized coiled-coil protein [Fun | 96.28 | |
| KOG0946 | 970 | consensus ER-Golgi vesicle-tethering protein p115 | 96.28 | |
| PF13445 | 43 | zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A. | 96.21 | |
| PF09726 | 697 | Macoilin: Transmembrane protein; InterPro: IPR0191 | 96.2 | |
| COG5236 | 493 | Uncharacterized conserved protein, contains RING Z | 96.17 | |
| PF00261 | 237 | Tropomyosin: Tropomyosin; InterPro: IPR000533 Trop | 96.16 | |
| KOG0994 | 1758 | consensus Extracellular matrix glycoprotein Lamini | 96.09 | |
| PF08647 | 96 | BRE1: BRE1 E3 ubiquitin ligase; InterPro: IPR01395 | 96.08 | |
| KOG0978 | 698 | consensus E3 ubiquitin ligase involved in syntaxin | 95.99 | |
| PF09730 | 717 | BicD: Microtubule-associated protein Bicaudal-D; I | 95.99 | |
| PF14835 | 65 | zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM | 95.95 | |
| KOG0963 | 629 | consensus Transcription factor/CCAAT displacement | 95.88 | |
| KOG1029 | 1118 | consensus Endocytic adaptor protein intersectin [S | 95.87 | |
| KOG0964 | 1200 | consensus Structural maintenance of chromosome pro | 95.87 | |
| TIGR03007 | 498 | pepcterm_ChnLen polysaccharide chain length determ | 95.85 | |
| COG5152 | 259 | Uncharacterized conserved protein, contains RING a | 95.84 | |
| KOG2177 | 386 | consensus Predicted E3 ubiquitin ligase [Posttrans | 95.81 | |
| PF05557 | 722 | MAD: Mitotic checkpoint protein; InterPro: IPR0086 | 95.69 | |
| KOG1813 | 313 | consensus Predicted E3 ubiquitin ligase [Posttrans | 95.67 | |
| COG5540 | 374 | RING-finger-containing ubiquitin ligase [Posttrans | 95.61 | |
| PRK04778 | 569 | septation ring formation regulator EzrA; Provision | 95.59 | |
| KOG1029 | 1118 | consensus Endocytic adaptor protein intersectin [S | 95.59 | |
| PRK09039 | 343 | hypothetical protein; Validated | 95.55 | |
| KOG0999 | 772 | consensus Microtubule-associated protein Bicaudal- | 95.54 | |
| KOG0964 | 1200 | consensus Structural maintenance of chromosome pro | 95.54 | |
| KOG0250 | 1074 | consensus DNA repair protein RAD18 (SMC family pro | 95.49 | |
| KOG4593 | 716 | consensus Mitotic checkpoint protein MAD1 [Cell cy | 95.48 | |
| KOG0980 | 980 | consensus Actin-binding protein SLA2/Huntingtin-in | 95.42 | |
| PF05622 | 713 | HOOK: HOOK protein; InterPro: IPR008636 This famil | 95.42 | |
| PF14915 | 305 | CCDC144C: CCDC144C protein coiled-coil region | 95.35 | |
| PF06818 | 202 | Fez1: Fez1; InterPro: IPR009638 This family repres | 95.32 | |
| KOG0239 | 670 | consensus Kinesin (KAR3 subfamily) [Cytoskeleton] | 95.22 | |
| PF15066 | 527 | CAGE1: Cancer-associated gene protein 1 family | 95.22 | |
| KOG4360 | 596 | consensus Uncharacterized coiled coil protein [Fun | 95.19 | |
| PRK11281 | 1113 | hypothetical protein; Provisional | 95.19 | |
| PF05667 | 594 | DUF812: Protein of unknown function (DUF812); Inte | 95.18 | |
| PF00038 | 312 | Filament: Intermediate filament protein; InterPro: | 95.13 | |
| PRK09039 | 343 | hypothetical protein; Validated | 95.12 | |
| KOG0249 | 916 | consensus LAR-interacting protein and related prot | 95.12 | |
| PF07926 | 132 | TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: | 95.08 | |
| PF04849 | 306 | HAP1_N: HAP1 N-terminal conserved region; InterPro | 94.9 | |
| PRK10929 | 1109 | putative mechanosensitive channel protein; Provisi | 94.79 | |
| COG4942 | 420 | Membrane-bound metallopeptidase [Cell division and | 94.74 | |
| PF12678 | 73 | zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 | 94.69 | |
| COG5243 | 491 | HRD1 HRD ubiquitin ligase complex, ER membrane com | 94.67 | |
| PRK11281 | 1113 | hypothetical protein; Provisional | 94.61 | |
| KOG0018 | 1141 | consensus Structural maintenance of chromosome pro | 94.59 | |
| PF09787 | 511 | Golgin_A5: Golgin subfamily A member 5; InterPro: | 94.54 | |
| PF15619 | 194 | Lebercilin: Ciliary protein causing Leber congenit | 94.41 | |
| PF12718 | 143 | Tropomyosin_1: Tropomyosin like; InterPro: IPR0005 | 94.27 | |
| PF09789 | 319 | DUF2353: Uncharacterized coiled-coil protein (DUF2 | 94.27 | |
| PF05622 | 713 | HOOK: HOOK protein; InterPro: IPR008636 This famil | 94.24 | |
| KOG4360 | 596 | consensus Uncharacterized coiled coil protein [Fun | 94.2 | |
| PF07058 | 351 | Myosin_HC-like: Myosin II heavy chain-like; InterP | 94.2 | |
| KOG4687 | 389 | consensus Uncharacterized coiled-coil protein [Fun | 94.16 | |
| COG1340 | 294 | Uncharacterized archaeal coiled-coil protein [Func | 94.09 | |
| COG4372 | 499 | Uncharacterized protein conserved in bacteria with | 94.08 | |
| PF06818 | 202 | Fez1: Fez1; InterPro: IPR009638 This family repres | 94.06 | |
| KOG1853 | 333 | consensus LIS1-interacting protein NUDE [Cytoskele | 94.02 | |
| KOG4673 | 961 | consensus Transcription factor TMF, TATA element m | 94.0 | |
| COG1579 | 239 | Zn-ribbon protein, possibly nucleic acid-binding [ | 93.99 | |
| PF05667 | 594 | DUF812: Protein of unknown function (DUF812); Inte | 93.95 | |
| KOG0802 | 543 | consensus E3 ubiquitin ligase [Posttranslational m | 93.89 | |
| KOG2113 | 394 | consensus Predicted RNA binding protein, contains | 93.82 | |
| PF05483 | 786 | SCP-1: Synaptonemal complex protein 1 (SCP-1); Int | 93.78 | |
| PF07926 | 132 | TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: | 93.75 | |
| PF06785 | 401 | UPF0242: Uncharacterised protein family (UPF0242); | 93.71 | |
| KOG4159 | 398 | consensus Predicted E3 ubiquitin ligase [Posttrans | 93.7 | |
| KOG2879 | 298 | consensus Predicted E3 ubiquitin ligase [Posttrans | 93.65 | |
| TIGR01843 | 423 | type_I_hlyD type I secretion membrane fusion prote | 93.62 | |
| PF04564 | 73 | U-box: U-box domain; InterPro: IPR003613 Quality c | 93.61 | |
| PRK10929 | 1109 | putative mechanosensitive channel protein; Provisi | 93.51 | |
| KOG0946 | 970 | consensus ER-Golgi vesicle-tethering protein p115 | 93.35 | |
| KOG0982 | 502 | consensus Centrosomal protein Nuf [Cell cycle cont | 93.31 | |
| TIGR00634 | 563 | recN DNA repair protein RecN. All proteins in this | 93.3 | |
| PF00308 | 219 | Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013 | 93.3 | |
| PF15619 | 194 | Lebercilin: Ciliary protein causing Leber congenit | 93.25 | |
| COG3096 | 1480 | MukB Uncharacterized protein involved in chromosom | 93.24 | |
| PF08614 | 194 | ATG16: Autophagy protein 16 (ATG16); InterPro: IPR | 93.24 | |
| COG5185 | 622 | HEC1 Protein involved in chromosome segregation, i | 93.16 | |
| KOG0311 | 381 | consensus Predicted E3 ubiquitin ligase [Posttrans | 93.1 | |
| PRK01156 | 895 | chromosome segregation protein; Provisional | 92.84 | |
| PF04641 | 260 | Rtf2: Rtf2 RING-finger | 92.8 | |
| TIGR03017 | 444 | EpsF chain length determinant protein EpsF. Sequen | 92.78 | |
| PF12325 | 120 | TMF_TATA_bd: TATA element modulatory factor 1 TATA | 92.68 | |
| KOG0962 | 1294 | consensus DNA repair protein RAD50, ABC-type ATPas | 92.39 | |
| PF01576 | 859 | Myosin_tail_1: Myosin tail; InterPro: IPR002928 Mu | 92.35 | |
| COG0556 | 663 | UvrB Helicase subunit of the DNA excision repair c | 92.17 | |
| KOG4628 | 348 | consensus Predicted E3 ubiquitin ligase [Posttrans | 92.05 | |
| PRK06893 | 229 | DNA replication initiation factor; Validated | 91.87 | |
| KOG2129 | 552 | consensus Uncharacterized conserved protein H4 [Fu | 91.81 | |
| PF06785 | 401 | UPF0242: Uncharacterised protein family (UPF0242); | 91.76 | |
| KOG0249 | 916 | consensus LAR-interacting protein and related prot | 91.71 | |
| PRK14086 | 617 | dnaA chromosomal replication initiation protein; P | 91.67 | |
| PRK06620 | 214 | hypothetical protein; Validated | 91.66 | |
| PF01576 | 859 | Myosin_tail_1: Myosin tail; InterPro: IPR002928 Mu | 91.61 | |
| KOG0828 | 636 | consensus Predicted E3 ubiquitin ligase [Posttrans | 91.53 | |
| KOG0999 | 772 | consensus Microtubule-associated protein Bicaudal- | 91.48 | |
| KOG1003 | 205 | consensus Actin filament-coating protein tropomyos | 91.34 | |
| PF14662 | 193 | CCDC155: Coiled-coil region of CCDC155 | 91.32 | |
| PF14988 | 206 | DUF4515: Domain of unknown function (DUF4515) | 91.18 | |
| COG2804 | 500 | PulE Type II secretory pathway, ATPase PulE/Tfp pi | 91.16 | |
| TIGR01005 | 754 | eps_transp_fam exopolysaccharide transport protein | 91.12 | |
| KOG0825 | 1134 | consensus PHD Zn-finger protein [General function | 91.12 | |
| KOG1001 | 674 | consensus Helicase-like transcription factor HLTF/ | 91.03 | |
| KOG0018 | 1141 | consensus Structural maintenance of chromosome pro | 90.97 | |
| KOG0979 | 1072 | consensus Structural maintenance of chromosome pro | 90.9 | |
| PF13851 | 201 | GAS: Growth-arrest specific micro-tubule binding | 90.89 | |
| PF09789 | 319 | DUF2353: Uncharacterized coiled-coil protein (DUF2 | 90.87 | |
| COG3883 | 265 | Uncharacterized protein conserved in bacteria [Fun | 90.86 | |
| PF10168 | 717 | Nup88: Nuclear pore component; InterPro: IPR019321 | 90.86 | |
| PF05483 | 786 | SCP-1: Synaptonemal complex protein 1 (SCP-1); Int | 90.82 | |
| PF10212 | 518 | TTKRSYEDQ: Predicted coiled-coil domain-containing | 90.8 | |
| PF15066 | 527 | CAGE1: Cancer-associated gene protein 1 family | 90.8 | |
| PF12718 | 143 | Tropomyosin_1: Tropomyosin like; InterPro: IPR0005 | 90.65 | |
| COG3883 | 265 | Uncharacterized protein conserved in bacteria [Fun | 90.65 | |
| TIGR03007 | 498 | pepcterm_ChnLen polysaccharide chain length determ | 90.52 | |
| TIGR01005 | 754 | eps_transp_fam exopolysaccharide transport protein | 90.49 | |
| PF03148 | 384 | Tektin: Tektin family; InterPro: IPR000435 Tektin | 90.37 | |
| PF08172 | 248 | CASP_C: CASP C terminal; InterPro: IPR012955 This | 89.97 | |
| KOG1039 | 344 | consensus Predicted E3 ubiquitin ligase [Posttrans | 89.88 | |
| PF06160 | 560 | EzrA: Septation ring formation regulator, EzrA ; I | 89.86 | |
| TIGR03185 | 650 | DNA_S_dndD DNA sulfur modification protein DndD. T | 89.83 | |
| PF08317 | 325 | Spc7: Spc7 kinetochore protein; InterPro: IPR01325 | 89.82 | |
| PF07111 | 739 | HCR: Alpha helical coiled-coil rod protein (HCR); | 89.8 | |
| PRK10884 | 206 | SH3 domain-containing protein; Provisional | 89.63 | |
| PRK10884 | 206 | SH3 domain-containing protein; Provisional | 89.6 | |
| COG2805 | 353 | PilT Tfp pilus assembly protein, pilus retraction | 89.59 | |
| KOG4807 | 593 | consensus F-actin binding protein, regulates actin | 89.57 | |
| TIGR01000 | 457 | bacteriocin_acc bacteriocin secretion accessory pr | 89.53 | |
| PF12861 | 85 | zf-Apc11: Anaphase-promoting complex subunit 11 RI | 89.31 | |
| KOG1853 | 333 | consensus LIS1-interacting protein NUDE [Cytoskele | 89.24 | |
| PF13514 | 1111 | AAA_27: AAA domain | 89.15 | |
| PRK10869 | 553 | recombination and repair protein; Provisional | 88.86 | |
| KOG1814 | 445 | consensus Predicted E3 ubiquitin ligase [Posttrans | 88.51 | |
| KOG4302 | 660 | consensus Microtubule-associated protein essential | 88.41 | |
| PRK06835 | 329 | DNA replication protein DnaC; Validated | 88.36 | |
| KOG3002 | 299 | consensus Zn finger protein [General function pred | 88.29 | |
| PF09728 | 309 | Taxilin: Myosin-like coiled-coil protein; InterPro | 88.22 | |
| KOG0995 | 581 | consensus Centromere-associated protein HEC1 [Cell | 88.21 | |
| PRK12377 | 248 | putative replication protein; Provisional | 88.13 | |
| KOG0243 | 1041 | consensus Kinesin-like protein [Cytoskeleton] | 87.96 | |
| TIGR00634 | 563 | recN DNA repair protein RecN. All proteins in this | 87.92 | |
| PRK08116 | 268 | hypothetical protein; Validated | 87.9 | |
| PRK05642 | 234 | DNA replication initiation factor; Validated | 87.66 | |
| PRK04778 | 569 | septation ring formation regulator EzrA; Provision | 87.39 | |
| PF10481 | 307 | CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR0 | 87.37 | |
| KOG3039 | 303 | consensus Uncharacterized conserved protein [Funct | 87.35 | |
| PRK08084 | 235 | DNA replication initiation factor; Provisional | 87.3 | |
| COG0497 | 557 | RecN ATPase involved in DNA repair [DNA replicatio | 87.27 | |
| TIGR02680 | 1353 | conserved hypothetical protein TIGR02680. Members | 87.19 | |
| PRK06526 | 254 | transposase; Provisional | 87.02 | |
| PLN02939 | 977 | transferase, transferring glycosyl groups | 86.94 | |
| PRK14088 | 440 | dnaA chromosomal replication initiation protein; P | 86.82 | |
| PF10473 | 140 | CENP-F_leu_zip: Leucine-rich repeats of kinetochor | 86.79 | |
| PF05911 | 769 | DUF869: Plant protein of unknown function (DUF869) | 86.75 | |
| PF05557 | 722 | MAD: Mitotic checkpoint protein; InterPro: IPR0086 | 86.71 | |
| PF12325 | 120 | TMF_TATA_bd: TATA element modulatory factor 1 TATA | 86.61 | |
| PRK14087 | 450 | dnaA chromosomal replication initiation protein; P | 86.59 | |
| TIGR01843 | 423 | type_I_hlyD type I secretion membrane fusion prote | 86.56 | |
| PRK09087 | 226 | hypothetical protein; Validated | 86.53 | |
| KOG4807 | 593 | consensus F-actin binding protein, regulates actin | 86.14 | |
| TIGR00362 | 405 | DnaA chromosomal replication initiator protein Dna | 85.97 | |
| PF00769 | 246 | ERM: Ezrin/radixin/moesin family; InterPro: IPR011 | 85.84 | |
| PRK00149 | 450 | dnaA chromosomal replication initiation protein; R | 85.4 | |
| PF15035 | 182 | Rootletin: Ciliary rootlet component, centrosome c | 85.21 | |
| PF15254 | 861 | CCDC14: Coiled-coil domain-containing protein 14 | 85.14 | |
| PRK07952 | 244 | DNA replication protein DnaC; Validated | 85.09 | |
| PF10168 | 717 | Nup88: Nuclear pore component; InterPro: IPR019321 | 84.85 | |
| PLN03229 | 762 | acetyl-coenzyme A carboxylase carboxyl transferase | 84.83 | |
| TIGR03420 | 226 | DnaA_homol_Hda DnaA regulatory inactivator Hda. Me | 84.77 | |
| PF06005 | 72 | DUF904: Protein of unknown function (DUF904); Inte | 84.64 | |
| PF13514 | 1111 | AAA_27: AAA domain | 84.6 | |
| COG4477 | 570 | EzrA Negative regulator of septation ring formatio | 84.19 | |
| PF14197 | 69 | Cep57_CLD_2: Centrosome localisation domain of PPC | 84.13 | |
| KOG4809 | 654 | consensus Rab6 GTPase-interacting protein involved | 84.04 | |
| PRK08903 | 227 | DnaA regulatory inactivator Hda; Validated | 83.99 | |
| KOG1002 | 791 | consensus Nucleotide excision repair protein RAD16 | 83.76 | |
| KOG2113 | 394 | consensus Predicted RNA binding protein, contains | 83.65 | |
| COG1340 | 294 | Uncharacterized archaeal coiled-coil protein [Func | 83.37 | |
| COG0497 | 557 | RecN ATPase involved in DNA repair [DNA replicatio | 83.24 | |
| PF13870 | 177 | DUF4201: Domain of unknown function (DUF4201) | 83.04 | |
| PF08614 | 194 | ATG16: Autophagy protein 16 (ATG16); InterPro: IPR | 82.9 | |
| TIGR02928 | 365 | orc1/cdc6 family replication initiation protein. M | 82.81 | |
| COG1474 | 366 | CDC6 Cdc6-related protein, AAA superfamily ATPase | 82.8 | |
| PF10481 | 307 | CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR0 | 82.74 | |
| TIGR02680 | 1353 | conserved hypothetical protein TIGR02680. Members | 82.65 | |
| PF09787 | 511 | Golgin_A5: Golgin subfamily A member 5; InterPro: | 82.56 | |
| COG2433 | 652 | Uncharacterized conserved protein [Function unknow | 82.34 | |
| PF07058 | 351 | Myosin_HC-like: Myosin II heavy chain-like; InterP | 82.3 | |
| PRK08181 | 269 | transposase; Validated | 81.94 | |
| COG0593 | 408 | DnaA ATPase involved in DNA replication initiation | 81.86 | |
| PRK15422 | 79 | septal ring assembly protein ZapB; Provisional | 81.82 | |
| PRK00411 | 394 | cdc6 cell division control protein 6; Reviewed | 81.67 | |
| PRK08939 | 306 | primosomal protein DnaI; Reviewed | 81.66 | |
| PRK08727 | 233 | hypothetical protein; Validated | 81.55 | |
| PF04851 | 184 | ResIII: Type III restriction enzyme, res subunit; | 81.25 | |
| PF10186 | 302 | Atg14: UV radiation resistance protein and autopha | 81.17 | |
| PF04012 | 221 | PspA_IM30: PspA/IM30 family; InterPro: IPR007157 T | 80.9 | |
| PF03962 | 188 | Mnd1: Mnd1 family; InterPro: IPR005647 This family | 80.79 | |
| PF04111 | 314 | APG6: Autophagy protein Apg6; InterPro: IPR007243 | 80.03 | |
| KOG0804 | 493 | consensus Cytoplasmic Zn-finger protein BRAP2 (BRC | 80.01 |
| >KOG0243 consensus Kinesin-like protein [Cytoskeleton] | Back alignment and domain information |
|---|
Probab=100.00 E-value=2.1e-88 Score=819.36 Aligned_cols=401 Identities=36% Similarity=0.598 Sum_probs=343.8
Q ss_pred CCCCCCEEEEEEeCCCChhhhhcCCeEEEeeCC-CE-EEecCC--C--CCcceeeceecCCCCChhHHHhhhhHHHHHHH
Q 001316 96 QRSGDSISVTIRFRPLSEREFQRGDEIAWYADG-DK-IVRNEY--N--PATAYAFDRVFGPHANSQEVYDVAARPVVKAA 169 (1102)
Q Consensus 96 ~~~~~~I~V~vRvRP~~~~E~~~~~~~~~~~~~-~~-~~~~~~--~--~~~~f~FD~VF~~~~~q~~Vy~~~~~plV~~~ 169 (1102)
...+.||+|+|||||++.+|.......++..+| .+ |.+... . -.+.|+||+||||.+.|++||+.++.|+|..|
T Consensus 45 ~e~~~NIqVivRcRp~n~~E~~~~s~~VVs~~~~~kEV~v~~~~~sk~~~k~ftFDkVFGpes~Q~d~Y~~~v~p~i~eV 124 (1041)
T KOG0243|consen 45 KEKEVNIQVIVRCRPRNDRERKSKSSVVVSCDGIRKEVAVRQTIASKQIDKTFTFDKVFGPESQQEDLYDQAVSPIIKEV 124 (1041)
T ss_pred CCCCCceEEEEEeCCCCchhhhcCCCeEEecCCCcceEEEecccccccccceeecceeeCcchhHHHHHHHHHHHHHHHH
Confidence 355679999999999999999888888877776 33 322221 1 36789999999999999999999999999999
Q ss_pred hcCCceeEEeeccCCCCCccccCC--------CCCCCCchhhHHHHHHHHhhcCCCceeEEEeehhhhhcceeeecCCCC
Q 001316 170 MEGVNGTVFAYGVTSSGKTHTMHG--------DQNSPGIIPLAIKDVFSIIQDTPGREFLLRVSYLEIYNEVINDLLDPT 241 (1102)
Q Consensus 170 l~G~N~tIfaYGqTgSGKT~Tm~G--------~~~~~GIipr~~~~LF~~i~~~~~~~~~v~vS~lEIYnE~i~DLL~~~ 241 (1102)
+.|||||||||||||+||||||.| .+..+|||||++.+||+.+.... .+|.|+|||||+|||.|+|||+|.
T Consensus 125 l~GyNCTIFAYGQTGTGKTyTMeG~~~~~~g~l~~~aGIIPRal~~IFd~Le~~~-~EYsvKVSfLELYNEEl~DLLa~~ 203 (1041)
T KOG0243|consen 125 LEGYNCTIFAYGQTGTGKTYTMEGGERKKNGELPSEAGIIPRALRQIFDTLEAQG-AEYSVKVSFLELYNEELTDLLASE 203 (1041)
T ss_pred hccCCceEEEecCCCCCceeeeecCcccccCCCCccCCcchHHHHHHHHHHHhcC-CeEEEEEEehhhhhHHHHHhcCCc
Confidence 999999999999999999999999 56788999999999999998654 899999999999999999999886
Q ss_pred C---CcceEEeCC------CCcEeeCceEEEeCChHHHHHHHHHHhhhcccCCCccccCCCCceeEEEEEEEEecCCCC-
Q 001316 242 G---QNLRVREDA------QGTYVEGIKEEVVLSPGHALSFIAAGEEHRHVGSNNFNLLSSRSHTIFTLMIESSDHGDE- 311 (1102)
Q Consensus 242 ~---~~l~ire~~------~g~~v~gl~e~~V~s~~e~~~ll~~g~~~R~~~~t~~N~~SSRSH~If~i~v~~~~~~~~- 311 (1102)
. ..+.+.+++ +|++|.||.+++|.++.|++.+|.+|...|++++|.||.+|||||+||+|+|........
T Consensus 204 ~~~~~~~~~k~~~~~~~~kggV~vkGlEEi~V~~A~ei~klLekGs~kRrtAaTl~N~~SSRSHsIFsItvhike~t~~g 283 (1041)
T KOG0243|consen 204 DTSDKKLRIKDDSTIVDGKGGVIVKGLEEIIVTNADEIYKLLEKGSKKRRTAATLMNDQSSRSHSIFSITVHIKENTPEG 283 (1041)
T ss_pred cccccccccccCCcccCCcCcEEEecceeeeecchhHHHHHHHhhhhHhHHHHHHhhhhccccceEEEEEEEEecCCCcc
Confidence 4 345555555 579999999999999999999999999999999999999999999999999987654433
Q ss_pred CCcEEEEEEEEeecCCCCC-cccccchhhhhhhHHHhhhHHHHHHHHHHhhcCCCCCccCCCCcchhhhhccCCCCccce
Q 001316 312 YDGVIFSQLNLIDLAGSES-SKTETTGLRRKEGSYINKSLLTLGTVIGKLSEGKASHVPYRDSKLTRLLQSSLSGHGHVS 390 (1102)
Q Consensus 312 ~~~~~~skL~lVDLAGSEr-~kt~~~g~r~kE~~~INkSL~aLg~vI~aL~~~k~~hvPYRdSkLTrLLqdsLgGnskt~ 390 (1102)
.+.++.|||+||||||||. ..+|+.+.|.+|++.||+||+|||+||+||.++. .|||||+|||||||||||||.+||+
T Consensus 284 eelvK~GKLNLVDLAGSENI~RSGA~~~RArEAG~INqSLLTLGRVInALVe~s-~HIPYRESKLTRLLQDSLGGkTKT~ 362 (1041)
T KOG0243|consen 284 EELVKIGKLNLVDLAGSENISRSGARNGRAREAGEINQSLLTLGRVINALVEHS-GHIPYRESKLTRLLQDSLGGKTKTC 362 (1041)
T ss_pred hhhHhhcccceeeccccccccccccccchhHHhhhhhHHHHHHHHHHHHHHccC-CCCCchHHHHHHHHHHHhCCCceeE
Confidence 3557889999999999998 7789999999999999999999999999999964 5999999999999999999999999
Q ss_pred EEEeeCCCCCCHHHHHHHHHHHHHhcccccccccccccCHHHHHHHHHHHHHHHHHHHHHHHcccccCCCHHHHHHHHHH
Q 001316 391 LICTVTPASSSMEETHNTLKFASRAKRVEIYASRNKIIDEKSLIKKYQREISSLKEELDQLKRGILVGVSHEELMTLRQK 470 (1102)
Q Consensus 391 ~I~~isP~~~~~~ETlsTLrfA~rak~I~~~~~~n~~~~~~~~i~~~~~ei~~Lk~el~~~~~~~~~~~~~~e~~~l~~~ 470 (1102)
|||||||+..+++||++||.||.|||+|+|+|.+|..+..+.+++.|-.||.+||.+|...+....+...++.+......
T Consensus 363 iIATiSPa~~~lEETlSTLEYA~RAKnIkNKPevNQkl~K~~llKd~~~EIerLK~dl~AaReKnGvyisee~y~~~e~e 442 (1041)
T KOG0243|consen 363 IIATISPAKHNLEETLSTLEYAHRAKNIKNKPEVNQKLMKKTLLKDLYEEIERLKRDLAAAREKNGVYISEERYTQEEKE 442 (1041)
T ss_pred EEEEeCCCcccHHHHHHHHHHHHHhhhccCCCccchHHHHHHHHHHHHHHHHHHHHHHHHhHhhCceEechHHHHHHHHH
Confidence 99999999999999999999999999999999999988899999999999999999999887766555666555322111
Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q 001316 471 LEEGQVKMQSRLEEEEEAKAALMSRIQRLTKL 502 (1102)
Q Consensus 471 l~~~~~~~~~~l~~~~~~~~~l~~~~~~l~~l 502 (1102)
...+..++++.+....++..++..++.+
T Consensus 443 ----~~~~~~~ieele~el~~~~~~l~~~~e~ 470 (1041)
T KOG0243|consen 443 ----KKEMAEQIEELEEELENLEKQLKDLTEL 470 (1041)
T ss_pred ----HHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence 1223334444445555555555555443
|
|
| >KOG0245 consensus Kinesin-like protein [Cytoskeleton] | Back alignment and domain information |
|---|
| >PLN03188 kinesin-12 family protein; Provisional | Back alignment and domain information |
|---|
| >KOG4280 consensus Kinesin-like protein [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG0242 consensus Kinesin-like protein [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG0240 consensus Kinesin (SMY1 subfamily) [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG0241 consensus Kinesin-like protein [Cytoskeleton] | Back alignment and domain information |
|---|
| >cd01373 KISc_KLP2_like Kinesin motor domain, KLP2-like subgroup | Back alignment and domain information |
|---|
| >cd01370 KISc_KIP3_like Kinesin motor domain, KIP3-like subgroup | Back alignment and domain information |
|---|
| >cd01368 KISc_KIF23_like Kinesin motor domain, KIF23-like subgroup | Back alignment and domain information |
|---|
| >cd01365 KISc_KIF1A_KIF1B Kinesin motor domain, KIF1_like proteins | Back alignment and domain information |
|---|
| >cd01374 KISc_CENP_E Kinesin motor domain, CENP-E/KIP2-like subgroup, involved in chromosome movement and/or spindle elongation during mitosis | Back alignment and domain information |
|---|
| >cd01371 KISc_KIF3 Kinesin motor domain, kinesins II or KIF3_like proteins | Back alignment and domain information |
|---|
| >cd01367 KISc_KIF2_like Kinesin motor domain, KIF2-like group | Back alignment and domain information |
|---|
| >cd01364 KISc_BimC_Eg5 Kinesin motor domain, BimC/Eg5 spindle pole proteins, participate in spindle assembly and chromosome segregation during cell division | Back alignment and domain information |
|---|
| >cd01369 KISc_KHC_KIF5 Kinesin motor domain, kinesin heavy chain (KHC) or KIF5-like subgroup | Back alignment and domain information |
|---|
| >cd01376 KISc_KID_like Kinesin motor domain, KIF22/Kid-like subgroup | Back alignment and domain information |
|---|
| >cd01375 KISc_KIF9_like Kinesin motor domain, KIF9-like subgroup; might play a role in cell shape remodeling | Back alignment and domain information |
|---|
| >cd01372 KISc_KIF4 Kinesin motor domain, KIF4-like subfamily | Back alignment and domain information |
|---|
| >cd01366 KISc_C_terminal Kinesin motor domain, KIFC2/KIFC3/ncd-like carboxy-terminal kinesins | Back alignment and domain information |
|---|
| >KOG0239 consensus Kinesin (KAR3 subfamily) [Cytoskeleton] | Back alignment and domain information |
|---|
| >smart00129 KISc Kinesin motor, catalytic domain | Back alignment and domain information |
|---|
| >cd00106 KISc Kinesin motor domain | Back alignment and domain information |
|---|
| >PF00225 Kinesin: Kinesin motor domain; InterPro: IPR001752 Kinesin [, , ] is a microtubule-associated force-producing protein that may play a role in organelle transport | Back alignment and domain information |
|---|
| >KOG0244 consensus Kinesin-like protein [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG0246 consensus Kinesin-like protein [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG0247 consensus Kinesin-like protein [Cytoskeleton] | Back alignment and domain information |
|---|
| >COG5059 KIP1 Kinesin-like protein [Cytoskeleton] | Back alignment and domain information |
|---|
| >cd01363 Motor_domain Myosin and Kinesin motor domain | Back alignment and domain information |
|---|
| >KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0612 consensus Rho-associated, coiled-coil containing protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG4265 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4172 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4275 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1571 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A | Back alignment and domain information |
|---|
| >KOG1100 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT) | Back alignment and domain information |
|---|
| >KOG0823 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR02169 SMC_prok_A chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >TIGR02169 SMC_prok_A chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional | Back alignment and domain information |
|---|
| >TIGR02168 SMC_prok_B chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >TIGR02168 SMC_prok_B chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >KOG0996 consensus Structural maintenance of chromosome protein 4 (chromosome condensation complex Condensin, subunit C) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG4673 consensus Transcription factor TMF, TATA element modulatory factor [Transcription] | Back alignment and domain information |
|---|
| >KOG0320 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0317 consensus Predicted E3 ubiquitin ligase, integral peroxisomal membrane protein [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT) | Back alignment and domain information |
|---|
| >PF10174 Cast: RIM-binding protein of the cytomatrix active zone; InterPro: IPR019323 This entry represents a family of proteins that form part of the CAZ (cytomatrix at the active zone) complex which is involved in determining the site of synaptic vesicle fusion [] | Back alignment and domain information |
|---|
| >KOG0161 consensus Myosin class II heavy chain [Cytoskeleton] | Back alignment and domain information |
|---|
| >COG5059 KIP1 Kinesin-like protein [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG0963 consensus Transcription factor/CCAAT displacement protein CDP1 [Transcription] | Back alignment and domain information |
|---|
| >KOG0971 consensus Microtubule-associated protein dynactin DCTN1/Glued [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton] | Back alignment and domain information |
|---|
| >PHA02929 N1R/p28-like protein; Provisional | Back alignment and domain information |
|---|
| >PRK03918 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >COG1196 Smc Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG2164 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF14634 zf-RING_5: zinc-RING finger domain | Back alignment and domain information |
|---|
| >PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A | Back alignment and domain information |
|---|
| >TIGR00606 rad50 rad50 | Back alignment and domain information |
|---|
| >PRK02224 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >KOG0161 consensus Myosin class II heavy chain [Cytoskeleton] | Back alignment and domain information |
|---|
| >COG1196 Smc Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PF15070 GOLGA2L5: Putative golgin subfamily A member 2-like protein 5 | Back alignment and domain information |
|---|
| >PF09730 BicD: Microtubule-associated protein Bicaudal-D; InterPro: IPR018477 BicD proteins consist of three coiled-coiled domains and are involved in dynein-mediated minus end-directed transport from the Golgi apparatus to the endoplasmic reticulum (ER) [] | Back alignment and domain information |
|---|
| >KOG0971 consensus Microtubule-associated protein dynactin DCTN1/Glued [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton] | Back alignment and domain information |
|---|
| >COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] | Back alignment and domain information |
|---|
| >PRK11637 AmiB activator; Provisional | Back alignment and domain information |
|---|
| >PF08826 DMPK_coil: DMPK coiled coil domain like; InterPro: IPR014930 This domain is found in the myotonic dystrophy protein kinase (DMPK) and adopts a coiled coil structure | Back alignment and domain information |
|---|
| >KOG4674 consensus Uncharacterized conserved coiled-coil protein [Function unknown] | Back alignment and domain information |
|---|
| >TIGR00606 rad50 rad50 | Back alignment and domain information |
|---|
| >KOG0933 consensus Structural maintenance of chromosome protein 2 (chromosome condensation complex Condensin, subunit E) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PF12128 DUF3584: Protein of unknown function (DUF3584); InterPro: IPR021979 This family consist of uncharacterised bacterial proteins | Back alignment and domain information |
|---|
| >KOG0995 consensus Centromere-associated protein HEC1 [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PHA02562 46 endonuclease subunit; Provisional | Back alignment and domain information |
|---|
| >PRK02224 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >PRK04863 mukB cell division protein MukB; Provisional | Back alignment and domain information |
|---|
| >COG5574 PEX10 RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A | Back alignment and domain information |
|---|
| >KOG0976 consensus Rho/Rac1-interacting serine/threonine kinase Citron [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes | Back alignment and domain information |
|---|
| >TIGR00599 rad18 DNA repair protein rad18 | Back alignment and domain information |
|---|
| >KOG0994 consensus Extracellular matrix glycoprotein Laminin subunit beta [Extracellular structures] | Back alignment and domain information |
|---|
| >PHA02926 zinc finger-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG0933 consensus Structural maintenance of chromosome protein 2 (chromosome condensation complex Condensin, subunit E) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG4674 consensus Uncharacterized conserved coiled-coil protein [Function unknown] | Back alignment and domain information |
|---|
| >COG5185 HEC1 Protein involved in chromosome segregation, interacts with SMC proteins [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PF14662 CCDC155: Coiled-coil region of CCDC155 | Back alignment and domain information |
|---|
| >KOG1785 consensus Tyrosine kinase negative regulator CBL [Defense mechanisms] | Back alignment and domain information |
|---|
| >KOG0977 consensus Nuclear envelope protein lamin, intermediate filament superfamily [Cell cycle control, cell division, chromosome partitioning; Nuclear structure] | Back alignment and domain information |
|---|
| >smart00184 RING Ring finger | Back alignment and domain information |
|---|
| >cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) | Back alignment and domain information |
|---|
| >PF12128 DUF3584: Protein of unknown function (DUF3584); InterPro: IPR021979 This family consist of uncharacterised bacterial proteins | Back alignment and domain information |
|---|
| >KOG4643 consensus Uncharacterized coiled-coil protein [Function unknown] | Back alignment and domain information |
|---|
| >COG5432 RAD18 RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0996 consensus Structural maintenance of chromosome protein 4 (chromosome condensation complex Condensin, subunit C) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0287 consensus Postreplication repair protein RAD18 [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >COG4372 Uncharacterized protein conserved in bacteria with the myosin-like domain [Function unknown] | Back alignment and domain information |
|---|
| >PRK11637 AmiB activator; Provisional | Back alignment and domain information |
|---|
| >PF15070 GOLGA2L5: Putative golgin subfamily A member 2-like protein 5 | Back alignment and domain information |
|---|
| >PF15227 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A | Back alignment and domain information |
|---|
| >PF14447 Prok-RING_4: Prokaryotic RING finger family 4 | Back alignment and domain information |
|---|
| >PF00261 Tropomyosin: Tropomyosin; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells | Back alignment and domain information |
|---|
| >PRK03918 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >PRK04863 mukB cell division protein MukB; Provisional | Back alignment and domain information |
|---|
| >KOG0612 consensus Rho-associated, coiled-coil containing protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF05701 WEMBL: Weak chloroplast movement under blue light; InterPro: IPR008545 This family consists of several plant proteins of unknown function | Back alignment and domain information |
|---|
| >COG4942 Membrane-bound metallopeptidase [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >smart00504 Ubox Modified RING finger domain | Back alignment and domain information |
|---|
| >PF05701 WEMBL: Weak chloroplast movement under blue light; InterPro: IPR008545 This family consists of several plant proteins of unknown function | Back alignment and domain information |
|---|
| >PF04849 HAP1_N: HAP1 N-terminal conserved region; InterPro: IPR006933 This family is defined by an N-terminal conserved region found in several huntingtin-associated protein 1 (HAP1) homologues | Back alignment and domain information |
|---|
| >KOG0250 consensus DNA repair protein RAD18 (SMC family protein) [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG0977 consensus Nuclear envelope protein lamin, intermediate filament superfamily [Cell cycle control, cell division, chromosome partitioning; Nuclear structure] | Back alignment and domain information |
|---|
| >KOG0980 consensus Actin-binding protein SLA2/Huntingtin-interacting protein Hip1 [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG4692 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0976 consensus Rho/Rac1-interacting serine/threonine kinase Citron [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF09755 DUF2046: Uncharacterized conserved protein H4 (DUF2046); InterPro: IPR019152 This is the conserved N-terminal 350 residues of a family of proteins of unknown function possibly containing a coiled-coil domain | Back alignment and domain information |
|---|
| >PF00038 Filament: Intermediate filament protein; InterPro: IPR016044 Intermediate filaments (IF) [, , ] are proteins which are primordial components of the cytoskeleton and the nuclear envelope | Back alignment and domain information |
|---|
| >PF10174 Cast: RIM-binding protein of the cytomatrix active zone; InterPro: IPR019323 This entry represents a family of proteins that form part of the CAZ (cytomatrix at the active zone) complex which is involved in determining the site of synaptic vesicle fusion [] | Back alignment and domain information |
|---|
| >PHA02562 46 endonuclease subunit; Provisional | Back alignment and domain information |
|---|
| >KOG4643 consensus Uncharacterized coiled-coil protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0946 consensus ER-Golgi vesicle-tethering protein p115 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PF13445 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A | Back alignment and domain information |
|---|
| >PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes | Back alignment and domain information |
|---|
| >COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] | Back alignment and domain information |
|---|
| >PF00261 Tropomyosin: Tropomyosin; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells | Back alignment and domain information |
|---|
| >KOG0994 consensus Extracellular matrix glycoprotein Laminin subunit beta [Extracellular structures] | Back alignment and domain information |
|---|
| >PF08647 BRE1: BRE1 E3 ubiquitin ligase; InterPro: IPR013956 BRE1 is an E3 ubiquitin ligase that has been shown to act as a transcriptional activator through direct activator interactions [] | Back alignment and domain information |
|---|
| >KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF09730 BicD: Microtubule-associated protein Bicaudal-D; InterPro: IPR018477 BicD proteins consist of three coiled-coiled domains and are involved in dynein-mediated minus end-directed transport from the Golgi apparatus to the endoplasmic reticulum (ER) [] | Back alignment and domain information |
|---|
| >PF14835 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM7_B | Back alignment and domain information |
|---|
| >KOG0963 consensus Transcription factor/CCAAT displacement protein CDP1 [Transcription] | Back alignment and domain information |
|---|
| >KOG1029 consensus Endocytic adaptor protein intersectin [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG0964 consensus Structural maintenance of chromosome protein 3 (sister chromatid cohesion complex Cohesin, subunit SMC3) [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >TIGR03007 pepcterm_ChnLen polysaccharide chain length determinant protein, PEP-CTERM locus subfamily | Back alignment and domain information |
|---|
| >COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2177 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF05557 MAD: Mitotic checkpoint protein; InterPro: IPR008672 This family consists of several eukaryotic mitotic checkpoint (Mitotic arrest deficient or MAD) proteins | Back alignment and domain information |
|---|
| >KOG1813 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG5540 RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK04778 septation ring formation regulator EzrA; Provisional | Back alignment and domain information |
|---|
| >KOG1029 consensus Endocytic adaptor protein intersectin [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PRK09039 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >KOG0999 consensus Microtubule-associated protein Bicaudal-D [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG0964 consensus Structural maintenance of chromosome protein 3 (sister chromatid cohesion complex Cohesin, subunit SMC3) [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0250 consensus DNA repair protein RAD18 (SMC family protein) [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG4593 consensus Mitotic checkpoint protein MAD1 [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0980 consensus Actin-binding protein SLA2/Huntingtin-interacting protein Hip1 [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF05622 HOOK: HOOK protein; InterPro: IPR008636 This family consists of several HOOK1, 2 and 3 proteins from different eukaryotic organisms | Back alignment and domain information |
|---|
| >PF14915 CCDC144C: CCDC144C protein coiled-coil region | Back alignment and domain information |
|---|
| >PF06818 Fez1: Fez1; InterPro: IPR009638 This family represents the eukaryotic Fez1 protein | Back alignment and domain information |
|---|
| >KOG0239 consensus Kinesin (KAR3 subfamily) [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF15066 CAGE1: Cancer-associated gene protein 1 family | Back alignment and domain information |
|---|
| >KOG4360 consensus Uncharacterized coiled coil protein [Function unknown] | Back alignment and domain information |
|---|
| >PRK11281 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF05667 DUF812: Protein of unknown function (DUF812); InterPro: IPR008530 This family consists of several eukaryotic proteins of unknown function | Back alignment and domain information |
|---|
| >PF00038 Filament: Intermediate filament protein; InterPro: IPR016044 Intermediate filaments (IF) [, , ] are proteins which are primordial components of the cytoskeleton and the nuclear envelope | Back alignment and domain information |
|---|
| >PRK09039 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >KOG0249 consensus LAR-interacting protein and related proteins [General function prediction only] | Back alignment and domain information |
|---|
| >PF07926 TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: IPR012929 This domain is found in a number of proteins, including TPR protein (P12270 from SWISSPROT) and yeast myosin-like proteins 1 (MLP1, Q02455 from SWISSPROT) and 2 (MLP2, P40457 from SWISSPROT) | Back alignment and domain information |
|---|
| >PF04849 HAP1_N: HAP1 N-terminal conserved region; InterPro: IPR006933 This family is defined by an N-terminal conserved region found in several huntingtin-associated protein 1 (HAP1) homologues | Back alignment and domain information |
|---|
| >PRK10929 putative mechanosensitive channel protein; Provisional | Back alignment and domain information |
|---|
| >COG4942 Membrane-bound metallopeptidase [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PF12678 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >COG5243 HRD1 HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK11281 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG0018 consensus Structural maintenance of chromosome protein 1 (sister chromatid cohesion complex Cohesin, subunit SMC1) [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PF09787 Golgin_A5: Golgin subfamily A member 5; InterPro: IPR019177 This entry represents a family of proteins involved in maintaining Golgi structure | Back alignment and domain information |
|---|
| >PF15619 Lebercilin: Ciliary protein causing Leber congenital amaurosis disease | Back alignment and domain information |
|---|
| >PF12718 Tropomyosin_1: Tropomyosin like; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells | Back alignment and domain information |
|---|
| >PF09789 DUF2353: Uncharacterized coiled-coil protein (DUF2353); InterPro: IPR019179 Members of this family have been annotated as being coiled-coil domain-containing protein 149, however they currently have no known function | Back alignment and domain information |
|---|
| >PF05622 HOOK: HOOK protein; InterPro: IPR008636 This family consists of several HOOK1, 2 and 3 proteins from different eukaryotic organisms | Back alignment and domain information |
|---|
| >KOG4360 consensus Uncharacterized coiled coil protein [Function unknown] | Back alignment and domain information |
|---|
| >PF07058 Myosin_HC-like: Myosin II heavy chain-like; InterPro: IPR009768 This family represents a conserved region within a number of myosin II heavy chain-like proteins that seem to be specific to Arabidopsis thaliana | Back alignment and domain information |
|---|
| >KOG4687 consensus Uncharacterized coiled-coil protein [Function unknown] | Back alignment and domain information |
|---|
| >COG1340 Uncharacterized archaeal coiled-coil protein [Function unknown] | Back alignment and domain information |
|---|
| >COG4372 Uncharacterized protein conserved in bacteria with the myosin-like domain [Function unknown] | Back alignment and domain information |
|---|
| >PF06818 Fez1: Fez1; InterPro: IPR009638 This family represents the eukaryotic Fez1 protein | Back alignment and domain information |
|---|
| >KOG1853 consensus LIS1-interacting protein NUDE [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG4673 consensus Transcription factor TMF, TATA element modulatory factor [Transcription] | Back alignment and domain information |
|---|
| >COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] | Back alignment and domain information |
|---|
| >PF05667 DUF812: Protein of unknown function (DUF812); InterPro: IPR008530 This family consists of several eukaryotic proteins of unknown function | Back alignment and domain information |
|---|
| >KOG0802 consensus E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG2113 consensus Predicted RNA binding protein, contains KH domain [General function prediction only] | Back alignment and domain information |
|---|
| >PF05483 SCP-1: Synaptonemal complex protein 1 (SCP-1); InterPro: IPR008827 Synaptonemal complex protein 1 (SCP-1) is the major component of the transverse filaments of the synaptonemal complex | Back alignment and domain information |
|---|
| >PF07926 TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: IPR012929 This domain is found in a number of proteins, including TPR protein (P12270 from SWISSPROT) and yeast myosin-like proteins 1 (MLP1, Q02455 from SWISSPROT) and 2 (MLP2, P40457 from SWISSPROT) | Back alignment and domain information |
|---|
| >PF06785 UPF0242: Uncharacterised protein family (UPF0242); InterPro: IPR009623 This is a group of proteins of unknown function | Back alignment and domain information |
|---|
| >KOG4159 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG2879 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR01843 type_I_hlyD type I secretion membrane fusion protein, HlyD family | Back alignment and domain information |
|---|
| >PF04564 U-box: U-box domain; InterPro: IPR003613 Quality control of intracellular proteins is essential for cellular homeostasis | Back alignment and domain information |
|---|
| >PRK10929 putative mechanosensitive channel protein; Provisional | Back alignment and domain information |
|---|
| >KOG0946 consensus ER-Golgi vesicle-tethering protein p115 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG0982 consensus Centrosomal protein Nuf [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton] | Back alignment and domain information |
|---|
| >TIGR00634 recN DNA repair protein RecN | Back alignment and domain information |
|---|
| >PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication | Back alignment and domain information |
|---|
| >PF15619 Lebercilin: Ciliary protein causing Leber congenital amaurosis disease | Back alignment and domain information |
|---|
| >COG3096 MukB Uncharacterized protein involved in chromosome partitioning [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PF08614 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR013923 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells | Back alignment and domain information |
|---|
| >COG5185 HEC1 Protein involved in chromosome segregation, interacts with SMC proteins [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0311 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK01156 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >PF04641 Rtf2: Rtf2 RING-finger | Back alignment and domain information |
|---|
| >TIGR03017 EpsF chain length determinant protein EpsF | Back alignment and domain information |
|---|
| >PF12325 TMF_TATA_bd: TATA element modulatory factor 1 TATA binding; InterPro: IPR022091 This is the C-terminal conserved coiled coil region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes [] | Back alignment and domain information |
|---|
| >KOG0962 consensus DNA repair protein RAD50, ABC-type ATPase/SMC superfamily [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PF01576 Myosin_tail_1: Myosin tail; InterPro: IPR002928 Muscle contraction is caused by sliding between the thick and thin filaments of the myofibril | Back alignment and domain information |
|---|
| >COG0556 UvrB Helicase subunit of the DNA excision repair complex [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >KOG4628 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK06893 DNA replication initiation factor; Validated | Back alignment and domain information |
|---|
| >KOG2129 consensus Uncharacterized conserved protein H4 [Function unknown] | Back alignment and domain information |
|---|
| >PF06785 UPF0242: Uncharacterised protein family (UPF0242); InterPro: IPR009623 This is a group of proteins of unknown function | Back alignment and domain information |
|---|
| >KOG0249 consensus LAR-interacting protein and related proteins [General function prediction only] | Back alignment and domain information |
|---|
| >PRK14086 dnaA chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >PRK06620 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PF01576 Myosin_tail_1: Myosin tail; InterPro: IPR002928 Muscle contraction is caused by sliding between the thick and thin filaments of the myofibril | Back alignment and domain information |
|---|
| >KOG0828 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0999 consensus Microtubule-associated protein Bicaudal-D [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG1003 consensus Actin filament-coating protein tropomyosin [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF14662 CCDC155: Coiled-coil region of CCDC155 | Back alignment and domain information |
|---|
| >PF14988 DUF4515: Domain of unknown function (DUF4515) | Back alignment and domain information |
|---|
| >COG2804 PulE Type II secretory pathway, ATPase PulE/Tfp pilus assembly pathway, ATPase PilB [Cell motility and secretion / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >TIGR01005 eps_transp_fam exopolysaccharide transport protein family | Back alignment and domain information |
|---|
| >KOG0825 consensus PHD Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1001 consensus Helicase-like transcription factor HLTF/DNA helicase RAD5, DEAD-box superfamily [Transcription; Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG0018 consensus Structural maintenance of chromosome protein 1 (sister chromatid cohesion complex Cohesin, subunit SMC1) [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0979 consensus Structural maintenance of chromosome protein SMC5/Spr18, SMC superfamily [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PF13851 GAS: Growth-arrest specific micro-tubule binding | Back alignment and domain information |
|---|
| >PF09789 DUF2353: Uncharacterized coiled-coil protein (DUF2353); InterPro: IPR019179 Members of this family have been annotated as being coiled-coil domain-containing protein 149, however they currently have no known function | Back alignment and domain information |
|---|
| >COG3883 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs | Back alignment and domain information |
|---|
| >PF05483 SCP-1: Synaptonemal complex protein 1 (SCP-1); InterPro: IPR008827 Synaptonemal complex protein 1 (SCP-1) is the major component of the transverse filaments of the synaptonemal complex | Back alignment and domain information |
|---|
| >PF10212 TTKRSYEDQ: Predicted coiled-coil domain-containing protein; InterPro: IPR019348 This entry represents a C-terminal 500 residue region, which contains a conserved TTKRSYEDQ motif | Back alignment and domain information |
|---|
| >PF15066 CAGE1: Cancer-associated gene protein 1 family | Back alignment and domain information |
|---|
| >PF12718 Tropomyosin_1: Tropomyosin like; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells | Back alignment and domain information |
|---|
| >COG3883 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >TIGR03007 pepcterm_ChnLen polysaccharide chain length determinant protein, PEP-CTERM locus subfamily | Back alignment and domain information |
|---|
| >TIGR01005 eps_transp_fam exopolysaccharide transport protein family | Back alignment and domain information |
|---|
| >PF03148 Tektin: Tektin family; InterPro: IPR000435 Tektin heteropolymers form unique protofilaments of flagellar microtubules [] | Back alignment and domain information |
|---|
| >PF08172 CASP_C: CASP C terminal; InterPro: IPR012955 This domain is the C-terminal region of the CASP family of proteins | Back alignment and domain information |
|---|
| >KOG1039 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF06160 EzrA: Septation ring formation regulator, EzrA ; InterPro: IPR010379 During the bacterial cell cycle, the tubulin-like cell-division protein FtsZ polymerises into a ring structure that establishes the location of the nascent division site | Back alignment and domain information |
|---|
| >TIGR03185 DNA_S_dndD DNA sulfur modification protein DndD | Back alignment and domain information |
|---|
| >PF08317 Spc7: Spc7 kinetochore protein; InterPro: IPR013253 This entry consists of cell division proteins which are required for kinetochore-spindle association [] | Back alignment and domain information |
|---|
| >PF07111 HCR: Alpha helical coiled-coil rod protein (HCR); InterPro: IPR009800 This family consists of several mammalian alpha helical coiled-coil rod HCR proteins | Back alignment and domain information |
|---|
| >PRK10884 SH3 domain-containing protein; Provisional | Back alignment and domain information |
|---|
| >PRK10884 SH3 domain-containing protein; Provisional | Back alignment and domain information |
|---|
| >COG2805 PilT Tfp pilus assembly protein, pilus retraction ATPase PilT [Cell motility and secretion / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >KOG4807 consensus F-actin binding protein, regulates actin cytoskeletal organization [Cytoskeleton] | Back alignment and domain information |
|---|
| >TIGR01000 bacteriocin_acc bacteriocin secretion accessory protein | Back alignment and domain information |
|---|
| >PF12861 zf-Apc11: Anaphase-promoting complex subunit 11 RING-H2 finger | Back alignment and domain information |
|---|
| >KOG1853 consensus LIS1-interacting protein NUDE [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF13514 AAA_27: AAA domain | Back alignment and domain information |
|---|
| >PRK10869 recombination and repair protein; Provisional | Back alignment and domain information |
|---|
| >KOG1814 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4302 consensus Microtubule-associated protein essential for anaphase spindle elongation [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton] | Back alignment and domain information |
|---|
| >PRK06835 DNA replication protein DnaC; Validated | Back alignment and domain information |
|---|
| >KOG3002 consensus Zn finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF09728 Taxilin: Myosin-like coiled-coil protein; InterPro: IPR019132 Taxilin contains an extraordinarily long coiled-coil domain in its C-terminal half and is ubiquitously expressed | Back alignment and domain information |
|---|
| >KOG0995 consensus Centromere-associated protein HEC1 [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PRK12377 putative replication protein; Provisional | Back alignment and domain information |
|---|
| >KOG0243 consensus Kinesin-like protein [Cytoskeleton] | Back alignment and domain information |
|---|
| >TIGR00634 recN DNA repair protein RecN | Back alignment and domain information |
|---|
| >PRK08116 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK05642 DNA replication initiation factor; Validated | Back alignment and domain information |
|---|
| >PRK04778 septation ring formation regulator EzrA; Provisional | Back alignment and domain information |
|---|
| >PF10481 CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR018463 Mitosin or centromere-associated protein-F (Cenp-F) is found bound across the centromere as one of the proteins of the outer layer of the kinetochore [] | Back alignment and domain information |
|---|
| >KOG3039 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PRK08084 DNA replication initiation factor; Provisional | Back alignment and domain information |
|---|
| >COG0497 RecN ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >TIGR02680 conserved hypothetical protein TIGR02680 | Back alignment and domain information |
|---|
| >PRK06526 transposase; Provisional | Back alignment and domain information |
|---|
| >PLN02939 transferase, transferring glycosyl groups | Back alignment and domain information |
|---|
| >PRK14088 dnaA chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >PF10473 CENP-F_leu_zip: Leucine-rich repeats of kinetochore protein Cenp-F/LEK1; InterPro: IPR019513 Cenp-F, a centromeric kinetochore, microtubule-binding protein consisting of two 1,600-amino acid-long coils, is essential for the full functioning of the mitotic checkpoint pathway [, ] | Back alignment and domain information |
|---|
| >PF05911 DUF869: Plant protein of unknown function (DUF869); InterPro: IPR008587 This family consists of a number of sequences found in plants | Back alignment and domain information |
|---|
| >PF05557 MAD: Mitotic checkpoint protein; InterPro: IPR008672 This family consists of several eukaryotic mitotic checkpoint (Mitotic arrest deficient or MAD) proteins | Back alignment and domain information |
|---|
| >PF12325 TMF_TATA_bd: TATA element modulatory factor 1 TATA binding; InterPro: IPR022091 This is the C-terminal conserved coiled coil region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes [] | Back alignment and domain information |
|---|
| >PRK14087 dnaA chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >TIGR01843 type_I_hlyD type I secretion membrane fusion protein, HlyD family | Back alignment and domain information |
|---|
| >PRK09087 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >KOG4807 consensus F-actin binding protein, regulates actin cytoskeletal organization [Cytoskeleton] | Back alignment and domain information |
|---|
| >TIGR00362 DnaA chromosomal replication initiator protein DnaA | Back alignment and domain information |
|---|
| >PF00769 ERM: Ezrin/radixin/moesin family; InterPro: IPR011259 The ERM family consists of three closely-related proteins, ezrin, radixin and moesin [] | Back alignment and domain information |
|---|
| >PRK00149 dnaA chromosomal replication initiation protein; Reviewed | Back alignment and domain information |
|---|
| >PF15035 Rootletin: Ciliary rootlet component, centrosome cohesion | Back alignment and domain information |
|---|
| >PF15254 CCDC14: Coiled-coil domain-containing protein 14 | Back alignment and domain information |
|---|
| >PRK07952 DNA replication protein DnaC; Validated | Back alignment and domain information |
|---|
| >PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs | Back alignment and domain information |
|---|
| >PLN03229 acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha; Provisional | Back alignment and domain information |
|---|
| >TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda | Back alignment and domain information |
|---|
| >PF06005 DUF904: Protein of unknown function (DUF904); InterPro: IPR009252 Cell division protein ZapB is a non-essential, abundant cell division factor that is required for proper Z-ring formation | Back alignment and domain information |
|---|
| >PF13514 AAA_27: AAA domain | Back alignment and domain information |
|---|
| >COG4477 EzrA Negative regulator of septation ring formation [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PF14197 Cep57_CLD_2: Centrosome localisation domain of PPC89 | Back alignment and domain information |
|---|
| >KOG4809 consensus Rab6 GTPase-interacting protein involved in endosome-to-TGN transport [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PRK08903 DnaA regulatory inactivator Hda; Validated | Back alignment and domain information |
|---|
| >KOG1002 consensus Nucleotide excision repair protein RAD16 [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG2113 consensus Predicted RNA binding protein, contains KH domain [General function prediction only] | Back alignment and domain information |
|---|
| >COG1340 Uncharacterized archaeal coiled-coil protein [Function unknown] | Back alignment and domain information |
|---|
| >COG0497 RecN ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PF13870 DUF4201: Domain of unknown function (DUF4201) | Back alignment and domain information |
|---|
| >PF08614 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR013923 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells | Back alignment and domain information |
|---|
| >TIGR02928 orc1/cdc6 family replication initiation protein | Back alignment and domain information |
|---|
| >COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF10481 CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR018463 Mitosin or centromere-associated protein-F (Cenp-F) is found bound across the centromere as one of the proteins of the outer layer of the kinetochore [] | Back alignment and domain information |
|---|
| >TIGR02680 conserved hypothetical protein TIGR02680 | Back alignment and domain information |
|---|
| >PF09787 Golgin_A5: Golgin subfamily A member 5; InterPro: IPR019177 This entry represents a family of proteins involved in maintaining Golgi structure | Back alignment and domain information |
|---|
| >COG2433 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF07058 Myosin_HC-like: Myosin II heavy chain-like; InterPro: IPR009768 This family represents a conserved region within a number of myosin II heavy chain-like proteins that seem to be specific to Arabidopsis thaliana | Back alignment and domain information |
|---|
| >PRK08181 transposase; Validated | Back alignment and domain information |
|---|
| >COG0593 DnaA ATPase involved in DNA replication initiation [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK15422 septal ring assembly protein ZapB; Provisional | Back alignment and domain information |
|---|
| >PRK00411 cdc6 cell division control protein 6; Reviewed | Back alignment and domain information |
|---|
| >PRK08939 primosomal protein DnaI; Reviewed | Back alignment and domain information |
|---|
| >PRK08727 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PF04851 ResIII: Type III restriction enzyme, res subunit; InterPro: IPR006935 This entry represents a domain found in the N terminus of several proteins, including helicases, the R subunit (HsdR) of type I restriction endonucleases (3 | Back alignment and domain information |
|---|
| >PF10186 Atg14: UV radiation resistance protein and autophagy-related subunit 14; InterPro: IPR018791 Class III phosphatidylinositol 3-kinase (PI3-kinase) regulates multiple membrane trafficking | Back alignment and domain information |
|---|
| >PF04012 PspA_IM30: PspA/IM30 family; InterPro: IPR007157 This family includes PspA a protein that suppresses sigma54-dependent transcription | Back alignment and domain information |
|---|
| >PF03962 Mnd1: Mnd1 family; InterPro: IPR005647 This family of proteins includes meiotic nuclear division protein 1 (MND1) from Saccharomyces cerevisiae (Baker's yeast) | Back alignment and domain information |
|---|
| >PF04111 APG6: Autophagy protein Apg6; InterPro: IPR007243 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells | Back alignment and domain information |
|---|
| >KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 1102 | ||||
| 1t5c_A | 349 | Crystal Structure Of The Motor Domain Of Human Kine | 4e-73 | ||
| 1mkj_A | 349 | Human Kinesin Motor Domain With Docked Neck Linker | 9e-64 | ||
| 4atx_C | 340 | Rigor Kinesin Motor Domain With An Ordered Neck-Lin | 9e-64 | ||
| 1bg2_A | 325 | Human Ubiquitous Kinesin Motor Domain Length = 325 | 1e-63 | ||
| 2y5w_A | 365 | Crystal Structure Of Drosophila Melanogaster Kinesi | 1e-61 | ||
| 3b6u_A | 372 | Crystal Structure Of The Motor Domain Of Human Kine | 3e-59 | ||
| 1goj_A | 355 | Structure Of A Fast Kinesin: Implications For Atpas | 8e-59 | ||
| 2vvg_A | 350 | Crystal Structure Of The G.Intestinalis Kinesin 2 G | 1e-56 | ||
| 3b6v_A | 395 | Crystal Structure Of The Motor Domain Of Human Kine | 3e-55 | ||
| 2wbe_C | 373 | Kinesin-5-Tubulin Complex With Amppnp Length = 373 | 6e-54 | ||
| 3gbj_A | 354 | Crystal Structure Of The Motor Domain Of Kinesin Ki | 4e-52 | ||
| 4a14_A | 344 | Human Kif7, A Kinesin Involved In Hedgehog Signalli | 2e-51 | ||
| 2xt3_A | 344 | Human Kif7, A Kinesin Involved In Hedgehog Signalli | 5e-50 | ||
| 4aqv_C | 373 | Model Of Human Kinesin-5 Motor Domain (3hqd) And Ma | 7e-50 | ||
| 1ia0_K | 394 | Kif1a Head-Microtubule Complex Structure In Atp-For | 3e-49 | ||
| 4a1z_A | 368 | Eg5-1 Length = 368 | 4e-49 | ||
| 3hqd_A | 369 | Human Kinesin Eg5 Motor Domain In Complex With Ampp | 4e-49 | ||
| 4a28_A | 368 | Eg5-2 Length = 368 | 5e-49 | ||
| 1ii6_A | 368 | Crystal Structure Of The Mitotic Kinesin Eg5 In Com | 5e-49 | ||
| 1q0b_A | 367 | Crystal Structure Of The Motor Protein Ksp In Compl | 5e-49 | ||
| 1x88_A | 359 | Human Eg5 Motor Domain Bound To Mg-Adp And Monastro | 5e-49 | ||
| 4ap0_A | 370 | The Mitotic Kinesin Eg5 In Complex With Mg-Adp And | 6e-49 | ||
| 3zcw_A | 348 | Eg5 - New Allosteric Binding Site Length = 348 | 1e-48 | ||
| 1i5s_A | 367 | Crystal Structure Of The Kif1a Motor Domain Complex | 2e-48 | ||
| 1i6i_A | 366 | Crystal Structure Of The Kif1a Motor Domain Complex | 4e-48 | ||
| 2owm_A | 443 | Motor Domain Of Neurospora Crassa Kinesin-3 (Nckin3 | 4e-48 | ||
| 1vfv_A | 366 | Crystal Structure Of The Kif1a Motor Domain Complex | 5e-48 | ||
| 3bfn_A | 388 | Crystal Structure Of The Motor Domain Of Human Kine | 1e-47 | ||
| 3lre_A | 355 | Crystal Structure Analysis Of Human Kinesin-8 Motor | 3e-47 | ||
| 3nwn_A | 359 | Crystal Structure Of The Human Kif9 Motor Domain In | 2e-46 | ||
| 3h4s_A | 386 | Structure Of The Complex Of A Mitotic Kinesin With | 7e-46 | ||
| 1sdm_A | 369 | Crystal Structure Of Kinesin-Like Calmodulin Bindin | 3e-45 | ||
| 3u06_A | 412 | Crystal Structure Of The Kinesin-14 Ncdg347d Length | 4e-43 | ||
| 1v8j_A | 410 | The Crystal Structure Of The Minimal Functional Dom | 1e-42 | ||
| 1cz7_A | 406 | The Crystal Structure Of A Minus-End Directed Micro | 2e-42 | ||
| 2h58_A | 330 | Crystal Structure Of The Kifc3 Motor Domain In Comp | 3e-42 | ||
| 2ncd_A | 420 | Ncd (Non-Claret Disjunctional) Dimer From D. Melano | 3e-42 | ||
| 2heh_A | 387 | Crystal Structure Of The Kif2c Motor Domain (Casp T | 3e-42 | ||
| 3edl_D | 331 | Kinesin13-Microtubule Ring Complex Length = 331 | 6e-42 | ||
| 1n6m_A | 409 | Rotation Of The StalkNECK AND ONE HEAD IN A NEW CRY | 1e-41 | ||
| 2kin_A | 238 | Kinesin (Monomeric) From Rattus Norvegicus Length = | 2e-41 | ||
| 3l1c_A | 383 | Kinesin-14 Protein Ncd, T436s Mutant Length = 383 | 3e-41 | ||
| 2gry_A | 420 | Crystal Structure Of The Human Kif2 Motor Domain In | 5e-41 | ||
| 4h1g_A | 715 | Structure Of Candida Albicans Kar3 Motor Domain Fus | 2e-38 | ||
| 4gkr_A | 371 | Structure Of The C-Terminal Motor Domain Of Kar3 Fr | 2e-36 | ||
| 3t0q_A | 349 | Motor Domain Structure Of The Kar3-Like Kinesin Fro | 2e-35 | ||
| 2rep_A | 376 | Crystal Structure Of The Motor Domain Of Human Kine | 1e-34 | ||
| 4etp_A | 403 | C-Terminal Motor And Motor Homology Domain Of Kar3v | 3e-32 | ||
| 1f9t_A | 358 | Crystal Structures Of Kinesin Mutants Reveal A Sign | 5e-32 | ||
| 3kar_A | 346 | The Motor Domain Of Kinesin-Like Protein Kar3, A Sa | 5e-32 | ||
| 1f9w_A | 347 | Crystal Structures Of Mutants Reveal A Signalling P | 3e-31 | ||
| 1f9u_A | 347 | Crystal Structures Of Mutants Reveal A Signalling P | 4e-31 | ||
| 1f9v_A | 347 | Crystal Structures Of Mutants Reveal A Signalling P | 4e-31 | ||
| 3pxn_A | 344 | Crystal Structure Of The Drosophila Kinesin Family | 4e-31 | ||
| 3dc4_A | 344 | Crystal Structure Of The Drosophila Kinesin Family | 1e-30 | ||
| 1ry6_A | 360 | Crystal Structure Of Internal Kinesin Motor Domain | 2e-29 | ||
| 2kin_B | 100 | Kinesin (Monomeric) From Rattus Norvegicus Length = | 7e-14 | ||
| 3kin_B | 117 | Kinesin (Dimeric) From Rattus Norvegicus Length = 1 | 3e-13 | ||
| 3eb5_A | 74 | Structure Of The Ciap2 Ring Domain Length = 74 | 9e-06 | ||
| 2ecg_A | 75 | Solution Structure Of The Ring Domain Of The Baculo | 3e-05 | ||
| 4ic2_A | 74 | Crystal Structure Of The Xiap Ring Domain Length = | 3e-05 | ||
| 4ic3_A | 74 | Crystal Structure Of The F495l Mutant Xiap Ring Dom | 3e-05 | ||
| 3t6p_A | 345 | Iap Antagonist-Induced Conformational Change In Cia | 7e-05 | ||
| 4auq_B | 62 | Structure Of Birc7-Ubch5b-Ub Complex. Length = 62 | 4e-04 |
| >pdb|1T5C|A Chain A, Crystal Structure Of The Motor Domain Of Human Kinetochore Protein Cenp-E Length = 349 | Back alignment and structure |
|
| >pdb|1MKJ|A Chain A, Human Kinesin Motor Domain With Docked Neck Linker Length = 349 | Back alignment and structure |
| >pdb|4ATX|C Chain C, Rigor Kinesin Motor Domain With An Ordered Neck-Linker, Docked On Tubulin Dimer, Modelled Into The 8a Cryo-Em Map Of Doublecortin-Microtubules Decorated With Kinesin Length = 340 | Back alignment and structure |
| >pdb|1BG2|A Chain A, Human Ubiquitous Kinesin Motor Domain Length = 325 | Back alignment and structure |
| >pdb|2Y5W|A Chain A, Crystal Structure Of Drosophila Melanogaster Kinesin-1 Motor Domain Dimer Length = 365 | Back alignment and structure |
| >pdb|3B6U|A Chain A, Crystal Structure Of The Motor Domain Of Human Kinesin Family Member 3b In Complex With Adp Length = 372 | Back alignment and structure |
| >pdb|1GOJ|A Chain A, Structure Of A Fast Kinesin: Implications For Atpase Mechanism And Interactions With Microtubules Length = 355 | Back alignment and structure |
| >pdb|2VVG|A Chain A, Crystal Structure Of The G.Intestinalis Kinesin 2 Gikin2a Motor Domain Length = 350 | Back alignment and structure |
| >pdb|3B6V|A Chain A, Crystal Structure Of The Motor Domain Of Human Kinesin Family Member 3c In Complex With Adp Length = 395 | Back alignment and structure |
| >pdb|2WBE|C Chain C, Kinesin-5-Tubulin Complex With Amppnp Length = 373 | Back alignment and structure |
| >pdb|3GBJ|A Chain A, Crystal Structure Of The Motor Domain Of Kinesin Kif13b Bound With Adp Length = 354 | Back alignment and structure |
| >pdb|4A14|A Chain A, Human Kif7, A Kinesin Involved In Hedgehog Signalling Length = 344 | Back alignment and structure |
| >pdb|2XT3|A Chain A, Human Kif7, A Kinesin Involved In Hedgehog Signalling Length = 344 | Back alignment and structure |
| >pdb|4AQV|C Chain C, Model Of Human Kinesin-5 Motor Domain (3hqd) And Mammalian Tubulin Heterodimer (1jff) Docked Into The 9.7-angstrom Cryo-em Map Of Microtubule-bound Kinesin-5 Motor Domain In The Ampppnp State. Length = 373 | Back alignment and structure |
| >pdb|1IA0|K Chain K, Kif1a Head-Microtubule Complex Structure In Atp-Form Length = 394 | Back alignment and structure |
| >pdb|4A1Z|A Chain A, Eg5-1 Length = 368 | Back alignment and structure |
| >pdb|3HQD|A Chain A, Human Kinesin Eg5 Motor Domain In Complex With Amppnp And Mg2+ Length = 369 | Back alignment and structure |
| >pdb|4A28|A Chain A, Eg5-2 Length = 368 | Back alignment and structure |
| >pdb|1II6|A Chain A, Crystal Structure Of The Mitotic Kinesin Eg5 In Complex With Mg-Adp. Length = 368 | Back alignment and structure |
| >pdb|1Q0B|A Chain A, Crystal Structure Of The Motor Protein Ksp In Complex With Adp And Monastrol Length = 367 | Back alignment and structure |
| >pdb|1X88|A Chain A, Human Eg5 Motor Domain Bound To Mg-Adp And Monastrol Length = 359 | Back alignment and structure |
| >pdb|4AP0|A Chain A, The Mitotic Kinesin Eg5 In Complex With Mg-Adp And Ispinesib Length = 370 | Back alignment and structure |
| >pdb|3ZCW|A Chain A, Eg5 - New Allosteric Binding Site Length = 348 | Back alignment and structure |
| >pdb|1I5S|A Chain A, Crystal Structure Of The Kif1a Motor Domain Complexed With Mg-Adp Length = 367 | Back alignment and structure |
| >pdb|1I6I|A Chain A, Crystal Structure Of The Kif1a Motor Domain Complexed With Mg-Amppcp Length = 366 | Back alignment and structure |
| >pdb|2OWM|A Chain A, Motor Domain Of Neurospora Crassa Kinesin-3 (Nckin3) Length = 443 | Back alignment and structure |
| >pdb|1VFV|A Chain A, Crystal Structure Of The Kif1a Motor Domain Complexed With Mg-Amppnp Length = 366 | Back alignment and structure |
| >pdb|3BFN|A Chain A, Crystal Structure Of The Motor Domain Of Human Kinesin Family Member 22 Length = 388 | Back alignment and structure |
| >pdb|3LRE|A Chain A, Crystal Structure Analysis Of Human Kinesin-8 Motor Domain Length = 355 | Back alignment and structure |
| >pdb|3NWN|A Chain A, Crystal Structure Of The Human Kif9 Motor Domain In Complex With Adp Length = 359 | Back alignment and structure |
| >pdb|3H4S|A Chain A, Structure Of The Complex Of A Mitotic Kinesin With Its Calcium Binding Regulator Length = 386 | Back alignment and structure |
| >pdb|1SDM|A Chain A, Crystal Structure Of Kinesin-Like Calmodulin Binding Protein Length = 369 | Back alignment and structure |
| >pdb|3U06|A Chain A, Crystal Structure Of The Kinesin-14 Ncdg347d Length = 412 | Back alignment and structure |
| >pdb|1V8J|A Chain A, The Crystal Structure Of The Minimal Functional Domain Of The Microtubule Destabilizer Kif2c Complexed With Mg-adp Length = 410 | Back alignment and structure |
| >pdb|1CZ7|A Chain A, The Crystal Structure Of A Minus-End Directed Microtubule Motor Protein Ncd Reveals Variable Dimer Conformations Length = 406 | Back alignment and structure |
| >pdb|2H58|A Chain A, Crystal Structure Of The Kifc3 Motor Domain In Complex With Adp Length = 330 | Back alignment and structure |
| >pdb|2NCD|A Chain A, Ncd (Non-Claret Disjunctional) Dimer From D. Melanogaster Length = 420 | Back alignment and structure |
| >pdb|2HEH|A Chain A, Crystal Structure Of The Kif2c Motor Domain (Casp Target) Length = 387 | Back alignment and structure |
| >pdb|3EDL|D Chain D, Kinesin13-Microtubule Ring Complex Length = 331 | Back alignment and structure |
| >pdb|1N6M|A Chain A, Rotation Of The StalkNECK AND ONE HEAD IN A NEW CRYSTAL Structure Of The Kinesin Motor Protein, Ncd Length = 409 | Back alignment and structure |
| >pdb|2KIN|A Chain A, Kinesin (Monomeric) From Rattus Norvegicus Length = 238 | Back alignment and structure |
| >pdb|3L1C|A Chain A, Kinesin-14 Protein Ncd, T436s Mutant Length = 383 | Back alignment and structure |
| >pdb|2GRY|A Chain A, Crystal Structure Of The Human Kif2 Motor Domain In Complex With Adp Length = 420 | Back alignment and structure |
| >pdb|4H1G|A Chain A, Structure Of Candida Albicans Kar3 Motor Domain Fused To Maltose- Binding Protein Length = 715 | Back alignment and structure |
| >pdb|4GKR|A Chain A, Structure Of The C-Terminal Motor Domain Of Kar3 From Candida Glabrata Length = 371 | Back alignment and structure |
| >pdb|3T0Q|A Chain A, Motor Domain Structure Of The Kar3-Like Kinesin From Ashbya Gossypii Length = 349 | Back alignment and structure |
| >pdb|2REP|A Chain A, Crystal Structure Of The Motor Domain Of Human Kinesin Family Member C1 Length = 376 | Back alignment and structure |
| >pdb|4ETP|A Chain A, C-Terminal Motor And Motor Homology Domain Of Kar3vik1 Fused To A Synthetic Heterodimeric Coiled Coil Length = 403 | Back alignment and structure |
| >pdb|1F9T|A Chain A, Crystal Structures Of Kinesin Mutants Reveal A Signalling Pathway For Activation Of The Motor Atpase Length = 358 | Back alignment and structure |
| >pdb|3KAR|A Chain A, The Motor Domain Of Kinesin-Like Protein Kar3, A Saccharomyces Cerevisiae Kinesin-Related Protein Length = 346 | Back alignment and structure |
| >pdb|1F9W|A Chain A, Crystal Structures Of Mutants Reveal A Signalling Pathway For Activation Of The Kinesin Motor Atpase Length = 347 | Back alignment and structure |
| >pdb|1F9U|A Chain A, Crystal Structures Of Mutants Reveal A Signalling Pathway For Activation Of The Kinesin Motor Atpase Length = 347 | Back alignment and structure |
| >pdb|1F9V|A Chain A, Crystal Structures Of Mutants Reveal A Signalling Pathway For Activation Of The Kinesin Motor Atpase Length = 347 | Back alignment and structure |
| >pdb|3PXN|A Chain A, Crystal Structure Of The Drosophila Kinesin Family Member Kin10NOD IN Complex With Divalent Manganese And Adp Length = 344 | Back alignment and structure |
| >pdb|3DC4|A Chain A, Crystal Structure Of The Drosophila Kinesin Family Member Nod In Complex With Adp Length = 344 | Back alignment and structure |
| >pdb|1RY6|A Chain A, Crystal Structure Of Internal Kinesin Motor Domain Length = 360 | Back alignment and structure |
| >pdb|2KIN|B Chain B, Kinesin (Monomeric) From Rattus Norvegicus Length = 100 | Back alignment and structure |
| >pdb|3KIN|B Chain B, Kinesin (Dimeric) From Rattus Norvegicus Length = 117 | Back alignment and structure |
| >pdb|3EB5|A Chain A, Structure Of The Ciap2 Ring Domain Length = 74 | Back alignment and structure |
| >pdb|2ECG|A Chain A, Solution Structure Of The Ring Domain Of The Baculoviral Iap Repeat-Containing Protein 4 From Homo Sapiens Length = 75 | Back alignment and structure |
| >pdb|4IC2|A Chain A, Crystal Structure Of The Xiap Ring Domain Length = 74 | Back alignment and structure |
| >pdb|4IC3|A Chain A, Crystal Structure Of The F495l Mutant Xiap Ring Domain Length = 74 | Back alignment and structure |
| >pdb|3T6P|A Chain A, Iap Antagonist-Induced Conformational Change In Ciap1 Promotes E3 Ligase Activation Via Dimerization Length = 345 | Back alignment and structure |
| >pdb|4AUQ|B Chain B, Structure Of Birc7-Ubch5b-Ub Complex. Length = 62 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 1102 | |||
| 1t5c_A | 349 | CENP-E protein, centromeric protein E; kinesin mot | 1e-166 | |
| 2y65_A | 365 | Kinesin, kinesin heavy chain; motor protein; HET: | 1e-152 | |
| 2nr8_A | 358 | Kinesin-like protein KIF9; motor domain, ADP, stru | 1e-147 | |
| 1bg2_A | 325 | Kinesin; motor protein, ATPase, microtubule associ | 1e-141 | |
| 1goj_A | 355 | Kinesin, kinesin heavy chain; motor protein, ATPas | 1e-133 | |
| 3b6u_A | 372 | Kinesin-like protein KIF3B; structural genomics co | 1e-133 | |
| 3bfn_A | 388 | Kinesin-like protein KIF22; limited proteolysis, s | 1e-130 | |
| 4a14_A | 344 | Kinesin, kinesin-like protein KIF7; motor protein, | 1e-128 | |
| 2vvg_A | 350 | Kinesin-2; motor protein, nucleotide-binding, micr | 1e-127 | |
| 3lre_A | 355 | Kinesin-like protein KIF18A; motor protein, nucleo | 1e-124 | |
| 3cob_A | 369 | Kinesin heavy chain-like protein; motor, switch II | 1e-123 | |
| 1x88_A | 359 | Kinesin-like protein KIF11; switch II, motor domai | 1e-123 | |
| 2wbe_C | 373 | Bipolar kinesin KRP-130; EG5, KLP61F, tubulin, mit | 1e-122 | |
| 3gbj_A | 354 | KIF13B protein; kinesin, motor domain, ADP, struct | 1e-122 | |
| 2zfi_A | 366 | Kinesin-like protein KIF1A, kinesin heavy chain is | 1e-121 | |
| 2h58_A | 330 | Kinesin-like protein KIFC3 variant; motor domain, | 1e-118 | |
| 2owm_A | 443 | Nckin3-434, related to kinesin-like protein KIF1C; | 1e-117 | |
| 3dc4_A | 344 | Kinesin-like protein NOD; catalytic domain, ATPase | 1e-116 | |
| 1ry6_A | 360 | Internal kinesin; kinesin motor domain, nucleotide | 1e-116 | |
| 1f9v_A | 347 | Kinesin-like protein KAR3; kinesin-related protein | 1e-115 | |
| 3u06_A | 412 | Protein claret segregational; motor domain, stalk | 1e-113 | |
| 2heh_A | 387 | KIF2C protein; kinesin, motor domain, ADP, structu | 1e-111 | |
| 4etp_A | 403 | Kinesin-like protein KAR3; kinesin motor protein, | 1e-111 | |
| 3t0q_A | 349 | AGR253WP; kinesin, alpha and beta proteins, P-loop | 1e-111 | |
| 1v8k_A | 410 | Kinesin-like protein KIF2C; microtubule destabiliz | 1e-111 | |
| 2rep_A | 376 | Kinesin-like protein KIFC1; structural genomics co | 1e-108 | |
| 3kin_B | 117 | Kinesin heavy chain; motor protein, cytoskeleton; | 6e-42 | |
| 2kin_B | 100 | Kinesin; motor protein, cytoskeleton; HET: ADP; 2. | 3e-40 | |
| 2yho_A | 79 | E3 ubiquitin-protein ligase mylip; ligase, E2 liga | 2e-20 | |
| 2ecg_A | 75 | Baculoviral IAP repeat-containing protein 4; BIRC4 | 3e-20 | |
| 2ea5_A | 68 | Cell growth regulator with ring finger domain prot | 4e-20 | |
| 3t6p_A | 345 | Baculoviral IAP repeat-containing protein 2; ring, | 3e-16 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 3e-16 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 1e-10 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 5e-09 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 8e-07 | |
| 2vje_B | 63 | MDM4 protein; proto-oncogene, phosphorylation, alt | 5e-14 | |
| 2vje_A | 64 | E3 ubiquitin-protein ligase MDM2; proto-oncogene, | 6e-13 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 3e-12 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 2e-08 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 3e-07 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 1e-04 | |
| 2d8t_A | 71 | Dactylidin, ring finger protein 146; RNF146, ring | 8e-08 | |
| 2y1n_A | 389 | E3 ubiquitin-protein ligase; ligase-transferase co | 7e-07 | |
| 1bor_A | 56 | Transcription factor PML; proto-oncogene, nuclear | 5e-06 | |
| 2ecy_A | 66 | TNF receptor-associated factor 3; metal binding pr | 1e-05 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 1e-05 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 4e-05 | |
| 3hct_A | 118 | TNF receptor-associated factor 6; cross-brace, bet | 2e-05 | |
| 2csy_A | 81 | Zinc finger protein 183-like 1; ring finger protei | 2e-05 | |
| 1chc_A | 68 | Equine herpes virus-1 ring domain; viral protein; | 5e-05 | |
| 3hcs_A | 170 | TNF receptor-associated factor 6; cross-brace, bet | 9e-05 | |
| 2ecm_A | 55 | Ring finger and CHY zinc finger domain- containing | 1e-04 | |
| 4epo_C | 149 | E3 ubiquitin-protein ligase RNF8; coiled-coil, E3 | 1e-04 | |
| 3k1f_M | 197 | Transcription initiation factor IIB; RNA polymeras | 1e-04 | |
| 3k1f_M | 197 | Transcription initiation factor IIB; RNA polymeras | 6e-04 | |
| 1c1g_A | 284 | Tropomyosin; contractIle protein; 7.00A {Sus scrof | 2e-04 | |
| 1c1g_A | 284 | Tropomyosin; contractIle protein; 7.00A {Sus scrof | 3e-04 | |
| 1c1g_A | 284 | Tropomyosin; contractIle protein; 7.00A {Sus scrof | 3e-04 | |
| 1c1g_A | 284 | Tropomyosin; contractIle protein; 7.00A {Sus scrof | 5e-04 | |
| 2ea6_A | 69 | Ring finger protein 4; RNF4, RES4-26, ring domain, | 2e-04 | |
| 3vkg_A | 3245 | Dynein heavy chain, cytoplasmic; AAA+ protein, mol | 2e-04 | |
| 2ecn_A | 70 | Ring finger protein 141; RNF141, ring domain, zinc | 3e-04 | |
| 2djb_A | 72 | Polycomb group ring finger protein 6; PCGF6, ring | 3e-04 | |
| 3knv_A | 141 | TNF receptor-associated factor 2; cross-brace, alt | 3e-04 | |
| 3l11_A | 115 | E3 ubiquitin-protein ligase RNF168; E3 ligase, rin | 4e-04 | |
| 2xeu_A | 64 | Ring finger protein 4; transcription, zinc-finger, | 7e-04 | |
| 2kiz_A | 69 | E3 ubiquitin-protein ligase arkadia; ring-H2 finge | 7e-04 |
| >1t5c_A CENP-E protein, centromeric protein E; kinesin motor-domain-ADP complex, stranded beta-sheet core with solvent exposed alpha-helices; HET: ADP PIN; 2.50A {Homo sapiens} Length = 349 | Back alignment and structure |
|---|
Score = 493 bits (1272), Expect = e-166
Identities = 152/349 (43%), Positives = 217/349 (62%), Gaps = 10/349 (2%)
Query: 98 SGDSISVTIRFRPLSEREFQRGDEIAWYADGDKIVRNEYNPATAYAFDRVFGPHANSQEV 157
+++V +R RPL+ RE G+ Y D V + + + ++ FDRVF + ++ V
Sbjct: 2 EEGAVAVCVRVRPLNSREESLGETAQVYWKTDNNVIYQVDGSKSFNFDRVFHGNETTKNV 61
Query: 158 YDVAARPVVKAAMEGVNGTVFAYGVTSSGKTHTMHGDQNSPGIIPLAIKDVFSIIQDTPG 217
Y+ A P++ +A++G NGT+FAYG T+SGKT+TM G ++ G+IP AI D+F I+ P
Sbjct: 62 YEEIAAPIIDSAIQGYNGTIFAYGQTASGKTYTMMGSEDHLGVIPRAIHDIFQKIKKFPD 121
Query: 218 REFLLRVSYLEIYNEVINDLLDPT--GQNLRVREDA-QGTYVEGIKEEVVLSPGHALSFI 274
REFLLRVSY+EIYNE I DLL T + L +RED + YV + EEVV + AL +I
Sbjct: 122 REFLLRVSYMEIYNETITDLLCGTQKMKPLIIREDVNRNVYVADLTEEVVYTSEMALKWI 181
Query: 275 AAGEEHRHVGSNNFNLLSSRSHTIFTLMIESSDHGDEYDG---VIFSQLNLIDLAGSE-S 330
GE+ RH G N SSRSHTIF +++ES + G+ + V S LNL+DLAGSE +
Sbjct: 182 TKGEKSRHYGETKMNQRSSRSHTIFRMILESREKGEPSNCEGSVKVSHLNLVDLAGSERA 241
Query: 331 SKTETTGLRRKEGSYINKSLLTLGTVIGKLSEGK-ASHVPYRDSKLTRLLQSSLSGHGHV 389
++T G+R KEG IN+SL LG VI KLS+G+ + YRDSKLTR+LQ+SL G+
Sbjct: 242 AQTGAAGVRLKEGCNINRSLFILGQVIKKLSDGQVGGFINYRDSKLTRILQNSLGGNAKT 301
Query: 390 SLICTVTPASSSMEETHNTLKFASRAKRVEIYASRNKIIDEKSLIKKYQ 438
+ICT+TP S +ET L+FAS AK ++ N++ ++ +
Sbjct: 302 RIICTITPV--SFDETLTALQFASTAKYMKNTPYVNEVSTDELEHHHHH 348
|
| >2y65_A Kinesin, kinesin heavy chain; motor protein; HET: ADP; 2.20A {Drosophila melanogaster} PDB: 2y5w_A* Length = 365 | Back alignment and structure |
|---|
| >1bg2_A Kinesin; motor protein, ATPase, microtubule associated; HET: ADP; 1.80A {Homo sapiens} SCOP: c.37.1.9 PDB: 2p4n_K* 1mkj_A* 2kin_A* 3kin_A* Length = 325 | Back alignment and structure |
|---|
| >1goj_A Kinesin, kinesin heavy chain; motor protein, ATPase; HET: ADP; 2.3A {Neurospora crassa} SCOP: c.37.1.9 Length = 355 | Back alignment and structure |
|---|
| >3b6u_A Kinesin-like protein KIF3B; structural genomics consortium, motor domain, ADP, SGC, ATP-binding, coiled coil, microtubule, motor protein; HET: ADP; 1.80A {Homo sapiens} PDB: 3b6v_A* Length = 372 | Back alignment and structure |
|---|
| >3bfn_A Kinesin-like protein KIF22; limited proteolysis, structural genomics consortium domain, ADP, SGC, ATP-binding, DNA-binding, microtubule, MO protein; HET: ADP; 2.30A {Homo sapiens} Length = 388 | Back alignment and structure |
|---|
| >4a14_A Kinesin, kinesin-like protein KIF7; motor protein, motor domain; HET: ADP; 1.60A {Homo sapiens} PDB: 2xt3_A* Length = 344 | Back alignment and structure |
|---|
| >2vvg_A Kinesin-2; motor protein, nucleotide-binding, microtubule, ATP-binding; HET: ADP; 1.60A {Giardia intestinalis} Length = 350 | Back alignment and structure |
|---|
| >3lre_A Kinesin-like protein KIF18A; motor protein, nucleotide binding, microtubule binding, ATP- cell projection, cytoskeleton, glycoprotein, microtubule; HET: ADP; 2.20A {Homo sapiens} Length = 355 | Back alignment and structure |
|---|
| >3cob_A Kinesin heavy chain-like protein; motor, switch II, loop L11, conformation, nucleotide, ATP-binding, microtubule, motor protein; HET: ADP; 2.20A {Solanum tuberosum} SCOP: c.37.1.9 PDB: 3cnz_A* 1sdm_A* 3h4s_A* Length = 369 | Back alignment and structure |
|---|
| >1x88_A Kinesin-like protein KIF11; switch II, motor domain, NECK linker, cell cycle; HET: ADP NAT; 1.80A {Homo sapiens} SCOP: c.37.1.9 PDB: 3hqd_A* 3ken_A* 2pg2_A* 1yrs_A* 2fme_A* 2g1q_A* 2gm1_A* 1ii6_A* 2uyi_A* 2uym_A* 2wog_A* 2x2r_A* 2x7c_A* 2x7d_A* 2x7e_A* 2xae_A* 3k3b_A* 3k5e_A* 3l9h_A* 1q0b_A* ... Length = 359 | Back alignment and structure |
|---|
| >2wbe_C Bipolar kinesin KRP-130; EG5, KLP61F, tubulin, mitosis, GTP-binding, motor protein, cell division, cell cycle, microtubule, ATP-binding; HET: GTP ANP GDP TA1; 9.40A {Drosophila melanogaster} Length = 373 | Back alignment and structure |
|---|
| >3gbj_A KIF13B protein; kinesin, motor domain, ADP, structural genomics, structural genomics consortium, SGC, ATP-binding, microtubule, motor protein; HET: ADP; 2.10A {Homo sapiens} Length = 354 | Back alignment and structure |
|---|
| >2zfi_A Kinesin-like protein KIF1A, kinesin heavy chain isoform 5C; alpha and beta protein, enzyme, ATPase, P-loop, motor protein, ATP-binding, coiled coil; HET: ADP; 1.55A {Mus musculus} SCOP: c.37.1.9 PDB: 1vfw_A* 1vfx_A* 1vfz_A* 1vfv_A* 2zfj_A* 2zfk_A* 2zfl_A* 2zfm_A* 1i5s_A* 1i6i_A* 2hxf_C* 1ia0_K* 2hxh_C* Length = 366 | Back alignment and structure |
|---|
| >2h58_A Kinesin-like protein KIFC3 variant; motor domain, ADP, structural genomics, structur Al genomics consortium, SGC; HET: ADP; 1.85A {Homo sapiens} Length = 330 | Back alignment and structure |
|---|
| >2owm_A Nckin3-434, related to kinesin-like protein KIF1C; motor domain, ADP, NECK linker, motor PR; HET: ADP; 3.25A {Neurospora crassa} Length = 443 | Back alignment and structure |
|---|
| >3dc4_A Kinesin-like protein NOD; catalytic domain, ATPase, microtubule, ADP, nucleotide-binding protein, ATP-binding, coiled coil, motor protein; HET: ADP; 1.90A {Drosophila melanogaster} PDB: 3dcb_A* 3dco_N* 3pxn_A* Length = 344 | Back alignment and structure |
|---|
| >1ry6_A Internal kinesin; kinesin motor domain, nucleotide-free, transport protein; 1.60A {Plasmodium falciparum} SCOP: c.37.1.9 Length = 360 | Back alignment and structure |
|---|
| >1f9v_A Kinesin-like protein KAR3; kinesin-related protein, motor protein, microtubinding proteinbule, contractIle protein; HET: ADP; 1.30A {Saccharomyces cerevisiae} SCOP: c.37.1.9 PDB: 1f9t_A* 1f9w_A* 1f9u_A* 3kar_A* Length = 347 | Back alignment and structure |
|---|
| >3u06_A Protein claret segregational; motor domain, stalk rotation, power stroke, kinesin-14, MICR binding, NCD, transport, molecular motor; HET: ADP GOL; 2.35A {Drosophila melanogaster} PDB: 2ncd_A* 1n6m_A* 1cz7_A* 3l1c_A* Length = 412 | Back alignment and structure |
|---|
| >2heh_A KIF2C protein; kinesin, motor domain, ADP, structural genomics, structural genomics consortium, SGC, structural protein; HET: ADP; 2.15A {Homo sapiens} PDB: 3edl_D* Length = 387 | Back alignment and structure |
|---|
| >4etp_A Kinesin-like protein KAR3; kinesin motor protein, kinesin motor homology domain, karyog mitosis, microtubules; HET: ADP EBC; 2.30A {Saccharomyces cerevisiae} Length = 403 | Back alignment and structure |
|---|
| >3t0q_A AGR253WP; kinesin, alpha and beta proteins, P-loop containing nucleosi triphosphate hydrolases, microtubule motor protein; HET: ADP; 2.35A {Ashbya gossypii} Length = 349 | Back alignment and structure |
|---|
| >1v8k_A Kinesin-like protein KIF2C; microtubule destabilizer, structural P; HET: ANP; 2.25A {Mus musculus} SCOP: c.37.1.9 PDB: 1v8j_A* 2gry_A* Length = 410 | Back alignment and structure |
|---|
| >2rep_A Kinesin-like protein KIFC1; structural genomics consortium, motor domain, ADP, binding, cell cycle, cell division, endosome, microtubule; HET: ADP; 2.60A {Homo sapiens} Length = 376 | Back alignment and structure |
|---|
| >3kin_B Kinesin heavy chain; motor protein, cytoskeleton; HET: ADP; 3.10A {Rattus norvegicus} SCOP: c.37.1.9 Length = 117 | Back alignment and structure |
|---|
| >2kin_B Kinesin; motor protein, cytoskeleton; HET: ADP; 2.00A {Rattus norvegicus} SCOP: c.37.1.9 Length = 100 | Back alignment and structure |
|---|
| >2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A Length = 79 | Back alignment and structure |
|---|
| >2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 75 | Back alignment and structure |
|---|
| >2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 68 | Back alignment and structure |
|---|
| >3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A Length = 345 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* Length = 63 | Back alignment and structure |
|---|
| >2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A Length = 64 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 71 | Back alignment and structure |
|---|
| >2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Length = 389 | Back alignment and structure |
|---|
| >1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 56 | Back alignment and structure |
|---|
| >2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 66 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
| >3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Length = 118 | Back alignment and structure |
|---|
| >2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81 | Back alignment and structure |
|---|
| >1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Length = 68 | Back alignment and structure |
|---|
| >3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Length = 170 | Back alignment and structure |
|---|
| >2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Length = 55 | Back alignment and structure |
|---|
| >4epo_C E3 ubiquitin-protein ligase RNF8; coiled-coil, E3 ubiquitin ligase, protein binding complex; 4.80A {Homo sapiens} Length = 149 | Back alignment and structure |
|---|
| >3k1f_M Transcription initiation factor IIB; RNA polymerase II, TFIIB, transcription factor, DNA-binding, DNA-directed RNA polymerase; 4.30A {Saccharomyces cerevisiae} Length = 197 | Back alignment and structure |
|---|
| >3k1f_M Transcription initiation factor IIB; RNA polymerase II, TFIIB, transcription factor, DNA-binding, DNA-directed RNA polymerase; 4.30A {Saccharomyces cerevisiae} Length = 197 | Back alignment and structure |
|---|
| >1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Length = 284 | Back alignment and structure |
|---|
| >1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Length = 284 | Back alignment and structure |
|---|
| >1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Length = 284 | Back alignment and structure |
|---|
| >1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Length = 284 | Back alignment and structure |
|---|
| >2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 69 | Back alignment and structure |
|---|
| >3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* 3vkh_C* Length = 3245 | Back alignment and structure |
|---|
| >2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 | Back alignment and structure |
|---|
| >2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 72 | Back alignment and structure |
|---|
| >3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} Length = 141 | Back alignment and structure |
|---|
| >3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, chromosomal protein, DNA repair, metal-binding; 2.12A {Homo sapiens} Length = 115 | Back alignment and structure |
|---|
| >2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Length = 64 | Back alignment and structure |
|---|
| >2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} Length = 69 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 1102 | |||
| 2y65_A | 365 | Kinesin, kinesin heavy chain; motor protein; HET: | 100.0 | |
| 3cob_A | 369 | Kinesin heavy chain-like protein; motor, switch II | 100.0 | |
| 3b6u_A | 372 | Kinesin-like protein KIF3B; structural genomics co | 100.0 | |
| 2vvg_A | 350 | Kinesin-2; motor protein, nucleotide-binding, micr | 100.0 | |
| 1goj_A | 355 | Kinesin, kinesin heavy chain; motor protein, ATPas | 100.0 | |
| 3bfn_A | 388 | Kinesin-like protein KIF22; limited proteolysis, s | 100.0 | |
| 1t5c_A | 349 | CENP-E protein, centromeric protein E; kinesin mot | 100.0 | |
| 2owm_A | 443 | Nckin3-434, related to kinesin-like protein KIF1C; | 100.0 | |
| 2zfi_A | 366 | Kinesin-like protein KIF1A, kinesin heavy chain is | 100.0 | |
| 1bg2_A | 325 | Kinesin; motor protein, ATPase, microtubule associ | 100.0 | |
| 3lre_A | 355 | Kinesin-like protein KIF18A; motor protein, nucleo | 100.0 | |
| 1x88_A | 359 | Kinesin-like protein KIF11; switch II, motor domai | 100.0 | |
| 2wbe_C | 373 | Bipolar kinesin KRP-130; EG5, KLP61F, tubulin, mit | 100.0 | |
| 4a14_A | 344 | Kinesin, kinesin-like protein KIF7; motor protein, | 100.0 | |
| 3gbj_A | 354 | KIF13B protein; kinesin, motor domain, ADP, struct | 100.0 | |
| 3nwn_A | 359 | Kinesin-like protein KIF9; motor domain, ADP, stru | 100.0 | |
| 2h58_A | 330 | Kinesin-like protein KIFC3 variant; motor domain, | 100.0 | |
| 2nr8_A | 358 | Kinesin-like protein KIF9; motor domain, ADP, stru | 100.0 | |
| 3t0q_A | 349 | AGR253WP; kinesin, alpha and beta proteins, P-loop | 100.0 | |
| 2rep_A | 376 | Kinesin-like protein KIFC1; structural genomics co | 100.0 | |
| 1f9v_A | 347 | Kinesin-like protein KAR3; kinesin-related protein | 100.0 | |
| 1ry6_A | 360 | Internal kinesin; kinesin motor domain, nucleotide | 100.0 | |
| 2heh_A | 387 | KIF2C protein; kinesin, motor domain, ADP, structu | 100.0 | |
| 3u06_A | 412 | Protein claret segregational; motor domain, stalk | 100.0 | |
| 1v8k_A | 410 | Kinesin-like protein KIF2C; microtubule destabiliz | 100.0 | |
| 4etp_A | 403 | Kinesin-like protein KAR3; kinesin motor protein, | 100.0 | |
| 3dc4_A | 344 | Kinesin-like protein NOD; catalytic domain, ATPase | 100.0 | |
| 4h1g_A | 715 | Maltose binding protein-cakar3 motor domain fusio; | 100.0 | |
| 2kin_B | 100 | Kinesin; motor protein, cytoskeleton; HET: ADP; 2. | 99.96 | |
| 3kin_B | 117 | Kinesin heavy chain; motor protein, cytoskeleton; | 99.94 | |
| 2o0a_A | 298 | S.cerevisiae chromosome XVI reading frame ORF YPL2 | 99.89 | |
| 2ea5_A | 68 | Cell growth regulator with ring finger domain prot | 99.19 | |
| 2yho_A | 79 | E3 ubiquitin-protein ligase mylip; ligase, E2 liga | 99.14 | |
| 2vje_B | 63 | MDM4 protein; proto-oncogene, phosphorylation, alt | 99.07 | |
| 4ic3_A | 74 | E3 ubiquitin-protein ligase XIAP; ring domain, zin | 99.05 | |
| 2ecg_A | 75 | Baculoviral IAP repeat-containing protein 4; BIRC4 | 99.0 | |
| 2vje_A | 64 | E3 ubiquitin-protein ligase MDM2; proto-oncogene, | 98.97 | |
| 3t6p_A | 345 | Baculoviral IAP repeat-containing protein 2; ring, | 98.73 | |
| 4ayc_A | 138 | E3 ubiquitin-protein ligase RNF8; DNA damage, K63 | 98.28 | |
| 1chc_A | 68 | Equine herpes virus-1 ring domain; viral protein; | 98.15 | |
| 2ecn_A | 70 | Ring finger protein 141; RNF141, ring domain, zinc | 98.15 | |
| 2d8t_A | 71 | Dactylidin, ring finger protein 146; RNF146, ring | 98.14 | |
| 2ysl_A | 73 | Tripartite motif-containing protein 31; ring-type | 98.11 | |
| 2csy_A | 81 | Zinc finger protein 183-like 1; ring finger protei | 98.1 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 98.05 | |
| 1c1g_A | 284 | Tropomyosin; contractIle protein; 7.00A {Sus scrof | 98.05 | |
| 2y1n_A | 389 | E3 ubiquitin-protein ligase; ligase-transferase co | 98.04 | |
| 2xeu_A | 64 | Ring finger protein 4; transcription, zinc-finger, | 98.03 | |
| 2ecm_A | 55 | Ring finger and CHY zinc finger domain- containing | 98.02 | |
| 2ea6_A | 69 | Ring finger protein 4; RNF4, RES4-26, ring domain, | 98.02 | |
| 2egp_A | 79 | Tripartite motif-containing protein 34; ZF-C3HC4 d | 97.99 | |
| 3ng2_A | 71 | RNF4, snurf, ring finger protein 4; ring domain, E | 97.99 | |
| 2ct2_A | 88 | Tripartite motif protein 32; zinc-finger protein H | 97.97 | |
| 2ecw_A | 85 | Tripartite motif-containing protein 30; metal bind | 97.97 | |
| 2kiz_A | 69 | E3 ubiquitin-protein ligase arkadia; ring-H2 finge | 97.96 | |
| 2djb_A | 72 | Polycomb group ring finger protein 6; PCGF6, ring | 97.95 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 97.93 | |
| 1bor_A | 56 | Transcription factor PML; proto-oncogene, nuclear | 97.92 | |
| 3fl2_A | 124 | E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA | 97.92 | |
| 1c1g_A | 284 | Tropomyosin; contractIle protein; 7.00A {Sus scrof | 97.91 | |
| 2ecv_A | 85 | Tripartite motif-containing protein 5; metal bindi | 97.91 | |
| 2ecy_A | 66 | TNF receptor-associated factor 3; metal binding pr | 97.91 | |
| 1e4u_A | 78 | Transcriptional repressor NOT4; gene regulation, t | 97.89 | |
| 1iym_A | 55 | EL5; ring-H2 finger, ubiquitin ligase, DNA binding | 97.88 | |
| 2l0b_A | 91 | E3 ubiquitin-protein ligase praja-1; zinc finger, | 97.87 | |
| 1jm7_A | 112 | BRCA1, breast cancer type 1 susceptibility protein | 97.85 | |
| 2yur_A | 74 | Retinoblastoma-binding protein 6; P53-associated c | 97.85 | |
| 2ect_A | 78 | Ring finger protein 126; metal binding protein, st | 97.83 | |
| 2ep4_A | 74 | Ring finger protein 24; zinc binding, ubiquitin, E | 97.82 | |
| 1x4j_A | 75 | Ring finger protein 38; structural genomics, NPPSF | 97.82 | |
| 3ztg_A | 92 | E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR | 97.79 | |
| 1g25_A | 65 | CDK-activating kinase assembly factor MAT1; ring f | 97.75 | |
| 3l11_A | 115 | E3 ubiquitin-protein ligase RNF168; E3 ligase, rin | 97.74 | |
| 3lrq_A | 100 | E3 ubiquitin-protein ligase TRIM37; structural gen | 97.73 | |
| 1z6u_A | 150 | NP95-like ring finger protein isoform B; structura | 97.72 | |
| 1t1h_A | 78 | Gspef-atpub14, armadillo repeat containing protein | 97.69 | |
| 2ckl_B | 165 | Ubiquitin ligase protein RING2; BMI1, RING1B, poly | 97.67 | |
| 2y43_A | 99 | E3 ubiquitin-protein ligase RAD18; DNA repair, met | 97.66 | |
| 2ckl_A | 108 | Polycomb group ring finger protein 4; BMI1, RING1B | 97.64 | |
| 2ysj_A | 63 | Tripartite motif-containing protein 31; ring-type | 97.59 | |
| 1jm7_B | 117 | BARD1, BRCA1-associated ring domain protein 1; rin | 97.58 | |
| 2ecj_A | 58 | Tripartite motif-containing protein 39; TRIM39, ri | 97.57 | |
| 3hct_A | 118 | TNF receptor-associated factor 6; cross-brace, bet | 97.51 | |
| 1wt6_A | 81 | Myotonin-protein kinase; coiled-coil, kinase activ | 97.49 | |
| 1v87_A | 114 | Deltex protein 2; ring-H2 domain, zinc-binding dom | 97.42 | |
| 1rmd_A | 116 | RAG1; V(D)J recombination, antibody, MAD, ring fin | 97.32 | |
| 2c2l_A | 281 | CHIP, carboxy terminus of HSP70-interacting protei | 97.29 | |
| 3na7_A | 256 | HP0958; flagellar biogenesis, flagellum export, C4 | 97.22 | |
| 2kre_A | 100 | Ubiquitin conjugation factor E4 B; U-box domain, E | 97.2 | |
| 2ecl_A | 81 | Ring-box protein 2; RNF7, ring domian, zinc-bindin | 97.19 | |
| 4ap4_A | 133 | E3 ubiquitin ligase RNF4; ligase-signalling protei | 97.18 | |
| 2kr4_A | 85 | Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri | 97.16 | |
| 1wgm_A | 98 | Ubiquitin conjugation factor E4A; ubiquitinating e | 97.14 | |
| 3knv_A | 141 | TNF receptor-associated factor 2; cross-brace, alt | 97.13 | |
| 2f42_A | 179 | STIP1 homology and U-box containing protein 1; cha | 97.1 | |
| 4ap4_A | 133 | E3 ubiquitin ligase RNF4; ligase-signalling protei | 97.05 | |
| 3hcs_A | 170 | TNF receptor-associated factor 6; cross-brace, bet | 96.82 | |
| 3vkg_A | 3245 | Dynein heavy chain, cytoplasmic; AAA+ protein, mol | 96.81 | |
| 3dpl_R | 106 | Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST | 96.72 | |
| 2v71_A | 189 | Nuclear distribution protein NUDE-like 1; developm | 96.61 | |
| 4a0k_B | 117 | E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi | 96.4 | |
| 2yu4_A | 94 | E3 SUMO-protein ligase NSE2; SP-ring domain, struc | 96.35 | |
| 3na7_A | 256 | HP0958; flagellar biogenesis, flagellum export, C4 | 95.98 | |
| 1wim_A | 94 | KIAA0161 protein; ring finger domain, UBCM4-intera | 95.88 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 95.86 | |
| 3htk_C | 267 | E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- | 95.68 | |
| 2d8s_A | 80 | Cellular modulator of immune recognition; C-MIR, m | 95.62 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 95.57 | |
| 3vk6_A | 101 | E3 ubiquitin-protein ligase hakai; HYB, phosphotyr | 95.18 | |
| 3vkg_A | 3245 | Dynein heavy chain, cytoplasmic; AAA+ protein, mol | 95.03 | |
| 2efr_A | 155 | General control protein GCN4 and tropomyosin 1 Al; | 94.66 | |
| 3o0z_A | 168 | RHO-associated protein kinase 1; coiled-coil, tran | 94.11 | |
| 2ocy_A | 154 | RAB guanine nucleotide exchange factor SEC2; RAB, | 93.95 | |
| 2bay_A | 61 | PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin l | 93.4 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 93.0 | |
| 3ec2_A | 180 | DNA replication protein DNAC; helicase loader, rep | 92.8 | |
| 2v71_A | 189 | Nuclear distribution protein NUDE-like 1; developm | 92.61 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 92.56 | |
| 3nmd_A | 72 | CGMP dependent protein kinase; leucine zipper, coi | 92.0 | |
| 3o0z_A | 168 | RHO-associated protein kinase 1; coiled-coil, tran | 91.6 | |
| 2w58_A | 202 | DNAI, primosome component (helicase loader); ATP-b | 91.25 | |
| 2qgz_A | 308 | Helicase loader, putative primosome component; str | 90.39 | |
| 4gkw_A | 167 | Spindle assembly abnormal protein 6; double helix, | 90.21 | |
| 3s9g_A | 104 | Protein hexim1; cyclin T-binding domain (TBD), cyc | 88.49 | |
| 2ocy_A | 154 | RAB guanine nucleotide exchange factor SEC2; RAB, | 87.24 | |
| 3i00_A | 120 | HIP-I, huntingtin-interacting protein 1; transcrip | 86.5 | |
| 3s4r_A | 93 | Vimentin; alpha-helix, cytoskeleton, intermediate | 86.42 | |
| 3t15_A | 293 | Ribulose bisphosphate carboxylase/oxygenase activ | 86.03 | |
| 4gkw_A | 167 | Spindle assembly abnormal protein 6; double helix, | 85.97 | |
| 2jee_A | 81 | YIIU; FTSZ, septum, coiled-coil, cell division, ce | 85.85 | |
| 2v4h_A | 110 | NF-kappa-B essential modulator; transcription, met | 85.48 | |
| 3k1l_B | 381 | Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A | 84.82 | |
| 3u1c_A | 101 | Tropomyosin alpha-1 chain; anti-parallel coiled co | 83.69 | |
| 4b4t_M | 434 | 26S protease regulatory subunit 6A; hydrolase, AAA | 83.25 | |
| 1vyx_A | 60 | ORF K3, K3RING; zinc-binding protein, ring domain, | 82.75 | |
| 2bjv_A | 265 | PSP operon transcriptional activator; AAA, transcr | 82.69 | |
| 4etp_B | 333 | Spindle POLE BODY-associated protein VIK1; kinesin | 82.41 | |
| 2jee_A | 81 | YIIU; FTSZ, septum, coiled-coil, cell division, ce | 82.4 | |
| 2r62_A | 268 | Cell division protease FTSH homolog; ATPase domain | 82.18 | |
| 3hnw_A | 138 | Uncharacterized protein; coiled-coil, structural g | 82.1 | |
| 3s84_A | 273 | Apolipoprotein A-IV; four helix bundle, transport | 81.94 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 81.17 | |
| 3tnu_B | 129 | Keratin, type II cytoskeletal 5; coiled-coil, stru | 81.13 | |
| 4b4t_K | 428 | 26S protease regulatory subunit 6B homolog; hydrol | 80.78 | |
| 1jbk_A | 195 | CLPB protein; beta barrel, chaperone; 1.80A {Esche | 80.65 |
| >2y65_A Kinesin, kinesin heavy chain; motor protein; HET: ADP; 2.20A {Drosophila melanogaster} PDB: 2y5w_A* | Back alignment and structure |
|---|
Probab=100.00 E-value=1.4e-88 Score=776.59 Aligned_cols=343 Identities=41% Similarity=0.633 Sum_probs=292.6
Q ss_pred CCCCCEEEEEEeCCCChhhhhcCCeEEEeeC----CCEEEecCCCCCcceeeceecCCCCChhHHHhhhhHHHHHHHhcC
Q 001316 97 RSGDSISVTIRFRPLSEREFQRGDEIAWYAD----GDKIVRNEYNPATAYAFDRVFGPHANSQEVYDVAARPVVKAAMEG 172 (1102)
Q Consensus 97 ~~~~~I~V~vRvRP~~~~E~~~~~~~~~~~~----~~~~~~~~~~~~~~f~FD~VF~~~~~q~~Vy~~~~~plV~~~l~G 172 (1102)
..+++|+|+||+||++++|...+...++..+ ...+... .+.|.||+||+++++|++||+.++.|+|+++|+|
T Consensus 8 ~~~~~i~V~vRvRP~~~~E~~~~~~~~v~~~~~~~~~~i~~~----~~~f~FD~Vf~~~~~Q~~Vy~~~~~plv~~~l~G 83 (365)
T 2y65_A 8 PAEDSIKVVCRFRPLNDSEEKAGSKFVVKFPNNVEENCISIA----GKVYLFDKVFKPNASQEKVYNEAAKSIVTDVLAG 83 (365)
T ss_dssp CCEEECEEEEEECCCCHHHHHTTCCBCEECCSSSTTCEEEET----TEEEECSEEECTTCCHHHHHHHHTHHHHHHHHTT
T ss_pred CCCCCeEEEEEcCcCChhHhccCCceEEEeCCCCCCcEEEEC----CEEEeCceEecCCCCHHHHHHHhhhhHHHHHhCC
Confidence 4578999999999999999887766544433 2344332 4689999999999999999999999999999999
Q ss_pred CceeEEeeccCCCCCccccCCCCC---CCCchhhHHHHHHHHhhcC-CCceeEEEeehhhhhcceeeecCCCCCCcceEE
Q 001316 173 VNGTVFAYGVTSSGKTHTMHGDQN---SPGIIPLAIKDVFSIIQDT-PGREFLLRVSYLEIYNEVINDLLDPTGQNLRVR 248 (1102)
Q Consensus 173 ~N~tIfaYGqTgSGKT~Tm~G~~~---~~GIipr~~~~LF~~i~~~-~~~~~~v~vS~lEIYnE~i~DLL~~~~~~l~ir 248 (1102)
||+||||||||||||||||+|+.. .+|||||++++||..+... .+..|.|+|||+|||||+|+|||++....+.|+
T Consensus 84 ~n~tifAYGqTGSGKTyTm~G~~~~~~~~Giipr~~~~lF~~i~~~~~~~~~~v~vS~~EIYnE~i~DLL~~~~~~l~i~ 163 (365)
T 2y65_A 84 YNGTIFAYGQTSSGKTHTMEGVIGDSVKQGIIPRIVNDIFNHIYAMEVNLEFHIKVSYYEIYMDKIRDLLDVSKVNLSVH 163 (365)
T ss_dssp CCEEEEEECSTTSSHHHHHTBSTTCTTTBCHHHHHHHHHHHHHHHCCSCEEEEEEEEEEEEETTEEEETTCTTCCSBCEE
T ss_pred CceEEEeecCCCCCCceEEecCCCCcccCChHHHHHHHHHHHHHhccCCceEEEEEEEEEEECCeeeecccCCcCCceEE
Confidence 999999999999999999999654 5699999999999999764 456899999999999999999999998899999
Q ss_pred eCC-CCcEeeCceEEEeCChHHHHHHHHHHhhhcccCCCccccCCCCceeEEEEEEEEecCCCCCCcEEEEEEEEeecCC
Q 001316 249 EDA-QGTYVEGIKEEVVLSPGHALSFIAAGEEHRHVGSNNFNLLSSRSHTIFTLMIESSDHGDEYDGVIFSQLNLIDLAG 327 (1102)
Q Consensus 249 e~~-~g~~v~gl~e~~V~s~~e~~~ll~~g~~~R~~~~t~~N~~SSRSH~If~i~v~~~~~~~~~~~~~~skL~lVDLAG 327 (1102)
+++ .|++|.|++++.|.|++|++.+|..|..+|++++|.||..|||||+||+|+|.+..... .....|+|+||||||
T Consensus 164 e~~~~~~~v~gl~~~~V~s~~e~~~ll~~g~~~R~~~~T~~N~~SSRSH~if~i~v~~~~~~~--~~~~~skL~lVDLAG 241 (365)
T 2y65_A 164 EDKNRVPYVKGATERFVSSPEDVFEVIEEGKSNRHIAVTNMNEHSSRSHSVFLINVKQENLEN--QKKLSGKLYLVDLAG 241 (365)
T ss_dssp ECSSSCEEETTCCCEEECSHHHHHHHHHHHHHHHTTTCSCHHHHHHTSEEEEEEEEEEEETTT--CCEEEEEEEEEECCC
T ss_pred ECCCCCEEecCCEEEecCCHHHHHHHHHHHHhhcccccccCCCCCCCceEEEEEEEEEEecCC--CCEeEEEEEEEECCC
Confidence 998 57899999999999999999999999999999999999999999999999999876433 346789999999999
Q ss_pred CCC-cccccchhhhhhhHHHhhhHHHHHHHHHHhhcCCCCCccCCCCcchhhhhccCCCCccceEEEeeCCCCCCHHHHH
Q 001316 328 SES-SKTETTGLRRKEGSYINKSLLTLGTVIGKLSEGKASHVPYRDSKLTRLLQSSLSGHGHVSLICTVTPASSSMEETH 406 (1102)
Q Consensus 328 SEr-~kt~~~g~r~kE~~~INkSL~aLg~vI~aL~~~k~~hvPYRdSkLTrLLqdsLgGnskt~~I~~isP~~~~~~ETl 406 (1102)
||| .++++.|.|++|+.+||+||++||+||.+|++++..|||||||||||||||+|||||+|+|||||||+..+++||+
T Consensus 242 SEr~~~t~~~g~rl~E~~~INkSL~aLg~vI~aL~~~~~~hvPyRdSkLT~lLqdsLgGnskt~mI~~isP~~~~~~ETl 321 (365)
T 2y65_A 242 SEKVSKTGAEGTVLDEAKNINKSLSALGNVISALADGNKTHIPYRDSKLTRILQESLGGNARTTIVICCSPASFNESETK 321 (365)
T ss_dssp CCC----------------CCHHHHHHHHHHHHHHHCCCSCCCGGGCHHHHHTGGGTTSSSEEEEEEEECCBGGGHHHHH
T ss_pred CCcchhcCCcchhHHHHHHHHHHHHHHHHHHHHHhcCCCCCCccccCHHHHHHHhhcCCCccEEEEEEecCccCCHHHHH
Confidence 999 5689999999999999999999999999999987789999999999999999999999999999999999999999
Q ss_pred HHHHHHHHhcccccccccccccCHHHHHHHHHHHHHHHH
Q 001316 407 NTLKFASRAKRVEIYASRNKIIDEKSLIKKYQREISSLK 445 (1102)
Q Consensus 407 sTLrfA~rak~I~~~~~~n~~~~~~~~i~~~~~ei~~Lk 445 (1102)
+||+||+|||+|+|.|.+|+..+.+.++++|++|+..|+
T Consensus 322 ~TL~fA~rak~I~n~~~~n~~~~~~~~~~~~~~e~~~~~ 360 (365)
T 2y65_A 322 STLDFGRRAKTVKNVVCVNEELTAEEWKRRYEKEKEKNA 360 (365)
T ss_dssp HHHHHHHHHTTCEEECCCEEECCSHHHHHC---------
T ss_pred HHHHHHHHHhcccCcceeCCCCCHHHHHHHHHHHHHHHH
Confidence 999999999999999999999888888888888887665
|
| >3cob_A Kinesin heavy chain-like protein; motor, switch II, loop L11, conformation, nucleotide, ATP-binding, microtubule, motor protein; HET: ADP; 2.20A {Solanum tuberosum} SCOP: c.37.1.9 PDB: 3cnz_A* 1sdm_A* 3h4s_A* | Back alignment and structure |
|---|
| >3b6u_A Kinesin-like protein KIF3B; structural genomics consortium, motor domain, ADP, SGC, ATP-binding, coiled coil, microtubule, motor protein; HET: ADP; 1.80A {Homo sapiens} PDB: 3b6v_A* | Back alignment and structure |
|---|
| >2vvg_A Kinesin-2; motor protein, nucleotide-binding, microtubule, ATP-binding; HET: ADP; 1.60A {Giardia intestinalis} | Back alignment and structure |
|---|
| >1goj_A Kinesin, kinesin heavy chain; motor protein, ATPase; HET: ADP; 2.3A {Neurospora crassa} SCOP: c.37.1.9 | Back alignment and structure |
|---|
| >3bfn_A Kinesin-like protein KIF22; limited proteolysis, structural genomics consortium domain, ADP, SGC, ATP-binding, DNA-binding, microtubule, MO protein; HET: ADP; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >1t5c_A CENP-E protein, centromeric protein E; kinesin motor-domain-ADP complex, stranded beta-sheet core with solvent exposed alpha-helices; HET: ADP PIN; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >2owm_A Nckin3-434, related to kinesin-like protein KIF1C; motor domain, ADP, NECK linker, motor PR; HET: ADP; 3.25A {Neurospora crassa} | Back alignment and structure |
|---|
| >2zfi_A Kinesin-like protein KIF1A, kinesin heavy chain isoform 5C; alpha and beta protein, enzyme, ATPase, P-loop, motor protein, ATP-binding, coiled coil; HET: ADP; 1.55A {Mus musculus} SCOP: c.37.1.9 PDB: 1vfw_A* 1vfx_A* 1vfz_A* 1vfv_A* 2zfj_A* 2zfk_A* 2zfl_A* 2zfm_A* 1i5s_A* 1i6i_A* 2hxf_C* 1ia0_K* 2hxh_C* | Back alignment and structure |
|---|
| >1bg2_A Kinesin; motor protein, ATPase, microtubule associated; HET: ADP; 1.80A {Homo sapiens} SCOP: c.37.1.9 PDB: 2p4n_K* 1mkj_A* 2kin_A* 3kin_A* | Back alignment and structure |
|---|
| >3lre_A Kinesin-like protein KIF18A; motor protein, nucleotide binding, microtubule binding, ATP- cell projection, cytoskeleton, glycoprotein, microtubule; HET: ADP; 2.20A {Homo sapiens} SCOP: c.37.1.0 | Back alignment and structure |
|---|
| >1x88_A Kinesin-like protein KIF11; switch II, motor domain, NECK linker, cell cycle; HET: ADP NAT; 1.80A {Homo sapiens} SCOP: c.37.1.9 PDB: 3hqd_A* 3ken_A* 2pg2_A* 1yrs_A* 2fme_A* 2g1q_A* 2gm1_A* 1ii6_A* 2uyi_A* 2uym_A* 2wog_A* 2x2r_A* 2x7c_A* 2x7d_A* 2x7e_A* 2xae_A* 3k3b_A* 3k5e_A* 3l9h_A* 1q0b_A* ... | Back alignment and structure |
|---|
| >2wbe_C Bipolar kinesin KRP-130; EG5, KLP61F, tubulin, mitosis, GTP-binding, motor protein, cell division, cell cycle, microtubule, ATP-binding; HET: GTP ANP GDP TA1; 9.40A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >4a14_A Kinesin, kinesin-like protein KIF7; motor protein, motor domain; HET: ADP; 1.60A {Homo sapiens} SCOP: c.37.1.0 PDB: 2xt3_A* | Back alignment and structure |
|---|
| >3gbj_A KIF13B protein; kinesin, motor domain, ADP, structural genomics, structural genomics consortium, SGC, ATP-binding, microtubule, motor protein; HET: ADP; 2.10A {Homo sapiens} SCOP: c.37.1.9 | Back alignment and structure |
|---|
| >3nwn_A Kinesin-like protein KIF9; motor domain, ADP, structural genomics, structural consortium, SGC, contractIle protein; HET: ADP; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2h58_A Kinesin-like protein KIFC3 variant; motor domain, ADP, structural genomics, structur Al genomics consortium, SGC; HET: ADP; 1.85A {Homo sapiens} | Back alignment and structure |
|---|
| >3t0q_A AGR253WP; kinesin, alpha and beta proteins, P-loop containing nucleosi triphosphate hydrolases, microtubule motor protein; HET: ADP; 2.35A {Ashbya gossypii} | Back alignment and structure |
|---|
| >2rep_A Kinesin-like protein KIFC1; structural genomics consortium, motor domain, ADP, binding, cell cycle, cell division, endosome, microtubule; HET: ADP; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >1f9v_A Kinesin-like protein KAR3; kinesin-related protein, motor protein, microtubinding proteinbule, contractIle protein; HET: ADP; 1.30A {Saccharomyces cerevisiae} SCOP: c.37.1.9 PDB: 1f9t_A* 1f9w_A* 1f9u_A* 3kar_A* | Back alignment and structure |
|---|
| >1ry6_A Internal kinesin; kinesin motor domain, nucleotide-free, transport protein; 1.60A {Plasmodium falciparum} SCOP: c.37.1.9 | Back alignment and structure |
|---|
| >2heh_A KIF2C protein; kinesin, motor domain, ADP, structural genomics, structural genomics consortium, SGC, structural protein; HET: ADP; 2.15A {Homo sapiens} PDB: 3edl_D* | Back alignment and structure |
|---|
| >3u06_A Protein claret segregational; motor domain, stalk rotation, power stroke, kinesin-14, MICR binding, NCD, transport, molecular motor; HET: ADP GOL; 2.35A {Drosophila melanogaster} PDB: 2ncd_A* 1n6m_A* 1cz7_A* 3l1c_A* | Back alignment and structure |
|---|
| >1v8k_A Kinesin-like protein KIF2C; microtubule destabilizer, structural P; HET: ANP; 2.25A {Mus musculus} SCOP: c.37.1.9 PDB: 1v8j_A* 2gry_A* | Back alignment and structure |
|---|
| >4etp_A Kinesin-like protein KAR3; kinesin motor protein, kinesin motor homology domain, karyog mitosis, microtubules; HET: ADP EBC; 2.30A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3dc4_A Kinesin-like protein NOD; catalytic domain, ATPase, microtubule, ADP, nucleotide-binding protein, ATP-binding, coiled coil, motor protein; HET: ADP; 1.90A {Drosophila melanogaster} PDB: 3dcb_A* 3dco_N* 3pxn_A* | Back alignment and structure |
|---|
| >4h1g_A Maltose binding protein-cakar3 motor domain fusio; kinesin motor domain, motor protein, chimera; HET: MTT ADP EDO; 2.15A {Escherichia coli} | Back alignment and structure |
|---|
| >2kin_B Kinesin; motor protein, cytoskeleton; HET: ADP; 2.00A {Rattus norvegicus} SCOP: c.37.1.9 | Back alignment and structure |
|---|
| >3kin_B Kinesin heavy chain; motor protein, cytoskeleton; HET: ADP; 3.10A {Rattus norvegicus} SCOP: c.37.1.9 | Back alignment and structure |
|---|
| >2o0a_A S.cerevisiae chromosome XVI reading frame ORF YPL253C; VIK1, motor homology domain, kinesin, motor domain, microtubule-binding; 1.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A | Back alignment and structure |
|---|
| >2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* | Back alignment and structure |
|---|
| >4ic3_A E3 ubiquitin-protein ligase XIAP; ring domain, zinc-finger, E3 ligase; 1.78A {Homo sapiens} PDB: 4ic2_A | Back alignment and structure |
|---|
| >2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A | Back alignment and structure |
|---|
| >3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A 4auq_B | Back alignment and structure |
|---|
| >4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C | Back alignment and structure |
|---|
| >1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A | Back alignment and structure |
|---|
| >1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A | Back alignment and structure |
|---|
| >2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* | Back alignment and structure |
|---|
| >2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} | Back alignment and structure |
|---|
| >2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A | Back alignment and structure |
|---|
| >2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A | Back alignment and structure |
|---|
| >1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} | Back alignment and structure |
|---|
| >1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A | Back alignment and structure |
|---|
| >2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B | Back alignment and structure |
|---|
| >1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens} | Back alignment and structure |
|---|
| >3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} | Back alignment and structure |
|---|
| >1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 | Back alignment and structure |
|---|
| >2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B | Back alignment and structure |
|---|
| >2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A | Back alignment and structure |
|---|
| >2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A | Back alignment and structure |
|---|
| >1wt6_A Myotonin-protein kinase; coiled-coil, kinase activation, DMPK, molecular replacement, transferase; 1.60A {Homo sapiens} | Back alignment and structure |
|---|
| >1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 | Back alignment and structure |
|---|
| >2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 | Back alignment and structure |
|---|
| >3na7_A HP0958; flagellar biogenesis, flagellum export, C4 Zn-ribbon, coiled post-transcriptional, gene regulation, chaperone; HET: EPE; 2.20A {Helicobacter pylori} | Back alignment and structure |
|---|
| >2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B | Back alignment and structure |
|---|
| >2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2 | Back alignment and structure |
|---|
| >3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C | Back alignment and structure |
|---|
| >4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* | Back alignment and structure |
|---|
| >3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 4f52_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A | Back alignment and structure |
|---|
| >2v71_A Nuclear distribution protein NUDE-like 1; developmental protein, nuclear protein, neurogenesis, cytosk LIS1 binding, differentiation; 2.24A {Rattus norvegicus} | Back alignment and structure |
|---|
| >4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} | Back alignment and structure |
|---|
| >2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3na7_A HP0958; flagellar biogenesis, flagellum export, C4 Zn-ribbon, coiled post-transcriptional, gene regulation, chaperone; HET: EPE; 2.20A {Helicobacter pylori} | Back alignment and structure |
|---|
| >1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} | Back alignment and structure |
|---|
| >3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} | Back alignment and structure |
|---|
| >3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus} | Back alignment and structure |
|---|
| >3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* | Back alignment and structure |
|---|
| >2efr_A General control protein GCN4 and tropomyosin 1 Al; destabilizing cluster, hydrophobic core, contractIle protein; 1.80A {Saccharomyces cerevisiae} PDB: 2efs_A 2d3e_A | Back alignment and structure |
|---|
| >3o0z_A RHO-associated protein kinase 1; coiled-coil, transferase; HET: MSE; 2.33A {Homo sapiens} | Back alignment and structure |
|---|
| >2ocy_A RAB guanine nucleotide exchange factor SEC2; RAB, GEF, guanine exchange factor, coiled-coil, endocytosis/exocytosis complex; 3.30A {Saccharomyces cerevisiae} SCOP: h.1.33.1 | Back alignment and structure |
|---|
| >2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* | Back alignment and structure |
|---|
| >2v71_A Nuclear distribution protein NUDE-like 1; developmental protein, nuclear protein, neurogenesis, cytosk LIS1 binding, differentiation; 2.24A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3nmd_A CGMP dependent protein kinase; leucine zipper, coiled-coil, structural genomics, berkeley S genomics center, BSGC, dimerization; HET: MSE; 2.27A {Homo sapiens} | Back alignment and structure |
|---|
| >3o0z_A RHO-associated protein kinase 1; coiled-coil, transferase; HET: MSE; 2.33A {Homo sapiens} | Back alignment and structure |
|---|
| >2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} | Back alignment and structure |
|---|
| >2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} | Back alignment and structure |
|---|
| >4gkw_A Spindle assembly abnormal protein 6; double helix, SAS-5, centriole, structural protein; 3.30A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >3s9g_A Protein hexim1; cyclin T-binding domain (TBD), cyclin T1/P-TEFB/7SK snRNA, N transcription; 2.10A {Homo sapiens} PDB: 2gd7_A | Back alignment and structure |
|---|
| >2ocy_A RAB guanine nucleotide exchange factor SEC2; RAB, GEF, guanine exchange factor, coiled-coil, endocytosis/exocytosis complex; 3.30A {Saccharomyces cerevisiae} SCOP: h.1.33.1 | Back alignment and structure |
|---|
| >3i00_A HIP-I, huntingtin-interacting protein 1; transcription; 2.30A {Homo sapiens} PDB: 2qa7_A | Back alignment and structure |
|---|
| >3s4r_A Vimentin; alpha-helix, cytoskeleton, intermediate filament, structural; 2.45A {Homo sapiens} PDB: 3ssu_A | Back alignment and structure |
|---|
| >3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A | Back alignment and structure |
|---|
| >4gkw_A Spindle assembly abnormal protein 6; double helix, SAS-5, centriole, structural protein; 3.30A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >2jee_A YIIU; FTSZ, septum, coiled-coil, cell division, cell cycle, hypothetical protein; 2.8A {Escherichia coli} | Back alignment and structure |
|---|
| >2v4h_A NF-kappa-B essential modulator; transcription, metal-binding, NEMO - IKK gamma - NFKB pathwa darpin, transcription regulation; 2.9A {Mus musculus} | Back alignment and structure |
|---|
| >3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >3u1c_A Tropomyosin alpha-1 chain; anti-parallel coiled coil, contractIle protein; 1.80A {Gallus gallus} PDB: 3u1a_A | Back alignment and structure |
|---|
| >4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3 | Back alignment and structure |
|---|
| >2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A* | Back alignment and structure |
|---|
| >4etp_B Spindle POLE BODY-associated protein VIK1; kinesin motor protein, kinesin motor homology domain, karyog mitosis, microtubules; HET: ADP EBC; 2.30A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2jee_A YIIU; FTSZ, septum, coiled-coil, cell division, cell cycle, hypothetical protein; 2.8A {Escherichia coli} | Back alignment and structure |
|---|
| >2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* | Back alignment and structure |
|---|
| >3hnw_A Uncharacterized protein; coiled-coil, structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 2.20A {Eubacterium eligens} | Back alignment and structure |
|---|
| >3s84_A Apolipoprotein A-IV; four helix bundle, transport protein; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3tnu_B Keratin, type II cytoskeletal 5; coiled-coil, structural support, cytosolic protein; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
| >4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 1102 | ||||
| d1goja_ | 354 | c.37.1.9 (A:) Kinesin {Neurospora crassa [TaxId: 5 | 3e-79 | |
| d1bg2a_ | 323 | c.37.1.9 (A:) Kinesin {Human (Homo sapiens) [TaxId | 6e-79 | |
| d2zfia1 | 349 | c.37.1.9 (A:4-352) Kinesin {Mouse (Mus musculus), | 4e-74 | |
| d1ry6a_ | 330 | c.37.1.9 (A:) Kinesin {Malaria parasite (Plasmodiu | 5e-72 | |
| d1x88a1 | 345 | c.37.1.9 (A:18-362) Kinesin {Human (Homo sapiens), | 1e-70 | |
| d1v8ka_ | 362 | c.37.1.9 (A:) Kinesin {Mouse (Mus musculus), kif2c | 4e-69 | |
| d1sdma_ | 364 | c.37.1.9 (A:) Kinesin heavy chain-like protein {Po | 1e-65 | |
| d1f9va_ | 342 | c.37.1.9 (A:) Kinesin motor Ncd (non-claret disjun | 8e-65 | |
| d2ncda_ | 368 | c.37.1.9 (A:) Kinesin motor Ncd (non-claret disjun | 2e-61 | |
| d1fbva4 | 79 | g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [Ta | 7e-10 | |
| d1bora_ | 56 | g.44.1.1 (A:) Acute promyelocytic leukaemia proto- | 6e-08 | |
| d1chca_ | 68 | g.44.1.1 (A:) Immediate early protein, IEEHV {Equi | 1e-06 | |
| d1rmda2 | 86 | g.44.1.1 (A:1-86) V(D)J recombination activating p | 6e-05 | |
| d1jm7a_ | 103 | g.44.1.1 (A:) brca1 RING domain {Human (Homo sapie | 2e-04 | |
| d1ur6b_ | 52 | g.44.1.1 (B:) Not-4 N-terminal RING finger domain | 4e-04 | |
| d1iyma_ | 55 | g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sati | 0.002 | |
| d1vyxa_ | 60 | g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal do | 0.003 | |
| d1g25a_ | 65 | g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapi | 0.003 |
| >d1goja_ c.37.1.9 (A:) Kinesin {Neurospora crassa [TaxId: 5141]} Length = 354 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: P-loop containing nucleoside triphosphate hydrolases superfamily: P-loop containing nucleoside triphosphate hydrolases family: Motor proteins domain: Kinesin species: Neurospora crassa [TaxId: 5141]
Score = 261 bits (668), Expect = 3e-79
Identities = 137/358 (38%), Positives = 193/358 (53%), Gaps = 14/358 (3%)
Query: 98 SGDSISVTIRFRPLSEREFQRGDEIAWYADG-DKIVRNEYNPATAYAFDRVFGPHANSQE 156
S +SI V RFRP + E + G + G D + ++ FDRVF +
Sbjct: 3 SANSIKVVARFRPQNRVEIESGGQPIVTFQGPDTCTVDSKEAQGSFTFDRVFDMSCKQSD 62
Query: 157 VYDVAARPVVKAAMEGVNGTVFAYGVTSSGKTHTMH----GDQNSPGIIPLAIKDVF-SI 211
++D + +P V + G NGTVFAYG T +GK++TM D + G+IP ++ +F SI
Sbjct: 63 IFDFSIKPTVDDILNGYNGTVFAYGQTGAGKSYTMMGTSIDDPDGRGVIPRIVEQIFTSI 122
Query: 212 IQDTPGREFLLRVSYLEIYNEVINDLLDPTGQNLRVREDA-QGTYVEGIKEEVVLSPGHA 270
+ E+ +RVSY+EIY E I DLL P NL V E+ +G YV+G+ E V S
Sbjct: 123 LSSAANIEYTVRVSYMEIYMERIRDLLAPQNDNLPVHEEKNRGVYVKGLLEIYVSSVQEV 182
Query: 271 LSFIAAGEEHRHVGSNNFNLLSSRSHTIFTLMIESSDHGDEYDGVIFSQLNLIDLAGSE- 329
+ G R V + N N SSRSH+IF + I + QL L+DLAGSE
Sbjct: 183 YEVMRRGGNARAVAATNMNQESSRSHSIFVITITQKNVET--GSAKSGQLFLVDLAGSEK 240
Query: 330 SSKTETTGLRRKEGSYINKSLLTLGTVIGKLSEGKASHVPYRDSKLTRLLQSSLSGHGHV 389
KT +G +E INKSL LG VI L++GK+SHVPYRDSKLTR+LQ SL G+
Sbjct: 241 VGKTGASGQTLEEAKKINKSLSALGMVINALTDGKSSHVPYRDSKLTRILQESLGGNSRT 300
Query: 390 SLICTVTPASSSMEETHNTLKFASRAKRVEIYASRNKIIDEKSLIKKYQREISSLKEE 447
+LI +P+S + ET +TL+F RAK ++ A N + L ++ ++ K +
Sbjct: 301 TLIINCSPSSYNDAETLSTLRFGMRAKSIKNKAKVNAELSPAEL----KQMLAKAKTQ 354
|
| >d1bg2a_ c.37.1.9 (A:) Kinesin {Human (Homo sapiens) [TaxId: 9606]} Length = 323 | Back information, alignment and structure |
|---|
| >d2zfia1 c.37.1.9 (A:4-352) Kinesin {Mouse (Mus musculus), kif1a [TaxId: 10090]} Length = 349 | Back information, alignment and structure |
|---|
| >d1ry6a_ c.37.1.9 (A:) Kinesin {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Length = 330 | Back information, alignment and structure |
|---|
| >d1x88a1 c.37.1.9 (A:18-362) Kinesin {Human (Homo sapiens), mitotic kinesin eg5 [TaxId: 9606]} Length = 345 | Back information, alignment and structure |
|---|
| >d1v8ka_ c.37.1.9 (A:) Kinesin {Mouse (Mus musculus), kif2c [TaxId: 10090]} Length = 362 | Back information, alignment and structure |
|---|
| >d1sdma_ c.37.1.9 (A:) Kinesin heavy chain-like protein {Potato (Solanum tuberosum) [TaxId: 4113]} Length = 364 | Back information, alignment and structure |
|---|
| >d1f9va_ c.37.1.9 (A:) Kinesin motor Ncd (non-claret disjunctional) {Baker's yeast (Saccharomyces cerevisiae), Kar [TaxId: 4932]} Length = 342 | Back information, alignment and structure |
|---|
| >d2ncda_ c.37.1.9 (A:) Kinesin motor Ncd (non-claret disjunctional) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 368 | Back information, alignment and structure |
|---|
| >d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Length = 79 | Back information, alignment and structure |
|---|
| >d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Length = 56 | Back information, alignment and structure |
|---|
| >d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Length = 68 | Back information, alignment and structure |
|---|
| >d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 | Back information, alignment and structure |
|---|
| >d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Length = 103 | Back information, alignment and structure |
|---|
| >d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Length = 52 | Back information, alignment and structure |
|---|
| >d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Length = 55 | Back information, alignment and structure |
|---|
| >d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Length = 60 | Back information, alignment and structure |
|---|
| >d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 65 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 1102 | |||
| d1sdma_ | 364 | Kinesin heavy chain-like protein {Potato (Solanum | 100.0 | |
| d1goja_ | 354 | Kinesin {Neurospora crassa [TaxId: 5141]} | 100.0 | |
| d1v8ka_ | 362 | Kinesin {Mouse (Mus musculus), kif2c [TaxId: 10090 | 100.0 | |
| d2zfia1 | 349 | Kinesin {Mouse (Mus musculus), kif1a [TaxId: 10090 | 100.0 | |
| d1x88a1 | 345 | Kinesin {Human (Homo sapiens), mitotic kinesin eg5 | 100.0 | |
| d1bg2a_ | 323 | Kinesin {Human (Homo sapiens) [TaxId: 9606]} | 100.0 | |
| d2ncda_ | 368 | Kinesin motor Ncd (non-claret disjunctional) {Frui | 100.0 | |
| d1f9va_ | 342 | Kinesin motor Ncd (non-claret disjunctional) {Bake | 100.0 | |
| d1ry6a_ | 330 | Kinesin {Malaria parasite (Plasmodium falciparum) | 100.0 | |
| d1fbva4 | 79 | CBL {Human (Homo sapiens) [TaxId: 9606]} | 98.38 | |
| d1bora_ | 56 | Acute promyelocytic leukaemia proto-oncoprotein PM | 98.23 | |
| d1chca_ | 68 | Immediate early protein, IEEHV {Equine herpesvirus | 98.19 | |
| d1rmda2 | 86 | V(D)J recombination activating protein 1 (RAG1), d | 98.05 | |
| d1jm7a_ | 103 | brca1 RING domain {Human (Homo sapiens) [TaxId: 96 | 98.03 | |
| d1g25a_ | 65 | TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9 | 97.86 | |
| d1jm7b_ | 97 | bard1 RING domain {Human (Homo sapiens) [TaxId: 96 | 97.78 | |
| d1iyma_ | 55 | EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 | 97.77 | |
| d1ur6b_ | 52 | Not-4 N-terminal RING finger domain {Human (Homo s | 97.73 | |
| d2baya1 | 56 | Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac | 97.52 | |
| d2c2la2 | 80 | STIP1 homology and U box-containing protein 1, STU | 97.49 | |
| d1v87a_ | 114 | Deltex protein 2 RING-H2 domain {Mouse (Mus muscul | 97.3 | |
| d1t1ha_ | 78 | E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi | 97.26 | |
| d3dplr1 | 88 | RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase | 97.07 | |
| d1wgma_ | 98 | Ubiquitin conjugation factor E4A {Human (Homo sapi | 96.9 | |
| d1vyxa_ | 60 | IE1B protein (ORF K3), N-terminal domain {Kaposi's | 96.66 | |
| d1wima_ | 94 | UbcM4-interacting protein 4 (KIAA0161) {Human (Hom | 95.28 | |
| d1l8qa2 | 213 | Chromosomal replication initiation factor DnaA {Aq | 93.31 | |
| d1w5sa2 | 287 | CDC6-like protein APE0152, N-terminal domain {Aero | 90.47 | |
| d1r7ra3 | 265 | Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu | 89.89 | |
| d1gvnb_ | 273 | Plasmid maintenance system epsilon/zeta, toxin zet | 83.42 | |
| d1fnna2 | 276 | CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T | 81.25 |
| >d1sdma_ c.37.1.9 (A:) Kinesin heavy chain-like protein {Potato (Solanum tuberosum) [TaxId: 4113]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: P-loop containing nucleoside triphosphate hydrolases superfamily: P-loop containing nucleoside triphosphate hydrolases family: Motor proteins domain: Kinesin heavy chain-like protein species: Potato (Solanum tuberosum) [TaxId: 4113]
Probab=100.00 E-value=3.6e-79 Score=701.05 Aligned_cols=342 Identities=34% Similarity=0.532 Sum_probs=294.2
Q ss_pred CEEEEEEeCCCChhhhhcCCeEE-EeeCCCEEEe-cCCCCCcceeeceecCCCCChhHHHhhhhHHHHHHHhcCCceeEE
Q 001316 101 SISVTIRFRPLSEREFQRGDEIA-WYADGDKIVR-NEYNPATAYAFDRVFGPHANSQEVYDVAARPVVKAAMEGVNGTVF 178 (1102)
Q Consensus 101 ~I~V~vRvRP~~~~E~~~~~~~~-~~~~~~~~~~-~~~~~~~~f~FD~VF~~~~~q~~Vy~~~~~plV~~~l~G~N~tIf 178 (1102)
.|+|+|||||+.+.|...+...+ ...++.++.. ......+.|.||+||+++++|++||+.+ .|+|+++++|||+|||
T Consensus 1 rIkV~vRvRP~~~~E~~~~~~~~v~~~~~~~~~~~~~~~~~~~f~FD~vf~~~~~q~~vy~~v-~~lv~~~l~G~n~~i~ 79 (364)
T d1sdma_ 1 KIRVYCRLRPLCEKEIIAKERNAIRSVDEFTVEHLWKDDKAKQHMYDRVFDGNATQDDVFEDT-KYLVQSAVDGYNVCIF 79 (364)
T ss_dssp CCEEEEEECCCCHHHHHTTCCBCEEECSTTEEEEECSSSSEEEEECSEEECTTCCHHHHHHTT-THHHHHHHTTCEEEEE
T ss_pred CeEEEEEcCCCChhhcccCCCCeEEeCCCCeEEecCCCCCceEEECCeecCCCCCHHHHHHHH-HHHHHHHhcCCceeee
Confidence 48999999999999987665443 3455555443 3444567899999999999999999975 7999999999999999
Q ss_pred eeccCCCCCccccCCCCCCCCchhhHHHHHHHHhhcCC-CceeEEEeehhhhhcceeeecCCCCC---CcceEEeCC-CC
Q 001316 179 AYGVTSSGKTHTMHGDQNSPGIIPLAIKDVFSIIQDTP-GREFLLRVSYLEIYNEVINDLLDPTG---QNLRVREDA-QG 253 (1102)
Q Consensus 179 aYGqTgSGKT~Tm~G~~~~~GIipr~~~~LF~~i~~~~-~~~~~v~vS~lEIYnE~i~DLL~~~~---~~l~ire~~-~g 253 (1102)
|||||||||||||+|+..++|||||++.+||..+.... ...|.|++||+|||||.|||||.|.. ..+.+++++ .|
T Consensus 80 aYGqTGSGKTyTm~G~~~~~Giipr~~~~lf~~i~~~~~~~~~~v~~S~~EIyne~i~DLL~~~~~~~~~l~~~~~~~~~ 159 (364)
T d1sdma_ 80 AYGQTGSGKTFTIYGADSNPGLTPRAMSELFRIMKKDSNKFSFSLKAYMVELYQDTLVDLLLPKQAKRLKLDIKKDSKGM 159 (364)
T ss_dssp EECSTTSSHHHHHTBCSSSBCHHHHHHHHHHHHHHHGGGTEEEEEEEEEEEESSSCEEETTSCTTSCCCCCEEEECTTSC
T ss_pred ccccCCCCcccccccCccccchhHHHHHHHHhhhhhccccccceEEEEEEEEeccccccccCcccccccccceeecccCc
Confidence 99999999999999999999999999999999997654 46899999999999999999998754 467899998 67
Q ss_pred cEeeCceEEEeCChHHHHHHHHHHhhhcccCCCccccCCCCceeEEEEEEEEecCCCCCCcEEEEEEEEeecCCCCC-cc
Q 001316 254 TYVEGIKEEVVLSPGHALSFIAAGEEHRHVGSNNFNLLSSRSHTIFTLMIESSDHGDEYDGVIFSQLNLIDLAGSES-SK 332 (1102)
Q Consensus 254 ~~v~gl~e~~V~s~~e~~~ll~~g~~~R~~~~t~~N~~SSRSH~If~i~v~~~~~~~~~~~~~~skL~lVDLAGSEr-~k 332 (1102)
++|.|++++.|.++++++.+|..|..+|.+++|.+|..|||||+||+|.|.+...+. .....++|+||||||||| .+
T Consensus 160 ~~v~~l~~~~v~s~~~~~~~l~~g~~~R~~~~t~~n~~ssRsH~i~~i~v~~~~~~~--~~~~~~kl~~vDLAGsEr~~~ 237 (364)
T d1sdma_ 160 VSVENVTVVSISTYEELKTIIQRGSEQRHTTGTLMNEQSSRSHLIVSVIIESTNLQT--QAIARGKLSFVDLAGSERVKK 237 (364)
T ss_dssp EEEETCCCEEECSHHHHHHHHHHHHHHHCCCSSCTTCHHHHSEEEEEEEEEEEETTT--CCEEEEEEEEEECCCCSCCCC
T ss_pred cccccceeeeeCCHHHHHHHhhccceeeccccccccccccccceEEEEEEEEeccCc--ceeeeEEEEeechhhcccccc
Confidence 899999999999999999999999999999999999999999999999999876543 456789999999999999 56
Q ss_pred cccchhhhhhhHHHhhhHHHHHHHHHHhhcCCCCCccCCCCcchhhhhccCCCCccceEEEeeCCCCCCHHHHHHHHHHH
Q 001316 333 TETTGLRRKEGSYINKSLLTLGTVIGKLSEGKASHVPYRDSKLTRLLQSSLSGHGHVSLICTVTPASSSMEETHNTLKFA 412 (1102)
Q Consensus 333 t~~~g~r~kE~~~INkSL~aLg~vI~aL~~~k~~hvPYRdSkLTrLLqdsLgGnskt~~I~~isP~~~~~~ETlsTLrfA 412 (1102)
+++.|.+++|+.+||+||++||+||.+|+++. .||||||||||+||+|+|||||+|+|||||||+..+++||++||+||
T Consensus 238 ~~~~g~~~~E~~~iN~SL~~L~~vi~aL~~~~-~~ipyR~SkLT~lL~d~Lggns~t~~I~~isp~~~~~~eTl~TL~fa 316 (364)
T d1sdma_ 238 SGSAGNQLKEAQSINKSLSALGDVISALSSGN-QHIPYRNHKLTMLMSDSLGGNAKTLMFVNISPAESNLDETHNSLTYA 316 (364)
T ss_dssp ---------CCCTTCHHHHHHHHHHHHHHHTC-SCCCGGGCHHHHHTTTTTTSSSEEEEEEEECCBGGGHHHHHHHHHHH
T ss_pred ccccCceeeeccccccchhhHHHHHHHHHcCC-CcCCchhhhhhHHHHhhcCCCceEEEEEEeCCCcchHHHHHHHHHHH
Confidence 88999999999999999999999999999865 59999999999999999999999999999999999999999999999
Q ss_pred HHhcccccccccccccCHHHHHHHHHHHHHHHHHHHH
Q 001316 413 SRAKRVEIYASRNKIIDEKSLIKKYQREISSLKEELD 449 (1102)
Q Consensus 413 ~rak~I~~~~~~n~~~~~~~~i~~~~~ei~~Lk~el~ 449 (1102)
+|||+|+|.|.+|+..+ .+.+|+++|..|++++.
T Consensus 317 ~~ak~i~n~p~~n~~~~---~~~~l~~~i~~l~~~~~ 350 (364)
T d1sdma_ 317 SRVRSIVNDPSKNVSSK---EVARLKKLVSYWKEQAG 350 (364)
T ss_dssp HHHTTCCCCCCCCEECH---HHHHHHTTTTCC-----
T ss_pred HHHhhcccCCcccCCHH---HHHHHHHHHHHHHHHHH
Confidence 99999999999997542 35667777777776654
|
| >d1goja_ c.37.1.9 (A:) Kinesin {Neurospora crassa [TaxId: 5141]} | Back information, alignment and structure |
|---|
| >d1v8ka_ c.37.1.9 (A:) Kinesin {Mouse (Mus musculus), kif2c [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2zfia1 c.37.1.9 (A:4-352) Kinesin {Mouse (Mus musculus), kif1a [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1x88a1 c.37.1.9 (A:18-362) Kinesin {Human (Homo sapiens), mitotic kinesin eg5 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bg2a_ c.37.1.9 (A:) Kinesin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ncda_ c.37.1.9 (A:) Kinesin motor Ncd (non-claret disjunctional) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1f9va_ c.37.1.9 (A:) Kinesin motor Ncd (non-claret disjunctional) {Baker's yeast (Saccharomyces cerevisiae), Kar [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1ry6a_ c.37.1.9 (A:) Kinesin {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} | Back information, alignment and structure |
|---|
| >d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} | Back information, alignment and structure |
|---|
| >d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} | Back information, alignment and structure |
|---|
| >d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} | Back information, alignment and structure |
|---|