Citrus Sinensis ID: 001321


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------1000------1010------1020------1030------1040------1050------1060------1070------1080------1090------1100
MFAKRLLQKAKHNSQHGSLTAADLNLRIAVHYGIPATASILAFDHIQRLLAIATLDGRIKVIGGDGIEGLLISPSQLPYKNLEFLQNQGFLISITNDNEIQVWSLESRSLACCLKWESNITAFSVISGSHFMYIGDENGLMSVIKYDADEGKLFQLPYNISADALSEKAGFPLLSHQPVVGVLPHPNSSGNRVLIAYENALVILWDVSEAQIIFVGGGKDLQLKDGVVDSPSEGDSTFLEGISEHQPEEKEISALCWASSSGSILAVGYIDGDILLWNTSTTASTKGQQTGSRNNVVKLELSSAERRLPVIVLHWSTNKESRSNIDGRLFVYGGDEIGSEEVLTVLSLEWSSGMENLRCVSRVDITLTGSFADMILLSSAGATVGNHKADLFVLTSPGQLHFYDNASLTTLLSQQEKKPSVCPVEFPGVIPISDPIMTVAEFMLLPFGGHSSKGLSEIATFTKLHSSHTQAGHIKWPLSGGVPSPVPITKCHSVDRVYLAGYHDGSVRIWDATYPVFKLICALDAEVQGIEVAGSRAPVSTLSFCFINSSLAVGNEFGLVYIYNLNGSLDAKNFLFVLETKSEVHALPEGKISLCRAVFSLVNSPVRALQFTSSGAKLAVGFECGRVAVLDMNLLSVLFFTDDISGSSSPIISMTWTEFKNTHSLAKNPNHSEREVPVNPAEEVIIVLFKDAKISIVGGSSENMISSSPWHLKKKVIAISMEVIEPVCGFPIEKQAEQSAEENAAKNKPTPDTSSIETKSHETEHLFSSENACSGESSNDALVLLCCEDSVRLYSRKSVIQKVKHKNRCCWASTIEKDEKVCGLLLLFQTGAVQIRSLPDLELVMESSLMSILRWNFKANMDKTISADNGQITLANGSEVAFVNLLAGENEFSILESSPCLHDKVLEAAAAAAFNVSSNQKKKQTTAAGILGGIVKGFRGEKMIHTLDDSIDPKSSFSQLGGIFSRPPFPDLSPAATNNEEIELNIDDIEIDEPPSMMATSSHEVTNTKKEKLSERERLLGVPDDAKPRLRTREEIIAKYRKAEDASSVAAHARDKLFERQDKLERISRCTEELQSGAEDFASLANELVKTMENRKWWKI
cccccccccccccccccccccccccEEEEEEEccccccEEEEEcccccEEEEEEcccEEEEEccccEEEEEEccccccEEEEEEEccccEEEEEEccccEEEEEcccccEEEEEcccccEEEEEEcccccEEEEEEccccEEEEEEcccccEEEEEEcccccccccccccccccccccEEEEEEcccccccEEEEEEcccEEEEEEccccEEEEEcccccccccccccccccccccccccccccccccccEEEEEEEEcccccEEEEEEEcccEEEEEcccccccccccccccccccccccccccccccEEEEEEEEcccccccccccEEEEccccccccccEEEEEEEccccccccEEEEccccccccccEEEEEEcccccccccccccEEEEcccccEEEEccccEEEEEcccccccccccccccccccccccccccEEEEEcccccccccccHHHHHHcccccccccccccccccccccccccccccccccccEEEEEEccccEEEEccccccEEEEEccccccccEEcccccccEEEEEEEccccEEEEEEcccEEEEEEEccccccccEEEEEccccEEccccccccccEEEEEEcccccEEEEEEcccccEEEEEEcccEEEEEEccccEEEEEEEccccccccEEEEEEcEEccccccccccccccccccccccccEEEEEEcccEEEEEEcccccEEEcccccccccEEEEEEEEEcccccccccHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccEEEEEEccEEEEEEcccHHHccccccccEEEEEEEcccccEEEEEEEEcccEEEEccccccHHHHccccEEEEccccccccEEEEcccccEEEEcccEEEEEEEEcccccEEEccccccccccccHHHHHccccccccccccccccccccccEEEcccccccccccccccccccccccccccccccccccccccccccHHHHcccccccccccccccccccccccccccccHHHHHHccccccccccccccHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHccccccccc
cHHHHHHcccccccHHccccHHHccHHHHEHccccccccEEcccHHHEEEEEEccccEEEEEcccccEEEEEccccccEEEEEEEccccEEEEEEcccEEEEEEEcccccEEEEEcccEEEEEEEcccccEEEEEcccccEEEEEEccEEccccEEEccHEHHcccHHcccccccccccEEEccccccccccEEEEEcccEEEEEEccccEEEEEEcccccccccccccccHHcccccHHHHHHHccccccEEEEEEEcccccEEEEEEccccEEEEEcccccccccccccccccccccccccccccccEEEEEEEEccccccccccccEEccccccccccEEEEEEcccEEEEEEEccEEEEEEEccccEEEEEEEccccccccccccEEEEEEccccEEEEEcccHHHHHHccccccccccccccccccccccccEHHHHEEccccccccccHHHHHHHHHccccccccccccccccccccccccccccccccEEEEEEcccccEEEEccccHcHHHHEEEcccccccccccccccEEEEEEcccccEEEEEccccEEEEEEEcccccccEEEEEEcccccccccccccccccEEEEEcccccccEEEEccccEEccccccccEEEEEEccccEEEEEEEEccccccccEEcccEEcccccccccccccccccccccccccEEEEEccccEEEEEEccccccccccccccccccEEEEEEEEcccccccccccccccccccccccccccccEEEEccccccccccccccccccccccccEEEEEcHHHEEEEcHHHHHHccccccccEEEEEEEccccEEEEEEEEEccEEEEEccccHHHHHHHcHHHHHcccccccccEEEEccccEEEEEcccEEEEEEEEcccccccccccccccccHHHHHHHHHHccccccHHHccccccccccHEEcccccccccccccccccccccHHHHHHHHccccccccccccccccccEEccccccccccccccccccccccccccccccHHHHccccccccccccccHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHccccccc
MFAKRLLQKakhnsqhgsltaaDLNLRIAVHYGIPATASILAFDHIQRLLAIATLDGrikviggdgiegllispsqlpyknleFLQNQGFLISITNDNEIQVWSLESRSLACCLKWESNITAFSvisgshfmyigdenGLMSVIKYdadegklfqlpynisadalsekagfpllshqpvvgvlphpnssgnrVLIAYENALVILWDVSEAQIIFvgggkdlqlkdgvvdspsegdstflegisehqpeeKEISALCWasssgsilavgyidgdillwntsttastkgqqtgsrnnVVKLELSSAERRLPVIVLHWstnkesrsnidgrlfvyggdeigsEEVLTVLSLEwssgmenlrcvsrvditltgSFADMILLSsagatvgnhkadlfvltspgqlhfydnaslTTLLsqqekkpsvcpvefpgvipisdpimTVAEFmllpfgghsskglsEIATFTKLhsshtqaghikwplsggvpspvpitkchsvdrvylagyhdgsvriwdaTYPVFKLICALDAEVqgievagsrapvstlsfcfinsslavgneFGLVYIYNLNGSLDAKNFLFVLETksevhalpegkISLCRAVFSLvnspvralqftssgaklavgfECGRVAVLDMNLLSVLFFtddisgssspiismtwtefknthslaknpnhserevpvnpaEEVIIVLFKDakisivggssenmissspwhLKKKVIAISMEViepvcgfpiekQAEQSAEEnaaknkptpdtssietkshetehlfssenacsgessnDALVLLCCEdsvrlysrKSVIQKVKhknrccwastieKDEKVCGLLLLFQTgavqirslpdLELVMESSLMSILRWNFKAnmdktisadngqitlanGSEVAFVNLLAGenefsilesspclhDKVLEAAAAAAFnvssnqkkkqttaagilggivkgfrgekmihtlddsidpkssfsqlggifsrppfpdlspaatnneeielniddieideppsmmatsshevtntkkekLSERErllgvpddakprlRTREEIIAKYRkaedassvaAHARDKLFERQDKLERISRCTEELQSGAEDFASLANELVKTMENRKWWKI
MFAKRLLqkakhnsqhgslTAADLNLRIAVHYGIPATASILAFDHIQRLLAIATLDGRIKVIGGDGIEGLLISPSQLPYKNLEFLQNQGFLISITNDNEIQVWSLESRSLACCLKWESNITAFSVISGSHFMYIGDENGLMSVIKYDADEGKLFQLPYNISADALSEKAGFPLLSHQPVVGVLPHPNSSGNRVLIAYENALVILWDVSEAQIIFVGGGKDLQLKDGVVDSPSEGDSTFLEGISEHQPEEKEISALCWASSSGSILAVGYIDGDILLWNTSTtastkgqqtgsrnnVVKLelssaerrlpVIVLhwstnkesrsnidGRLFVYGGDEIGSEEVLTVLSLEWSSGMENLRCVSRVDITLTGSFADMILLSSAGATVGNHKADLFVLTSPGQLHFYDNASLTTLLSQQEKKPSVCPVEFPGVIPISDPIMTVAEFMLLPFGGHSSKGLSEIATFTKLHSSHTQAGHIKWPLSGGVPSPVPITKCHSVDRVYLAGYHDGSVRIWDATYPVFKLICALDAEVQGIEVAGSRAPVSTLSFCFINSSLAVGNEFGLVYIYNLNGSLDAKNFLFVLETKSEVHALPEGKISLCRAVFSLVNSPVRALQFTSSGAKLAVGFECGRVAVLDMNLLSVLFFTDDISGSSSPIISMTWTEFKNTHSLAKnpnhserevpvNPAEEVIIVLFKDAKISIVGgssenmissspwHLKKKVIAISMEVIEPVCGFPIEKQAEQSAeenaaknkptpdtssieTKSHETEHLFSSENACSGESSNDALVLLCCEDSVRLysrksviqkvkhknrccWASTIEKDEKVCGLLLLFQTGAVQIRSLPDLELVMESSLMSILRWNFKANMDKTISADNGQITLANGSEVAFVNLLAGENEFSILESSPCLHDKVLEAAAAAAfnvssnqkkkqttaagilGGIVKGFRGEKMIHTLDDSIDPKSSFSQLGGIFSRPPFPDLSPAATNNEEIELNIDDIEIDEPPSMMatsshevtntkkeklsererllgvpddakprlrtREEIIAkyrkaedassvaahardklferqdkLERISRCTEELQSGAEDFASLANELVktmenrkwwki
MFAKRLLQKAKHNSQHGSLTAADLNLRIAVHYGIPATASILAFDHIQRLLAIATLDGRIKVIGGDGIEGLLISPSQLPYKNLEFLQNQGFLISITNDNEIQVWSLESRSLACCLKWESNITAFSVISGSHFMYIGDENGLMSVIKYDADEGKLFQLPYNISADALSEKAGFPLLSHQPVVGVLPHPNSSGNRVLIAYENALVILWDVSEAQIIFVGGGKDLQLKDGVVDSPSEGDSTFLEGISEHQPEEKEISALCWASSSGSILAVGYIDGDILLWNTSTTASTKGQQTGSRNNVVKLELSSAERRLPVIVLHWSTNKESRSNIDGRLFVYGGDEIGSEEVLTVLSLEWSSGMENLRCVSRVDITLTGSFADMILLSSAGATVGNHKADLFVLTSPGQLHFYDNASLTTLLSQQEKKPSVCPVEFPGVIPISDPIMTVAEFMLLPFGGHSSKGLSEIATFTKLHSSHTQAGHIKWPLSGGVPSPVPITKCHSVDRVYLAGYHDGSVRIWDATYPVFKLICALDAEVQGIEVAGSRAPVSTLSFCFINSSLAVGNEFGLVYIYNLNGSLDAKNFLFVLETKSEVHALPEGKISLCRAVFSLVNSPVRALQFTSSGAKLAVGFECGRVAVLDMNLLSVLFFTDDisgssspiisMTWTEFKNTHSLAKNPNHSEREVPVNPAEEVIIVLFKDAKISIVGGSSENMISSSPWHLKKKVIAISMEVIEPVCGFPIEKQAEQSAEENAAKNKPTPDTSSIETKSHETEHLFSSENACSGESSNDALVLLCCEDSVRLYSRKSVIQKVKHKNRCCWASTIEKDEKVCGLLLLFQTGAVQIRSLPDLELVMESSLMSILRWNFKANMDKTISADNGQITLANGSEVAFVNLLAGENEFSILESSPCLHDKVLEaaaaaaFNVSSNQKKKQTTAAGILGGIVKGFRGEKMIHTLDDSIDPKSSFSQLGGIFSRPPFPDLSPAATnneeielniddieidePPSMMATSSHEVTNTKKEKLSERERLLGVPDDAKPRLRTREEIIAKYRKAEDASSVAAHARDKLFERQDKLERISRCTEELQSGAEDFASLANELVKTMENRKWWKI
*******************TAADLNLRIAVHYGIPATASILAFDHIQRLLAIATLDGRIKVIGGDGIEGLLISPSQLPYKNLEFLQNQGFLISITNDNEIQVWSLESRSLACCLKWESNITAFSVISGSHFMYIGDENGLMSVIKYDADEGKLFQLPYNISADALSEKAGFPLLSHQPVVGVLPHPNSSGNRVLIAYENALVILWDVSEAQIIFVGGGKDLQLKD**************************ISALCWASSSGSILAVGYIDGDILLWNTS***********************AERRLPVIVLHWSTNKESRSNIDGRLFVYGGDEIGSEEVLTVLSLEWSSGMENLRCVSRVDITLTGSFADMILLSSAGATVGNHKADLFVLTSPGQLHFYDNASLTTLLSQQEKKPSVCPVEFPGVIPISDPIMTVAEFMLLPFGGHSSKGLSEIATFTKLHSSHTQAGHIKWPLSGGVPSPVPITKCHSVDRVYLAGYHDGSVRIWDATYPVFKLICALDAEVQGIEVAGSRAPVSTLSFCFINSSLAVGNEFGLVYIYNLNGSLDAKNFLFVLETKSEVHALPEGKISLCRAVFSLVNSPVRALQFTSSGAKLAVGFECGRVAVLDMNLLSVLFFTDDISGSSSPIISMTWTEFK********************AEEVIIVLFKDAKISIVGGSSENMISSSPWHLKKKVIAISMEVIEPVCGFPI************************************************ALVLLCCEDSVRLYSRKSVIQKVKHKNRCCWASTIEKDEKVCGLLLLFQTGAVQIRSLPDLELVMESSLMSILRWNFKANMDKTISADNGQITLANGSEVAFVNLLAGENEFSILESSPCLHDKVLEAAAAAAFNV*********TAAGILGGIVKGFRGEKMIHTL*********************************************************************************************************************************************************
***********************LNLRIAVHYGIPATASILAFDHIQRLLAIATLDGRIKVIGGDGIEGLLISPSQLPYKNLEFLQNQGFLISITNDNEIQVWSLESRSLACCLKWESNITAFSVISGSHFMYIGDENGLMSVIKYDADEGKLFQLPYNISADALSEKAGFPLLSHQPVVGVLPHPNSSGNRVLIAYENALVILWDVSEAQIIFVGGGKDLQLKDGVVDSPSEGDSTFLEGISEHQPEEKEISALCWASSSGSILAVGYIDGDILLWNTSTT********************SAERRLPVIVLHWSTNKESRSNIDGRLFVYGGDEIGSEEVLTVLSLEWSSGMENLRCVSRVDITLTGSFADMILLSSAGATVGNHKADLFVLTSPGQLHFYDNASLTTLLSQQEKKPSVCPVEFPGVIPISDPIMTVAEFMLLPFGGHSSKGLSEIATFTKLHSSHTQAGHIKWPLSGGVPSPVPITKCHSVDRVYLAGYHDGSVRIWDATYPVFKLICALDAEVQGIEVAGSRAPVSTLSFCFINSSLAVGNEFGLVYIYNLNGSLDA*************HALPEGKISLCRAVFSLVNSPVRALQFTSSGAKLAVGFECGRVAVLDMNLLSVLFFTDDISGSSSPIISMTWTE********************NPAEEVIIVLFKDAKISIVGGSSENMISSSPWH*KKKVIAISMEVIEPVC******************************************************VLLCCEDSVRLYSRKSVIQKVKHKNRCCWASTIEKDEKVCGLLLLFQTGAVQIRSLPDLELVMESSLM*********************ITLANGSEVAFVNLLAGENEFSILESSPCLHDKVL**********************************************************************************I*****************************************************************************************************TMENRKWWKI
****************GSLTAADLNLRIAVHYGIPATASILAFDHIQRLLAIATLDGRIKVIGGDGIEGLLISPSQLPYKNLEFLQNQGFLISITNDNEIQVWSLESRSLACCLKWESNITAFSVISGSHFMYIGDENGLMSVIKYDADEGKLFQLPYNISADALSEKAGFPLLSHQPVVGVLPHPNSSGNRVLIAYENALVILWDVSEAQIIFVGGGKDLQLKDGVVDSPSEGDSTFLEGISEHQPEEKEISALCWASSSGSILAVGYIDGDILLWNTSTT**********RNNVVKLELSSAERRLPVIVLHWSTNKESRSNIDGRLFVYGGDEIGSEEVLTVLSLEWSSGMENLRCVSRVDITLTGSFADMILLSSAGATVGNHKADLFVLTSPGQLHFYDNASLTTL*********VCPVEFPGVIPISDPIMTVAEFMLLPFGGHSSKGLSEIATFTKLHSSHTQAGHIKWPLSGGVPSPVPITKCHSVDRVYLAGYHDGSVRIWDATYPVFKLICALDAEVQGIEVAGSRAPVSTLSFCFINSSLAVGNEFGLVYIYNLNGSLDAKNFLFVLETKSEVHALPEGKISLCRAVFSLVNSPVRALQFTSSGAKLAVGFECGRVAVLDMNLLSVLFFTDDISGSSSPIISMTWTEFKNTHSLAKNPNHSEREVPVNPAEEVIIVLFKDAKISIVGGSSENMISSSPWHLKKKVIAISMEVIEPVCGFPIEKQ*****************************************SSNDALVLLCCEDSVRLYSRKSVIQKVKHKNRCCWASTIEKDEKVCGLLLLFQTGAVQIRSLPDLELVMESSLMSILRWNFKANMDKTISADNGQITLANGSEVAFVNLLAGENEFSILESSPCLHDKVLEAAAAAAFN**********TAAGILGGIVKGFRGEKMIHTLDDSIDPKSSFSQLGGIFSRPPFPDLSPAATNNEEIELNIDDIEIDEPPSMM****************ERERLLGVPDDAKPRLRTREEIIAKY***********HARDKLFERQDKLERISRCTEELQSGAEDFASLANELVKTMENRKWWKI
MFA*RLL****HNS*HGSLTAADLNLRIAVHYGIPATASILAFDHIQRLLAIATLDGRIKVIGGDGIEGLLISPSQLPYKNLEFLQNQGFLISITNDNEIQVWSLESRSLACCLKWESNITAFSVISGSHFMYIGDENGLMSVIKYDADEGKLFQLPYNISADALSEKAGFPLLSHQPVVGVLPHPNSSGNRVLIAYENALVILWDVSEAQIIFVGGGKDLQLKDGVVDSPSEGDSTFLEGISEHQPEEKEISALCWASSSGSILAVGYIDGDILLWNTSTTASTKGQQTGSRNNVVKLELSSAERRLPVIVLHWSTNKESRSNIDGRLFVYGGDEIGSEEVLTVLSLEWSSGMENLRCVSRVDITLTGSFADMILLSSAGATVGNHKADLFVLTSPGQLHFYDNASLTTLLSQQEKKPSVCPVEFPGVIPISDPIMTVAEFMLLPFGGHSSKGLSEIATFTKLHSS*****************PVP**KCHSVDRVYLAGYHDGSVRIWDATYPVFKLICALDAEVQGIEVAGSRAPVSTLSFCFINSSLAVGNEFGLVYIYNLNGSLDAKNFLFVLETKSEVHALPEGKISLCRAVFSLVNSPVRALQFTSSGAKLAVGFECGRVAVLDMNLLSVLFFTDDISGSSSPIISMTWTEFKN*****************NPAEEVIIVLFKDAKISIVGGSSENMISSSPWHLKKKVIAISMEVIEPV*************************************************SSNDALVLLCCEDSVRLYSRKSVIQKVKHKNRCCWASTIEKDEKVCGLLLLFQTGAVQIRSLPDLELVMESSLMSILRWNFKANMDKTISADNGQITLANGSEVAFVNLLAGENEFSILESSPCLHDKVLEAAAAAAFNVSSNQ****TTAAGI****VKGFR***************S******GIFSRPPFPDLSPAATNNEEIELNIDDIEIDEPP**********************************LRTREEIIAKYRKAEDASSVAAHARDKLFERQDKLERISRCTEELQSGAEDFASLANELVKTMENRKWWKI
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFAKRLLQKAKHNSQHGSLTAADLNLRIAVHYGIPATASILAFDHIQRLLAIATLDGRIKVIGGDGIEGLLISPSQLPYKNLEFLQNQGFLISITNDNEIQVWSLESRSLACCLKWESNITAFSVISGSHFMYIGDENGLMSVIKYDADEGKLFQLPYNISADALSEKAGFPLLSHQPVVGVLPHPNSSGNRVLIAYENALVILWDVSEAQIIFVGGGKDLQLKDGVVDSPSEGDSTFLEGISEHQPEEKEISALCWASSSGSILAVGYIDGDILLWNTSTTASTKGQQTGSRNNVVKLELSSAERRLPVIVLHWSTNKESRSNIDGRLFVYGGDEIGSEEVLTVLSLEWSSGMENLRCVSRVDITLTGSFADMILLSSAGATVGNHKADLFVLTSPGQLHFYDNASLTTLLSQQEKKPSVCPVEFPGVIPISDPIMTVAEFMLLPFGGHSSKGLSEIATFTKLHSSHTQAGHIKWPLSGGVPSPVPITKCHSVDRVYLAGYHDGSVRIWDATYPVFKLICALDAEVQGIEVAGSRAPVSTLSFCFINSSLAVGNEFGLVYIYNLNGSLDAKNFLFVLETKSEVHALPEGKISLCRAVFSLVNSPVRALQFTSSGAKLAVGFECGRVAVLDMNLLSVLFFTDDISGSSSPIISMTWTEFKNTHSLAKNPNHSEREVPVNPAEEVIIVLFKDAKISIVGGSSENMISSSPWHLKKKVIAISMEVIEPVCGFPIEKQAEQSAEENAAKNKPTPDTSSIETKSHETEHLFSSENACSGESSNDALVLLCCEDSVRLYSRKSVIQKVKHKNRCCWASTIEKDEKVCGLLLLFQTGAVQIRSLPDLELVMESSLMSILRWNFKANMDKTISADNGQITLANGSEVAFVNLLAGENEFSILESSPCLHDKVLEAAAAAAFNVSSNQKKKQTTAAGILGGIVKGFRGEKMIHTLDDSIDPKSSFSQLGGIFSRPPFPDLSPAATNNEEIELNIDDIEIDEPPSMMATSSHEVTNTKKEKLSERERLLGVPDDAKPRLRTREEIIAKYRKAEDASSVAAHARDKLFERQDKLERISRCTEELQSGAEDFASLANELVKTMENRKWWKI
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query1100 2.2.26 [Sep-21-2011]
Q9Y2K9 1186 Syntaxin-binding protein yes no 0.382 0.354 0.203 5e-16
Q5DQR4 1185 Syntaxin-binding protein no no 0.379 0.351 0.201 1e-15
Q5T5C01151 Syntaxin-binding protein no no 0.38 0.363 0.221 4e-14
Q8K4001152 Syntaxin-binding protein no no 0.39 0.372 0.217 5e-14
Q9WU701152 Syntaxin-binding protein no no 0.389 0.371 0.217 5e-14
Q5SQE21159 Syntaxin-binding protein no no 0.383 0.364 0.198 2e-12
Q6P1M31020 Lethal(2) giant larvae pr no no 0.183 0.198 0.245 5e-10
Q5RCX21019 Lethal(2) giant larvae pr no no 0.183 0.198 0.245 6e-10
Q120381033 Lethal(2) giant larvae pr yes no 0.144 0.153 0.293 1e-09
P381631010 Lethal(2) giant larvae pr no no 0.149 0.162 0.279 4e-09
>sp|Q9Y2K9|STB5L_HUMAN Syntaxin-binding protein 5-like OS=Homo sapiens GN=STXBP5L PE=2 SV=2 Back     alignment and function desciption
 Score = 87.8 bits (216), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 106/522 (20%), Positives = 206/522 (39%), Gaps = 101/522 (19%)

Query: 18  SLTAADLNLRIAVHYGIPATASILAFDHIQRLLAIATLDGRIKVIGGDGIEGLLISPSQL 77
           +LT+    +   V +G P   + LAFD +Q++LAI T  G I+++G  G++      S  
Sbjct: 53  TLTSEYFQICKTVRHGFPHQPTALAFDPVQKILAIGTRTGAIRILGRPGVDCYCQHESGA 112

Query: 78  PYKNLEFLQNQGFLISITNDNEIQVWSLESRSLACCLKWESN---ITAFSVISGSHFMYI 134
               L+FL N+G L+S ++D+ + +W+L  +  A     + N   IT   +   S ++Y+
Sbjct: 113 AVLQLQFLINEGALVSASSDDTLHLWNLRQKRPAILHSLKFNRERITYCHLPFQSKWLYV 172

Query: 135 GDENGLMSVIKYDADEGKLFQLPYNISADALSEKAGFPLLSHQ-PVVGVLPHPNSSGNRV 193
           G E G   ++  ++     + + +N  A  LS K      +H  PVV +   P   G ++
Sbjct: 173 GTERGNTHIVNIESFILSGYVIMWN-KAIELSTK------THPGPVVHLSDSPRDEG-KL 224

Query: 194 LIAYENALVILWDVSEAQIIFVGGGKDLQLKDGVVDSPSEGDSTFLEGISEHQPEEKEIS 253
           LI YEN  V+ WD+   +        +L++                         ++ I 
Sbjct: 225 LIGYENGTVVFWDLKSKR-------AELRVY-----------------------YDEAIH 254

Query: 254 ALCWASSSGSILAVGYIDGDILLWN--------TSTTASTKGQQTGSRNN----VVKLEL 301
           ++ W    G      + DG + LWN         +T    K Q+ G ++     ++K+E 
Sbjct: 255 SIDW-HHEGKQFMCSHSDGSLTLWNLKSPSRPFQTTIPHGKSQREGRKSESCKPILKVEY 313

Query: 302 SSAERRLPVIVLHWSTNKESRSNIDGRLFVYGGDEIGSEEVLTVLSLEWSSGMENLRCVS 361
            + +   P I+     + +          ++G       + +TVL ++         C +
Sbjct: 314 KTCKNSEPFIIFSGGLSYDKACRRPSLTIMHG-------KAITVLEMDHPIVEFLTLCET 366

Query: 362 RVDITLTGSFADMILLSSAGATVGNHKADLFVLTSPGQLHFYDNASLTTLLSQQEKKPSV 421
                    +A ++LL      V   +++  +  +P  +  +++             P  
Sbjct: 367 PYPNEFQEPYAVVVLLEKDLIVVDLTQSNFPIFENPYPMDIHES-------------PVT 413

Query: 422 CPVEFPGVIPISDPIMTVAEFMLLPFGGHSSKGLSEIATFTKLHSSHTQAGHIKWPLSGG 481
           C   F    P  D I+ +    +     H  +G S                + +WP+SGG
Sbjct: 414 CTAYFADCPP--DLILVLYSIGV----KHKKQGYS----------------NKEWPISGG 451

Query: 482 VPSPVPITKCHSVDRVYLAGYHDGSVRIWDATYPVFKLICAL 523
             +        +   + + G+ DGS++ WDA+    +++  L
Sbjct: 452 AWN----LGAQTYPEIIITGHADGSIKFWDASAITLQMLYKL 489




May play a role in vesicle trafficking and exocytosis.
Homo sapiens (taxid: 9606)
>sp|Q5DQR4|STB5L_MOUSE Syntaxin-binding protein 5-like OS=Mus musculus GN=Stxbp5l PE=1 SV=1 Back     alignment and function description
>sp|Q5T5C0|STXB5_HUMAN Syntaxin-binding protein 5 OS=Homo sapiens GN=STXBP5 PE=1 SV=1 Back     alignment and function description
>sp|Q8K400|STXB5_MOUSE Syntaxin-binding protein 5 OS=Mus musculus GN=Stxbp5 PE=1 SV=3 Back     alignment and function description
>sp|Q9WU70|STXB5_RAT Syntaxin-binding protein 5 OS=Rattus norvegicus GN=Stxbp5 PE=1 SV=1 Back     alignment and function description
>sp|Q5SQE2|STB5L_DANRE Syntaxin-binding protein 5-like OS=Danio rerio GN=stxbp5l PE=3 SV=1 Back     alignment and function description
>sp|Q6P1M3|L2GL2_HUMAN Lethal(2) giant larvae protein homolog 2 OS=Homo sapiens GN=LLGL2 PE=1 SV=2 Back     alignment and function description
>sp|Q5RCX2|L2GL2_PONAB Lethal(2) giant larvae protein homolog 2 OS=Pongo abelii GN=LLGL2 PE=2 SV=1 Back     alignment and function description
>sp|Q12038|SRO7_YEAST Lethal(2) giant larvae protein homolog SRO7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SRO7 PE=1 SV=1 Back     alignment and function description
>sp|P38163|SRO77_YEAST Lethal(2) giant larvae protein homolog SRO77 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SRO77 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1100
2960831691127 unnamed protein product [Vitis vinifera] 0.995 0.971 0.642 0.0
2254394081176 PREDICTED: uncharacterized protein LOC10 0.984 0.920 0.650 0.0
2555826701096 nucleotide binding protein, putative [Ri 0.979 0.982 0.607 0.0
2241404331099 predicted protein [Populus trichocarpa] 0.97 0.970 0.607 0.0
3565681101115 PREDICTED: uncharacterized protein LOC10 0.993 0.980 0.578 0.0
3565233181118 PREDICTED: uncharacterized protein LOC10 0.992 0.976 0.571 0.0
4494402591085 PREDICTED: LOW QUALITY PROTEIN: uncharac 0.940 0.953 0.549 0.0
2254484591108 PREDICTED: uncharacterized protein LOC10 0.988 0.981 0.531 0.0
2977365951137 unnamed protein product [Vitis vinifera] 0.988 0.956 0.518 0.0
3071359251044 nucleotide binding protein [Cucumis melo 0.91 0.958 0.540 0.0
>gi|296083169|emb|CBI22805.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score = 1403 bits (3632), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 727/1132 (64%), Positives = 854/1132 (75%), Gaps = 37/1132 (3%)

Query: 1    MFAKRLLQKAKH-----------------NSQHGSLTAADLNLRIAVHYGIPATASILAF 43
            MFAKRL+QKA                   N QH S+   DL+LRIA+HYGIP+TASILAF
Sbjct: 1    MFAKRLIQKATQHHLHHHQHHQHQDHHQPNEQHSSVALTDLDLRIAIHYGIPSTASILAF 60

Query: 44   DHIQRLLAIATLDGRIKVIGGDGIEGLLISPSQLPYKNLEFLQNQGFLISITNDNEIQVW 103
            D IQRLLAI TLDGRIKVIGGD IEGL ISP QLPYK LEFLQNQGFL+SI+ND+EIQVW
Sbjct: 61   DPIQRLLAIGTLDGRIKVIGGDNIEGLFISPKQLPYKYLEFLQNQGFLVSISNDDEIQVW 120

Query: 104  SLESRSLACCLKWESNITAFSVISGSHFMYIGDENGLMSVIKYDADEGKLFQLPYNISAD 163
            +LE + ++CCL WESNITAFSVISGS+FMYIGDE G +SV+K +AD+GKL QLPYNI A 
Sbjct: 121  NLERQCISCCLHWESNITAFSVISGSNFMYIGDEYGSISVLKCEADDGKLLQLPYNIFAK 180

Query: 164  ALSEKAGFPLLSHQPVVGVLPHPNSSGNRVLIAYENALVILWDVSEAQIIFVGGGKDLQL 223
            ++SE  GF   +HQPV+GVLP P SSGNRVLIAYEN L+ILWDVSEAQII   G K+LQL
Sbjct: 181  SISEAGGFSFFNHQPVIGVLPQPCSSGNRVLIAYENGLIILWDVSEAQIIVAKGDKNLQL 240

Query: 224  KDGVVDSPSEGDSTFLEGISEHQPEEKEISALCWASSSGSILAVGYIDGDILLWNTSTTA 283
             D  VDSPSE DS   +  SE   EEKEISALCWASS GSILAVGYIDGDIL WN S+ A
Sbjct: 241  NDRAVDSPSEADSNLPDDASEQHLEEKEISALCWASSDGSILAVGYIDGDILFWNLSSAA 300

Query: 284  STKGQQTGSR-NNVVKLELSSAERRLPVIVLHWSTNKESRSNIDGRLFVYGGDEIGSEEV 342
            STKGQQTGS  NNVVKL+LSSAERRLP+IVLHWST+ +  ++ DG LF+YGGD IGSEEV
Sbjct: 301  STKGQQTGSLGNNVVKLQLSSAERRLPIIVLHWSTSNKPHNDRDGLLFIYGGDAIGSEEV 360

Query: 343  LTVLSLEWSSGMENLRCVSRVDITLTGSFADMILLSSAGATVGNHKADLFVLTSPGQLHF 402
            LT+LSLEWSSG+E LRC  RV++TL GSFADMILL +AGAT  N  A LFVLT+PGQLHF
Sbjct: 361  LTILSLEWSSGVETLRCAGRVELTLVGSFADMILLPTAGATGINQNASLFVLTNPGQLHF 420

Query: 403  YDNASLTTLLSQQEKKPSVCPVEFPGVIPISDPIMTVAEFMLLPFGGHSSKGLSEIATFT 462
            YD+ASL+ L+SQQE+K S+  VEFP  +P SDP MTVA+   L  GG+SSK LSEIA+  
Sbjct: 421  YDDASLSALISQQERKSSLSAVEFPAAVPTSDPYMTVAKLSFLHTGGNSSKALSEIASVM 480

Query: 463  KLHSSHTQAGHIKWPLSGGVPSPVPITKCHSVDRVYLAGYHDGSVRIWDATYPVFKLICA 522
            K  S+ T  G  KWPL+GGVPS +   +   V+RVY+AGY DGSVRIWDATYPV  LIC 
Sbjct: 481  KHVSTPTLTGRAKWPLTGGVPSQLSFAEGKRVERVYVAGYQDGSVRIWDATYPVLSLICV 540

Query: 523  LDAEVQGIEVAGSRAPVSTLSFCFINSSLAVGNEFGLVYIYNLNGSLDAKNFLFVLETKS 582
            L+ EVQGI+VAGS A VS L FC +  SLAVGN  GLV +Y+LN + D  +F FV E+  
Sbjct: 541  LEGEVQGIKVAGSSASVSKLDFCHLTLSLAVGNACGLVRVYDLNDNSDKTSFHFVTESNQ 600

Query: 583  EVHALPEGKISLCRAVFSLVNSPVRALQFTSSGAKLAVGFECGRVAVLDMNLLSVLFFTD 642
            EVH LP+ K   CRA F L+NSP++AL++T+ G KLAVGFECGRVAVLDMN LSVL   D
Sbjct: 601  EVHVLPQQKGPQCRAAFCLLNSPIQALKYTNKGGKLAVGFECGRVAVLDMNSLSVLLSMD 660

Query: 643  DISGSSSPIISMTWTEFKNTHSLAKNPNHSEREVPVNPAEEVIIVLFKDAKISIVGGSSE 702
             ISGSSSP+IS+ W    N H+L K+P HSE E+  +P +E++ +L KD+K+ ++ GS+ 
Sbjct: 661  CISGSSSPVISIIWKAITNNHTLVKSPKHSESEISNDPPKELMFILTKDSKVVVIDGSTG 720

Query: 703  NMISSSPWHLKKKVIAISMEVIE---PVCGFPIEKQAEQSAEENAAKNKPTPDTSSIETK 759
            NMI+S P HLKK+  AISM VIE   PV G   EK   QS+ E   KN+P  DT  +   
Sbjct: 721  NMINSGPMHLKKESTAISMYVIEDNVPVSGSSNEKLL-QSSSEAPTKNEPVQDTVPVGIN 779

Query: 760  SHETEHLFSSENACSGESSNDALVLLCCEDSVRLYSRKSVIQ-------KVKHKNRCCWA 812
            S  +    SSE   SG    D+ VLLCCE+++RLY  KSVIQ       KV+    CCW 
Sbjct: 780  SPGS----SSETMYSGARLLDSHVLLCCENALRLYPTKSVIQGDNKPICKVELAKPCCWT 835

Query: 813  STIEKDEKVCGLLLLFQTGAVQIRSLPDLELVMESSLMSILRWNFKANMDKTISAD-NGQ 871
            +  +KDEKV GL+LL+QTGA++IRSLPDLE+V ESSLMSILRW FKANMDKTIS+  +GQ
Sbjct: 836  TIFKKDEKVYGLMLLYQTGAIEIRSLPDLEVVSESSLMSILRWAFKANMDKTISSSHDGQ 895

Query: 872  ITLANGSEVAFVNLLAGENEFSILESSPCLHDKVLEAAAAAAFNVSSNQKKKQTTAAGIL 931
            I LANG E+AF++LL GEN F I ES PCLHDKVL AAA AA  +SSNQKKKQ TA G+L
Sbjct: 896  IALANGCELAFISLLGGENGFRIPESFPCLHDKVLAAAADAAIGLSSNQKKKQGTAPGVL 955

Query: 932  GGIVKGFRGEKMIHTLDDSIDPKSSFSQLGGIFSRPPFPDLSPAATNNEE-IELNIDDIE 990
             GIVKGF+G K+IH +D S   KS+F+ L  IF R PFPD SP AT+N+E +ELNID+IE
Sbjct: 956  SGIVKGFKGGKVIHNVDLSASAKSNFAHLEDIFLRSPFPDPSPTATDNQEVVELNIDEIE 1015

Query: 991  I-DEPPSMMATSSHEVTNTKKEKLSERERLL-GVPDDAKPRLRTREEIIAKYRKAEDASS 1048
            I DEP  + +TSS +V N KKEK +ERERL  G   D +PR+RTREEIIAKYRK  DASS
Sbjct: 1016 IDDEPLPVASTSSRQVKNHKKEKGTERERLFQGTTADIEPRMRTREEIIAKYRKTGDASS 1075

Query: 1049 VAAHARDKLFERQDKLERISRCTEELQSGAEDFASLANELVKTMENRKWWKI 1100
            VAAHARDKL ERQ+KLERIS+ TEELQSGAEDFASLANELVK ME RKW++I
Sbjct: 1076 VAAHARDKLVERQEKLERISKRTEELQSGAEDFASLANELVKAMEGRKWYQI 1127




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|225439408|ref|XP_002263824.1| PREDICTED: uncharacterized protein LOC100257563 [Vitis vinifera] Back     alignment and taxonomy information
>gi|255582670|ref|XP_002532114.1| nucleotide binding protein, putative [Ricinus communis] gi|223528217|gb|EEF30276.1| nucleotide binding protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|224140433|ref|XP_002323587.1| predicted protein [Populus trichocarpa] gi|222868217|gb|EEF05348.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356568110|ref|XP_003552256.1| PREDICTED: uncharacterized protein LOC100776508 [Glycine max] Back     alignment and taxonomy information
>gi|356523318|ref|XP_003530287.1| PREDICTED: uncharacterized protein LOC100779801 [Glycine max] Back     alignment and taxonomy information
>gi|449440259|ref|XP_004137902.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC101217343 [Cucumis sativus] Back     alignment and taxonomy information
>gi|225448459|ref|XP_002272182.1| PREDICTED: uncharacterized protein LOC100250143 [Vitis vinifera] Back     alignment and taxonomy information
>gi|297736595|emb|CBI25466.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|307135925|gb|ADN33787.1| nucleotide binding protein [Cucumis melo subsp. melo] gi|307136468|gb|ADN34272.1| nucleotide binding protein [Cucumis melo subsp. melo] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1100
TAIR|locus:21696721124 AT5G05570 "AT5G05570" [Arabido 0.71 0.694 0.443 3.8e-165
FB|FBgn0030412 1470 tomosyn "tomosyn" [Drosophila 0.165 0.123 0.268 3.8e-21
ZFIN|ZDB-GENE-041001-1611129 stxbp5a "syntaxin binding prot 0.166 0.162 0.305 2.2e-20
UNIPROTKB|Q5T5C01151 STXBP5 "Syntaxin-binding prote 0.165 0.158 0.293 1.1e-18
MGI|MGI:19260581152 Stxbp5 "syntaxin binding prote 0.166 0.158 0.295 1.8e-18
UNIPROTKB|E1BNK41152 STXBP5 "Uncharacterized protei 0.165 0.157 0.293 5.6e-18
UNIPROTKB|F1S7R81115 STXBP5 "Uncharacterized protei 0.165 0.163 0.298 8.5e-18
UNIPROTKB|E2R4F71152 STXBP5 "Uncharacterized protei 0.165 0.157 0.293 1.4e-17
UNIPROTKB|C9JQS31129 STXBP5L "Syntaxin-binding prot 0.166 0.162 0.300 2.9e-17
UNIPROTKB|E9PFI21162 STXBP5L "Syntaxin-binding prot 0.166 0.157 0.300 3.5e-17
TAIR|locus:2169672 AT5G05570 "AT5G05570" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1607 (570.8 bits), Expect = 3.8e-165, P = 3.8e-165
 Identities = 373/841 (44%), Positives = 512/841 (60%)

Query:     1 MFAKRLLQKAKHNSQ---------HGSLTAADLNLRIAVHYGIPATASILAFDHIQRLLA 51
             MF ++ LQK+               G L A DL+  I  H GIP+TAS+LAFD IQ LLA
Sbjct:     1 MFVRKFLQKSSGGQNPPPPIAPPPRGCLMAEDLDPHIITHSGIPSTASLLAFDPIQCLLA 60

Query:    52 IATLDGRIKVIGGDGIEGLLISPSQLPYKNLEFLQNQGFLISITNDNEIQVWSLESRSLA 111
             + TLDGRIKVIGGD IE +L SP QLP+KNLEF+QNQGFL+SI+N+NEIQVW L+ R  A
Sbjct:    61 VGTLDGRIKVIGGDNIEAILASPKQLPFKNLEFMQNQGFLVSISNENEIQVWDLDLRQPA 120

Query:   112 CCLKWESNITAFSVISGSHFMYIGDENGLMSVIKYDADEGKLFQLPYNISADALSEKAGF 171
               LKWESNITAF+++ G+ +MY+GDE G++SV+ Y ADEGKL QLPY +  DALSE AG 
Sbjct:   121 SSLKWESNITAFAILHGTGYMYVGDEYGMVSVLNYSADEGKLLQLPYYVPTDALSEAAGL 180

Query:   172 PLLSHQPVVGVLPHPNSSGNRVLIAYENALVILWDVSEAQIIFVGGGKDLQLKDGVVDSP 231
                   PVVG+L  P S G R+LIA+ N L+ LWD SE  ++ V G KDL ++   V   
Sbjct:   181 SSPIDYPVVGLLSQPCSKGTRLLIAFSNGLLFLWDASEDHVVLVRGNKDLPVEGKTVADS 240

Query:   232 SEGDSTFLEGISEHQPEEKEISALCWASSSGSILAVGYIDGDILLWNTSTTASTKGQQTG 291
              E      + +S  + + KEIS+LCWAS+ GS+LAVGY+DGDIL W+ S      GQ+  
Sbjct:   241 LEASH---DELSNLELDGKEISSLCWASTDGSVLAVGYVDGDILFWDFSD-----GQKGK 292

Query:   292 SRNNVVKLELSSAERRLPVIVLHWSTNKESRSNIDGRLFVYGGDEIGSEEVLTVLSLEWS 351
               N+VVKL+LSSAE+RLPVIV+HW  +  SR +  G+LF+YGGD IGS+EVLT+L L+WS
Sbjct:   293 PSNHVVKLQLSSAEKRLPVIVMHWCLDV-SRKSSGGKLFIYGGDIIGSDEVLTMLGLDWS 351

Query:   352 SGMENLRCVSRVDITLTGSFADMILLSSAGATVGNHKADLFVLTSPGQLHFYDNASLTTL 411
             SGM  L+CV R D+TL+GSFADM+L   A +        LF+LT+PGQL  YD+ SL +L
Sbjct:   352 SGMGGLKCVGRADLTLSGSFADMVLSPIASSRQSG--VFLFLLTNPGQLQAYDDTSLASL 409

Query:   412 LSQQEKKPSVCPVEFPGVIPISDPIMTVAEFMLLPFGGHSSKGLSEIATFTKLHSSHTQA 471
             +SQ+E K SV P+ +P V+P  DP MTVA F  L     +S  LSEI    K  +  T +
Sbjct:   410 MSQKENKISVSPLPYPMVVPTMDPHMTVATFSALNVNDKTSLALSEIVLAAKARTPRTPS 469

Query:   472 GH-IKWPLSGGVPSPVPITKCHSVDRVYLAGYHDGSVRIWDATYPVFKLICALDAEVQGI 530
             G   +WPL+GGVPS V   K   ++R+Y+AGY DGS+RIWDATYP   LI  L+ +   I
Sbjct:   470 GESAQWPLTGGVPSHVDDYK---LERLYMAGYQDGSMRIWDATYPCLSLIYILEPKASVI 526

Query:   531 EVAGSRAPVSTLSFCFINSSLAVGNEFGLVYIYNL-----NGSLDA-----KNFLFVLET 580
             ++ G  A V+   FC   S LAVGNE G+V +Y L      G+L+      K  L ++ T
Sbjct:   527 DITGVDASVTAFCFCSKTSCLAVGNECGMVRLYKLVGHTSGGTLEVVTNTEKKGLAIVTT 586

Query:   581 KSE--VHALPE--GKISLCR-----------AVFSLVNSPVRALQFTSSGAKLAVGFECG 625
              +    +AL    G + +             A FS ++SPV  LQF  S  +LAVGF+CG
Sbjct:   587 LTLWICYALSHAVGSLLVAHHLHQEDGPQWLAAFSFLSSPVCTLQFVQSTRRLAVGFKCG 646

Query:   626 RVAVLDMNLLSVLFFTDDXXXXXXXXXXM-TWTEFKNTHSLAKNPNHSEREVPVNPAEEV 684
             +VAVLD+ + SVLF T+           +   +    T S +   +H+     +N  +++
Sbjct:   647 KVAVLDIGVPSVLFVTNSLSDSGSPIKSLYVKSSSAPTGSKSDPTDHNS----INSEDDL 702

Query:   685 II-VLFKDAKISIVGGSSENMISSSPWHLKKKVIAISMEVIEPVCGFPIEKQAEQSAEEN 743
             ++  + KD +  ++ G++  +++S    LK    AI M +IE  C    E  +E+ AE  
Sbjct:   703 LLCAMTKDGQTILLDGNTGKILASCLRPLKNPT-AICMHIIEN-CYENYETPSEKPAENP 760

Query:   744 AAKNKPTPDTSSIE-TKSH--ETEHLFSSENACSGESSNDALVLLCCEDSVRLYSRKSVI 800
             + K+K    +  I+ ++SH  + E    +E     +   ++L L+C ED++RLY+ KS+ 
Sbjct:   761 SGKDKHENKSHIIKASESHSPDGEQNAVTETKLIDQIFANSLFLMCSEDALRLYTVKSLS 820

Query:   801 Q 801
             Q
Sbjct:   821 Q 821


GO:0000166 "nucleotide binding" evidence=ISS
GO:0003676 "nucleic acid binding" evidence=IEA
GO:0005634 "nucleus" evidence=ISM
GO:0008168 "methyltransferase activity" evidence=IEA
GO:0016021 "integral to membrane" evidence=IEA
GO:0016192 "vesicle-mediated transport" evidence=IEA
GO:0032259 "methylation" evidence=IEA
GO:0005886 "plasma membrane" evidence=IDA
FB|FBgn0030412 tomosyn "tomosyn" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-041001-161 stxbp5a "syntaxin binding protein 5a (tomosyn)" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|Q5T5C0 STXBP5 "Syntaxin-binding protein 5" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:1926058 Stxbp5 "syntaxin binding protein 5 (tomosyn)" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|E1BNK4 STXBP5 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1S7R8 STXBP5 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|E2R4F7 STXBP5 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|C9JQS3 STXBP5L "Syntaxin-binding protein 5-like" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E9PFI2 STXBP5L "Syntaxin-binding protein 5-like" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1100
pfam0095789 pfam00957, Synaptobrevin, Synaptobrevin 2e-04
cd00200289 cd00200, WD40, WD40 domain, found in a number of e 7e-04
>gnl|CDD|201526 pfam00957, Synaptobrevin, Synaptobrevin Back     alignment and domain information
 Score = 41.0 bits (97), Expect = 2e-04
 Identities = 19/45 (42%), Positives = 26/45 (57%), Gaps = 4/45 (8%)

Query: 1055 DKLFERQDKLERISRCTEELQSGAEDFASLANELVKTMENRKWWK 1099
            DK+ ER +KL+ +   TE LQS A+ F   A +L + M    WWK
Sbjct: 24   DKVLERGEKLDLLVDKTENLQSSAQQFRKQARKLKRKM----WWK 64


Length = 89

>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 1100
KOG0291893 consensus WD40-repeat-containing subunit of the 18 100.0
KOG0271480 consensus Notchless-like WD40 repeat-containing pr 100.0
KOG0319775 consensus WD40-repeat-containing subunit of the 18 100.0
KOG0271480 consensus Notchless-like WD40 repeat-containing pr 100.0
KOG0318603 consensus WD40 repeat stress protein/actin interac 100.0
KOG0319775 consensus WD40-repeat-containing subunit of the 18 100.0
KOG1983993 consensus Tomosyn and related SNARE-interacting pr 100.0
KOG0306888 consensus WD40-repeat-containing subunit of the 18 100.0
KOG0291893 consensus WD40-repeat-containing subunit of the 18 100.0
KOG0318603 consensus WD40 repeat stress protein/actin interac 100.0
KOG0272459 consensus U4/U6 small nuclear ribonucleoprotein Pr 100.0
KOG0306888 consensus WD40-repeat-containing subunit of the 18 100.0
KOG0272459 consensus U4/U6 small nuclear ribonucleoprotein Pr 100.0
KOG1408 1080 consensus WD40 repeat protein [Function unknown] 99.98
KOG0292 1202 consensus Vesicle coat complex COPI, alpha subunit 99.97
KOG0286343 consensus G-protein beta subunit [General function 99.97
KOG2106626 consensus Uncharacterized conserved protein, conta 99.97
KOG0273524 consensus Beta-transducin family (WD-40 repeat) pr 99.97
KOG0286343 consensus G-protein beta subunit [General function 99.97
KOG0273524 consensus Beta-transducin family (WD-40 repeat) pr 99.97
KOG0296399 consensus Angio-associated migratory cell protein 99.97
KOG0315311 consensus G-protein beta subunit-like protein (con 99.96
PF08596395 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; 99.96
KOG0315311 consensus G-protein beta subunit-like protein (con 99.96
KOG2048691 consensus WD40 repeat protein [General function pr 99.96
KOG0296399 consensus Angio-associated migratory cell protein 99.96
KOG0279315 consensus G protein beta subunit-like protein [Sig 99.96
KOG0276794 consensus Vesicle coat complex COPI, beta' subunit 99.96
KOG0279315 consensus G protein beta subunit-like protein [Sig 99.96
KOG0276794 consensus Vesicle coat complex COPI, beta' subunit 99.96
KOG0263707 consensus Transcription initiation factor TFIID, s 99.95
KOG1539910 consensus WD repeat protein [General function pred 99.95
KOG1063764 consensus RNA polymerase II elongator complex, sub 99.95
KOG0263707 consensus Transcription initiation factor TFIID, s 99.95
KOG0295406 consensus WD40 repeat-containing protein [Function 99.95
KOG0285460 consensus Pleiotropic regulator 1 [RNA processing 99.95
PLN00181793 protein SPA1-RELATED; Provisional 99.94
KOG0293519 consensus WD40 repeat-containing protein [Function 99.94
PLN00181793 protein SPA1-RELATED; Provisional 99.94
KOG0645312 consensus WD40 repeat protein [General function pr 99.94
KOG1539910 consensus WD repeat protein [General function pred 99.94
KOG0266456 consensus WD40 repeat-containing protein [General 99.94
KOG0284464 consensus Polyadenylation factor I complex, subuni 99.94
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 99.94
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 99.94
KOG0292 1202 consensus Vesicle coat complex COPI, alpha subunit 99.93
KOG0284464 consensus Polyadenylation factor I complex, subuni 99.93
KOG0265338 consensus U5 snRNP-specific protein-like factor an 99.93
KOG0285460 consensus Pleiotropic regulator 1 [RNA processing 99.93
KOG0282503 consensus mRNA splicing factor [Function unknown] 99.93
KOG0645312 consensus WD40 repeat protein [General function pr 99.93
KOG0295406 consensus WD40 repeat-containing protein [Function 99.93
KOG0266456 consensus WD40 repeat-containing protein [General 99.93
KOG0278334 consensus Serine/threonine kinase receptor-associa 99.92
KOG0265338 consensus U5 snRNP-specific protein-like factor an 99.92
KOG0282503 consensus mRNA splicing factor [Function unknown] 99.92
KOG1063764 consensus RNA polymerase II elongator complex, sub 99.92
KOG0281499 consensus Beta-TrCP (transducin repeats containing 99.91
KOG14081080 consensus WD40 repeat protein [Function unknown] 99.91
KOG0293519 consensus WD40 repeat-containing protein [Function 99.91
KOG0313423 consensus Microtubule binding protein YTM1 (contai 99.91
KOG0310487 consensus Conserved WD40 repeat-containing protein 99.91
KOG0281499 consensus Beta-TrCP (transducin repeats containing 99.9
KOG0316307 consensus Conserved WD40 repeat-containing protein 99.9
KOG2106626 consensus Uncharacterized conserved protein, conta 99.89
KOG0268433 consensus Sof1-like rRNA processing protein (conta 99.89
KOG0772641 consensus Uncharacterized conserved protein, conta 99.89
KOG0643327 consensus Translation initiation factor 3, subunit 99.89
KOG0299479 consensus U3 snoRNP-associated protein (contains W 99.89
KOG0316307 consensus Conserved WD40 repeat-containing protein 99.89
KOG0313423 consensus Microtubule binding protein YTM1 (contai 99.89
KOG0643327 consensus Translation initiation factor 3, subunit 99.88
KOG0772641 consensus Uncharacterized conserved protein, conta 99.88
KOG0640430 consensus mRNA cleavage stimulating factor complex 99.88
KOG0275508 consensus Conserved WD40 repeat-containing protein 99.88
KOG0278334 consensus Serine/threonine kinase receptor-associa 99.88
KOG0275508 consensus Conserved WD40 repeat-containing protein 99.87
KOG2048691 consensus WD40 repeat protein [General function pr 99.86
KOG0305484 consensus Anaphase promoting complex, Cdc20, Cdh1, 99.86
KOG1407313 consensus WD40 repeat protein [Function unknown] 99.86
KOG0288459 consensus WD40 repeat protein TipD [General functi 99.86
KOG0647347 consensus mRNA export protein (contains WD40 repea 99.86
KOG0973942 consensus Histone transcription regulator HIRA, WD 99.86
KOG0274537 consensus Cdc4 and related F-box and WD-40 protein 99.85
KOG0299479 consensus U3 snoRNP-associated protein (contains W 99.85
KOG0640430 consensus mRNA cleavage stimulating factor complex 99.85
KOG0310487 consensus Conserved WD40 repeat-containing protein 99.85
KOG1036323 consensus Mitotic spindle checkpoint protein BUB3, 99.84
KOG0283712 consensus WD40 repeat-containing protein [Function 99.84
KOG0294362 consensus WD40 repeat-containing protein [Function 99.84
PTZ00421493 coronin; Provisional 99.84
KOG0288459 consensus WD40 repeat protein TipD [General functi 99.84
KOG1446311 consensus Histone H3 (Lys4) methyltransferase comp 99.84
KOG0973 942 consensus Histone transcription regulator HIRA, WD 99.83
KOG0289506 consensus mRNA splicing factor [General function p 99.83
KOG1963792 consensus WD40 repeat protein [General function pr 99.83
KOG14451012 consensus Tumor-specific antigen (contains WD repe 99.83
KOG0294362 consensus WD40 repeat-containing protein [Function 99.83
KOG0283712 consensus WD40 repeat-containing protein [Function 99.83
KOG0641350 consensus WD40 repeat protein [General function pr 99.83
KOG0308735 consensus Conserved WD40 repeat-containing protein 99.83
KOG0647347 consensus mRNA export protein (contains WD40 repea 99.83
KOG0277311 consensus Peroxisomal targeting signal type 2 rece 99.83
KOG1446311 consensus Histone H3 (Lys4) methyltransferase comp 99.82
KOG0274537 consensus Cdc4 and related F-box and WD-40 protein 99.82
PTZ00420568 coronin; Provisional 99.82
PTZ00420568 coronin; Provisional 99.82
PTZ00421493 coronin; Provisional 99.82
KOG0646476 consensus WD40 repeat protein [General function pr 99.82
KOG2096420 consensus WD40 repeat protein [General function pr 99.82
KOG2055514 consensus WD40 repeat protein [General function pr 99.82
KOG0305484 consensus Anaphase promoting complex, Cdc20, Cdh1, 99.82
KOG0277311 consensus Peroxisomal targeting signal type 2 rece 99.82
KOG0300481 consensus WD40 repeat-containing protein [Function 99.81
KOG4283397 consensus Transcription-coupled repair protein CSA 99.81
KOG0301745 consensus Phospholipase A2-activating protein (con 99.8
KOG0308735 consensus Conserved WD40 repeat-containing protein 99.8
KOG1036323 consensus Mitotic spindle checkpoint protein BUB3, 99.8
KOG1407313 consensus WD40 repeat protein [Function unknown] 99.8
KOG0300481 consensus WD40 repeat-containing protein [Function 99.8
KOG2055514 consensus WD40 repeat protein [General function pr 99.79
KOG0301745 consensus Phospholipase A2-activating protein (con 99.79
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 99.79
KOG0641350 consensus WD40 repeat protein [General function pr 99.78
KOG0646476 consensus WD40 repeat protein [General function pr 99.78
KOG2445361 consensus Nuclear pore complex component (sc Seh1) 99.78
KOG0289506 consensus mRNA splicing factor [General function p 99.77
KOG1274933 consensus WD40 repeat protein [General function pr 99.77
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 99.76
KOG1332299 consensus Vesicle coat complex COPII, subunit SEC1 99.76
KOG1332299 consensus Vesicle coat complex COPII, subunit SEC1 99.76
KOG0269839 consensus WD40 repeat-containing protein [Function 99.75
KOG0650733 consensus WD40 repeat nucleolar protein Bop1, invo 99.75
KOG0268433 consensus Sof1-like rRNA processing protein (conta 99.75
KOG0321720 consensus WD40 repeat-containing protein L2DTL [Fu 99.74
KOG2096420 consensus WD40 repeat protein [General function pr 99.74
KOG14451012 consensus Tumor-specific antigen (contains WD repe 99.73
KOG0639705 consensus Transducin-like enhancer of split protei 99.72
KOG1274933 consensus WD40 repeat protein [General function pr 99.72
KOG0639705 consensus Transducin-like enhancer of split protei 99.72
KOG15381081 consensus Uncharacterized conserved protein WDR10, 99.72
KOG1273405 consensus WD40 repeat protein [General function pr 99.71
KOG4328498 consensus WD40 protein [Function unknown] 99.71
KOG0269839 consensus WD40 repeat-containing protein [Function 99.71
KOG15381081 consensus Uncharacterized conserved protein WDR10, 99.7
KOG0264422 consensus Nucleosome remodeling factor, subunit CA 99.7
KOG1188376 consensus WD40 repeat protein [General function pr 99.7
KOG1273405 consensus WD40 repeat protein [General function pr 99.69
KOG4283397 consensus Transcription-coupled repair protein CSA 99.68
KOG0321720 consensus WD40 repeat-containing protein L2DTL [Fu 99.68
KOG0267825 consensus Microtubule severing protein katanin p80 99.68
KOG0650733 consensus WD40 repeat nucleolar protein Bop1, invo 99.67
KOG1034385 consensus Transcriptional repressor EED/ESC/FIE, r 99.67
KOG0264422 consensus Nucleosome remodeling factor, subunit CA 99.66
COG2319466 FOG: WD40 repeat [General function prediction only 99.65
KOG2445361 consensus Nuclear pore complex component (sc Seh1) 99.65
KOG0270463 consensus WD40 repeat-containing protein [Function 99.64
KOG4378673 consensus Nuclear protein COP1 [Signal transductio 99.63
KOG0322323 consensus G-protein beta subunit-like protein GNB1 99.62
KOG0267825 consensus Microtubule severing protein katanin p80 99.61
KOG0302440 consensus Ribosome Assembly protein [General funct 99.61
KOG12401431 consensus Protein kinase containing WD40 repeats [ 99.6
KOG1009434 consensus Chromatin assembly complex 1 subunit B/C 99.59
KOG1963792 consensus WD40 repeat protein [General function pr 99.59
KOG2919406 consensus Guanine nucleotide-binding protein [Gene 99.58
KOG4227609 consensus WD40 repeat protein [General function pr 99.55
COG2319466 FOG: WD40 repeat [General function prediction only 99.54
KOG0302440 consensus Ribosome Assembly protein [General funct 99.53
KOG19121062 consensus WD40 repeat protein [General function pr 99.53
KOG15171387 consensus Guanine nucleotide binding protein MIP1 99.53
PRK11028330 6-phosphogluconolactonase; Provisional 99.53
KOG4328498 consensus WD40 protein [Function unknown] 99.52
KOG15171387 consensus Guanine nucleotide binding protein MIP1 99.52
KOG0642577 consensus Cell-cycle nuclear protein, contains WD- 99.52
KOG03071049 consensus Vesicle coat complex COPII, subunit SEC3 99.51
KOG03071049 consensus Vesicle coat complex COPII, subunit SEC3 99.51
KOG4227609 consensus WD40 repeat protein [General function pr 99.5
KOG1009434 consensus Chromatin assembly complex 1 subunit B/C 99.5
KOG1587555 consensus Cytoplasmic dynein intermediate chain [C 99.5
KOG0322323 consensus G-protein beta subunit-like protein GNB1 99.49
KOG0270463 consensus WD40 repeat-containing protein [Function 99.49
KOG1034385 consensus Transcriptional repressor EED/ESC/FIE, r 99.49
KOG4378673 consensus Nuclear protein COP1 [Signal transductio 99.47
KOG2919406 consensus Guanine nucleotide-binding protein [Gene 99.47
KOG0771398 consensus Prolactin regulatory element-binding pro 99.46
KOG06441113 consensus Uncharacterized conserved protein, conta 99.46
PRK11028330 6-phosphogluconolactonase; Provisional 99.45
KOG1007370 consensus WD repeat protein TSSC1, WD repeat super 99.44
KOG0303472 consensus Actin-binding protein Coronin, contains 99.44
KOG1523361 consensus Actin-related protein Arp2/3 complex, su 99.43
KOG0642577 consensus Cell-cycle nuclear protein, contains WD- 99.42
KOG1007370 consensus WD repeat protein TSSC1, WD repeat super 99.42
KOG1587555 consensus Cytoplasmic dynein intermediate chain [C 99.38
KOG06441113 consensus Uncharacterized conserved protein, conta 99.38
PRK01742429 tolB translocation protein TolB; Provisional 99.37
KOG1310758 consensus WD40 repeat protein [General function pr 99.37
KOG2110391 consensus Uncharacterized conserved protein, conta 99.37
KOG0303472 consensus Actin-binding protein Coronin, contains 99.36
KOG0290364 consensus Conserved WD40 repeat-containing protein 99.35
KOG1524737 consensus WD40 repeat-containing protein CHE-2 [Ge 99.35
KOG4497447 consensus Uncharacterized conserved protein WDR8, 99.35
KOG0649325 consensus WD40 repeat protein [General function pr 99.34
KOG0771398 consensus Prolactin regulatory element-binding pro 99.33
KOG1188376 consensus WD40 repeat protein [General function pr 99.32
PRK01742429 tolB translocation protein TolB; Provisional 99.32
PF04762928 IKI3: IKI3 family; InterPro: IPR006849 Members of 99.31
KOG0974967 consensus WD-repeat protein WDR6, WD repeat superf 99.29
KOG0290364 consensus Conserved WD40 repeat-containing protein 99.28
KOG2111346 consensus Uncharacterized conserved protein, conta 99.28
KOG12401431 consensus Protein kinase containing WD40 repeats [ 99.26
KOG2394636 consensus WD40 protein DMR-N9 [General function pr 99.26
KOG2394636 consensus WD40 protein DMR-N9 [General function pr 99.25
KOG2139445 consensus WD40 repeat protein [General function pr 99.24
KOG0649325 consensus WD40 repeat protein [General function pr 99.23
KOG4497447 consensus Uncharacterized conserved protein WDR8, 99.21
KOG2321703 consensus WD40 repeat protein [General function pr 99.21
KOG2110391 consensus Uncharacterized conserved protein, conta 99.21
PRK03629429 tolB translocation protein TolB; Provisional 99.2
PF02239369 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO 99.2
KOG1334559 consensus WD40 repeat protein [General function pr 99.18
PRK05137435 tolB translocation protein TolB; Provisional 99.16
PRK04922433 tolB translocation protein TolB; Provisional 99.16
PRK03629429 tolB translocation protein TolB; Provisional 99.15
PRK05137435 tolB translocation protein TolB; Provisional 99.14
PRK02889427 tolB translocation protein TolB; Provisional 99.13
KOG1272545 consensus WD40-repeat-containing subunit of the 18 99.11
KOG1524737 consensus WD40 repeat-containing protein CHE-2 [Ge 99.08
PRK02889427 tolB translocation protein TolB; Provisional 99.07
KOG1523361 consensus Actin-related protein Arp2/3 complex, su 99.07
KOG2111346 consensus Uncharacterized conserved protein, conta 99.04
KOG1334559 consensus WD40 repeat protein [General function pr 99.01
KOG2041 1189 consensus WD40 repeat protein [General function pr 99.01
KOG1272545 consensus WD40-repeat-containing subunit of the 18 99.01
PF10282345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 99.01
PF02239369 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO 98.99
PRK04922433 tolB translocation protein TolB; Provisional 98.99
KOG2139445 consensus WD40 repeat protein [General function pr 98.97
PF08662194 eIF2A: Eukaryotic translation initiation factor eI 98.96
KOG3881412 consensus Uncharacterized conserved protein [Funct 98.95
TIGR02800417 propeller_TolB tol-pal system beta propeller repea 98.95
PF08662194 eIF2A: Eukaryotic translation initiation factor eI 98.95
TIGR02800417 propeller_TolB tol-pal system beta propeller repea 98.92
KOG2321703 consensus WD40 repeat protein [General function pr 98.92
KOG2315566 consensus Predicted translation initiation factor 98.9
COG5354561 Uncharacterized protein, contains Trp-Asp (WD) rep 98.9
KOG2041 1189 consensus WD40 repeat protein [General function pr 98.89
KOG19121062 consensus WD40 repeat protein [General function pr 98.88
PRK04792448 tolB translocation protein TolB; Provisional 98.86
PRK00178430 tolB translocation protein TolB; Provisional 98.86
PRK00178430 tolB translocation protein TolB; Provisional 98.85
KOG1310758 consensus WD40 repeat protein [General function pr 98.84
PRK01029428 tolB translocation protein TolB; Provisional 98.82
KOG3881412 consensus Uncharacterized conserved protein [Funct 98.82
PF04762928 IKI3: IKI3 family; InterPro: IPR006849 Members of 98.79
PRK04792448 tolB translocation protein TolB; Provisional 98.75
KOG1409404 consensus Uncharacterized conserved protein, conta 98.74
KOG0974967 consensus WD-repeat protein WDR6, WD repeat superf 98.73
KOG2314698 consensus Translation initiation factor 3, subunit 98.72
PF10282345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 98.71
KOG1409404 consensus Uncharacterized conserved protein, conta 98.6
COG4946668 Uncharacterized protein related to the periplasmic 98.6
TIGR03300377 assembly_YfgL outer membrane assembly lipoprotein 98.56
KOG1354433 consensus Serine/threonine protein phosphatase 2A, 98.56
TIGR02658352 TTQ_MADH_Hv methylamine dehydrogenase heavy chain. 98.55
TIGR03300377 assembly_YfgL outer membrane assembly lipoprotein 98.52
TIGR02658352 TTQ_MADH_Hv methylamine dehydrogenase heavy chain. 98.51
PLN029191057 haloacid dehalogenase-like hydrolase family protei 98.5
KOG3914390 consensus WD repeat protein WDR4 [Function unknown 98.5
COG2706346 3-carboxymuconate cyclase [Carbohydrate transport 98.49
KOG4547541 consensus WD40 repeat-containing protein [General 98.46
KOG4547541 consensus WD40 repeat-containing protein [General 98.45
COG2706346 3-carboxymuconate cyclase [Carbohydrate transport 98.44
KOG3914390 consensus WD repeat protein WDR4 [Function unknown 98.43
PLN029191057 haloacid dehalogenase-like hydrolase family protei 98.42
KOG10642439 consensus RAVE (regulator of V-ATPase assembly) co 98.39
PRK04043419 tolB translocation protein TolB; Provisional 98.34
KOG2066846 consensus Vacuolar assembly/sorting protein VPS41 98.33
KOG10642439 consensus RAVE (regulator of V-ATPase assembly) co 98.33
COG5354561 Uncharacterized protein, contains Trp-Asp (WD) rep 98.29
COG5170460 CDC55 Serine/threonine protein phosphatase 2A, reg 98.28
PF15492282 Nbas_N: Neuroblastoma-amplified sequence, N termin 98.28
PRK04043419 tolB translocation protein TolB; Provisional 98.26
PRK01029428 tolB translocation protein TolB; Provisional 98.24
KOG1354433 consensus Serine/threonine protein phosphatase 2A, 98.22
PF11768545 DUF3312: Protein of unknown function (DUF3312); In 98.21
KOG4532344 consensus WD40-like repeat containing protein [Gen 98.21
COG4946668 Uncharacterized protein related to the periplasmic 98.21
KOG2114933 consensus Vacuolar assembly/sorting protein PEP5/V 98.12
KOG0280339 consensus Uncharacterized conserved protein [Amino 98.12
PF0040039 WD40: WD domain, G-beta repeat; InterPro: IPR01978 98.11
KOG4714319 consensus Nucleoporin [Nuclear structure] 98.09
KOG2314698 consensus Translation initiation factor 3, subunit 98.09
KOG4714319 consensus Nucleoporin [Nuclear structure] 98.08
KOG2315566 consensus Predicted translation initiation factor 98.06
KOG3621 726 consensus WD40 repeat-containing protein [General 98.05
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 98.01
PRK11138394 outer membrane biogenesis protein BamB; Provisiona 98.0
KOG41901034 consensus Uncharacterized conserved protein [Funct 97.99
KOG4649354 consensus PQQ (pyrrolo-quinoline quinone) repeat p 97.96
KOG0280339 consensus Uncharacterized conserved protein [Amino 97.96
KOG0860116 consensus Synaptobrevin/VAMP-like protein [Intrace 97.93
PRK11138394 outer membrane biogenesis protein BamB; Provisiona 97.92
PF11768545 DUF3312: Protein of unknown function (DUF3312); In 97.92
PF0095789 Synaptobrevin: Synaptobrevin; InterPro: IPR001388 97.91
KOG4532344 consensus WD40-like repeat containing protein [Gen 97.87
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 97.83
KOG2695425 consensus WD40 repeat protein [General function pr 97.82
KOG3621726 consensus WD40 repeat-containing protein [General 97.81
PF15492282 Nbas_N: Neuroblastoma-amplified sequence, N termin 97.8
KOG1645463 consensus RING-finger-containing E3 ubiquitin liga 97.79
KOG1645463 consensus RING-finger-containing E3 ubiquitin liga 97.77
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 97.74
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 97.73
PF03178321 CPSF_A: CPSF A subunit region; InterPro: IPR004871 97.73
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 97.72
KOG2695425 consensus WD40 repeat protein [General function pr 97.72
KOG18971096 consensus Damage-specific DNA binding complex, sub 97.7
PF0040039 WD40: WD domain, G-beta repeat; InterPro: IPR01978 97.68
KOG1920 1265 consensus IkappaB kinase complex, IKAP component [ 97.66
KOG41901034 consensus Uncharacterized conserved protein [Funct 97.62
PF08596395 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; 97.52
PF07433305 DUF1513: Protein of unknown function (DUF1513); In 97.51
COG5170460 CDC55 Serine/threonine protein phosphatase 2A, reg 97.5
KOG18321516 consensus HIV-1 Vpr-binding protein [Cell cycle co 97.49
KOG0882558 consensus Cyclophilin-related peptidyl-prolyl cis- 97.49
KOG03091081 consensus Conserved WD40 repeat-containing protein 97.45
KOG1920 1265 consensus IkappaB kinase complex, IKAP component [ 97.43
KOG0882558 consensus Cyclophilin-related peptidyl-prolyl cis- 97.34
KOG18971096 consensus Damage-specific DNA binding complex, sub 97.33
PF06977248 SdiA-regulated: SdiA-regulated; InterPro: IPR00972 97.33
KOG4649354 consensus PQQ (pyrrolo-quinoline quinone) repeat p 97.28
KOG2079 1206 consensus Vacuolar assembly/sorting protein VPS8 [ 97.27
KOG03091081 consensus Conserved WD40 repeat-containing protein 97.22
KOG2066846 consensus Vacuolar assembly/sorting protein VPS41 97.22
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 97.2
PF14783111 BBS2_Mid: Ciliary BBSome complex subunit 2, middle 97.18
PF07433305 DUF1513: Protein of unknown function (DUF1513); In 97.13
KOG4640 665 consensus Anaphase-promoting complex (APC), subuni 97.09
PRK02888635 nitrous-oxide reductase; Validated 97.08
KOG2114 933 consensus Vacuolar assembly/sorting protein PEP5/V 97.04
PF00780275 CNH: CNH domain; InterPro: IPR001180 Based on sequ 97.03
PF04841410 Vps16_N: Vps16, N-terminal region; InterPro: IPR00 96.98
PF1289447 Apc4_WD40: Anaphase-promoting complex subunit 4 WD 96.98
COG0823425 TolB Periplasmic component of the Tol biopolymer t 96.79
PF00930353 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-termin 96.76
KOG20791206 consensus Vacuolar assembly/sorting protein VPS8 [ 96.72
PF00780275 CNH: CNH domain; InterPro: IPR001180 Based on sequ 96.7
KOG12751118 consensus PAB-dependent poly(A) ribonuclease, subu 96.7
PF14783111 BBS2_Mid: Ciliary BBSome complex subunit 2, middle 96.69
KOG4640665 consensus Anaphase-promoting complex (APC), subuni 96.66
PF10168717 Nup88: Nuclear pore component; InterPro: IPR019321 96.63
smart0032040 WD40 WD40 repeats. Note that these repeats are per 96.49
PF08553794 VID27: VID27 cytoplasmic protein; InterPro: IPR013 96.39
PF06977248 SdiA-regulated: SdiA-regulated; InterPro: IPR00972 96.31
PF14727418 PHTB1_N: PTHB1 N-terminus 96.28
KOG1008783 consensus Uncharacterized conserved protein, conta 96.26
KOG12751118 consensus PAB-dependent poly(A) ribonuclease, subu 96.23
COG0823425 TolB Periplasmic component of the Tol biopolymer t 96.23
PF03178321 CPSF_A: CPSF A subunit region; InterPro: IPR004871 96.13
COG3204316 Uncharacterized protein conserved in bacteria [Fun 96.12
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 95.98
PF08553794 VID27: VID27 cytoplasmic protein; InterPro: IPR013 95.96
KOG4499310 consensus Ca2+-binding protein Regucalcin/SMP30 [I 95.94
PRK13616591 lipoprotein LpqB; Provisional 95.75
KOG0859217 consensus Synaptobrevin/VAMP-like protein [Intrace 95.67
COG3391381 Uncharacterized conserved protein [Function unknow 95.63
PF06433342 Me-amine-dh_H: Methylamine dehydrogenase heavy cha 95.52
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 95.46
COG3391381 Uncharacterized conserved protein [Function unknow 95.34
COG3204316 Uncharacterized protein conserved in bacteria [Fun 95.27
KOG1008783 consensus Uncharacterized conserved protein, conta 95.26
cd00216488 PQQ_DH Dehydrogenases with pyrrolo-quinoline quino 95.25
PF10647253 Gmad1: Lipoprotein LpqB beta-propeller domain; Int 95.19
PF06433342 Me-amine-dh_H: Methylamine dehydrogenase heavy cha 95.02
smart0032040 WD40 WD40 repeats. Note that these repeats are per 95.0
KOG18321516 consensus HIV-1 Vpr-binding protein [Cell cycle co 94.94
COG3386307 Gluconolactonase [Carbohydrate transport and metab 94.71
PF1289447 Apc4_WD40: Anaphase-promoting complex subunit 4 WD 94.64
KOG2395644 consensus Protein involved in vacuole import and d 94.43
KOG3630 1405 consensus Nuclear pore complex, Nup214/CAN compone 94.28
PF02897414 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal 94.25
PRK13616591 lipoprotein LpqB; Provisional 94.18
PF14727418 PHTB1_N: PTHB1 N-terminus 93.92
PF10647253 Gmad1: Lipoprotein LpqB beta-propeller domain; Int 93.87
KOG2444238 consensus WD40 repeat protein [General function pr 93.76
TIGR03118336 PEPCTERM_chp_1 conserved hypothetical protein TIGR 93.74
PRK02888635 nitrous-oxide reductase; Validated 93.22
KOG2444238 consensus WD40 repeat protein [General function pr 93.21
PF14781136 BBS2_N: Ciliary BBSome complex subunit 2, N-termin 93.11
COG3490366 Uncharacterized protein conserved in bacteria [Fun 92.89
PF14655415 RAB3GAP2_N: Rab3 GTPase-activating protein regulat 92.5
cd00216488 PQQ_DH Dehydrogenases with pyrrolo-quinoline quino 92.44
PF04841410 Vps16_N: Vps16, N-terminal region; InterPro: IPR00 92.32
PF14583386 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C 92.13
TIGR03075527 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methan 91.8
COG3490366 Uncharacterized protein conserved in bacteria [Fun 91.6
PF1097943 DUF2786: Protein of unknown function (DUF2786); In 91.47
PF05096264 Glu_cyclase_2: Glutamine cyclotransferase; InterPr 91.4
PF08728717 CRT10: CRT10; InterPro: IPR014839 CRT10 is a trans 90.9
KOG3630 1405 consensus Nuclear pore complex, Nup214/CAN compone 90.86
PF08728717 CRT10: CRT10; InterPro: IPR014839 CRT10 is a trans 90.77
PF14870302 PSII_BNR: Photosynthesis system II assembly factor 90.68
PF14870302 PSII_BNR: Photosynthesis system II assembly factor 90.38
PF10168717 Nup88: Nuclear pore component; InterPro: IPR019321 90.31
PF10395 670 Utp8: Utp8 family; InterPro: IPR018843 Utp8 is an 90.08
PF15390671 DUF4613: Domain of unknown function (DUF4613) 89.97
PF14655415 RAB3GAP2_N: Rab3 GTPase-activating protein regulat 89.94
PF08366105 LLGL: LLGL2; InterPro: IPR013577 This domain is fo 89.64
KOG2395644 consensus Protein involved in vacuole import and d 89.6
PF14781136 BBS2_N: Ciliary BBSome complex subunit 2, N-termin 89.33
PF14761215 HPS3_N: Hermansky-Pudlak syndrome 3 89.26
COG3386307 Gluconolactonase [Carbohydrate transport and metab 89.09
PF12657173 TFIIIC_delta: Transcription factor IIIC subunit de 88.57
PF14583386 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C 88.32
PF13449326 Phytase-like: Esterase-like activity of phytase 88.3
TIGR02604367 Piru_Ver_Nterm putative membrane-bound dehydrogena 88.05
PF07569219 Hira: TUP1-like enhancer of split; InterPro: IPR01 87.4
PF1031343 DUF2415: Uncharacterised protein domain (DUF2415); 87.28
PF11635753 Med16: Mediator complex subunit 16; InterPro: IPR0 86.87
PF12768281 Rax2: Cortical protein marker for cell polarity 86.86
KOG18961366 consensus mRNA cleavage and polyadenylation factor 86.8
PF14761215 HPS3_N: Hermansky-Pudlak syndrome 3 85.96
PLN00033398 photosystem II stability/assembly factor; Provisio 85.87
PF02897414 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal 85.64
KOG18981205 consensus Splicing factor 3b, subunit 3 [RNA proce 84.15
PRK13684334 Ycf48-like protein; Provisional 83.92
PF12234631 Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR0 83.8
PF15390671 DUF4613: Domain of unknown function (DUF4613) 83.66
KOG2280829 consensus Vacuolar assembly/sorting protein VPS16 83.55
PF07569219 Hira: TUP1-like enhancer of split; InterPro: IPR01 83.36
PF07995331 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: 83.23
PF1031343 DUF2415: Uncharacterised protein domain (DUF2415); 82.56
PRK13684334 Ycf48-like protein; Provisional 82.36
KOG4460741 consensus Nuclear pore complex, Nup88/rNup84 compo 82.18
PF14779257 BBS1: Ciliary BBSome complex subunit 1 82.16
PRK10115686 protease 2; Provisional 82.11
PF11715547 Nup160: Nucleoporin Nup120/160; InterPro: IPR02171 81.42
TIGR03075527 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methan 81.39
PF13449326 Phytase-like: Esterase-like activity of phytase 81.25
COG5167776 VID27 Protein involved in vacuole import and degra 81.02
PF00930353 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-termin 80.04
>KOG0291 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
Probab=100.00  E-value=1.5e-38  Score=354.28  Aligned_cols=650  Identities=15%  Similarity=0.167  Sum_probs=411.2

Q ss_pred             cccceeeeecCCCCCeEEEEEcCCCCEEEEEECCCeEEEEeC-CCceEEEeCCCCCCEEEEEEEeCCCEEEEEECCCcEE
Q 001321           23 DLNLRIAVHYGIPATASILAFDHIQRLLAIATLDGRIKVIGG-DGIEGLLISPSQLPYKNLEFLQNQGFLISITNDNEIQ  101 (1100)
Q Consensus        23 ~~~~~~~~~~G~~~~v~~la~sp~~~lLA~gs~dG~I~vw~~-~~~~~~~~~~h~~~V~~l~fs~d~~~Lls~s~d~~I~  101 (1100)
                      ++++++.+..|-.++-..+.|++||.-+.+.. .++|-|||+ ++....+..++...|++++.+|+|.+|+++...|...
T Consensus         2 k~efrfsNllGTvyr~Gnl~ft~dG~sviSPv-GNrvsv~dLknN~S~Tl~~e~~~NI~~ialSp~g~lllavdE~g~~~   80 (893)
T KOG0291|consen    2 KTEFRFSNLLGTVYRAGNLVFTKDGNSVISPV-GNRVSVFDLKNNKSYTLPLETRYNITRIALSPDGTLLLAVDERGRAL   80 (893)
T ss_pred             ccccchhhcccceeecCcEEECCCCCEEEecc-CCEEEEEEccCCcceeEEeecCCceEEEEeCCCceEEEEEcCCCcEE
Confidence            46788889999999999999999999888765 689999999 6678889999999999999999999999999999999


Q ss_pred             EEEcCCCceeeeeecCCCeEEEEEecCCCEEEEEeCCCcEEEEEEecCCCeeeeeceeecccccccccCCCCCCCCCeEE
Q 001321          102 VWSLESRSLACCLKWESNITAFSVISGSHFMYIGDENGLMSVIKYDADEGKLFQLPYNISADALSEKAGFPLLSHQPVVG  181 (1100)
Q Consensus       102 vWd~~s~~~l~~~~~~~~Vt~~~~s~~~~~l~~G~~dG~V~Iw~~d~~~~~l~~~~~~i~~~~~~~~~~~~~~~~~~V~s  181 (1100)
                      +-++..+.+++.+.+...|.|+.|+|+++++|+|..+- +.||........ .-.||.+....        ..+...|++
T Consensus        81 lvs~~~r~Vlh~f~fk~~v~~i~fSPng~~fav~~gn~-lqiw~~P~~~~~-~~~pFvl~r~~--------~g~fddi~s  150 (893)
T KOG0291|consen   81 LVSLLSRSVLHRFNFKRGVGAIKFSPNGKFFAVGCGNL-LQIWHAPGEIKN-EFNPFVLHRTY--------LGHFDDITS  150 (893)
T ss_pred             EEecccceeeEEEeecCccceEEECCCCcEEEEEecce-eEEEecCcchhc-ccCcceEeeee--------cCCccceeE
Confidence            99999999999999999999999999999999998775 789998753321 12234332111        122378999


Q ss_pred             EEeccCCCCCEEEEEEcCCEEEEEEccCCEE---EEEecCCcccccccccCCCCCCCCccccCCCCCCCCCCceEEEEEe
Q 001321          182 VLPHPNSSGNRVLIAYENALVILWDVSEAQI---IFVGGGKDLQLKDGVVDSPSEGDSTFLEGISEHQPEEKEISALCWA  258 (1100)
Q Consensus       182 v~f~P~~~g~~ll~~~~dg~V~lwdl~~~~~---~~~~~~~~~~~~~~l~~~~~g~~~~~g~~~~~~~~~~~~V~sl~w~  258 (1100)
                      |.|  ++|...+++|+.|.++++|+++..+-   ..+.+|                              ...|.+.. +
T Consensus       151 i~W--s~DSr~l~~gsrD~s~rl~~v~~~k~~~~~~l~gH------------------------------kd~Vvacf-F  197 (893)
T KOG0291|consen  151 IDW--SDDSRLLVTGSRDLSARLFGVDGNKNLFTYALNGH------------------------------KDYVVACF-F  197 (893)
T ss_pred             EEe--ccCCceEEeccccceEEEEEeccccccceEeccCC------------------------------CcceEEEE-e
Confidence            999  66899899999999999999987653   334455                              45555544 4


Q ss_pred             cCCCCEEEEEEcCCcEEEEecCCC--CCCCCcc-cCCCCcceeeeccccCCCc----ceEEEEeccccc-----CCCCCC
Q 001321          259 SSSGSILAVGYIDGDILLWNTSTT--ASTKGQQ-TGSRNNVVKLELSSAERRL----PVIVLHWSTNKE-----SRSNID  326 (1100)
Q Consensus       259 spdg~~l~sg~~DG~I~lWd~~~~--~~~~~~~-~~~~~~~~~l~~~~~~~~~----~i~~~~w~~~~~-----~~~~~~  326 (1100)
                      ..|...+++.+.||.|.+|.+...  ....+.. ............... ...    .....+|....+     .+....
T Consensus       198 ~~~~~~l~tvskdG~l~~W~~~~~P~~~~~~~kd~eg~~d~~~~~~~Ee-k~~~~~~~k~~k~~ln~~~~kvtaa~fH~~  276 (893)
T KOG0291|consen  198 GANSLDLYTVSKDGALFVWTCDLRPPELDKAEKDEEGSDDEEMDEDGEE-KTHKIFWYKTKKHYLNQNSSKVTAAAFHKG  276 (893)
T ss_pred             ccCcceEEEEecCceEEEEEecCCCcccccccccccccccccccccchh-hhcceEEEEEEeeeecccccceeeeeccCC
Confidence            689999999999999999998732  1111000 000000000000000 000    011112222110     113344


Q ss_pred             ceEEEEeCCCCCCcceEEEEEcCCccccccceeeeeeeecCC-CcceeEEEccCCCCCCCCCcceEEEEec-CCeeeEee
Q 001321          327 GRLFVYGGDEIGSEEVLTVLSLEWSSGMENLRCVSRVDITLT-GSFADMILLSSAGATVGNHKADLFVLTS-PGQLHFYD  404 (1100)
Q Consensus       327 ~~llv~gg~~~g~~~~ltvl~l~~~~~~~~~~~~~~~~l~~~-~~v~d~~~~p~~~~~~~~~~~~l~vl~~-~G~l~~~d  404 (1100)
                      ..++++|...+       +..+...+++..+     ..+... .++.++.+...+.        -+.+.+. -|++++|+
T Consensus       277 t~~lvvgFssG-------~f~LyelP~f~li-----h~LSis~~~I~t~~~N~tGD--------WiA~g~~klgQLlVwe  336 (893)
T KOG0291|consen  277 TNLLVVGFSSG-------EFGLYELPDFNLI-----HSLSISDQKILTVSFNSTGD--------WIAFGCSKLGQLLVWE  336 (893)
T ss_pred             ceEEEEEecCC-------eeEEEecCCceEE-----EEeecccceeeEEEecccCC--------EEEEcCCccceEEEEE
Confidence            44555554433       2222222221111     111111 2333333332210        1122111 14444444


Q ss_pred             cCceeEeeeccCCCCCCCCccCCcccccCCCceEEEEEEeccCCCCchhhHhHHHhhccccCCCcccCcccccccCCccc
Q 001321          405 NASLTTLLSQQEKKPSVCPVEFPGVIPISDPIMTVAEFMLLPFGGHSSKGLSEIATFTKLHSSHTQAGHIKWPLSGGVPS  484 (1100)
Q Consensus       405 ~~~~~~~~~~~~~~~~~~~~~~p~~~~~~~~~it~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~pl~GG~~~  484 (1100)
                              |+.+                                          ....               -..||..
T Consensus       337 --------WqsE------------------------------------------sYVl---------------KQQgH~~  351 (893)
T KOG0291|consen  337 --------WQSE------------------------------------------SYVL---------------KQQGHSD  351 (893)
T ss_pred             --------eecc------------------------------------------ceee---------------ecccccc
Confidence                    1111                                          1111               1235666


Q ss_pred             ccCccccCCCCcEEEEEecCCcEEEeeCCCCceeEEeeeccceeeeeecCCCCCeeEEEEeeCCCeEEEEecCceEEEEE
Q 001321          485 PVPITKCHSVDRVYLAGYHDGSVRIWDATYPVFKLICALDAEVQGIEVAGSRAPVSTLSFCFINSSLAVGNEFGLVYIYN  564 (1100)
Q Consensus       485 ~~~~~~~s~~~~~l~Tg~~DGtIriWd~~~~~l~~~~~l~~~~~~~~l~~h~~~Vt~lafspd~~~Lasg~~dG~V~lw~  564 (1100)
                      .+.+++.+|||+++|||++||.|+|||...+.|.           ++...|...|+++.|+..++.|++.+.||+||.||
T Consensus       352 ~i~~l~YSpDgq~iaTG~eDgKVKvWn~~SgfC~-----------vTFteHts~Vt~v~f~~~g~~llssSLDGtVRAwD  420 (893)
T KOG0291|consen  352 RITSLAYSPDGQLIATGAEDGKVKVWNTQSGFCF-----------VTFTEHTSGVTAVQFTARGNVLLSSSLDGTVRAWD  420 (893)
T ss_pred             ceeeEEECCCCcEEEeccCCCcEEEEeccCceEE-----------EEeccCCCceEEEEEEecCCEEEEeecCCeEEeee
Confidence            6678899999999999999999999999999888           78999999999999999999999999999999999


Q ss_pred             ecCCCCCcce------eeec---cCCCc-------------eeeccCCCcceeEEEEeecCcCeEEEEEcCCCCEEEEEe
Q 001321          565 LNGSLDAKNF------LFVL---ETKSE-------------VHALPEGKISLCRAVFSLVNSPVRALQFTSSGAKLAVGF  622 (1100)
Q Consensus       565 l~~~~~~~~~------~~~~---~~~~~-------------~~~i~~~~~~~~~~~~~~h~~~VtsLafSp~g~~LavGs  622 (1100)
                      +....+..++      +|.+   +..++             +..++.   -+.+-.+.+|.+||.+|+|+|+|..||+|+
T Consensus       421 lkRYrNfRTft~P~p~QfscvavD~sGelV~AG~~d~F~IfvWS~qT---GqllDiLsGHEgPVs~l~f~~~~~~LaS~S  497 (893)
T KOG0291|consen  421 LKRYRNFRTFTSPEPIQFSCVAVDPSGELVCAGAQDSFEIFVWSVQT---GQLLDILSGHEGPVSGLSFSPDGSLLASGS  497 (893)
T ss_pred             ecccceeeeecCCCceeeeEEEEcCCCCEEEeeccceEEEEEEEeec---CeeeehhcCCCCcceeeEEccccCeEEecc
Confidence            9888654443      2221   22233             222222   235667889999999999999999999999


Q ss_pred             CCceEEEEecCCceEEEEeecCCCCCCCeEEEEEeecccCccccCCCCCCCCCCCCCCCceEEEEEecceeEEEEeCCCC
Q 001321          623 ECGRVAVLDMNLLSVLFFTDDISGSSSPIISMTWTEFKNTHSLAKNPNHSEREVPVNPAEEVIIVLFKDAKISIVGGSSE  702 (1100)
Q Consensus       623 ~dG~V~vwD~~~~~~~~~~~~~~~~~~~V~sl~fs~~~~~~~~~~~~~~~~~~~~~~~~~~lL~~gt~dg~v~v~d~~~g  702 (1100)
                      .|.+|++||+-...-..   -...+.+.|+++.|.+.+..                      |+++|-||.|.+||... 
T Consensus       498 WDkTVRiW~if~s~~~v---Etl~i~sdvl~vsfrPdG~e----------------------laVaTldgqItf~d~~~-  551 (893)
T KOG0291|consen  498 WDKTVRIWDIFSSSGTV---ETLEIRSDVLAVSFRPDGKE----------------------LAVATLDGQITFFDIKE-  551 (893)
T ss_pred             ccceEEEEEeeccCcee---eeEeeccceeEEEEcCCCCe----------------------EEEEEecceEEEEEhhh-
Confidence            99999999987652210   11137889999999988877                      99999999999999555 


Q ss_pred             ccccCCccccCCCceeEEEEEecccCCCCccchhhhhhhhhhccCCCCCCCCcccccCcccccccccccccCCCCCCCCE
Q 001321          703 NMISSSPWHLKKKVIAISMEVIEPVCGFPIEKQAEQSAEENAAKNKPTPDTSSIETKSHETEHLFSSENACSGESSNDAL  782 (1100)
Q Consensus       703 ~~l~~~~i~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  782 (1100)
                                     ...+..||+..++...+...          +.  +     ++.-+...+.-..-.++   ..+.+
T Consensus       552 ---------------~~q~~~IdgrkD~~~gR~~~----------D~--~-----ta~~sa~~K~Ftti~yS---aDG~~  596 (893)
T KOG0291|consen  552 ---------------AVQVGSIDGRKDLSGGRKET----------DR--I-----TAENSAKGKTFTTICYS---ADGKC  596 (893)
T ss_pred             ---------------ceeeccccchhhcccccccc----------ce--e-----ehhhcccCCceEEEEEc---CCCCE
Confidence                           34455566655544433311          10  0     00000000000001122   11667


Q ss_pred             EEEEecC-eeEEEeccccee--ecccccccceeeeeec--CCc--eEEEEEEEec------CcEEEeecCChhh--hhhc
Q 001321          783 VLLCCED-SVRLYSRKSVIQ--KVKHKNRCCWASTIEK--DEK--VCGLLLLFQT------GAVQIRSLPDLEL--VMES  847 (1100)
Q Consensus       783 ~~~cse~-~vrl~sl~~~~~--~~~~~~~c~~~~~~~~--~~~--~~~l~~~~~~------G~i~i~slp~l~~--~~~~  847 (1100)
                      ++..++. .+++|+.+....  +..+..--.|..+..-  +.+  ..+=+.+..+      |-|-| .||.-.-  +...
T Consensus       597 IlAgG~sn~iCiY~v~~~vllkkfqiS~N~sLdg~~efln~rkmtEfG~~~LiD~e~~~~e~~i~~-~lpG~~~gdlssR  675 (893)
T KOG0291|consen  597 ILAGGESNSICIYDVPEGVLLKKFQISDNRSLDGVLEFLNRRKMTEFGNMDLIDTEESDLEGRIDI-ALPGVQRGDLSSR  675 (893)
T ss_pred             EEecCCcccEEEEECchhheeeeEEeccccchhHHHHHhccccccccCCccccccccccccccccc-cCCccccCCcccc
Confidence            7777766 999999987755  3333333345433111  111  1111111111      11111 2332110  0111


Q ss_pred             cccceeeeeeccccccceeec-CCcEEEEcceeEEEEEe
Q 001321          848 SLMSILRWNFKANMDKTISAD-NGQITLANGSEVAFVNL  885 (1100)
Q Consensus       848 ~~~~~l~~~~~~~~~~~~~~s-~gq~~l~~g~e~~~~s~  885 (1100)
                      ..++..|       +.++.|| +|+-......|...|..
T Consensus       676 r~rpeIr-------v~sv~fsPtgraFAaatTEGl~IYs  707 (893)
T KOG0291|consen  676 RFRPEIR-------VTSVQFSPTGRAFAAATTEGLLIYS  707 (893)
T ss_pred             ccCceEE-------EEEEEECCCcCeeeeecccceEEEe
Confidence            2233333       6789999 99998888866666533



>KOG0271 consensus Notchless-like WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0319 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0271 consensus Notchless-like WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0318 consensus WD40 repeat stress protein/actin interacting protein [Cytoskeleton] Back     alignment and domain information
>KOG0319 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG1983 consensus Tomosyn and related SNARE-interacting proteins [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0306 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0291 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0318 consensus WD40 repeat stress protein/actin interacting protein [Cytoskeleton] Back     alignment and domain information
>KOG0272 consensus U4/U6 small nuclear ribonucleoprotein Prp4 (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0306 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0272 consensus U4/U6 small nuclear ribonucleoprotein Prp4 (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG1408 consensus WD40 repeat protein [Function unknown] Back     alignment and domain information
>KOG0292 consensus Vesicle coat complex COPI, alpha subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0286 consensus G-protein beta subunit [General function prediction only] Back     alignment and domain information
>KOG2106 consensus Uncharacterized conserved protein, contains HELP and WD40 domains [Function unknown] Back     alignment and domain information
>KOG0273 consensus Beta-transducin family (WD-40 repeat) protein [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0286 consensus G-protein beta subunit [General function prediction only] Back     alignment and domain information
>KOG0273 consensus Beta-transducin family (WD-40 repeat) protein [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0296 consensus Angio-associated migratory cell protein (contains WD40 repeats) [Function unknown] Back     alignment and domain information
>KOG0315 consensus G-protein beta subunit-like protein (contains WD40 repeats) [General function prediction only] Back     alignment and domain information
>PF08596 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; InterPro: IPR013905 The Lethal giant larvae (Lgl) tumour suppressor protein is conserved from yeast to mammals Back     alignment and domain information
>KOG0315 consensus G-protein beta subunit-like protein (contains WD40 repeats) [General function prediction only] Back     alignment and domain information
>KOG2048 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0296 consensus Angio-associated migratory cell protein (contains WD40 repeats) [Function unknown] Back     alignment and domain information
>KOG0279 consensus G protein beta subunit-like protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG0276 consensus Vesicle coat complex COPI, beta' subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0279 consensus G protein beta subunit-like protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG0276 consensus Vesicle coat complex COPI, beta' subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0263 consensus Transcription initiation factor TFIID, subunit TAF5 (also component of histone acetyltransferase SAGA) [Transcription] Back     alignment and domain information
>KOG1539 consensus WD repeat protein [General function prediction only] Back     alignment and domain information
>KOG1063 consensus RNA polymerase II elongator complex, subunit ELP2, WD repeat superfamily [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>KOG0263 consensus Transcription initiation factor TFIID, subunit TAF5 (also component of histone acetyltransferase SAGA) [Transcription] Back     alignment and domain information
>KOG0295 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0285 consensus Pleiotropic regulator 1 [RNA processing and modification] Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>KOG0293 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>KOG0645 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1539 consensus WD repeat protein [General function prediction only] Back     alignment and domain information
>KOG0266 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0284 consensus Polyadenylation factor I complex, subunit PFS2 [RNA processing and modification] Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>KOG0292 consensus Vesicle coat complex COPI, alpha subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0284 consensus Polyadenylation factor I complex, subunit PFS2 [RNA processing and modification] Back     alignment and domain information
>KOG0265 consensus U5 snRNP-specific protein-like factor and related proteins [RNA processing and modification] Back     alignment and domain information
>KOG0285 consensus Pleiotropic regulator 1 [RNA processing and modification] Back     alignment and domain information
>KOG0282 consensus mRNA splicing factor [Function unknown] Back     alignment and domain information
>KOG0645 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0295 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0266 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0278 consensus Serine/threonine kinase receptor-associated protein [Lipid transport and metabolism] Back     alignment and domain information
>KOG0265 consensus U5 snRNP-specific protein-like factor and related proteins [RNA processing and modification] Back     alignment and domain information
>KOG0282 consensus mRNA splicing factor [Function unknown] Back     alignment and domain information
>KOG1063 consensus RNA polymerase II elongator complex, subunit ELP2, WD repeat superfamily [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>KOG0281 consensus Beta-TrCP (transducin repeats containing)/Slimb proteins [Function unknown] Back     alignment and domain information
>KOG1408 consensus WD40 repeat protein [Function unknown] Back     alignment and domain information
>KOG0293 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0313 consensus Microtubule binding protein YTM1 (contains WD40 repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0310 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0281 consensus Beta-TrCP (transducin repeats containing)/Slimb proteins [Function unknown] Back     alignment and domain information
>KOG0316 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG2106 consensus Uncharacterized conserved protein, contains HELP and WD40 domains [Function unknown] Back     alignment and domain information
>KOG0268 consensus Sof1-like rRNA processing protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0772 consensus Uncharacterized conserved protein, contains WD40 repeat [Function unknown] Back     alignment and domain information
>KOG0643 consensus Translation initiation factor 3, subunit i (eIF-3i)/TGF-beta receptor-interacting protein (TRIP-1) [Translation, ribosomal structure and biogenesis; Signal transduction mechanisms] Back     alignment and domain information
>KOG0299 consensus U3 snoRNP-associated protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0316 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0313 consensus Microtubule binding protein YTM1 (contains WD40 repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0643 consensus Translation initiation factor 3, subunit i (eIF-3i)/TGF-beta receptor-interacting protein (TRIP-1) [Translation, ribosomal structure and biogenesis; Signal transduction mechanisms] Back     alignment and domain information
>KOG0772 consensus Uncharacterized conserved protein, contains WD40 repeat [Function unknown] Back     alignment and domain information
>KOG0640 consensus mRNA cleavage stimulating factor complex; subunit 1 [RNA processing and modification] Back     alignment and domain information
>KOG0275 consensus Conserved WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0278 consensus Serine/threonine kinase receptor-associated protein [Lipid transport and metabolism] Back     alignment and domain information
>KOG0275 consensus Conserved WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG2048 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0305 consensus Anaphase promoting complex, Cdc20, Cdh1, and Ama1 subunits [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1407 consensus WD40 repeat protein [Function unknown] Back     alignment and domain information
>KOG0288 consensus WD40 repeat protein TipD [General function prediction only] Back     alignment and domain information
>KOG0647 consensus mRNA export protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0973 consensus Histone transcription regulator HIRA, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning; Transcription] Back     alignment and domain information
>KOG0274 consensus Cdc4 and related F-box and WD-40 proteins [General function prediction only] Back     alignment and domain information
>KOG0299 consensus U3 snoRNP-associated protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0640 consensus mRNA cleavage stimulating factor complex; subunit 1 [RNA processing and modification] Back     alignment and domain information
>KOG0310 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG1036 consensus Mitotic spindle checkpoint protein BUB3, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0283 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0294 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>KOG0288 consensus WD40 repeat protein TipD [General function prediction only] Back     alignment and domain information
>KOG1446 consensus Histone H3 (Lys4) methyltransferase complex and RNA cleavage factor II complex, subunit SWD2 [RNA processing and modification; Chromatin structure and dynamics; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0973 consensus Histone transcription regulator HIRA, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning; Transcription] Back     alignment and domain information
>KOG0289 consensus mRNA splicing factor [General function prediction only] Back     alignment and domain information
>KOG1963 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1445 consensus Tumor-specific antigen (contains WD repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0294 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0283 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0641 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0308 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0647 consensus mRNA export protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0277 consensus Peroxisomal targeting signal type 2 receptor [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1446 consensus Histone H3 (Lys4) methyltransferase complex and RNA cleavage factor II complex, subunit SWD2 [RNA processing and modification; Chromatin structure and dynamics; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0274 consensus Cdc4 and related F-box and WD-40 proteins [General function prediction only] Back     alignment and domain information
>PTZ00420 coronin; Provisional Back     alignment and domain information
>PTZ00420 coronin; Provisional Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>KOG0646 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG2096 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG2055 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0305 consensus Anaphase promoting complex, Cdc20, Cdh1, and Ama1 subunits [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0277 consensus Peroxisomal targeting signal type 2 receptor [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0300 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG4283 consensus Transcription-coupled repair protein CSA, contains WD40 domain [Transcription; Replication, recombination and repair] Back     alignment and domain information
>KOG0301 consensus Phospholipase A2-activating protein (contains WD40 repeats) [Lipid transport and metabolism] Back     alignment and domain information
>KOG0308 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG1036 consensus Mitotic spindle checkpoint protein BUB3, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1407 consensus WD40 repeat protein [Function unknown] Back     alignment and domain information
>KOG0300 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG2055 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0301 consensus Phospholipase A2-activating protein (contains WD40 repeats) [Lipid transport and metabolism] Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>KOG0641 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0646 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG2445 consensus Nuclear pore complex component (sc Seh1) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0289 consensus mRNA splicing factor [General function prediction only] Back     alignment and domain information
>KOG1274 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>KOG1332 consensus Vesicle coat complex COPII, subunit SEC13 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1332 consensus Vesicle coat complex COPII, subunit SEC13 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0269 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0650 consensus WD40 repeat nucleolar protein Bop1, involved in ribosome biogenesis [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0268 consensus Sof1-like rRNA processing protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0321 consensus WD40 repeat-containing protein L2DTL [Function unknown] Back     alignment and domain information
>KOG2096 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1445 consensus Tumor-specific antigen (contains WD repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0639 consensus Transducin-like enhancer of split protein (contains WD40 repeats) [Chromatin structure and dynamics] Back     alignment and domain information
>KOG1274 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0639 consensus Transducin-like enhancer of split protein (contains WD40 repeats) [Chromatin structure and dynamics] Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>KOG1273 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG4328 consensus WD40 protein [Function unknown] Back     alignment and domain information
>KOG0269 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>KOG0264 consensus Nucleosome remodeling factor, subunit CAF1/NURF55/MSI1 [Chromatin structure and dynamics] Back     alignment and domain information
>KOG1188 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1273 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG4283 consensus Transcription-coupled repair protein CSA, contains WD40 domain [Transcription; Replication, recombination and repair] Back     alignment and domain information
>KOG0321 consensus WD40 repeat-containing protein L2DTL [Function unknown] Back     alignment and domain information
>KOG0267 consensus Microtubule severing protein katanin p80 subunit B (contains WD40 repeats) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0650 consensus WD40 repeat nucleolar protein Bop1, involved in ribosome biogenesis [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG1034 consensus Transcriptional repressor EED/ESC/FIE, required for transcriptional silencing, WD repeat superfamily [Transcription] Back     alignment and domain information
>KOG0264 consensus Nucleosome remodeling factor, subunit CAF1/NURF55/MSI1 [Chromatin structure and dynamics] Back     alignment and domain information
>COG2319 FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>KOG2445 consensus Nuclear pore complex component (sc Seh1) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0270 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG4378 consensus Nuclear protein COP1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0322 consensus G-protein beta subunit-like protein GNB1L, contains WD repeats [General function prediction only] Back     alignment and domain information
>KOG0267 consensus Microtubule severing protein katanin p80 subunit B (contains WD40 repeats) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0302 consensus Ribosome Assembly protein [General function prediction only] Back     alignment and domain information
>KOG1240 consensus Protein kinase containing WD40 repeats [Signal transduction mechanisms] Back     alignment and domain information
>KOG1009 consensus Chromatin assembly complex 1 subunit B/CAC2 (contains WD40 repeats) [Chromatin structure and dynamics; Replication, recombination and repair] Back     alignment and domain information
>KOG1963 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG2919 consensus Guanine nucleotide-binding protein [General function prediction only] Back     alignment and domain information
>KOG4227 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>COG2319 FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>KOG0302 consensus Ribosome Assembly protein [General function prediction only] Back     alignment and domain information
>KOG1912 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1517 consensus Guanine nucleotide binding protein MIP1 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>KOG4328 consensus WD40 protein [Function unknown] Back     alignment and domain information
>KOG1517 consensus Guanine nucleotide binding protein MIP1 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0642 consensus Cell-cycle nuclear protein, contains WD-40 repeats [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0307 consensus Vesicle coat complex COPII, subunit SEC31 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0307 consensus Vesicle coat complex COPII, subunit SEC31 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4227 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1009 consensus Chromatin assembly complex 1 subunit B/CAC2 (contains WD40 repeats) [Chromatin structure and dynamics; Replication, recombination and repair] Back     alignment and domain information
>KOG1587 consensus Cytoplasmic dynein intermediate chain [Cytoskeleton] Back     alignment and domain information
>KOG0322 consensus G-protein beta subunit-like protein GNB1L, contains WD repeats [General function prediction only] Back     alignment and domain information
>KOG0270 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG1034 consensus Transcriptional repressor EED/ESC/FIE, required for transcriptional silencing, WD repeat superfamily [Transcription] Back     alignment and domain information
>KOG4378 consensus Nuclear protein COP1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG2919 consensus Guanine nucleotide-binding protein [General function prediction only] Back     alignment and domain information
>KOG0771 consensus Prolactin regulatory element-binding protein/Protein transport protein SEC12p [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0644 consensus Uncharacterized conserved protein, contains WD40 repeat and BROMO domains [General function prediction only] Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>KOG1007 consensus WD repeat protein TSSC1, WD repeat superfamily [Function unknown] Back     alignment and domain information
>KOG0303 consensus Actin-binding protein Coronin, contains WD40 repeats [Cytoskeleton] Back     alignment and domain information
>KOG1523 consensus Actin-related protein Arp2/3 complex, subunit ARPC1/p41-ARC [Cytoskeleton] Back     alignment and domain information
>KOG0642 consensus Cell-cycle nuclear protein, contains WD-40 repeats [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1007 consensus WD repeat protein TSSC1, WD repeat superfamily [Function unknown] Back     alignment and domain information
>KOG1587 consensus Cytoplasmic dynein intermediate chain [Cytoskeleton] Back     alignment and domain information
>KOG0644 consensus Uncharacterized conserved protein, contains WD40 repeat and BROMO domains [General function prediction only] Back     alignment and domain information
>PRK01742 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1310 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG2110 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] Back     alignment and domain information
>KOG0303 consensus Actin-binding protein Coronin, contains WD40 repeats [Cytoskeleton] Back     alignment and domain information
>KOG0290 consensus Conserved WD40 repeat-containing protein AN11 [Function unknown] Back     alignment and domain information
>KOG1524 consensus WD40 repeat-containing protein CHE-2 [General function prediction only] Back     alignment and domain information
>KOG4497 consensus Uncharacterized conserved protein WDR8, contains WD repeats [General function prediction only] Back     alignment and domain information
>KOG0649 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0771 consensus Prolactin regulatory element-binding protein/Protein transport protein SEC12p [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1188 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PRK01742 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF04762 IKI3: IKI3 family; InterPro: IPR006849 Members of this family are components of the elongator multi-subunit component of a novel RNA polymerase II holoenzyme for transcriptional elongation [] Back     alignment and domain information
>KOG0974 consensus WD-repeat protein WDR6, WD repeat superfamily [General function prediction only] Back     alignment and domain information
>KOG0290 consensus Conserved WD40 repeat-containing protein AN11 [Function unknown] Back     alignment and domain information
>KOG2111 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] Back     alignment and domain information
>KOG1240 consensus Protein kinase containing WD40 repeats [Signal transduction mechanisms] Back     alignment and domain information
>KOG2394 consensus WD40 protein DMR-N9 [General function prediction only] Back     alignment and domain information
>KOG2394 consensus WD40 protein DMR-N9 [General function prediction only] Back     alignment and domain information
>KOG2139 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0649 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG4497 consensus Uncharacterized conserved protein WDR8, contains WD repeats [General function prediction only] Back     alignment and domain information
>KOG2321 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG2110 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] Back     alignment and domain information
>PRK03629 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A Back     alignment and domain information
>KOG1334 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK03629 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK02889 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1272 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG1524 consensus WD40 repeat-containing protein CHE-2 [General function prediction only] Back     alignment and domain information
>PRK02889 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1523 consensus Actin-related protein Arp2/3 complex, subunit ARPC1/p41-ARC [Cytoskeleton] Back     alignment and domain information
>KOG2111 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] Back     alignment and domain information
>KOG1334 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1272 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG2139 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF08662 eIF2A: Eukaryotic translation initiation factor eIF2A; InterPro: IPR013979 This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins Back     alignment and domain information
>KOG3881 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>PF08662 eIF2A: Eukaryotic translation initiation factor eIF2A; InterPro: IPR013979 This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>KOG2321 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG2315 consensus Predicted translation initiation factor related to eIF-3a [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG5354 Uncharacterized protein, contains Trp-Asp (WD) repeat [General function prediction only] Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1912 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1310 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PRK01029 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG3881 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF04762 IKI3: IKI3 family; InterPro: IPR006849 Members of this family are components of the elongator multi-subunit component of a novel RNA polymerase II holoenzyme for transcriptional elongation [] Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1409 consensus Uncharacterized conserved protein, contains WD40 repeats and FYVE domains [Function unknown] Back     alignment and domain information
>KOG0974 consensus WD-repeat protein WDR6, WD repeat superfamily [General function prediction only] Back     alignment and domain information
>KOG2314 consensus Translation initiation factor 3, subunit b (eIF-3b) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>KOG1409 consensus Uncharacterized conserved protein, contains WD40 repeats and FYVE domains [Function unknown] Back     alignment and domain information
>COG4946 Uncharacterized protein related to the periplasmic component of the Tol biopolymer transport system [Function unknown] Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>KOG1354 consensus Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms] Back     alignment and domain information
>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>KOG3914 consensus WD repeat protein WDR4 [Function unknown] Back     alignment and domain information
>COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG4547 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG4547 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG3914 consensus WD repeat protein WDR4 [Function unknown] Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>KOG1064 consensus RAVE (regulator of V-ATPase assembly) complex subunit RAV1/DMX protein, WD repeat superfamily [General function prediction only] Back     alignment and domain information
>PRK04043 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG2066 consensus Vacuolar assembly/sorting protein VPS41 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1064 consensus RAVE (regulator of V-ATPase assembly) complex subunit RAV1/DMX protein, WD repeat superfamily [General function prediction only] Back     alignment and domain information
>COG5354 Uncharacterized protein, contains Trp-Asp (WD) repeat [General function prediction only] Back     alignment and domain information
>COG5170 CDC55 Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms] Back     alignment and domain information
>PF15492 Nbas_N: Neuroblastoma-amplified sequence, N terminal Back     alignment and domain information
>PRK04043 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK01029 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1354 consensus Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms] Back     alignment and domain information
>PF11768 DUF3312: Protein of unknown function (DUF3312); InterPro: IPR024511 This is a eukaryotic family of uncharacterised proteins that contain WD40 repeats Back     alignment and domain information
>KOG4532 consensus WD40-like repeat containing protein [General function prediction only] Back     alignment and domain information
>COG4946 Uncharacterized protein related to the periplasmic component of the Tol biopolymer transport system [Function unknown] Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0280 consensus Uncharacterized conserved protein [Amino acid transport and metabolism] Back     alignment and domain information
>PF00400 WD40: WD domain, G-beta repeat; InterPro: IPR019781 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide Back     alignment and domain information
>KOG4714 consensus Nucleoporin [Nuclear structure] Back     alignment and domain information
>KOG2314 consensus Translation initiation factor 3, subunit b (eIF-3b) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG4714 consensus Nucleoporin [Nuclear structure] Back     alignment and domain information
>KOG2315 consensus Predicted translation initiation factor related to eIF-3a [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG3621 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK11138 outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>KOG4190 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4649 consensus PQQ (pyrrolo-quinoline quinone) repeat protein [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>KOG0280 consensus Uncharacterized conserved protein [Amino acid transport and metabolism] Back     alignment and domain information
>KOG0860 consensus Synaptobrevin/VAMP-like protein [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK11138 outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>PF11768 DUF3312: Protein of unknown function (DUF3312); InterPro: IPR024511 This is a eukaryotic family of uncharacterised proteins that contain WD40 repeats Back     alignment and domain information
>PF00957 Synaptobrevin: Synaptobrevin; InterPro: IPR001388 Synaptobrevin is an intrinsic membrane protein of small synaptic vesicles [], specialised secretory organelles of neurons that actively accumulate neurotransmitters and participate in their calcium-dependent release by exocytosis Back     alignment and domain information
>KOG4532 consensus WD40-like repeat containing protein [General function prediction only] Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG2695 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG3621 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF15492 Nbas_N: Neuroblastoma-amplified sequence, N terminal Back     alignment and domain information
>KOG1645 consensus RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1645 consensus RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>PF03178 CPSF_A: CPSF A subunit region; InterPro: IPR004871 This family includes a region that lies towards the C terminus of the cleavage and polyadenylation specificity factor (CPSF) A (160 kDa) subunit Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>KOG2695 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1897 consensus Damage-specific DNA binding complex, subunit DDB1 [Replication, recombination and repair] Back     alignment and domain information
>PF00400 WD40: WD domain, G-beta repeat; InterPro: IPR019781 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide Back     alignment and domain information
>KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information
>KOG4190 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF08596 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; InterPro: IPR013905 The Lethal giant larvae (Lgl) tumour suppressor protein is conserved from yeast to mammals Back     alignment and domain information
>PF07433 DUF1513: Protein of unknown function (DUF1513); InterPro: IPR008311 There are currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>COG5170 CDC55 Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms] Back     alignment and domain information
>KOG1832 consensus HIV-1 Vpr-binding protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0882 consensus Cyclophilin-related peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0309 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information
>KOG0882 consensus Cyclophilin-related peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1897 consensus Damage-specific DNA binding complex, subunit DDB1 [Replication, recombination and repair] Back     alignment and domain information
>PF06977 SdiA-regulated: SdiA-regulated; InterPro: IPR009722 This entry represents a conserved region approximately 100 residues long within a number of hypothetical bacterial proteins that may be regulated by SdiA, a member of the LuxR family of transcriptional regulators [] Back     alignment and domain information
>KOG4649 consensus PQQ (pyrrolo-quinoline quinone) repeat protein [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>KOG2079 consensus Vacuolar assembly/sorting protein VPS8 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0309 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG2066 consensus Vacuolar assembly/sorting protein VPS41 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>PF14783 BBS2_Mid: Ciliary BBSome complex subunit 2, middle region Back     alignment and domain information
>PF07433 DUF1513: Protein of unknown function (DUF1513); InterPro: IPR008311 There are currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>KOG4640 consensus Anaphase-promoting complex (APC), subunit 4 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK02888 nitrous-oxide reductase; Validated Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF00780 CNH: CNH domain; InterPro: IPR001180 Based on sequence similarities a domain of homology has been identified in the following proteins []: Citron and Citron kinase Back     alignment and domain information
>PF04841 Vps16_N: Vps16, N-terminal region; InterPro: IPR006926 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>PF12894 Apc4_WD40: Anaphase-promoting complex subunit 4 WD40 domain Back     alignment and domain information
>COG0823 TolB Periplasmic component of the Tol biopolymer transport system [Intracellular trafficking and secretion] Back     alignment and domain information
>PF00930 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-terminal region; InterPro: IPR002469 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>KOG2079 consensus Vacuolar assembly/sorting protein VPS8 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF00780 CNH: CNH domain; InterPro: IPR001180 Based on sequence similarities a domain of homology has been identified in the following proteins []: Citron and Citron kinase Back     alignment and domain information
>KOG1275 consensus PAB-dependent poly(A) ribonuclease, subunit PAN2 [Replication, recombination and repair] Back     alignment and domain information
>PF14783 BBS2_Mid: Ciliary BBSome complex subunit 2, middle region Back     alignment and domain information
>KOG4640 consensus Anaphase-promoting complex (APC), subunit 4 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs Back     alignment and domain information
>smart00320 WD40 WD40 repeats Back     alignment and domain information
>PF08553 VID27: VID27 cytoplasmic protein; InterPro: IPR013863 This entry represents fungal and plant proteins and contains many hypothetical proteins Back     alignment and domain information
>PF06977 SdiA-regulated: SdiA-regulated; InterPro: IPR009722 This entry represents a conserved region approximately 100 residues long within a number of hypothetical bacterial proteins that may be regulated by SdiA, a member of the LuxR family of transcriptional regulators [] Back     alignment and domain information
>PF14727 PHTB1_N: PTHB1 N-terminus Back     alignment and domain information
>KOG1008 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] Back     alignment and domain information
>KOG1275 consensus PAB-dependent poly(A) ribonuclease, subunit PAN2 [Replication, recombination and repair] Back     alignment and domain information
>COG0823 TolB Periplasmic component of the Tol biopolymer transport system [Intracellular trafficking and secretion] Back     alignment and domain information
>PF03178 CPSF_A: CPSF A subunit region; InterPro: IPR004871 This family includes a region that lies towards the C terminus of the cleavage and polyadenylation specificity factor (CPSF) A (160 kDa) subunit Back     alignment and domain information
>COG3204 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF08553 VID27: VID27 cytoplasmic protein; InterPro: IPR013863 This entry represents fungal and plant proteins and contains many hypothetical proteins Back     alignment and domain information
>KOG4499 consensus Ca2+-binding protein Regucalcin/SMP30 [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>PRK13616 lipoprotein LpqB; Provisional Back     alignment and domain information
>KOG0859 consensus Synaptobrevin/VAMP-like protein [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG3391 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF06433 Me-amine-dh_H: Methylamine dehydrogenase heavy chain (MADH); InterPro: IPR009451 Methylamine dehydrogenase (1 Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>COG3391 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG3204 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG1008 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] Back     alignment and domain information
>cd00216 PQQ_DH Dehydrogenases with pyrrolo-quinoline quinone (PQQ) as cofactor, like ethanol, methanol, and membrane bound glucose dehydrogenases Back     alignment and domain information
>PF10647 Gmad1: Lipoprotein LpqB beta-propeller domain; InterPro: IPR018910 The Gmad1 domain is found associated with IPR019606 from INTERPRO, in bacterial spore formation Back     alignment and domain information
>PF06433 Me-amine-dh_H: Methylamine dehydrogenase heavy chain (MADH); InterPro: IPR009451 Methylamine dehydrogenase (1 Back     alignment and domain information
>smart00320 WD40 WD40 repeats Back     alignment and domain information
>KOG1832 consensus HIV-1 Vpr-binding protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>COG3386 Gluconolactonase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF12894 Apc4_WD40: Anaphase-promoting complex subunit 4 WD40 domain Back     alignment and domain information
>KOG2395 consensus Protein involved in vacuole import and degradation [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG3630 consensus Nuclear pore complex, Nup214/CAN component [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF02897 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal beta-propeller domain; InterPro: IPR004106 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PRK13616 lipoprotein LpqB; Provisional Back     alignment and domain information
>PF14727 PHTB1_N: PTHB1 N-terminus Back     alignment and domain information
>PF10647 Gmad1: Lipoprotein LpqB beta-propeller domain; InterPro: IPR018910 The Gmad1 domain is found associated with IPR019606 from INTERPRO, in bacterial spore formation Back     alignment and domain information
>KOG2444 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>TIGR03118 PEPCTERM_chp_1 conserved hypothetical protein TIGR03118 Back     alignment and domain information
>PRK02888 nitrous-oxide reductase; Validated Back     alignment and domain information
>KOG2444 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF14781 BBS2_N: Ciliary BBSome complex subunit 2, N-terminal Back     alignment and domain information
>COG3490 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF14655 RAB3GAP2_N: Rab3 GTPase-activating protein regulatory subunit N-terminus Back     alignment and domain information
>cd00216 PQQ_DH Dehydrogenases with pyrrolo-quinoline quinone (PQQ) as cofactor, like ethanol, methanol, and membrane bound glucose dehydrogenases Back     alignment and domain information
>PF04841 Vps16_N: Vps16, N-terminal region; InterPro: IPR006926 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>PF14583 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C5M_C 3PE7_A Back     alignment and domain information
>TIGR03075 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methanol/ethanol family Back     alignment and domain information
>COG3490 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF10979 DUF2786: Protein of unknown function (DUF2786); InterPro: IPR024498 This domain is found in proteins that have no known function Back     alignment and domain information
>PF05096 Glu_cyclase_2: Glutamine cyclotransferase; InterPro: IPR007788 This family of enzymes 2 Back     alignment and domain information
>PF08728 CRT10: CRT10; InterPro: IPR014839 CRT10 is a transcriptional regulator of ribonucleotide reductase (RNR) genes [] Back     alignment and domain information
>KOG3630 consensus Nuclear pore complex, Nup214/CAN component [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF08728 CRT10: CRT10; InterPro: IPR014839 CRT10 is a transcriptional regulator of ribonucleotide reductase (RNR) genes [] Back     alignment and domain information
>PF14870 PSII_BNR: Photosynthesis system II assembly factor YCF48; PDB: 2XBG_A Back     alignment and domain information
>PF14870 PSII_BNR: Photosynthesis system II assembly factor YCF48; PDB: 2XBG_A Back     alignment and domain information
>PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs Back     alignment and domain information
>PF10395 Utp8: Utp8 family; InterPro: IPR018843 Utp8 is an essential component of the nuclear tRNA export machinery in Saccharomyces cerevisiae (Baker's yeast) Back     alignment and domain information
>PF15390 DUF4613: Domain of unknown function (DUF4613) Back     alignment and domain information
>PF14655 RAB3GAP2_N: Rab3 GTPase-activating protein regulatory subunit N-terminus Back     alignment and domain information
>PF08366 LLGL: LLGL2; InterPro: IPR013577 This domain is found in lethal giant larvae homologue 2 (LLGL2) proteins and syntaxin-binding proteins like tomosyn [] Back     alignment and domain information
>KOG2395 consensus Protein involved in vacuole import and degradation [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF14781 BBS2_N: Ciliary BBSome complex subunit 2, N-terminal Back     alignment and domain information
>PF14761 HPS3_N: Hermansky-Pudlak syndrome 3 Back     alignment and domain information
>COG3386 Gluconolactonase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF12657 TFIIIC_delta: Transcription factor IIIC subunit delta N-term; InterPro: IPR024761 This entry represents a domain found towards the N terminus of the 90 kDa subunit of transcription factor IIIC (also known as subunit 9 in yeast []) Back     alignment and domain information
>PF14583 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C5M_C 3PE7_A Back     alignment and domain information
>PF13449 Phytase-like: Esterase-like activity of phytase Back     alignment and domain information
>TIGR02604 Piru_Ver_Nterm putative membrane-bound dehydrogenase domain Back     alignment and domain information
>PF07569 Hira: TUP1-like enhancer of split; InterPro: IPR011494 The Hira proteins are found in a range of eukaryotes and are implicated in the assembly of repressive chromatin Back     alignment and domain information
>PF10313 DUF2415: Uncharacterised protein domain (DUF2415); InterPro: IPR019417 This entry represents a short (30 residues) domain of unknown function found in a family of fungal proteins Back     alignment and domain information
>PF11635 Med16: Mediator complex subunit 16; InterPro: IPR021665 Mediator is a large complex of up to 33 proteins that is conserved from plants through fungi to humans - the number and representation of individual subunits varying with species [],[] Back     alignment and domain information
>PF12768 Rax2: Cortical protein marker for cell polarity Back     alignment and domain information
>KOG1896 consensus mRNA cleavage and polyadenylation factor II complex, subunit CFT1 (CPSF subunit) [RNA processing and modification] Back     alignment and domain information
>PF14761 HPS3_N: Hermansky-Pudlak syndrome 3 Back     alignment and domain information
>PLN00033 photosystem II stability/assembly factor; Provisional Back     alignment and domain information
>PF02897 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal beta-propeller domain; InterPro: IPR004106 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>KOG1898 consensus Splicing factor 3b, subunit 3 [RNA processing and modification] Back     alignment and domain information
>PRK13684 Ycf48-like protein; Provisional Back     alignment and domain information
>PF12234 Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR022033 This domain family is found in eukaryotes, and is typically between 621 and 644 amino acids in length Back     alignment and domain information
>PF15390 DUF4613: Domain of unknown function (DUF4613) Back     alignment and domain information
>KOG2280 consensus Vacuolar assembly/sorting protein VPS16 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF07569 Hira: TUP1-like enhancer of split; InterPro: IPR011494 The Hira proteins are found in a range of eukaryotes and are implicated in the assembly of repressive chromatin Back     alignment and domain information
>PF07995 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: IPR012938 Proteins containing this domain are thought to be glucose/sorbosone dehydrogenases Back     alignment and domain information
>PF10313 DUF2415: Uncharacterised protein domain (DUF2415); InterPro: IPR019417 This entry represents a short (30 residues) domain of unknown function found in a family of fungal proteins Back     alignment and domain information
>PRK13684 Ycf48-like protein; Provisional Back     alignment and domain information
>KOG4460 consensus Nuclear pore complex, Nup88/rNup84 component [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF14779 BBS1: Ciliary BBSome complex subunit 1 Back     alignment and domain information
>PRK10115 protease 2; Provisional Back     alignment and domain information
>PF11715 Nup160: Nucleoporin Nup120/160; InterPro: IPR021717 Nup120 is conserved from fungi to plants to humans, and is homologous with the Nup160 of vertebrates Back     alignment and domain information
>TIGR03075 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methanol/ethanol family Back     alignment and domain information
>PF13449 Phytase-like: Esterase-like activity of phytase Back     alignment and domain information
>COG5167 VID27 Protein involved in vacuole import and degradation [Intracellular trafficking and secretion] Back     alignment and domain information
>PF00930 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-terminal region; InterPro: IPR002469 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1100
2oaj_A902 Crystal Structure Of Sro7 From S. Cerevisiae Length 1e-10
>pdb|2OAJ|A Chain A, Crystal Structure Of Sro7 From S. Cerevisiae Length = 902 Back     alignment and structure

Iteration: 1

Score = 65.9 bits (159), Expect = 1e-10, Method: Compositional matrix adjust. Identities = 49/167 (29%), Positives = 80/167 (47%), Gaps = 8/167 (4%) Query: 32 YGIPATASILAFDHIQRLLAIATLDGRIKVIGGDGIEGLLISPSQLPYKNLEFLQNQGFL 91 YG+ + AFD Q LLAIAT+ G + + G +E ++ + K + F++ +L Sbjct: 14 YGMSSKPIAAAFDFTQNLLAIATVTGEVHIYGQQQVEVVIKLEDRSAIKEMRFVKGI-YL 72 Query: 92 ISITNDNEIQVWSLESRSLACCLKWESNITAFSVISGSHFMYIGDENGLMSVIKYDADEG 151 + I + + V SL S+ + + IT+ + +M IG +NG M V D D+ Sbjct: 73 VVINAKDTVYVLSLYSQKVLTTVFVPGKITSIDTDASLDWMLIGLQNGSMIVYDIDRDQL 132 Query: 152 KLFQLPYNISADALSEKAGFPLLSHQPVVGVLPHPNSSGNRVLIAYE 198 F+L D L + + FP P+V + +P G VLI+YE Sbjct: 133 SSFKL------DNLQKSSFFPAARLSPIVSIQWNPRDIGT-VLISYE 172

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query1100
2oaj_A902 Protein SNI1; WD40 repeat, beta propeller, endocyt 100.0
2ymu_A577 WD-40 repeat protein; unknown function, two domain 100.0
2ymu_A577 WD-40 repeat protein; unknown function, two domain 100.0
1nr0_A611 Actin interacting protein 1; beta propeller, WD40 100.0
1nr0_A611 Actin interacting protein 1; beta propeller, WD40 100.0
3sfz_A1249 APAF-1, apoptotic peptidase activating factor 1; a 100.0
1pgu_A615 Actin interacting protein 1; WD repeat, seven-blad 100.0
3sfz_A1249 APAF-1, apoptotic peptidase activating factor 1; a 100.0
1pgu_A615 Actin interacting protein 1; WD repeat, seven-blad 100.0
2oaj_A902 Protein SNI1; WD40 repeat, beta propeller, endocyt 100.0
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 100.0
1vyh_C410 Platelet-activating factor acetylhydrolase IB alph 100.0
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 100.0
1vyh_C410 Platelet-activating factor acetylhydrolase IB alph 100.0
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 100.0
3fm0_A345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 100.0
3ow8_A321 WD repeat-containing protein 61; structural genomi 100.0
3ow8_A321 WD repeat-containing protein 61; structural genomi 100.0
2ynn_A304 Coatomer subunit beta'; protein transport, peptide 100.0
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 100.0
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 100.0
4g56_B357 MGC81050 protein; protein arginine methyltransfera 100.0
2ynn_A304 Coatomer subunit beta'; protein transport, peptide 100.0
3iz6_a380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 100.0
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 100.0
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 100.0
2pm9_A416 Protein WEB1, protein transport protein SEC31; bet 100.0
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 100.0
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 100.0
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 100.0
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 100.0
3vl1_A420 26S proteasome regulatory subunit RPN14; beta-prop 100.0
1erj_A393 Transcriptional repressor TUP1; beta-propeller, tr 100.0
4ery_A312 WD repeat-containing protein 5; WD40, WIN motif, b 100.0
4g56_B357 MGC81050 protein; protein arginine methyltransfera 100.0
3frx_A319 Guanine nucleotide-binding protein subunit beta- l 100.0
1erj_A393 Transcriptional repressor TUP1; beta-propeller, tr 100.0
3fm0_A345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 100.0
2xzm_R343 RACK1; ribosome, translation; 3.93A {Tetrahymena t 100.0
3iz6_a380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 100.0
3vl1_A420 26S proteasome regulatory subunit RPN14; beta-prop 100.0
2hes_X330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 100.0
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 99.98
3frx_A319 Guanine nucleotide-binding protein subunit beta- l 99.98
2pm9_A416 Protein WEB1, protein transport protein SEC31; bet 99.98
2hes_X330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 99.98
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 99.98
2xzm_R343 RACK1; ribosome, translation; 3.93A {Tetrahymena t 99.98
4ery_A312 WD repeat-containing protein 5; WD40, WIN motif, b 99.98
3gre_A437 Serine/threonine-protein kinase VPS15; seven-blade 99.97
3zwl_B369 Eukaryotic translation initiation factor 3 subuni; 99.97
2ovr_B445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 99.97
3ei3_B383 DNA damage-binding protein 2; UV-damage, DDB, nucl 99.97
2j04_B524 YDR362CP, TAU91; beta propeller, type 2 promoters, 99.97
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 99.97
3k26_A366 Polycomb protein EED; WD40, structural genomics, N 99.97
3i2n_A357 WD repeat-containing protein 92; WD40 repeats, str 99.97
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 99.97
3zwl_B369 Eukaryotic translation initiation factor 3 subuni; 99.97
4a11_B408 DNA excision repair protein ERCC-8; DNA binding pr 99.97
4e54_B435 DNA damage-binding protein 2; beta barrel, double 99.97
1k8k_C372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 99.97
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 99.97
1k8k_C372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 99.97
3dm0_A694 Maltose-binding periplasmic protein fused with RAC 99.97
3k26_A366 Polycomb protein EED; WD40, structural genomics, N 99.97
4h5i_A365 Guanine nucleotide-exchange factor SEC12; copii ve 99.97
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 99.97
3odt_A313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 99.97
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 99.97
3ei3_B383 DNA damage-binding protein 2; UV-damage, DDB, nucl 99.96
2ovr_B445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 99.96
2j04_B524 YDR362CP, TAU91; beta propeller, type 2 promoters, 99.96
3gre_A437 Serine/threonine-protein kinase VPS15; seven-blade 99.96
4a11_B408 DNA excision repair protein ERCC-8; DNA binding pr 99.96
3dwl_C377 Actin-related protein 2/3 complex subunit 1; prope 99.96
3i2n_A357 WD repeat-containing protein 92; WD40 repeats, str 99.96
3dwl_C377 Actin-related protein 2/3 complex subunit 1; prope 99.96
4e54_B435 DNA damage-binding protein 2; beta barrel, double 99.96
3dm0_A694 Maltose-binding periplasmic protein fused with RAC 99.96
3odt_A313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 99.96
2j04_A588 TAU60, YPL007P, hypothetical protein YPL007C; beta 99.96
4gga_A420 P55CDC, cell division cycle protein 20 homolog; ce 99.96
2pm7_B297 Protein transport protein SEC13, protein transport 99.96
4gga_A420 P55CDC, cell division cycle protein 20 homolog; ce 99.95
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 99.95
1yfq_A342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 99.95
4ggc_A318 P55CDC, cell division cycle protein 20 homolog; ce 99.95
3dw8_B447 Serine/threonine-protein phosphatase 2A 55 kDa RE 99.95
3bg1_A316 Protein SEC13 homolog; NPC, transport, WD repeat, 99.95
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 99.95
2pm7_B297 Protein transport protein SEC13, protein transport 99.95
3f3f_A351 Nucleoporin SEH1; structural protein, protein comp 99.95
4ggc_A318 P55CDC, cell division cycle protein 20 homolog; ce 99.95
1yfq_A342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 99.95
3mmy_A368 MRNA export factor; mRNA export, nuclear protein; 99.95
4h5i_A365 Guanine nucleotide-exchange factor SEC12; copii ve 99.95
1p22_A435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 99.95
1p22_A435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 99.95
3dw8_B447 Serine/threonine-protein phosphatase 2A 55 kDa RE 99.95
3f3f_A351 Nucleoporin SEH1; structural protein, protein comp 99.94
3mmy_A368 MRNA export factor; mRNA export, nuclear protein; 99.94
3bg1_A316 Protein SEC13 homolog; NPC, transport, WD repeat, 99.94
3jrp_A379 Fusion protein of protein transport protein SEC13 99.94
3jrp_A379 Fusion protein of protein transport protein SEC13 99.93
2aq5_A402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 99.93
1k32_A 1045 Tricorn protease; protein degradation, substrate g 99.93
2vdu_B450 TRNA (guanine-N(7)-)-methyltransferase- associated 99.92
2xyi_A430 Probable histone-binding protein CAF1; transcripti 99.92
3vu4_A355 KMHSV2; beta-propeller fold, protein transport; 2. 99.92
4gq1_A393 NUP37; propeller, transport protein; 2.40A {Schizo 99.92
1k32_A1045 Tricorn protease; protein degradation, substrate g 99.92
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 99.92
3vu4_A355 KMHSV2; beta-propeller fold, protein transport; 2. 99.92
3jro_A753 Fusion protein of protein transport protein SEC13 99.92
2j04_A588 TAU60, YPL007P, hypothetical protein YPL007C; beta 99.91
1l0q_A391 Surface layer protein; SLP, S-layer, 7-bladed beta 99.91
2vdu_B450 TRNA (guanine-N(7)-)-methyltransferase- associated 99.91
4gq1_A393 NUP37; propeller, transport protein; 2.40A {Schizo 99.91
2aq5_A402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 99.91
2xyi_A430 Probable histone-binding protein CAF1; transcripti 99.91
3jro_A753 Fusion protein of protein transport protein SEC13 99.9
3lrv_A343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 99.9
1l0q_A391 Surface layer protein; SLP, S-layer, 7-bladed beta 99.9
1nir_A543 Nitrite reductase; hemoprotein, denitrification, d 99.89
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 99.89
3lrv_A343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 99.89
2w18_A356 PALB2, fancn, partner and localizer of BRCA2; fanc 99.88
1nir_A543 Nitrite reductase; hemoprotein, denitrification, d 99.87
2ecf_A741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 99.86
2hqs_A415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 99.84
2w18_A356 PALB2, fancn, partner and localizer of BRCA2; fanc 99.83
2z3z_A706 Dipeptidyl aminopeptidase IV; peptidase family S9, 99.83
1xfd_A723 DIP, dipeptidyl aminopeptidase-like protein 6, dip 99.8
2ecf_A741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 99.8
2hqs_A415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 99.79
1ri6_A343 Putative isomerase YBHE; 7-bladed propeller, enzym 99.79
1ri6_A343 Putative isomerase YBHE; 7-bladed propeller, enzym 99.78
1pby_B337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 99.76
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 99.75
2z3z_A706 Dipeptidyl aminopeptidase IV; peptidase family S9, 99.75
3u4y_A331 Uncharacterized protein; structural genomics, PSI- 99.75
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 99.73
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 99.72
1z68_A719 Fibroblast activation protein, alpha subunit; sepr 99.72
3u4y_A331 Uncharacterized protein; structural genomics, PSI- 99.7
3o4h_A582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 99.7
1xfd_A723 DIP, dipeptidyl aminopeptidase-like protein 6, dip 99.69
3hfq_A347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 99.69
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 99.68
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 99.68
3hfq_A347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 99.67
1jmx_B349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 99.67
3o4h_A582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 99.65
2oit_A434 Nucleoporin 214KDA; NH2 terminal domain of NUP214/ 99.65
1z68_A719 Fibroblast activation protein, alpha subunit; sepr 99.61
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 99.6
1jof_A365 Carboxy-CIS,CIS-muconate cyclase; beta-propeller, 99.59
4a5s_A740 Dipeptidyl peptidase 4 soluble form; hydrolase, ty 99.59
1pby_B337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 99.56
2oit_A434 Nucleoporin 214KDA; NH2 terminal domain of NUP214/ 99.55
1jof_A365 Carboxy-CIS,CIS-muconate cyclase; beta-propeller, 99.55
3pe7_A388 Oligogalacturonate lyase; seven-bladed beta-propel 99.53
3pe7_A388 Oligogalacturonate lyase; seven-bladed beta-propel 99.51
2oiz_A361 Aromatic amine dehydrogenase, large subunit; oxido 99.46
3c5m_A396 Oligogalacturonate lyase; blade-shaped beta-propel 99.45
3azo_A662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 99.44
3azo_A662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 99.43
1jmx_B349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 99.42
1urq_A63 M-tomosyn isoform; transport protein, tomosyn-snar 99.4
1qks_A567 Cytochrome CD1 nitrite reductase; enzyme, oxidored 99.39
2oiz_A361 Aromatic amine dehydrogenase, large subunit; oxido 99.39
4a5s_A740 Dipeptidyl peptidase 4 soluble form; hydrolase, ty 99.39
2gop_A347 Trilobed protease; beta propeller, open velcro, hy 99.33
1qks_A567 Cytochrome CD1 nitrite reductase; enzyme, oxidored 99.32
2gop_A347 Trilobed protease; beta propeller, open velcro, hy 99.24
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 99.24
2dg1_A333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 99.21
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 99.19
2xdw_A710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 99.18
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 99.16
2bkl_A695 Prolyl endopeptidase; mechanistic study, celiac sp 99.15
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 99.13
3e5z_A296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 99.12
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 99.1
2dg1_A333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 99.09
1xip_A388 Nucleoporin NUP159; beta-propeller, transport prot 99.07
3c5m_A396 Oligogalacturonate lyase; blade-shaped beta-propel 99.06
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 99.06
3sjl_D386 Methylamine dehydrogenase heavy chain; MAUG, C-hem 99.02
2xdw_A710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 99.02
3e5z_A296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 98.96
1yr2_A741 Prolyl oligopeptidase; prolyl endopeptidase, mecha 98.96
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 98.95
2mad_H373 Methylamine dehydrogenase (heavy subunit); oxidore 98.95
3no2_A276 Uncharacterized protein; six-bladed beta-propeller 98.95
1pjx_A314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 98.94
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 98.94
2bkl_A695 Prolyl endopeptidase; mechanistic study, celiac sp 98.9
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 98.89
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 98.87
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 98.82
3sjl_D386 Methylamine dehydrogenase heavy chain; MAUG, C-hem 98.8
4a2l_A795 BT_4663, two-component system sensor histidine kin 98.79
4a2l_A795 BT_4663, two-component system sensor histidine kin 98.79
3v9f_A781 Two-component system sensor histidine kinase/RESP 98.78
2mad_H373 Methylamine dehydrogenase (heavy subunit); oxidore 98.78
3hrp_A409 Uncharacterized protein; NP_812590.1, structural g 98.77
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 98.74
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 98.73
1xip_A388 Nucleoporin NUP159; beta-propeller, transport prot 98.73
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 98.72
1pjx_A314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 98.67
3c75_H426 MADH, methylamine dehydrogenase heavy chain; coppe 98.64
3no2_A276 Uncharacterized protein; six-bladed beta-propeller 98.64
3q7m_A376 Lipoprotein YFGL, BAMB; beta-propeller, BAM comple 98.63
1yr2_A741 Prolyl oligopeptidase; prolyl endopeptidase, mecha 98.63
3v9f_A781 Two-component system sensor histidine kinase/RESP 98.62
2ghs_A326 AGR_C_1268P; regucalcin, structural genomics, join 98.58
2ghs_A326 AGR_C_1268P; regucalcin, structural genomics, join 98.52
3q7m_A376 Lipoprotein YFGL, BAMB; beta-propeller, BAM comple 98.5
2qe8_A343 Uncharacterized protein; structural genomics, join 98.49
3c75_H426 MADH, methylamine dehydrogenase heavy chain; coppe 98.49
3dr2_A305 Exported gluconolactonase; gluconolactonase SMP-30 98.49
3iuj_A693 Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas 98.48
1kb0_A677 Quinohemoprotein alcohol dehydrogenase; beta-prope 98.48
3iuj_A693 Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas 98.48
3hrp_A409 Uncharacterized protein; NP_812590.1, structural g 98.45
3dr2_A305 Exported gluconolactonase; gluconolactonase SMP-30 98.36
1yiq_A689 Quinohemoprotein alcohol dehydrogenase; electron t 98.34
2qe8_A343 Uncharacterized protein; structural genomics, join 98.23
1mda_H368 Methylamine dehydrogenase (heavy subunit); electro 98.21
1l4a_A80 Synaptobrevin; snare, snare complex, membrane fusi 98.18
1yiq_A689 Quinohemoprotein alcohol dehydrogenase; electron t 98.13
1mda_H368 Methylamine dehydrogenase (heavy subunit); electro 98.11
2hz6_A369 Endoplasmic reticulum to nucleus signalling 1 isof 98.08
2ece_A462 462AA long hypothetical selenium-binding protein; 98.07
2iwa_A266 Glutamine cyclotransferase; pyroglutamate, acyltra 98.06
1kb0_A677 Quinohemoprotein alcohol dehydrogenase; beta-prope 98.06
1sfc_A96 VAMP 2, protein (synaptobrevin 2); membrane fusion 98.04
1n7s_A63 Vesicle-associated membrane protein 2; neuronal sn 98.03
1npe_A267 Nidogen, entactin; glycoprotein, basement membrane 98.03
1fwx_A595 Nitrous oxide reductase; beta-propeller domain, cu 98.02
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 97.99
3s94_A619 LRP-6, low-density lipoprotein receptor-related pr 97.99
3ei3_A1158 DNA damage-binding protein 1; UV-damage, DDB, nucl 97.97
3hxj_A330 Pyrrolo-quinoline quinone; all beta protein. incom 97.93
3hd7_A91 Vesicle-associated membrane protein 2; membrane pr 97.91
2fp8_A322 Strictosidine synthase; six bladed beta propeller 97.88
2ece_A462 462AA long hypothetical selenium-binding protein; 97.88
3qqz_A255 Putative uncharacterized protein YJIK; MCSG, PSI-2 97.84
1kv9_A668 Type II quinohemoprotein alcohol dehydrogenase; el 97.76
3mbr_X243 Glutamine cyclotransferase; beta-propeller; 1.44A 97.75
2nps_A74 VAMP-4, vesicle-associated membrane protein 4; ves 97.74
4a0p_A628 LRP6, LRP-6, low-density lipoprotein receptor-rela 97.71
2ad6_A571 Methanol dehydrogenase subunit 1; PQQ configuratio 97.7
1fwx_A595 Nitrous oxide reductase; beta-propeller domain, cu 97.7
2kog_A119 Vesicle-associated membrane protein 2; synaptobrev 97.66
3ei3_A1158 DNA damage-binding protein 1; UV-damage, DDB, nucl 97.62
2iwa_A266 Glutamine cyclotransferase; pyroglutamate, acyltra 97.56
3nok_A268 Glutaminyl cyclase; beta-propeller, cyclotransfera 97.55
3mbr_X243 Glutamine cyclotransferase; beta-propeller; 1.44A 97.52
2hz6_A369 Endoplasmic reticulum to nucleus signalling 1 isof 97.52
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 97.52
1w6s_A599 Methanol dehydrogenase subunit 1; anisotropic, ele 97.5
3b5n_A61 Synaptobrevin homolog 1; snare complex, syntaxin, 97.49
3nok_A268 Glutaminyl cyclase; beta-propeller, cyclotransfera 97.49
1kv9_A668 Type II quinohemoprotein alcohol dehydrogenase; el 97.38
1npe_A267 Nidogen, entactin; glycoprotein, basement membrane 97.38
2xe4_A751 Oligopeptidase B; hydrolase-inhibitor complex, hyd 97.37
2p4o_A306 Hypothetical protein; putative lactonase, structur 97.36
2fp8_A322 Strictosidine synthase; six bladed beta propeller 97.32
1flg_A582 Protein (quinoprotein ethanol dehydrogenase); supe 97.26
1ijq_A316 LDL receptor, low-density lipoprotein receptor; be 97.25
3hxj_A330 Pyrrolo-quinoline quinone; all beta protein. incom 97.12
1flg_A582 Protein (quinoprotein ethanol dehydrogenase); supe 97.09
3v65_B386 Low-density lipoprotein receptor-related protein; 97.08
3v64_C349 Agrin; beta propeller, laminin-G, signaling, prote 97.07
1gl2_A65 Endobrevin; membrane protein, membrane fusion prot 97.06
3amr_A355 3-phytase; beta-propeller, phytate, MYO-inositol h 97.05
3p5b_L400 Low density lipoprotein receptor variant; B-propel 97.04
3tc9_A430 Hypothetical hydrolase; 6-bladed beta-propeller, i 96.95
3sov_A318 LRP-6, low-density lipoprotein receptor-related pr 96.95
3m0c_C791 LDL receptor, low-density lipoprotein receptor; pr 96.79
4hw6_A433 Hypothetical protein, IPT/TIG domain protein; puta 96.76
1k3i_A656 Galactose oxidase precursor; blade beta propeller, 96.76
2p4o_A306 Hypothetical protein; putative lactonase, structur 96.74
3amr_A355 3-phytase; beta-propeller, phytate, MYO-inositol h 96.7
3qqz_A255 Putative uncharacterized protein YJIK; MCSG, PSI-2 96.6
1k3i_A656 Galactose oxidase precursor; blade beta propeller, 96.59
3v64_C349 Agrin; beta propeller, laminin-G, signaling, prote 96.54
2p9w_A334 MAL S 1 allergenic protein; beta propeller; 1.35A 96.45
3v65_B386 Low-density lipoprotein receptor-related protein; 96.36
2ad6_A571 Methanol dehydrogenase subunit 1; PQQ configuratio 96.33
3tc9_A430 Hypothetical hydrolase; 6-bladed beta-propeller, i 96.32
2xbg_A327 YCF48-like protein; photosynthesis, photosystem II 96.02
3pbp_A452 Nucleoporin NUP82; beta-propeller, mRNA export, mR 95.99
3kya_A496 Putative phosphatase; structural genomics, joint c 95.93
1ijq_A316 LDL receptor, low-density lipoprotein receptor; be 95.78
2xe4_A751 Oligopeptidase B; hydrolase-inhibitor complex, hyd 95.61
2nut_C196 Vesicle-trafficking protein SEC22B; human copii SE 95.6
1n7d_A699 LDL receptor, low-density lipoprotein receptor; fa 95.54
1w6s_A599 Methanol dehydrogenase subunit 1; anisotropic, ele 95.49
4b93_A189 Vesicle-associated membrane protein 7; endocytosis 95.26
3kya_A496 Putative phosphatase; structural genomics, joint c 95.24
3p5b_L400 Low density lipoprotein receptor variant; B-propel 95.14
3sov_A318 LRP-6, low-density lipoprotein receptor-related pr 95.09
3m0c_C791 LDL receptor, low-density lipoprotein receptor; pr 94.84
4hw6_A433 Hypothetical protein, IPT/TIG domain protein; puta 94.53
4a0p_A628 LRP6, LRP-6, low-density lipoprotein receptor-rela 94.17
2p9w_A334 MAL S 1 allergenic protein; beta propeller; 1.35A 93.73
3pbp_A452 Nucleoporin NUP82; beta-propeller, mRNA export, mR 93.55
2xzh_A365 Clathrin heavy chain 1; endocytosis, endocytosis i 93.53
2xbg_A327 YCF48-like protein; photosynthesis, photosystem II 93.39
3ott_A758 Two-component system sensor histidine kinase; beta 93.32
3ott_A758 Two-component system sensor histidine kinase; beta 93.25
3sre_A355 PON1, serum paraoxonase; directed evolution, 6-bla 93.08
3a9g_A354 Putative uncharacterized protein; PQQ dependent de 92.41
3s94_A619 LRP-6, low-density lipoprotein receptor-related pr 89.97
2g8s_A353 Glucose/sorbosone dehydrogenases; bladed beta-prop 89.93
1n7d_A699 LDL receptor, low-density lipoprotein receptor; fa 89.6
3sre_A355 PON1, serum paraoxonase; directed evolution, 6-bla 89.55
3kyq_A199 YKT6, synaptobrevin homolog YKT6; V-snare homolog, 88.89
1bpo_A494 Protein (clathrin); clathrin endocytosis beta-prop 88.87
2ism_A352 Putative oxidoreductase; BL41XU spring-8, bladed b 87.72
2xzh_A365 Clathrin heavy chain 1; endocytosis, endocytosis i 87.7
2ism_A352 Putative oxidoreductase; BL41XU spring-8, bladed b 87.31
1cru_A454 Protein (soluble quinoprotein glucose dehydrogena; 86.65
1cru_A454 Protein (soluble quinoprotein glucose dehydrogena; 86.62
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 84.93
3s25_A302 Hypothetical 7-bladed beta-propeller-like protein; 84.63
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 84.27
3das_A347 Putative oxidoreductase; aldose sugar dehydrogenas 84.07
1bpo_A494 Protein (clathrin); clathrin endocytosis beta-prop 83.96
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 83.65
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 83.48
3uc1_A327 DNA gyrase subunit A; DNA binding protein, topoiso 83.14
1tl2_A236 L10, protein (tachylectin-2); animal lectin, horse 81.66
3a9g_A354 Putative uncharacterized protein; PQQ dependent de 81.46
3kci_A389 Probable E3 ubiquitin-protein ligase HERC2; WD40, 81.16
1tl2_A236 L10, protein (tachylectin-2); animal lectin, horse 80.85
>2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
Probab=100.00  E-value=4.9e-67  Score=671.33  Aligned_cols=778  Identities=15%  Similarity=0.189  Sum_probs=554.2

Q ss_pred             cccccceeeeecCCCCCeEEEEEcCCCCEEEEEECCCeEEEEeCCCceEEEeCCCCCCEEEEEEEeCCCEEEEEECCCcE
Q 001321           21 AADLNLRIAVHYGIPATASILAFDHIQRLLAIATLDGRIKVIGGDGIEGLLISPSQLPYKNLEFLQNQGFLISITNDNEI  100 (1100)
Q Consensus        21 ~~~~~~~~~~~~G~~~~v~~la~sp~~~lLA~gs~dG~I~vw~~~~~~~~~~~~h~~~V~~l~fs~d~~~Lls~s~d~~I  100 (1100)
                      ++.|++++.+++||++.|+|++|+|++++||+|+.||.|+||+....+......|..+|.+|+|+| +.+|++++.|++|
T Consensus         3 ~~~~~~~~~~~~gh~~~V~~lafspdg~~lAsgs~Dg~I~lw~~~~~~~~~~~~~~~~V~~l~fsp-g~~L~S~s~D~~v   81 (902)
T 2oaj_A            3 NKIFSLAETNKYGMSSKPIAAAFDFTQNLLAIATVTGEVHIYGQQQVEVVIKLEDRSAIKEMRFVK-GIYLVVINAKDTV   81 (902)
T ss_dssp             CTTEEEEEEEEEECSSCEEEEEEETTTTEEEEEETTSEEEEECSTTCEEEEECSSCCCEEEEEEET-TTEEEEEETTCEE
T ss_pred             hheeeeccccccCCCCCcEEEEECCCCCEEEEEeCCCEEEEEeCCCcEEEEEcCCCCCEEEEEEcC-CCEEEEEECcCeE
Confidence            578999999999999999999999999999999999999999999888888888999999999999 6799999999999


Q ss_pred             EEEEcCCCceeeeeecCCCeEEEEEecCCCEEEEEeCCCcEEEEEEecCCCeeeeeceeecccccccccCCCCCCCCCeE
Q 001321          101 QVWSLESRSLACCLKWESNITAFSVISGSHFMYIGDENGLMSVIKYDADEGKLFQLPYNISADALSEKAGFPLLSHQPVV  180 (1100)
Q Consensus       101 ~vWd~~s~~~l~~~~~~~~Vt~~~~s~~~~~l~~G~~dG~V~Iw~~d~~~~~l~~~~~~i~~~~~~~~~~~~~~~~~~V~  180 (1100)
                      ++||+.+++.+..+.+.+.|++++|+|+++++++|+.||+|++|+++.  +.+.  +|.++..+  +.......+.++|.
T Consensus        82 ~lWd~~~~~~~~~~~~~~~V~~v~~sp~g~~l~sgs~dg~V~lwd~~~--~~~~--~~~i~~~~--~~~~~~~~h~~~V~  155 (902)
T 2oaj_A           82 YVLSLYSQKVLTTVFVPGKITSIDTDASLDWMLIGLQNGSMIVYDIDR--DQLS--SFKLDNLQ--KSSFFPAARLSPIV  155 (902)
T ss_dssp             EEEETTTCSEEEEEECSSCEEEEECCTTCSEEEEEETTSCEEEEETTT--TEEE--EEEECCHH--HHHTCSSSCCCCCC
T ss_pred             EEEECCCCcEEEEEcCCCCEEEEEECCCCCEEEEEcCCCcEEEEECCC--Cccc--cceecccc--ccccccccCCCCeE
Confidence            999999999998888889999999999999999999999999999874  3432  34443211  00011234558999


Q ss_pred             EEEeccCCCCCEEEEEEcCCEEEEEEccCCEEEEEecCCcccccccccCCCCCCCCccccCCCCCCCCCCceEEEEEecC
Q 001321          181 GVLPHPNSSGNRVLIAYENALVILWDVSEAQIIFVGGGKDLQLKDGVVDSPSEGDSTFLEGISEHQPEEKEISALCWASS  260 (1100)
Q Consensus       181 sv~f~P~~~g~~ll~~~~dg~V~lwdl~~~~~~~~~~~~~~~~~~~l~~~~~g~~~~~g~~~~~~~~~~~~V~sl~w~sp  260 (1100)
                      +|+|+|. ++..+++|+.||.| +||+.+++....+.+       ...   .+.+...... .....+...|++++|. |
T Consensus       156 sl~~sp~-~~~~l~~g~~dg~v-lWd~~~~~~~~~~~~-------~~~---~g~~~~~~~~-~~~~~h~~~V~~v~fs-p  221 (902)
T 2oaj_A          156 SIQWNPR-DIGTVLISYEYVTL-TYSLVENEIKQSFIY-------ELP---PFAPGGDFSE-KTNEKRTPKVIQSLYH-P  221 (902)
T ss_dssp             EEEEETT-EEEEEEEECSSCEE-EEETTTTEEEEEECC-------CBC---TTCCCSTTCC-CTTSCBCCCEEEEEEC-T
T ss_pred             EEEEccC-CCCEEEEEeCCCcE-EEECCCCceEEEEec-------ccC---CcCCCccccc-ccccccCCCeEEEEEc-C
Confidence            9999995 34569999999999 999999987765543       110   1111111100 1111225789999996 9


Q ss_pred             CCCEEEEEEcCCcEEEEecCCCCCCCCccc---CCCCcceeeeccccCCCcceEEEEecccccCCCCCCceEEEEeCCCC
Q 001321          261 SGSILAVGYIDGDILLWNTSTTASTKGQQT---GSRNNVVKLELSSAERRLPVIVLHWSTNKESRSNIDGRLFVYGGDEI  337 (1100)
Q Consensus       261 dg~~l~sg~~DG~I~lWd~~~~~~~~~~~~---~~~~~~~~l~~~~~~~~~~i~~~~w~~~~~~~~~~~~~llv~gg~~~  337 (1100)
                      +|.+|++|+.||.|++||+.+++....+.-   ....+........-....++..+.|++..   .+.++.++++|+.+.
T Consensus       222 dg~~lasgs~Dg~i~lWd~~~g~~~~~r~l~~~~~~~~~~~~~~~~~~~~~~V~~v~w~~~~---~pd~~~ll~sg~~~~  298 (902)
T 2oaj_A          222 NSLHIITIHEDNSLVFWDANSGHMIMARTVFETEINVPQPDYIRDSSTNAAKISKVYWMCEN---NPEYTSLLISHKSIS  298 (902)
T ss_dssp             TSSEEEEEETTCCEEEEETTTCCEEEEECSSCSCTTSCCTTCCCCCSSCCCEEEEEEEEECS---STTEEEEEEEEECST
T ss_pred             CCCEEEEEECCCeEEEEECCCCcEEEEEeecccccCCCCCcCCCCCccccCCeeEEEEEecC---CCCCCEEEEeCCCCC
Confidence            999999999999999999987743221000   00000000000000123468888887753   444567888887654


Q ss_pred             CC-cceEEEEEcCCccc------------cccceeeeeeeecCCCcceeEEEccCCCC--CCCCCcceEEEEecCCeeeE
Q 001321          338 GS-EEVLTVLSLEWSSG------------MENLRCVSRVDITLTGSFADMILLSSAGA--TVGNHKADLFVLTSPGQLHF  402 (1100)
Q Consensus       338 g~-~~~ltvl~l~~~~~------------~~~~~~~~~~~l~~~~~v~d~~~~p~~~~--~~~~~~~~l~vl~~~G~l~~  402 (1100)
                      +. ...+.++.+..+..            .....+...+.+.....+.++.+.++.++  .+.+++..+++++.+|.+.+
T Consensus       299 ~~~~~~v~~~~~~~~~~~~~~s~~~~~~~~~~~~~~~~~~~~~~~~v~~~~~~~~~sp~~~g~~d~~~l~~~s~dg~l~~  378 (902)
T 2oaj_A          299 RGDNQSLTMIDLGYTPRYSITSYEGMKNYYANPKQMKIFPLPTNVPIVNILPIPRQSPYFAGCHNPGLILLILGNGEIET  378 (902)
T ss_dssp             TSSCCCEEEEEEEECCCGGGCCHHHHHHHHHSCSEEEEECCSSSSCEEEEEECCSSCSHHHHTBSCSEEEEEETTSCEEE
T ss_pred             CCCCceEEEEecCCCCCccccchhhhhhhhcCccceEEEecCCCCceEEEEECCCCCCCcCCCCCceeEEEEcCCCcEEE
Confidence            33 24555655432110            00111222333445678999999986554  35567778888999999999


Q ss_pred             eecCceeEeeeccCCCCCCCCccCCcccccCCCceEEEEEEeccCCCCchhhHhHHHhhccccCCCcccCcccccccCCc
Q 001321          403 YDNASLTTLLSQQEKKPSVCPVEFPGVIPISDPIMTVAEFMLLPFGGHSSKGLSEIATFTKLHSSHTQAGHIKWPLSGGV  482 (1100)
Q Consensus       403 ~d~~~~~~~~~~~~~~~~~~~~~~p~~~~~~~~~it~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~pl~GG~  482 (1100)
                      |+....         .........+..+..+.+.++++.+...+.     ..|.......         ....|++.|+.
T Consensus       379 ~~~~~g---------~~~~~~~~~~~~l~~~~~~v~~~~~s~~~~-----~~w~~~~~~~---------~~~~~~l~G~~  435 (902)
T 2oaj_A          379 MLYPSG---------IFTDKASLFPQNLSWLRPLATTSMAASVPN-----KLWLGALSAA---------QNKDYLLKGGV  435 (902)
T ss_dssp             EETTTC---------CEECCGGGSCGGGTTBTTBEEEEEEEEEEH-----HHHHHHHHTT---------BCCCCSCCCSB
T ss_pred             EECCCC---------CcccccccCCCcccccCCCeeEEEEEEcCH-----HHHHHHHhcc---------cCCCCcccCCc
Confidence            984221         111122334566777889999988876542     3677655432         12245777766


Q ss_pred             ccccCccccCCCCcEEEEEecCCcEEEeeCCCCceeEEeeeccceeeeee-----cCCCCCeeEEEEeeCCCeEEEEecC
Q 001321          483 PSPVPITKCHSVDRVYLAGYHDGSVRIWDATYPVFKLICALDAEVQGIEV-----AGSRAPVSTLSFCFINSSLAVGNEF  557 (1100)
Q Consensus       483 ~~~~~~~~~s~~~~~l~Tg~~DGtIriWd~~~~~l~~~~~l~~~~~~~~l-----~~h~~~Vt~lafspd~~~Lasg~~d  557 (1100)
                      ... ..++++|++++|+||+.||+||+||+..+.+..     ..+....+     .+|...|++|+|+||+++||+|+.|
T Consensus       436 ~~v-~sv~~spdg~~laSgs~DgtVrlWd~~~g~~~~-----~~~~~~~l~~~~~~~h~~~V~svafspdg~~LAsgs~D  509 (902)
T 2oaj_A          436 RTK-RQKLPAEYGTAFITGHSNGSVRIYDASHGDIQD-----NASFEVNLSRTLNKAKELAVDKISFAAETLELAVSIET  509 (902)
T ss_dssp             CCC-CCCCCCSEEEEEEEEETTSEEEEEESSCCTTTT-----TBCEEEEHHHHTTCSSSCCEEEEEEETTTTEEEEEETT
T ss_pred             CCC-CcccccccCcEEEEecCCCcEEEEECCCccccC-----CceEEeechhhcCCCCCCceeEEEecCCCCeEEEEecC
Confidence            543 445899999999999999999999999886421     01111222     2888999999999999999999999


Q ss_pred             ceEEEEEecCCCC----------Ccceeee----ccCCCceeecc------CCCcceeEEEEeecCcCeEEEEEcCCCCE
Q 001321          558 GLVYIYNLNGSLD----------AKNFLFV----LETKSEVHALP------EGKISLCRAVFSLVNSPVRALQFTSSGAK  617 (1100)
Q Consensus       558 G~V~lw~l~~~~~----------~~~~~~~----~~~~~~~~~i~------~~~~~~~~~~~~~h~~~VtsLafSp~g~~  617 (1100)
                      |+|+||++.+...          +.+..|.    .........+.      ...+++++..+.+|.++|++|+||||| +
T Consensus       510 gtV~lwd~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~l~~h~~~V~svafSpdG-~  588 (902)
T 2oaj_A          510 GDVVLFKYEVNQFYSVENRPESGDLEMNFRRFSLNNTNGVLVDVRDRAPTGVRQGFMPSTAVHANKGKTSAINNSNIG-F  588 (902)
T ss_dssp             SCEEEEEEEECCC---------------CCSCCGGGSSCSEEECGGGCCTTCSEEEEEEEEECCCSCSEEEEEECBTS-E
T ss_pred             cEEEEEEecCccccCccccCCCcccceeeeeccccCCccccccccccCCCCCCCccceeEEEEcCCCcEEEEEecCCc-E
Confidence            9999999987531          1111110    01111111111      123577888899999999999999999 9


Q ss_pred             EEEEeCCceEEEEecCCceEEEEee--cCC-CCCCCeEEEEEe--ecccCccccCCCCCCCCCCCCCCCceEEEEEecce
Q 001321          618 LAVGFECGRVAVLDMNLLSVLFFTD--DIS-GSSSPIISMTWT--EFKNTHSLAKNPNHSEREVPVNPAEEVIIVLFKDA  692 (1100)
Q Consensus       618 LavGs~dG~V~vwD~~~~~~~~~~~--~~~-~~~~~V~sl~fs--~~~~~~~~~~~~~~~~~~~~~~~~~~lL~~gt~dg  692 (1100)
                      ||+|+.||+|+|||++++.+++...  .+. +|.+.|++|+|+  .++.+                ++++.+|++|+.||
T Consensus       589 lAsgs~D~tv~lwd~~~~~~~~~~~~~~~~~gh~~~V~sv~Fs~~~~~~D----------------g~~~~~l~sgs~D~  652 (902)
T 2oaj_A          589 VGIAYAAGSLMLIDRRGPAIIYMENIREISGAQSACVTCIEFVIMEYGDD----------------GYSSILMVCGTDMG  652 (902)
T ss_dssp             EEEEETTSEEEEEETTTTEEEEEEEGGGTCSSCCCCEEEEEEEEEECTTS----------------SSEEEEEEEEETTS
T ss_pred             EEEEeCCCcEEEEECCCCeEEEEeehhHhccccccceEEEEEEEEecCCC----------------CCcceEEEEEecCC
Confidence            9999999999999999999887533  343 899999999999  22222                35578999999999


Q ss_pred             eEEEEeCCCCccccCCccccCCCceeEEEEEecccCCCCccchhhhhhhhhhccCCCCCCCCcccccCcccccccccc--
Q 001321          693 KISIVGGSSENMISSSPWHLKKKVIAISMEVIEPVCGFPIEKQAEQSAEENAAKNKPTPDTSSIETKSHETEHLFSSE--  770 (1100)
Q Consensus       693 ~v~v~d~~~g~~l~~~~i~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~~~~~~~~~~~~~~~~~~--  770 (1100)
                      +|++||           +.|...+ .+...+.+..      .          .+.++ +|   ..+.+|+.+++..+.  
T Consensus       653 tv~~wd-----------~~p~~~g-~~~~~~~~~~------~----------~~~~~-~v---~~i~~~~~~~~~~~~a~  700 (902)
T 2oaj_A          653 EVITYK-----------ILPASGG-KFDVQLMDIT------N----------VTSKG-PI---HKIDAFSKETKSSCLAT  700 (902)
T ss_dssp             EEEEEE-----------EEECGGG-CEEEEEEEEE------E----------CCSSC-CC---CEEEEEETTTCCBCBCB
T ss_pred             cEEEEE-----------EecCCCC-cEEEEecCce------e----------cCCCC-ce---EEEEeEecCCCCcccCC
Confidence            999999           5555444 2323322211      0          11222 55   456666655555443  


Q ss_pred             ----cccCCCCCCCCEEEEEecCeeEEEeccccee-ecccccccceeee--ee------cCCceEEEEEEEecCcEEEee
Q 001321          771 ----NACSGESSNDALVLLCCEDSVRLYSRKSVIQ-KVKHKNRCCWAST--IE------KDEKVCGLLLLFQTGAVQIRS  837 (1100)
Q Consensus       771 ----~~~~~~~~~~~~~~~cse~~vrl~sl~~~~~-~~~~~~~c~~~~~--~~------~~~~~~~l~~~~~~G~i~i~s  837 (1100)
                          ..++++...++++++|+|+++|||++++.+. ++.+...|++..+  +.      ...++++|+++++||+|+|||
T Consensus       701 ~~~~~~l~~~~~~~~~~l~~~~~~ir~~~~~~~k~~~k~~~~~~~~~~v~~~~~~~~~~~~~~~~~l~~~~~~g~i~~~s  780 (902)
T 2oaj_A          701 IPKMQNLSKGLCIPGIVLITGFDDIRLITLGKSKSTHKGFKYPLAATGLSYISTVEKNNDRKNLTVIITLEINGHLRVFT  780 (902)
T ss_dssp             HHHHHGGGGTCCCCEEEEEECSSEEEEECTTCCCEEEEECSSCEEEEEEEEEEEECSSSCEEEEEEEEEEETTSEEEEEE
T ss_pred             HHHHhccCCCCCCCeEEEEEeccceEEEeCccccceeeEcccceeeeEEEEEEeccccccccCceEEEEEeCCCcEEEEE
Confidence                2556677779999999999999999999877 3334447887776  44      356789999999999999999


Q ss_pred             cCChhhhhhccccceeeeeeccccccceeec-CCcEEEEcc-eeEEEEEeecCCCcccccCCCccchhhhh
Q 001321          838 LPDLELVMESSLMSILRWNFKANMDKTISAD-NGQITLANG-SEVAFVNLLAGENEFSILESSPCLHDKVL  906 (1100)
Q Consensus       838 lp~l~~~~~~~~~~~l~~~~~~~~~~~~~~s-~gq~~l~~g-~e~~~~s~~~~~~~~~~~~~~~~~~~~~~  906 (1100)
                      ||+||.+...++..+++.++    ++..+|+ +|++++..| .|+++++++.++..++.+  ...||.+..
T Consensus       781 ~p~l~~~~~~~~~~~~~~~~----~~~~~~~~~G~~~~~~~~~e~~~~~~~~~~~~~~~~--~~~l~~~~~  845 (902)
T 2oaj_A          781 IPDFKEQMSEHIPFPIAAKY----ITESSVLRNGDIAIRVSEFQASLFSTVKEQDTLAPV--SDTLYINGI  845 (902)
T ss_dssp             TTTCCEEEEEECSSCCCHHH----HTTCEECTTSCEEEECSSSEEEEEEEESCCCCCCCC--CCBCCCTTC
T ss_pred             CcchHHHhhccCCccccccc----ccceEEcCCCCEEEEeChhheEEEEEEcCCCCCCCC--CceeeCCCC
Confidence            99999999988877666443    4566899 999999998 999999999998888755  377888743



>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} Back     alignment and structure
>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} Back     alignment and structure
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Back     alignment and structure
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>2j04_B YDR362CP, TAU91; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>2j04_B YDR362CP, TAU91; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>2j04_A TAU60, YPL007P, hypothetical protein YPL007C; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} Back     alignment and structure
>3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} Back     alignment and structure
>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Back     alignment and structure
>4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Back     alignment and structure
>3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A Back     alignment and structure
>4gq1_A NUP37; propeller, transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4gq2_P 4fhl_A 4fhm_A 4fhn_A Back     alignment and structure
>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2j04_A TAU60, YPL007P, hypothetical protein YPL007C; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4gq1_A NUP37; propeller, transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4gq2_P 4fhl_A 4fhm_A 4fhn_A Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2w18_A PALB2, fancn, partner and localizer of BRCA2; fanconi anemia, homologous recomination, polymorphism, phosphoprotein, beta-propeller, WD40, nucleus; 1.90A {Homo sapiens} PDB: 3eu7_A Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>2w18_A PALB2, fancn, partner and localizer of BRCA2; fanconi anemia, homologous recomination, polymorphism, phosphoprotein, beta-propeller, WD40, nucleus; 1.90A {Homo sapiens} PDB: 3eu7_A Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens} Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>2oit_A Nucleoporin 214KDA; NH2 terminal domain of NUP214/CAN, X-RAY crystallography, beta-propeller, structure, mRNA export, NPC assembly, leukemia; HET: MES; 1.65A {Homo sapiens} PDB: 3fmo_A* 3fmp_A* 3fhc_A Back     alignment and structure
>1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens} Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>1jof_A Carboxy-CIS,CIS-muconate cyclase; beta-propeller, homotetramer, seMet-protein, isomerase; HET: PIN; 2.50A {Neurospora crassa} SCOP: b.69.10.1 Back     alignment and structure
>4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ... Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>2oit_A Nucleoporin 214KDA; NH2 terminal domain of NUP214/CAN, X-RAY crystallography, beta-propeller, structure, mRNA export, NPC assembly, leukemia; HET: MES; 1.65A {Homo sapiens} PDB: 3fmo_A* 3fmp_A* 3fhc_A Back     alignment and structure
>1jof_A Carboxy-CIS,CIS-muconate cyclase; beta-propeller, homotetramer, seMet-protein, isomerase; HET: PIN; 2.50A {Neurospora crassa} SCOP: b.69.10.1 Back     alignment and structure
>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} Back     alignment and structure
>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} Back     alignment and structure
>2oiz_A Aromatic amine dehydrogenase, large subunit; oxidoreductase, tryptophan tryptophyl quinone, H-tunneling; HET: TRQ TSR PG4; 1.05A {Alcaligenes faecalis} PDB: 2agw_A* 2agx_A* 2agl_A* 2agz_A* 2ah0_A* 2ah1_A* 2hj4_A* 2hjb_A* 2i0t_A* 2iup_A* 2iuq_A* 2iur_A* 2iuv_A* 2agy_A* 2ok4_A* 2ok6_A* 2iaa_A* 2h47_A* 2h3x_A* 2hkr_A* ... Back     alignment and structure
>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>1urq_A M-tomosyn isoform; transport protein, tomosyn-snare complex, exocytosis, four helical bundle, coiled coil; 2.0A {Rattus norvegicus} SCOP: h.1.15.1 Back     alignment and structure
>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* Back     alignment and structure
>2oiz_A Aromatic amine dehydrogenase, large subunit; oxidoreductase, tryptophan tryptophyl quinone, H-tunneling; HET: TRQ TSR PG4; 1.05A {Alcaligenes faecalis} PDB: 2agw_A* 2agx_A* 2agl_A* 2agz_A* 2ah0_A* 2ah1_A* 2hj4_A* 2hjb_A* 2i0t_A* 2iup_A* 2iuq_A* 2iur_A* 2iuv_A* 2agy_A* 2ok4_A* 2ok6_A* 2iaa_A* 2h47_A* 2h3x_A* 2hkr_A* ... Back     alignment and structure
>4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ... Back     alignment and structure
>2gop_A Trilobed protease; beta propeller, open velcro, hydrolase; 2.00A {Pyrococcus furiosus} Back     alignment and structure
>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* Back     alignment and structure
>2gop_A Trilobed protease; beta propeller, open velcro, hydrolase; 2.00A {Pyrococcus furiosus} Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>1xip_A Nucleoporin NUP159; beta-propeller, transport protein; 2.50A {Saccharomyces cerevisiae} SCOP: b.69.14.1 PDB: 3pez_C* 3rrm_C* Back     alignment and structure
>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>3sjl_D Methylamine dehydrogenase heavy chain; MAUG, C-heme, quinone cofactor, oxidoreductase-electron transport complex; HET: 0AF HEC MES; 1.63A {Paracoccus denitrificans} PDB: 2gc7_A* 2j55_H* 2j56_H* 2j57_G* 3l4m_D* 3l4o_D* 3orv_D* 3pxs_D* 3pxt_D* 3rlm_D* 2gc4_A* 3rn0_D* 3rn1_D* 3rmz_D* 3svw_D* 3sws_D* 3sxt_D* 3pxw_D* 3sle_D* 1mg2_A* ... Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H* Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>3sjl_D Methylamine dehydrogenase heavy chain; MAUG, C-heme, quinone cofactor, oxidoreductase-electron transport complex; HET: 0AF HEC MES; 1.63A {Paracoccus denitrificans} PDB: 2gc7_A* 2j55_H* 2j56_H* 2j57_G* 3l4m_D* 3l4o_D* 3orv_D* 3pxs_D* 3pxt_D* 3rlm_D* 2gc4_A* 3rn0_D* 3rn1_D* 3rmz_D* 3svw_D* 3sws_D* 3sxt_D* 3pxw_D* 3sle_D* 1mg2_A* ... Back     alignment and structure
>4a2l_A BT_4663, two-component system sensor histidine kinase/RESP; transcription, beta-propeller; HET: PGE PG4 MES 2PE; 2.60A {Bacteroides thetaiotaomicron} PDB: 4a2m_A* Back     alignment and structure
>4a2l_A BT_4663, two-component system sensor histidine kinase/RESP; transcription, beta-propeller; HET: PGE PG4 MES 2PE; 2.60A {Bacteroides thetaiotaomicron} PDB: 4a2m_A* Back     alignment and structure
>3v9f_A Two-component system sensor histidine kinase/RESP regulator, hybrid (ONE-component...; beta-propeller, beta-sandwich; 3.30A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H* Back     alignment and structure
>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>1xip_A Nucleoporin NUP159; beta-propeller, transport protein; 2.50A {Saccharomyces cerevisiae} SCOP: b.69.14.1 PDB: 3pez_C* 3rrm_C* Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>3c75_H MADH, methylamine dehydrogenase heavy chain; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus} Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A Back     alignment and structure
>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} Back     alignment and structure
>3v9f_A Two-component system sensor histidine kinase/RESP regulator, hybrid (ONE-component...; beta-propeller, beta-sandwich; 3.30A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 Back     alignment and structure
>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 Back     alignment and structure
>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A Back     alignment and structure
>2qe8_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL PG4; 1.35A {Anabaena variabilis atcc 29413} Back     alignment and structure
>3c75_H MADH, methylamine dehydrogenase heavy chain; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus} Back     alignment and structure
>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} Back     alignment and structure
>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* Back     alignment and structure
>1kb0_A Quinohemoprotein alcohol dehydrogenase; beta-propeller fold, cytochrome C, oxidoreductase; HET: TRO HEC PQQ; 1.44A {Comamonas testosteroni} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* Back     alignment and structure
>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} Back     alignment and structure
>1yiq_A Quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM; 2.20A {Pseudomonas putida} Back     alignment and structure
>2qe8_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL PG4; 1.35A {Anabaena variabilis atcc 29413} Back     alignment and structure
>1mda_H Methylamine dehydrogenase (heavy subunit); electron transport; HET: TRQ; 2.50A {Paracoccus denitrificans} SCOP: b.69.2.1 Back     alignment and structure
>1l4a_A Synaptobrevin; snare, snare complex, membrane fusion, neurotransmission, endocytosis/exocytosis complex; 2.95A {Loligo pealei} SCOP: h.1.15.1 Back     alignment and structure
>1yiq_A Quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM; 2.20A {Pseudomonas putida} Back     alignment and structure
>1mda_H Methylamine dehydrogenase (heavy subunit); electron transport; HET: TRQ; 2.50A {Paracoccus denitrificans} SCOP: b.69.2.1 Back     alignment and structure
>2hz6_A Endoplasmic reticulum to nucleus signalling 1 isoform 1 variant; triangular beta-sheet cluster, signaling protein; 3.10A {Homo sapiens} Back     alignment and structure
>2ece_A 462AA long hypothetical selenium-binding protein; beta propeller, structural genomics, unknown function; 2.00A {Sulfolobus tokodaii} Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>1kb0_A Quinohemoprotein alcohol dehydrogenase; beta-propeller fold, cytochrome C, oxidoreductase; HET: TRO HEC PQQ; 1.44A {Comamonas testosteroni} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>1sfc_A VAMP 2, protein (synaptobrevin 2); membrane fusion protein complex, transport protein; 2.40A {Rattus norvegicus} SCOP: h.1.15.1 Back     alignment and structure
>1n7s_A Vesicle-associated membrane protein 2; neuronal snare protein complex, four helix bundle, transport protein; 1.45A {Rattus norvegicus} SCOP: h.1.15.1 PDB: 1kil_A 3rk2_A 3rk3_A 3rl0_A 3fii_B 3g94_B Back     alignment and structure
>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Back     alignment and structure
>1fwx_A Nitrous oxide reductase; beta-propeller domain, cupredoxin domain, CUZ site, CUA site oxidoreductase; 1.60A {Paracoccus denitrificans} SCOP: b.6.1.4 b.69.3.1 PDB: 2iwk_A 2iwf_A Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} PDB: 4dg6_A* Back     alignment and structure
>3ei3_A DNA damage-binding protein 1; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Homo sapiens} PDB: 3ei1_A* 3ei2_A* 3ei4_A* 4a0l_A* 3e0c_A* 3i7k_A* 3i7h_A* 3i7l_A* 3i7n_A* 3i7o_A* 3i7p_A* 3i89_A* 3i8c_A* 3i8e_A* 2b5l_A 2b5m_A 2hye_A* 4a11_A* 4a0k_C* 4a0a_A* ... Back     alignment and structure
>3hxj_A Pyrrolo-quinoline quinone; all beta protein. incomplete 8-blade beta-propeller., struct genomics, PSI-2, protein structure initiative; 2.00A {Methanococcus maripaludis} Back     alignment and structure
>3hd7_A Vesicle-associated membrane protein 2; membrane protein, coiled-coil, 4-helical bundle, cell juncti cytoplasmic vesicle, membrane, phosphoprotein; HET: GGG; 3.40A {Rattus norvegicus} PDB: 3hd9_A 3ipd_A Back     alignment and structure
>2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A* Back     alignment and structure
>2ece_A 462AA long hypothetical selenium-binding protein; beta propeller, structural genomics, unknown function; 2.00A {Sulfolobus tokodaii} Back     alignment and structure
>3qqz_A Putative uncharacterized protein YJIK; MCSG, PSI-2, structural genomics, midwest center for structu genomics, TOLB-like, Ca binding; 2.55A {Escherichia coli} Back     alignment and structure
>1kv9_A Type II quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM EPE; 1.90A {Pseudomonas putida} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>2nps_A VAMP-4, vesicle-associated membrane protein 4; vesicle fusion, snare complex, early endosomal snare complex, VTI1A, VAMP4, transport protein; 2.50A {Mus musculus} Back     alignment and structure
>4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* Back     alignment and structure
>2ad6_A Methanol dehydrogenase subunit 1; PQQ configuration, native, oxidoredu; HET: PQQ; 1.50A {Methylophilus methylotrophus} SCOP: b.70.1.1 PDB: 2ad7_A* 2ad8_A* 4aah_A* 1g72_A* Back     alignment and structure
>1fwx_A Nitrous oxide reductase; beta-propeller domain, cupredoxin domain, CUZ site, CUA site oxidoreductase; 1.60A {Paracoccus denitrificans} SCOP: b.6.1.4 b.69.3.1 PDB: 2iwk_A 2iwf_A Back     alignment and structure
>2kog_A Vesicle-associated membrane protein 2; synaptobrevin, VAMP2, DPC micelle, snare, coiled coil, membrane fusion, transmembrane; NMR {Rattus norvegicus} Back     alignment and structure
>3ei3_A DNA damage-binding protein 1; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Homo sapiens} PDB: 3ei1_A* 3ei2_A* 3ei4_A* 4a0l_A* 3e0c_A* 3i7k_A* 3i7h_A* 3i7l_A* 3i7n_A* 3i7o_A* 3i7p_A* 3i89_A* 3i8c_A* 3i8e_A* 2b5l_A 2b5m_A 2hye_A* 4a11_A* 4a0k_C* 4a0a_A* ... Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>2hz6_A Endoplasmic reticulum to nucleus signalling 1 isoform 1 variant; triangular beta-sheet cluster, signaling protein; 3.10A {Homo sapiens} Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>1w6s_A Methanol dehydrogenase subunit 1; anisotropic, electron transfer, oxidoreductase, calcium- binding, methanol utilization, PQQ; HET: PQQ; 1.2A {Methylobacterium extorquens} SCOP: b.70.1.1 PDB: 1h4i_A* 1h4j_A* 2d0v_A* 1lrw_A* Back     alignment and structure
>3b5n_A Synaptobrevin homolog 1; snare complex, syntaxin, synaptobrevin, SNAP-25, SSO1P, SNC1P, SEC9P, SSO1, SNC1, coiled coil; 1.60A {Saccharomyces cerevisiae} SCOP: h.1.15.1 Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>1kv9_A Type II quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM EPE; 1.90A {Pseudomonas putida} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Back     alignment and structure
>2xe4_A Oligopeptidase B; hydrolase-inhibitor complex, hydrolase, protease inhibitor trypanosomes, CLAN SC; HET: FC0 RGL; 1.65A {Leishmania major} Back     alignment and structure
>2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3 Back     alignment and structure
>2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A* Back     alignment and structure
>1flg_A Protein (quinoprotein ethanol dehydrogenase); superbarrel, oxidoreductase; HET: PQQ; 2.60A {Pseudomonas aeruginosa} SCOP: b.70.1.1 Back     alignment and structure
>1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 Back     alignment and structure
>3hxj_A Pyrrolo-quinoline quinone; all beta protein. incomplete 8-blade beta-propeller., struct genomics, PSI-2, protein structure initiative; 2.00A {Methanococcus maripaludis} Back     alignment and structure
>1flg_A Protein (quinoprotein ethanol dehydrogenase); superbarrel, oxidoreductase; HET: PQQ; 2.60A {Pseudomonas aeruginosa} SCOP: b.70.1.1 Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Back     alignment and structure
>1gl2_A Endobrevin; membrane protein, membrane fusion protein complex, coiled coil, transmembrane; 1.9A {Rattus norvegicus} SCOP: h.1.15.1 Back     alignment and structure
>3amr_A 3-phytase; beta-propeller, phytate, MYO-inositol hexasulfate, hydrolase-hydrolase inhibitor complex; HET: IHS; 1.25A {Bacillus subtilis} PDB: 3ams_A* 2poo_A 1poo_A 1qlg_A 1h6l_A 1cvm_A Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>3tc9_A Hypothetical hydrolase; 6-bladed beta-propeller, immunoglobulin-like, structural GEN joint center for structural genomics, JCSG; 2.23A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>4hw6_A Hypothetical protein, IPT/TIG domain protein; putative carbohydrate bindning two domains protein, IPT/TIG (PF01833), 6-beta-propeller; HET: MSE; 1.70A {Bacteroides ovatus} Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Back     alignment and structure
>2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3 Back     alignment and structure
>3amr_A 3-phytase; beta-propeller, phytate, MYO-inositol hexasulfate, hydrolase-hydrolase inhibitor complex; HET: IHS; 1.25A {Bacillus subtilis} PDB: 3ams_A* 2poo_A 1poo_A 1qlg_A 1h6l_A 1cvm_A Back     alignment and structure
>3qqz_A Putative uncharacterized protein YJIK; MCSG, PSI-2, structural genomics, midwest center for structu genomics, TOLB-like, Ca binding; 2.55A {Escherichia coli} Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Back     alignment and structure
>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Back     alignment and structure
>2p9w_A MAL S 1 allergenic protein; beta propeller; 1.35A {Malassezia sympodialis} Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>2ad6_A Methanol dehydrogenase subunit 1; PQQ configuration, native, oxidoredu; HET: PQQ; 1.50A {Methylophilus methylotrophus} SCOP: b.70.1.1 PDB: 2ad7_A* 2ad8_A* 4aah_A* 1g72_A* Back     alignment and structure
>3tc9_A Hypothetical hydrolase; 6-bladed beta-propeller, immunoglobulin-like, structural GEN joint center for structural genomics, JCSG; 2.23A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2xbg_A YCF48-like protein; photosynthesis, photosystem II, beta-propeller, assembly FAC; 1.50A {Thermosynechococcus elongatus} Back     alignment and structure
>3pbp_A Nucleoporin NUP82; beta-propeller, mRNA export, mRNP remodelling, nucleocytoplasmic transport, protein transport; HET: PGE; 2.60A {Saccharomyces cerevisiae} PDB: 3tkn_A Back     alignment and structure
>3kya_A Putative phosphatase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.77A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 Back     alignment and structure
>2xe4_A Oligopeptidase B; hydrolase-inhibitor complex, hydrolase, protease inhibitor trypanosomes, CLAN SC; HET: FC0 RGL; 1.65A {Leishmania major} Back     alignment and structure
>2nut_C Vesicle-trafficking protein SEC22B; human copii SEC23/24 complexed with SEC22, protein transport; 2.30A {Homo sapiens} PDB: 2nup_C 3egd_C 3egx_C 1ifq_A Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>1w6s_A Methanol dehydrogenase subunit 1; anisotropic, electron transfer, oxidoreductase, calcium- binding, methanol utilization, PQQ; HET: PQQ; 1.2A {Methylobacterium extorquens} SCOP: b.70.1.1 PDB: 1h4i_A* 1h4j_A* 2d0v_A* 1lrw_A* Back     alignment and structure
>4b93_A Vesicle-associated membrane protein 7; endocytosis, exocytosis, snare; 2.00A {Mus musculus} PDB: 2dmw_A Back     alignment and structure
>3kya_A Putative phosphatase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.77A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>4hw6_A Hypothetical protein, IPT/TIG domain protein; putative carbohydrate bindning two domains protein, IPT/TIG (PF01833), 6-beta-propeller; HET: MSE; 1.70A {Bacteroides ovatus} Back     alignment and structure
>4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* Back     alignment and structure
>2p9w_A MAL S 1 allergenic protein; beta propeller; 1.35A {Malassezia sympodialis} Back     alignment and structure
>3pbp_A Nucleoporin NUP82; beta-propeller, mRNA export, mRNP remodelling, nucleocytoplasmic transport, protein transport; HET: PGE; 2.60A {Saccharomyces cerevisiae} PDB: 3tkn_A Back     alignment and structure
>2xbg_A YCF48-like protein; photosynthesis, photosystem II, beta-propeller, assembly FAC; 1.50A {Thermosynechococcus elongatus} Back     alignment and structure
>3ott_A Two-component system sensor histidine kinase; beta-propeller, beta-sandwich, transcription; HET: TBR; 2.30A {Bacteroides thetaiotaomicron} PDB: 3va6_A Back     alignment and structure
>3ott_A Two-component system sensor histidine kinase; beta-propeller, beta-sandwich, transcription; HET: TBR; 2.30A {Bacteroides thetaiotaomicron} PDB: 3va6_A Back     alignment and structure
>3sre_A PON1, serum paraoxonase; directed evolution, 6-blades-propeller fold, hydrolase; HET: LMT; 1.99A {Artificial gene} PDB: 1v04_A* 3srg_A* Back     alignment and structure
>3a9g_A Putative uncharacterized protein; PQQ dependent dehydrogenase, aldose sugar dehydrogenase, BET propeller fold, oxidoreductase; HET: TRE; 2.39A {Pyrobaculum aerophilum} PDB: 3a9h_A* Back     alignment and structure
>3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} PDB: 4dg6_A* Back     alignment and structure
>2g8s_A Glucose/sorbosone dehydrogenases; bladed beta-propellor, pyrolloquinoline quinone (PQQ), quinoprotein, sugar binding protein; HET: MSE; 1.50A {Escherichia coli K12} Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>3sre_A PON1, serum paraoxonase; directed evolution, 6-blades-propeller fold, hydrolase; HET: LMT; 1.99A {Artificial gene} PDB: 1v04_A* 3srg_A* Back     alignment and structure
>3kyq_A YKT6, synaptobrevin homolog YKT6; V-snare homolog, lipid binding, cytoplasmic vesicle, ER-GOLG transport, golgi apparatus, lipoprotein; HET: DPV; 2.44A {Rattus norvegicus} Back     alignment and structure
>1bpo_A Protein (clathrin); clathrin endocytosis beta-propeller coated-PITS, membrane PR; 2.60A {Rattus norvegicus} SCOP: a.118.1.4 b.69.6.1 Back     alignment and structure
>2ism_A Putative oxidoreductase; BL41XU spring-8, bladed beta-propellor, glucose dehydrogenas structural genomics, NPPSFA; 1.90A {Thermus thermophilus} Back     alignment and structure
>2ism_A Putative oxidoreductase; BL41XU spring-8, bladed beta-propellor, glucose dehydrogenas structural genomics, NPPSFA; 1.90A {Thermus thermophilus} Back     alignment and structure
>1cru_A Protein (soluble quinoprotein glucose dehydrogena; beta-propeller, superbarrel; HET: PQQ; 1.50A {Acinetobacter calcoaceticus} SCOP: b.68.2.1 PDB: 1c9u_A* 1cq1_A* 1qbi_A Back     alignment and structure
>1cru_A Protein (soluble quinoprotein glucose dehydrogena; beta-propeller, superbarrel; HET: PQQ; 1.50A {Acinetobacter calcoaceticus} SCOP: b.68.2.1 PDB: 1c9u_A* 1cq1_A* 1qbi_A Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Back     alignment and structure
>3s25_A Hypothetical 7-bladed beta-propeller-like protein; structural genomics, joint center F structural genomics, JCSG; 1.88A {Eubacterium rectale} Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Back     alignment and structure
>3das_A Putative oxidoreductase; aldose sugar dehydrogenase, beta propellor, PQQ, SGDH; HET: MSE ARA PQQ; 1.60A {Streptomyces coelicolor} Back     alignment and structure
>1bpo_A Protein (clathrin); clathrin endocytosis beta-propeller coated-PITS, membrane PR; 2.60A {Rattus norvegicus} SCOP: a.118.1.4 b.69.6.1 Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Back     alignment and structure
>3uc1_A DNA gyrase subunit A; DNA binding protein, topoisomerase, isomerase; HET: DNA; 1.65A {Mycobacterium tuberculosis} Back     alignment and structure
>1tl2_A L10, protein (tachylectin-2); animal lectin, horseshoe CRAB, N-acetylglucosamine, beta- propeller, sugar binding protein; HET: NDG; 2.00A {Tachypleus tridentatus} SCOP: b.67.1.1 PDB: 3kif_A* 3kih_A* Back     alignment and structure
>3a9g_A Putative uncharacterized protein; PQQ dependent dehydrogenase, aldose sugar dehydrogenase, BET propeller fold, oxidoreductase; HET: TRE; 2.39A {Pyrobaculum aerophilum} PDB: 3a9h_A* Back     alignment and structure
>3kci_A Probable E3 ubiquitin-protein ligase HERC2; WD40, RCC1, structural genomics consortium, SGC, coiled coil, metal-binding, phosphoprotein; 1.80A {Homo sapiens} Back     alignment and structure
>1tl2_A L10, protein (tachylectin-2); animal lectin, horseshoe CRAB, N-acetylglucosamine, beta- propeller, sugar binding protein; HET: NDG; 2.00A {Tachypleus tridentatus} SCOP: b.67.1.1 PDB: 3kif_A* 3kih_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 1100
d1vyhc1317 b.69.4.1 (C:92-408) Platelet-activating factor ace 3e-04
d1tbga_340 b.69.4.1 (A:) beta1-subunit of the signal-transduc 9e-04
d1nr0a2299 b.69.4.1 (A:313-611) Actin interacting protein 1 { 0.001
d1gxra_337 b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Hum 0.003
d1k8kc_371 b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 0.004
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure

class: All beta proteins
fold: 7-bladed beta-propeller
superfamily: WD40 repeat-like
family: WD40-repeat
domain: Platelet-activating factor acetylhydrolase IB subunit alpha
species: Mouse (Mus musculus) [TaxId: 10090]
 Score = 41.7 bits (96), Expect = 3e-04
 Identities = 39/319 (12%), Positives = 91/319 (28%), Gaps = 23/319 (7%)

Query: 249 EKEISALCWASSSGSILAVGYIDGDILLWNTSTTASTKGQQTGSRNNVVKLELSSAERRL 308
              ++ + +     S++     D  I +W+  T    +    G  ++V  +    + + L
Sbjct: 17  RSPVTRVIF-HPVFSVMVSASEDATIKVWDYET-GDFERTLKGHTDSVQDISFDHSGKLL 74

Query: 309 PVIVLHWSTNKESRSNIDGRLFVYGGDEIGSEEVL----TVLSLEWSSGMENLRCVSRVD 364
                  +         +    ++G D   S   +      +          +  V    
Sbjct: 75  ASCSADMTIKLWDFQGFECIRTMHGHDHNVSSVSIMPNGDHIVSASRDKTIKMWEVQTGY 134

Query: 365 ITLTGSFADMILLSSAGATVGNHKADLFVLTSPGQLHFYDNASLTTLLSQQEKKPSVCPV 424
              T +     +        G     +   ++   +  +  A+       +E +  V  +
Sbjct: 135 CVKTFTGHREWVRMVRPNQDGTL---IASCSNDQTVRVWVVATKECKAELREHRHVVECI 191

Query: 425 EFPGVIPISDPIMTVAEFMLLPFGGHSSKGLSEIATFTKLHSSHTQAGHIKWPLSGGVPS 484
            +      S   ++ A        G     L   +    +       G     L G   +
Sbjct: 192 SWA--PESSYSSISEATGSETKKSGKPGPFLLSGSRDKTIKMWDVSTGMCLMTLVGH-DN 248

Query: 485 PVPITKCHSVDRVYLAGYHDGSVRIWDATYPVFKLICALDAEVQGIEVAGSRAPVSTLSF 544
            V     HS  +  L+   D ++R+WD  Y   + +  L+              V++L F
Sbjct: 249 WVRGVLFHSGGKFILSCADDKTLRVWD--YKNKRCMKTLN---------AHEHFVTSLDF 297

Query: 545 CFINSSLAVGNEFGLVYIY 563
                 +  G+    V ++
Sbjct: 298 HKTAPYVVTGSVDQTVKVW 316


>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Length = 340 Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 299 Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Length = 371 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query1100
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 100.0
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 100.0
d1vyhc1317 Platelet-activating factor acetylhydrolase IB subu 100.0
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 100.0
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 99.97
d1k8kc_371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 99.97
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 99.97
d1vyhc1317 Platelet-activating factor acetylhydrolase IB subu 99.97
d1tbga_340 beta1-subunit of the signal-transducing G protein 99.97
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 99.96
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 99.96
d1tbga_340 beta1-subunit of the signal-transducing G protein 99.96
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 99.96
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 99.96
d1k8kc_371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 99.96
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 99.96
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 99.95
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 99.95
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 99.93
d1k32a3360 Tricorn protease domain 2 {Archaeon Thermoplasma a 99.92
d1p22a2293 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 99.92
d1p22a2293 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 99.92
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 99.91
d1yfqa_342 Cell cycle arrest protein BUB3 {Baker's yeast (Sac 99.91
d1yfqa_342 Cell cycle arrest protein BUB3 {Baker's yeast (Sac 99.91
d1sq9a_393 Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac 99.91
d1pgua2287 Actin interacting protein 1 {Baker's yeast (Saccha 99.91
d1pgua2287 Actin interacting protein 1 {Baker's yeast (Saccha 99.9
d1sq9a_393 Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac 99.9
d1k32a3360 Tricorn protease domain 2 {Archaeon Thermoplasma a 99.84
d1qksa2432 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.84
d1qksa2432 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.83
d1hzua2426 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.82
d1hzua2426 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.81
d1jmxb_346 Quinohemoprotein amine dehydrogenase B chain {Pseu 99.77
d1pbyb_337 Quinohemoprotein amine dehydrogenase B chain {Para 99.72
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 99.7
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 99.67
d2madh_373 Methylamine dehydrogenase, H-chain {Gram negative 99.6
d2madh_373 Methylamine dehydrogenase, H-chain {Gram negative 99.6
d1jmxb_346 Quinohemoprotein amine dehydrogenase B chain {Pseu 99.6
d1ri6a_333 Putative isomerase YbhE {Escherichia coli [TaxId: 99.59
d1ri6a_333 Putative isomerase YbhE {Escherichia coli [TaxId: 99.54
d1pbyb_337 Quinohemoprotein amine dehydrogenase B chain {Para 99.49
d2bbkh_355 Methylamine dehydrogenase, H-chain {Paracoccus den 99.44
d2bbkh_355 Methylamine dehydrogenase, H-chain {Paracoccus den 99.36
d2bgra1470 Dipeptidyl peptidase IV/CD26, N-terminal domain {P 99.17
d1mdah_368 Methylamine dehydrogenase, H-chain {Paracoccus den 98.98
d2bgra1470 Dipeptidyl peptidase IV/CD26, N-terminal domain {P 98.94
d1mdah_368 Methylamine dehydrogenase, H-chain {Paracoccus den 98.79
d1qnia2441 Nitrous oxide reductase, N-terminal domain {Pseudo 98.77
d1jofa_365 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu 98.63
d1qnia2441 Nitrous oxide reductase, N-terminal domain {Pseudo 98.44
d2p4oa1302 Hypothetical protein All0351 homologue {Nostoc pun 98.34
d2hqsa1269 TolB, C-terminal domain {Escherichia coli [TaxId: 98.31
d1jofa_365 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu 98.22
d2p4oa1302 Hypothetical protein All0351 homologue {Nostoc pun 98.19
d1rwia_260 Serine/threonine-protein kinase PknD {Mycobacteriu 98.0
d2hqsa1269 TolB, C-terminal domain {Escherichia coli [TaxId: 97.97
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 97.83
d1rwia_260 Serine/threonine-protein kinase PknD {Mycobacteriu 97.77
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 97.77
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 97.76
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 97.75
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 97.67
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 97.64
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 97.57
d1xfda1465 Dipeptidyl aminopeptidase-like protein 6, DPP6, N- 97.24
d1k32a2281 Tricorn protease N-terminal domain {Archaeon Therm 97.08
d1xfda1465 Dipeptidyl aminopeptidase-like protein 6, DPP6, N- 97.04
d1npea_263 Nidogen {Mouse (Mus musculus) [TaxId: 10090]} 96.43
d1k32a2281 Tricorn protease N-terminal domain {Archaeon Therm 96.24
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 95.92
d1k3ia3387 Galactose oxidase, central domain {Fungi (Fusarium 94.21
d1fwxa2459 Nitrous oxide reductase, N-terminal domain {Paraco 94.2
d1ijqa1266 Low density lipoprotein (LDL) receptor {Human (Hom 93.43
d1fwxa2459 Nitrous oxide reductase, N-terminal domain {Paraco 92.42
d1ijqa1266 Low density lipoprotein (LDL) receptor {Human (Hom 92.27
d1qfma1430 Prolyl oligopeptidase, N-terminal domain {Pig (Sus 92.09
d1kb0a2573 Quinoprotein alcohol dehydrogenase, N-terminal dom 91.81
d1npea_263 Nidogen {Mouse (Mus musculus) [TaxId: 10090]} 91.28
d1k3ia3387 Galactose oxidase, central domain {Fungi (Fusarium 90.44
d1utca2327 Clathrin heavy-chain terminal domain {Rat (Rattus 90.28
d1utca2327 Clathrin heavy-chain terminal domain {Rat (Rattus 89.35
d1xipa_381 Nucleoporin NUP159 {Baker's yeast (Saccharomyces c 89.0
d2ad6a1571 Methanol dehydrogenase, heavy chain {Methylophilus 88.68
d1kv9a2560 Quinoprotein alcohol dehydrogenase, N-terminal dom 85.75
d1v04a_340 Serum paraoxonase/arylesterase 1, PON1 {Rabit (Ory 85.51
d1h6la_353 Thermostable phytase (3-phytase) {Bacillus amyloli 84.4
d1xipa_381 Nucleoporin NUP159 {Baker's yeast (Saccharomyces c 83.0
d1h6la_353 Thermostable phytase (3-phytase) {Bacillus amyloli 80.17
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All beta proteins
fold: 7-bladed beta-propeller
superfamily: WD40 repeat-like
family: WD40-repeat
domain: Groucho/tle1, C-terminal domain
species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00  E-value=2.7e-31  Score=299.45  Aligned_cols=314  Identities=11%  Similarity=0.150  Sum_probs=240.9

Q ss_pred             EEEEcCCCCEEEEEECCCeEEEEeC-CCceEEEeCCCCCCEEEEEEEeCCCEEEEEECCCcEEEEEcCCCcee---e---
Q 001321           40 ILAFDHIQRLLAIATLDGRIKVIGG-DGIEGLLISPSQLPYKNLEFLQNQGFLISITNDNEIQVWSLESRSLA---C---  112 (1100)
Q Consensus        40 ~la~sp~~~lLA~gs~dG~I~vw~~-~~~~~~~~~~h~~~V~~l~fs~d~~~Lls~s~d~~I~vWd~~s~~~l---~---  112 (1100)
                      .+.+++++++..+......+..-.. ...+.+...+|..+|.+++|+|++.+|++++ |+.|+|||+.+....   .   
T Consensus        14 ~~~~~~~~~~~~~~~~~~~~~~~~~p~~~~~~~~~~H~~~V~~v~fs~~g~~latg~-dg~V~iWd~~~~~~~~~~~~~~   92 (337)
T d1gxra_          14 SFHVTADGQMQPVPFPPDALIGPGIPRHARQINTLNHGEVVCAVTISNPTRHVYTGG-KGCVKVWDISHPGNKSPVSQLD   92 (337)
T ss_dssp             EEEECSSSCEEECCCCTTSSSSTTCCSEEEEEEEECCSSCCCEEEECSSSSEEEEEC-BSEEEEEETTSTTCCSCSEEEE
T ss_pred             cccCCCCCCEEeeccCCcceecCCCCCCceEEEECCCCCcEEEEEECCCCCEEEEEE-CCEEEEEEccCCcccceeEEee
Confidence            3566666666555443332211111 2234455668999999999999999999987 899999999765322   2   


Q ss_pred             eeecCCCeEEEEEecCCCEEEEEeCCCcEEEEEEecCCCeeeeeceeecccccccccCCCCCCCCCeEEEEeccCCCCCE
Q 001321          113 CLKWESNITAFSVISGSHFMYIGDENGLMSVIKYDADEGKLFQLPYNISADALSEKAGFPLLSHQPVVGVLPHPNSSGNR  192 (1100)
Q Consensus       113 ~~~~~~~Vt~~~~s~~~~~l~~G~~dG~V~Iw~~d~~~~~l~~~~~~i~~~~~~~~~~~~~~~~~~V~sv~f~P~~~g~~  192 (1100)
                      ...|.+.|++++|+|++++|++|+.||.|++|++........   ..+..|.            ..|.++.|+|  ++..
T Consensus        93 ~~~h~~~I~~v~~s~dg~~l~s~~~dg~i~iwd~~~~~~~~~---~~~~~~~------------~~v~~~~~~~--~~~~  155 (337)
T d1gxra_          93 CLNRDNYIRSCKLLPDGCTLIVGGEASTLSIWDLAAPTPRIK---AELTSSA------------PACYALAISP--DSKV  155 (337)
T ss_dssp             CSCTTSBEEEEEECTTSSEEEEEESSSEEEEEECCCC--EEE---EEEECSS------------SCEEEEEECT--TSSE
T ss_pred             ecCCCCcEEEEEEcCCCCEEEEeecccccccccccccccccc---ccccccc------------cccccccccc--cccc
Confidence            225678899999999999999999999999999886555544   3355555            7899999988  6888


Q ss_pred             EEEEEcCCEEEEEEccCCEEEEE-ecCCcccccccccCCCCCCCCccccCCCCCCCCCCceEEEEEecCCCCEEEEEEcC
Q 001321          193 VLIAYENALVILWDVSEAQIIFV-GGGKDLQLKDGVVDSPSEGDSTFLEGISEHQPEEKEISALCWASSSGSILAVGYID  271 (1100)
Q Consensus       193 ll~~~~dg~V~lwdl~~~~~~~~-~~~~~~~~~~~l~~~~~g~~~~~g~~~~~~~~~~~~V~sl~w~spdg~~l~sg~~D  271 (1100)
                      +++++.++.|.+||+.+++.... .+|                              ...|.+++|. +++..+++++.|
T Consensus       156 l~s~~~d~~i~~~~~~~~~~~~~~~~~------------------------------~~~v~~l~~s-~~~~~~~~~~~d  204 (337)
T d1gxra_         156 CFSCCSDGNIAVWDLHNQTLVRQFQGH------------------------------TDGASCIDIS-NDGTKLWTGGLD  204 (337)
T ss_dssp             EEEEETTSCEEEEETTTTEEEEEECCC------------------------------SSCEEEEEEC-TTSSEEEEEETT
T ss_pred             ccccccccccccccccccccccccccc------------------------------cccccccccc-cccccccccccc
Confidence            99999999999999999887554 334                              7789999985 999999999999


Q ss_pred             CcEEEEecCCCCCCCCcccCCCCcceeeeccccCCCcceEEEEecccccCCCCCCceEEEEeCCCCCCcceEEEEEcCCc
Q 001321          272 GDILLWNTSTTASTKGQQTGSRNNVVKLELSSAERRLPVIVLHWSTNKESRSNIDGRLFVYGGDEIGSEEVLTVLSLEWS  351 (1100)
Q Consensus       272 G~I~lWd~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~i~~~~w~~~~~~~~~~~~~llv~gg~~~g~~~~ltvl~l~~~  351 (1100)
                      |.+++||+.+++.           +.              ..                                 .    
T Consensus       205 ~~v~i~d~~~~~~-----------~~--------------~~---------------------------------~----  222 (337)
T d1gxra_         205 NTVRSWDLREGRQ-----------LQ--------------QH---------------------------------D----  222 (337)
T ss_dssp             SEEEEEETTTTEE-----------EE--------------EE---------------------------------E----
T ss_pred             cccccccccccee-----------ec--------------cc---------------------------------c----
Confidence            9999999864410           00              00                                 0    


Q ss_pred             cccccceeeeeeeecCCCcceeEEEccCCCCCCCCCcceEEEEecCCeeeEeecCceeEeeeccCCCCCCCCccCCcccc
Q 001321          352 SGMENLRCVSRVDITLTGSFADMILLSSAGATVGNHKADLFVLTSPGQLHFYDNASLTTLLSQQEKKPSVCPVEFPGVIP  431 (1100)
Q Consensus       352 ~~~~~~~~~~~~~l~~~~~v~d~~~~p~~~~~~~~~~~~l~vl~~~G~l~~~d~~~~~~~~~~~~~~~~~~~~~~p~~~~  431 (1100)
                                     ..                             +.                                
T Consensus       223 ---------------~~-----------------------------~~--------------------------------  226 (337)
T d1gxra_         223 ---------------FT-----------------------------SQ--------------------------------  226 (337)
T ss_dssp             ---------------CS-----------------------------SC--------------------------------
T ss_pred             ---------------cc-----------------------------cc--------------------------------
Confidence                           00                             00                                


Q ss_pred             cCCCceEEEEEEeccCCCCchhhHhHHHhhccccCCCcccCcccccccCCcccccCccccCCCCcEEEEEecCCcEEEee
Q 001321          432 ISDPIMTVAEFMLLPFGGHSSKGLSEIATFTKLHSSHTQAGHIKWPLSGGVPSPVPITKCHSVDRVYLAGYHDGSVRIWD  511 (1100)
Q Consensus       432 ~~~~~it~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~pl~GG~~~~~~~~~~s~~~~~l~Tg~~DGtIriWd  511 (1100)
                                                                            +..++++++++++++|+.||.|++||
T Consensus       227 ------------------------------------------------------i~~l~~~~~~~~l~~~~~d~~i~i~d  252 (337)
T d1gxra_         227 ------------------------------------------------------IFSLGYCPTGEWLAVGMESSNVEVLH  252 (337)
T ss_dssp             ------------------------------------------------------EEEEEECTTSSEEEEEETTSCEEEEE
T ss_pred             ------------------------------------------------------eEEEEEcccccccceecccccccccc
Confidence                                                                  01114556777999999999999999


Q ss_pred             CCCCceeEEeeeccceeeeeecCCCCCeeEEEEeeCCCeEEEEecCceEEEEEecCCCCCcceeeeccCCCceeeccCCC
Q 001321          512 ATYPVFKLICALDAEVQGIEVAGSRAPVSTLSFCFINSSLAVGNEFGLVYIYNLNGSLDAKNFLFVLETKSEVHALPEGK  591 (1100)
Q Consensus       512 ~~~~~l~~~~~l~~~~~~~~l~~h~~~Vt~lafspd~~~Lasg~~dG~V~lw~l~~~~~~~~~~~~~~~~~~~~~i~~~~  591 (1100)
                      +..+...            ....|...|++++|+|++++|++|+.||.|++|++....                      
T Consensus       253 ~~~~~~~------------~~~~~~~~i~~v~~s~~g~~l~s~s~Dg~i~iwd~~~~~----------------------  298 (337)
T d1gxra_         253 VNKPDKY------------QLHLHESCVLSLKFAYCGKWFVSTGKDNLLNAWRTPYGA----------------------  298 (337)
T ss_dssp             TTSSCEE------------EECCCSSCEEEEEECTTSSEEEEEETTSEEEEEETTTCC----------------------
T ss_pred             ccccccc------------cccccccccceEEECCCCCEEEEEeCCCeEEEEECCCCC----------------------
Confidence            9877643            355788899999999999999999999999999987651                      


Q ss_pred             cceeEEEEeecCcCeEEEEEcCCCCEEEEEeCCceEEEEec
Q 001321          592 ISLCRAVFSLVNSPVRALQFTSSGAKLAVGFECGRVAVLDM  632 (1100)
Q Consensus       592 ~~~~~~~~~~h~~~VtsLafSp~g~~LavGs~dG~V~vwD~  632 (1100)
                         ++ ....|.++|++++|+|++++||+|+.||+|+|||+
T Consensus       299 ---~~-~~~~~~~~v~~~~~s~d~~~l~t~s~D~~I~vWdl  335 (337)
T d1gxra_         299 ---SI-FQSKESSSVLSCDISVDDKYIVTGSGDKKATVYEV  335 (337)
T ss_dssp             ---EE-EEEECSSCEEEEEECTTSCEEEEEETTSCEEEEEE
T ss_pred             ---EE-EEccCCCCEEEEEEeCCCCEEEEEeCCCeEEEEEE
Confidence               22 23568899999999999999999999999999996



>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2bgra1 b.70.3.1 (A:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2bgra1 b.70.3.1 (A:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]} Back     information, alignment and structure
>d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]} Back     information, alignment and structure
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d2hqsa1 b.68.4.1 (A:163-431) TolB, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2hqsa1 b.68.4.1 (A:163-431) TolB, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1xfda1 b.70.3.1 (A:127-591) Dipeptidyl aminopeptidase-like protein 6, DPP6, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k32a2 b.68.7.1 (A:39-319) Tricorn protease N-terminal domain {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1xfda1 b.70.3.1 (A:127-591) Dipeptidyl aminopeptidase-like protein 6, DPP6, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1npea_ b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1k32a2 b.68.7.1 (A:39-319) Tricorn protease N-terminal domain {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Back     information, alignment and structure
>d1fwxa2 b.69.3.1 (A:8-451) Nitrous oxide reductase, N-terminal domain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1ijqa1 b.68.5.1 (A:377-642) Low density lipoprotein (LDL) receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fwxa2 b.69.3.1 (A:8-451) Nitrous oxide reductase, N-terminal domain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1ijqa1 b.68.5.1 (A:377-642) Low density lipoprotein (LDL) receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qfma1 b.69.7.1 (A:1-430) Prolyl oligopeptidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1kb0a2 b.70.1.1 (A:1-573) Quinoprotein alcohol dehydrogenase, N-terminal domain {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1npea_ b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Back     information, alignment and structure
>d1utca2 b.69.6.1 (A:4-330) Clathrin heavy-chain terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1utca2 b.69.6.1 (A:4-330) Clathrin heavy-chain terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1xipa_ b.69.14.1 (A:) Nucleoporin NUP159 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ad6a1 b.70.1.1 (A:1-571) Methanol dehydrogenase, heavy chain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1kv9a2 b.70.1.1 (A:1-560) Quinoprotein alcohol dehydrogenase, N-terminal domain {Pseudomonas putida, hk5 [TaxId: 303]} Back     information, alignment and structure
>d1v04a_ b.68.6.2 (A:) Serum paraoxonase/arylesterase 1, PON1 {Rabit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1h6la_ b.68.3.1 (A:) Thermostable phytase (3-phytase) {Bacillus amyloliquefaciens [TaxId: 1390]} Back     information, alignment and structure
>d1xipa_ b.69.14.1 (A:) Nucleoporin NUP159 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1h6la_ b.68.3.1 (A:) Thermostable phytase (3-phytase) {Bacillus amyloliquefaciens [TaxId: 1390]} Back     information, alignment and structure