Citrus Sinensis ID: 001385

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------1000------1010------1020------1030------1040------1050------1060------1070------1080------109
MSSWGLGWKRPLEIFKLTLSYGTEEAGYDPFNRLSTSSSSSTSTSSLSSPTVMTRDPELGFRIDLEWTSGEEEDQVALKLQSQLMVALPVPEDTVVVELAPQEEGDVATDAANVGVEMRVVKRREPLRAVVLTKGVGSGHLSDGIGVLTRLMRSDLSTSGPGNNMGSGFCDHWKTVTAVSLCGLGLSALPVDLTRLPVLEKLYLDNNKLSTLPPELGAMKNLKVLIVDNNMLVCVPVELRECVGLVELSLEHNRLVRPLLDFRAMAELKILRLFGNPLEFLPEILPLLKLRHLSLANIRIVADENLRSVNVQIEMENNSYFGASRHKLSAFFSLIFRFSSCHHPLLASALAKIMQDQENRVVVGKDENAVRQLISMISSDNRHVVEQACSALSSLAGDVSVAMLLMKCDIMQPIIAVLKSFAPEEVKSVLQVVGQLAFASDTVAQKMLTKDVLKSLKLLCAHKNPEVQRFALLAVGNLAFCLENRRILVTSESLRDLLMRLTVGPEPRVNKAAARALAILGENESLRRAIRGRQVPKQGLRILSMDGGGMKGLATVQILKEIEKGTGKRIHELFDLVCGTSTGGMLAIALAVKLMTLDQCEEIYKNLGKLVFAEPFPKDNEAATWREKLDQIYKSSSQSFRVVVHGSKHSADQFERLLKEMCADEDGDLLIESSVKNIPKVFTVSTLVNVMPAQPFIFRNYQYPAGTPEVPFSISENSGITVLGSPTTGAQVGYKRSAFIGSCKHQVWQAIRASSAAPYYLDDFSDDVFRWQDGAIVANNPTIFAIREAQLLWPDTRIDCLVSIGCGSVPTKTRRGGWRYLDTGQVLIESACSVDRAEEALSTLLPMLPEIQYYRFNPVDERCEMELDETDPAEWLKLEAAVDEYINNNSESFKNVCERLLLPFQQDEKWSENLKSQHFPRGKVSNTDEISPSLGWRRNTLLVEAMHSPDSGRVGHHARALESFCASNGIRLSLLHGISGIGKSMPGATFPTPFSSPLITGSFPSSPLLYSPDVGPQRIGRIDMVPPLSLDGLQAGKTFSSPPVSPKAHRQLSLHVRSLHEKLQSLPQVGIVHLCLQNDTVGSILRSA
cccccccccccccEEEEEccccccccccccccccccccccccccccccccccccccccccEEEEEcccccccHHHHHHHHHHHHHHHcccccccEEEEcccccccccccccccccHHHHHHHccccccEEEcccccccccccHHHHHHcccccccccccccccccccccccccccccEEEccccccccccHHccccccccEEEccccccccccHHHcccccccEEcccccccccccHHHHccccccEEEccccccccccHHHHccccccEEccccccccccccccccccccEEEcccccccccccccccccccccccccEEcccccccccccccHHHcccccccccccHHHHHHcccccccEEccccccccccHHHHHcccccHHHHHHHHHHcccccHHHHHHHHHccccHHHHHHHHcccHHHHHHHHHHHcccccccHHHHHHcccHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHcHHHccccHHHHHHHHHHHccccHHHHHHHHHHHHHHcccHHHHHHHccccccccccEEEEEccccccHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHcccccHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHcccccEEEEccccccHHHHHHHHHHHHcccccccHHccccccccEEEEEEEEcccccccEEEEccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHcccccccccccccccccEEEEcccccccHHHHHHHHHHHHcccccccEEEEEcccccccccccccccHHHHHHHHHHHHHcHHHHHHHHHHHccccccccEEEEcccccccccccccccHHHHHHHHHHHHHHHHHcHHHHHHHHHHHcccccHHHHHHHHHHccccccccccccccccccccccccEEEEEEccccccccccccHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHccccEEEEEEEEEccccccccccc
ccccccccccccHEEEEEEcccccccccccccccccccccccccccccccccccccccccEEEEEEccccccHHHHHHHHHHHHHHHccccccEEEEEEccccccccccccccEEEEEEEEEcccccEEEEEEEEccccccccccEHHHHHHHcccccccccccHHHHccHccHHHHEEEcccccccEccHHHHHcHHHHHEEccccccccccHHHHHHHccEEEEEcccEEEEccHHHHHHHHHHEEEcHcccccccHHcHHHHHHHHHHHHccccHHHcHHHcHHHHccEEEEEEEEEEEcccccccEEEEEEcccHHHHHcHHHHHHHHHHHEcccccccHHHHHHHHHHHHcccccHEHcccHHHHHHHHHHHccccHHHHHHHHHHHHHHcccHHHHHHHHHccHHHHHHHHHHccccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHccHcccEEEEcHHHHHHHHHHHHcccHHHHHHHHHHHHHHcccHHHHHHHcccccccccEEEEEEcccHHHHHHHHHHHHHHHHHHcccHHHHHHEEccccHHHHHHHHHHHccccHHHHHHHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHcHcccccccccccccccEEEEEEEEEccccccEEEEEccccccccccccccccccccccccccccccccccHHccccccccccHHHHHHHHccccccccccccccccEEccccEEcccHHHHHHHHHHHHcccccEEEEEEEccccccccccccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccEEEEcccccccccccccccHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHccccHHHHHHHHHHHccHcccccccccccccccccccEEEEEEcccccccccccccHHHHHHHHHccccEEEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEcccccccccccccccccHHHHHHHHHccccEEEEEEEEEccccccEEEcc
msswglgwkrpLEIFKLTLsygteeagydpfnrlstssssststsslssptvmtrdpelgfridlewtsgeeEDQVALKLQSQLMvalpvpedtvvvelapqeegdvatdaANVGVEMRVVKRREPLRAVVLTkgvgsghlsdgIGVLTRLMrsdlstsgpgnnmgsgfcdhwKTVTAVSLcglglsalpvdltrlpvleklyldnnklstlppelgamkNLKVLIVDNNMLVCVPVELRECVGLVELSLehnrlvrpllDFRAMAELKILRLfgnpleflpeILPLLKLRHLSLANIRIVADENLRSVNVQIEmennsyfgasrHKLSAFFSLIFRFSSCHHPLLASALAKIMQdqenrvvvgkdENAVRQLISMISSDNRHVVEQACSALSSLAGDVSVAMLLMKCDIMQPIIAVLKSFAPEEVKSVLQVVGQLAFASDTVAQKMLTKDVLKSLKLLCAHKNPEVQRFALLAVGNLAFCLENRRILVTSESLRDLLMRLTVGPEPRVNKAAARALAILGENESLRRAirgrqvpkqGLRILsmdgggmkgLATVQILKEIEKGTGKRIHELFDLVCGTSTGGMLAIALAVKLMTLDQCEEIYKNLGklvfaepfpkdneaATWREKLDQIYKSSSQSFRVVVHGSKHSADQFERLLKEMCADEDGDLLIESSVKNIPKVFTVSTLvnvmpaqpfifrnyqypagtpevpfsisensgitvlgspttgaqvgykrsafigSCKHQVWQAIRassaapyylddfsddvfrwqdgaivannpTIFAIREAqllwpdtridclvsigcgsvptktrrggwryldtGQVLIESACSVDRAEEALSTLlpmlpeiqyyrfnpvdercemeldetdpaEWLKLEAAVDEYINNNSESFKNVCERLllpfqqdekwsenlksqhfprgkvsntdeispslgwrRNTLLVEamhspdsgrvghhARALESFCASNGIRLSLLHGisgigksmpgatfptpfssplitgsfpsspllyspdvgpqrigridmvpplsldglqagktfssppvspkahrqLSLHVRSLHEKLQSLPQVGIVHLCLQNDTVGSILRSA
msswglgwkrpLEIFKLTLSYGTEEAGYDPFNrlstssssststsslssptvmtrdpeLGFRIDLEWTSGEEEDQVALKLQSQLMVALPVPEDTVVVELAPqeegdvatdaanvgvemrvvkrreplravvltkgvgsghlsdgiGVLTRLMRSDLSTSGPGNNMGSGFCDHWKTVTAVSLCGLGLSALPVDLTRLPVLEKLYLDNNKLSTLPPELGAMKNLKVLIVDNNMLVCVPVELRECVGLVELSLEHNRLVRPLLDFRAMAELKILRLFGNPLEFLPEILPLLKLRHLSLANIRIVADENLRSVNVQIEMENNSYFGASRHKLSAFFSLIFRFSSCHHPLLASALAKIMQDQENRVVVGKDENAVRQLISmissdnrhVVEQACSALSSLAGDVSVAMLLMKCDIMQPIIAVLKSFAPEEVKSVLQVVGQLAFASDTVAQKMLTKDVLKSLKLLCAHKNPEVQRFALLAVGNLAFCLENRRILVTSESLRDLLMRltvgpeprvnKAAARALAIlgeneslrrairgrqvpkqglrilsmdgggmkGLATVQILKEIEKGTGKRIHELFDLVCGTSTGGMLAIALAVKLMTLDQCEEIYKNLGKLVFAEPFPKDNEAATWREKLDQIYKSSSQSFRVVVHGSKHSADQFERLLKEMCADEDGDLLIESSVKNIPKVFTVSTLVNVMPAQPFIFRNYQYPAGTPEVPFSISENSGITVLGSPTTGAQVGYKRSAFIGSCKHQVWQAIRASSAAPYYLDDFSDDVFRWQDGAIVANNPTIFAIREAQLLWPDTRIDCLVSIgcgsvptktrrggwryLDTGQVLIESACSVDRAEEALStllpmlpeiQYYRFNPVDERCEMELDETDPAEWLKLEAAVDEYINNNSESFKNVCERLLLPFQQDEKWSENLksqhfprgkvsntdeispslgWRRNTLLVEAMHSPDSGRVGHHARALESFCASNGIRLSLLHGISGIGKSMPGATFPTPFSSPLITGSFPSSPLLYSPDVGPQRIGRIDMVPPLSLDGLQAGKTFSSPPVSPKAHRQLSLHVRSLHEKLQSLPQVGIVHLCLQNDTVGSILRSA
MSSWGLGWKRPLEIFKLTLSYGTEEAGYDPFNRlstssssststsslssPTVMTRDPELGFRIDLEWTSGEEEDQVALKLQSQLMVALPVPEDTVVVELAPQEEGDVATDAANVGVEMRVVKRREPLRAVVLTKGVGSGHLSDGIGVLTRLMRSDLSTSGPGNNMGSGFCDHWKTVTAVSLCGLGLSALPVDLTRLPVLEKLYLDNNKLSTLPPELGAMKNLKVLIVDNNMLVCVPVELRECVGLVELSLEHNRLVRPLLDFRAMAELKILRLFGNpleflpeilpllklrhlSLANIRIVADENLRSVNVQIEMENNSYFGASRHKLSAFFSLIFRFSSCHHPLLASALAKIMQDQENRVVVGKDENAVRQLISMISSDNRHVVEQACSALSSLAGDVSVAMLLMKCDIMQPIIAVLKSFAPEEVKSVLQVVGQLAFASDTVAQKMLTKDVLKSLKLLCAHKNPEVQRFALLAVGNLAFCLENRRILVTSESLRDLLMRLTVGPEPRVNKAAARALAILGENESLRRAIRGRQVPKQGLRILSMDGGGMKGLATVQILKEIEKGTGKRIHELFDLVCGTSTGGMLAIALAVKLMTLDQCEEIYKNLGKLVFAEPFPKDNEAATWREKLDQIYKSSSQSFRVVVHGSKHSADQFERLLKEMCADEDGDLLIESSVKNIPKVFTVSTLVNVMPAQPFIFRNYQYPAGTPEVPFSISENSGITVLGSPTTGAQVGYKRSAFIGSCKHQVWQAIRASSAAPYYLDDFSDDVFRWQDGAIVANNPTIFAIREAQLLWPDTRIDCLVSIGCGSVPTKTRRGGWRYLDTGQVLIESACSVDRAEEALSTLLPMLPEIQYYRFNPVDERCEMELDETDPAEWLKLEAAVDEYINNNSESFKNVCERLLLPFQQDEKWSENLKSQHFPRGKVSNTDEISPSLGWRRNTLLVEAMHSPDSGRVGHHARALESFCASNGIRLSLLHGISGIGKSMPGATFPTPFSSPLITGSFPSSPLLYSPDVGPQRIGRIDMVPPLSLDGLQAGKTFSSPPVSPKAHRQLSLHVRSLHEKLQSLPQVGIVHLCLQNDTVGSILRSA
***WGLGWKRPLEIFKLTLSYGTEEAG********************************GFRIDLEWTS*****QVALKLQSQLMVALPVPEDTVVVELAPQEEGDVATDAANVGVEMRVVKRREPLRAVVLTKGVGSGHLSDGIGVLTRLMR***********MGSGFCDHWKTVTAVSLCGLGLSALPVDLTRLPVLEKLYLDNNKLSTLPPELGAMKNLKVLIVDNNMLVCVPVELRECVGLVELSLEHNRLVRPLLDFRAMAELKILRLFGNPLEFLPEILPLLKLRHLSLANIRIVADENLRSVNVQIEMENNSYFGASRHKLSAFFSLIFRFSSCHHPLLASALAKIMQDQENRVVVGKDENAVRQLISMISSDNRHVVEQACSALSSLAGDVSVAMLLMKCDIMQPIIAVLKSFAPEEVKSVLQVVGQLAFASDTVAQKMLTKDVLKSLKLLCAHKNPEVQRFALLAVGNLAFCLENRRILVTSESLRDLLMRLTVGPEPRVNKAAARALAILGENESLRRAIRGRQVPKQGLRILSMDGGGMKGLATVQILKEIEKGTGKRIHELFDLVCGTSTGGMLAIALAVKLMTLDQCEEIYKNLGKLVFAEPFPKDNEAATWREKLDQIYK****SFRVVVHGS***ADQFERLLKEMCADEDGDLLIESSVKNIPKVFTVSTLVNVMPAQPFIFRNYQYPAGTPEVPFSISENSGITVLGSPTTGAQVGYKRSAFIGSCKHQVWQAIRASSAAPYYLDDFSDDVFRWQDGAIVANNPTIFAIREAQLLWPDTRIDCLVSIGCGSVPTKTRRGGWRYLDTGQVLIESACSVDRAEEALSTLLPMLPEIQYYRFNPVDERCEMELDETDPAEWLKLEAAVDEYINNNSESFKNVCERLLLPFQQ****************************GWRRNTLLVEA********VGHHARALESFCASNGIRLSLLHGISGIGKSM*************************************************************************LHEKLQSLPQVGIVHLCLQNDTVGS*****
**SWG*GWKRPLEIFKLTLSYGTE***********************************GFRIDLEWTS*EE**QVALKLQSQLMVALPVPEDTVVVELAPQEEGDVATDAANVGVEMRVVKRREPLRAVVLTKGVGSGHLSDGIGVLTRLMRSDLSTSGPGNNMGSGFCDHWKTVTAVSLCGLGLSALPVDLTRLPVLEKLYLDNNKLSTLPPELGAMKNLKVLIVDNNMLVCVPVELRECVGLVELSLEHNRLVRPLLDFRAMAELKILRLFGNPLEFLPEILPLLKLRHLSLANIRIVADENLRSVNVQIEMENNSYFGASRHKLSAFFSLIFRFSSCHHPLLASALAKIMQDQENRVVVGKDENAVRQLISMISSDNRHVVEQACSALSSLAGDVSVAMLLMKCDIMQPIIAVLKSFAPEEVKSVLQVVGQLAFASDTVAQKMLTKDVLKSLKLLCAHKNPEVQRFALLAVGNLAFCLENRRILVTSESLRDLLMRLTVGPE*RVNKAAARALAILGENESLRRAIR*RQVPKQGLRILSMDGGGMKGLATVQILKEIEKGTGKRIHELFDLVCGTSTGGMLAIALAVKLMTLDQCEEIYKNLGKLVFAEPFPKDNEAATWREKLDQIYKSSSQSFRVVVHGSKHSADQFERLLKEMC******************VFTVSTLVNVMPAQPFIFRNYQYPAGTPEVPFSISENSGITVLGS****************SCKHQVWQAIRASSAAPYYLDDFSDDVFRWQDGAIVANNPTIFAIREAQLLWPDTRIDCLVSIGCGSVPTK*****WRYLDTGQVLIESACSVDRAEEALSTLLPMLPEIQYYRFNPVDERCEMELDETDPAEWLKLEAAVDEYINNNSESFKNVCERLLL**********************************************************LESFCAS******************************************************************************************************GIVHLCLQNDTVGSILR**
MSSWGLGWKRPLEIFKLTLSYGTEEAGYDPFNR*******************MTRDPELGFRIDLEWTSGEEEDQVALKLQSQLMVALPVPEDTVVVELAPQEEGDVATDAANVGVEMRVVKRREPLRAVVLTKGVGSGHLSDGIGVLTRLMRSDLSTSGPGNNMGSGFCDHWKTVTAVSLCGLGLSALPVDLTRLPVLEKLYLDNNKLSTLPPELGAMKNLKVLIVDNNMLVCVPVELRECVGLVELSLEHNRLVRPLLDFRAMAELKILRLFGNPLEFLPEILPLLKLRHLSLANIRIVADENLRSVNVQIEMENNSYFGASRHKLSAFFSLIFRFSSCHHPLLASALAKIMQDQENRVVVGKDENAVRQLISMISSDNRHVVEQACSALSSLAGDVSVAMLLMKCDIMQPIIAVLKSFAPEEVKSVLQVVGQLAFASDTVAQKMLTKDVLKSLKLLCAHKNPEVQRFALLAVGNLAFCLENRRILVTSESLRDLLMRLTVGPEPRVNKAAARALAILGENESLRRAIRGRQVPKQGLRILSMDGGGMKGLATVQILKEIEKGTGKRIHELFDLVCGTSTGGMLAIALAVKLMTLDQCEEIYKNLGKLVFAEPFPKDNEAATWREKLDQIYKSSSQSFRVVVHGSKHSADQFERLLKEMCADEDGDLLIESSVKNIPKVFTVSTLVNVMPAQPFIFRNYQYPAGTPEVPFSISENSGITVLGSPTTGAQVGYKRSAFIGSCKHQVWQAIRASSAAPYYLDDFSDDVFRWQDGAIVANNPTIFAIREAQLLWPDTRIDCLVSIGCGSVPTKTRRGGWRYLDTGQVLIESACSVDRAEEALSTLLPMLPEIQYYRFNPVDERCEMELDETDPAEWLKLEAAVDEYINNNSESFKNVCERLLLPFQQDEKWSENLKSQHFPRGKVSNTDEISPSLGWRRNTLLVEAMHSPDSGRVGHHARALESFCASNGIRLSLLHGISGIGKSMPGATFPTPFSSPLITGSFPSSPLLYSPDVGPQRIGRIDMVPPLSLDGLQAGKT*************LSLHVRSLHEKLQSLPQVGIVHLCLQNDTVGSILRSA
****GLGWKRPLEIFKLTLSYGTE*********************************ELGFRIDLEWTSGEEEDQVALKLQSQLMVALPVPEDTVVVELAPQ*******DAANVGVEMRVVKRREPLRAVVLTKGVGSGHLSDGIGVLTRLMRSDLSTSGPGNNMGSGFCDHWKTVTAVSLCGLGLSALPVDLTRLPVLEKLYLDNNKLSTLPPELGAMKNLKVLIVDNNMLVCVPVELRECVGLVELSLEHNRLVRPLLDFRAMAELKILRLFGNPLEFLPEILPLLKLRHLSLANIRIVADENLRSVNVQIEMENNSYFGASRHKLSAFFSLIFRFSSCHHPLLASALAKIMQDQENRVVVGKDENAVRQLISMISSDNRHVVEQACSALSSLAGDVSVAMLLMKCDIMQPIIAVLKSFAPEEVKSVLQVVGQLAFASDTVAQKMLTKDVLKSLKLLCAHKNPEVQRFALLAVGNLAFCLENRRILVTSESLRDLLMRLTVGPEPRVNKAAARALAILGENESLRRAIRGRQVPKQGLRILSMDGGGMKGLATVQILKEIEKGTGKRIHELFDLVCGTSTGGMLAIALAVKLMTLDQCEEIYKNLGKLVFAEPFPKDNEAATWREKLDQIYKSSSQSFRVVVHGSKHSADQFERLLKEMCADEDGDLLIESSVKNIPKVFTVSTLVNVMPAQPFIFRNYQYPAGT**********SGITVLGS***GAQVGYKRSAFIGSCKHQVWQAIRASSAAPYYLDDFSDDVFRWQDGAIVANNPTIFAIREAQLLWPDTRIDCLVSIGCGSVPTKTRRGGWRYLDTGQVLIESACSVDRAEEALSTLLPMLPEIQYYRFNPVDERCEMELDETDPAEWLKLEAAVDEYINNNSESFKNVCERLLLPFQQDEKWSENLKSQHFPRGKVSNTDEISPSLGWRRNTLLVEAMHSPDSGRVGHHARALESFCASNGIRLSLLHGISGIGKSMPGATFPTPFSSPLITGSFPSSPLLYSPDVGPQRIGRIDMVPPLSLD**QAGKTFSSPPVSPKAHRQLSLHVRSLHEKLQSLPQVGIVHLCLQNDTV**I****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSSWGLGWKRPLEIFKLTLSYGTEEAGYDPFNRLSTSSSSSTSTSSLSSPTVMTRDPELGFRIDLEWTSGEEEDQVALKLQSQLMVALPVPEDTVVVELAPQEEGDVATDAANVGVEMRVVKRREPLRAVVLTKGVGSGHLSDGIGVLTRLMRSDLSTSGPGNNMGSGFCDHWKTVTAVSLCGLGLSALPVDLTRLPVLEKLYLDNNKLSTLPPELGAMKNLKVLIVDNNMLVCVPVELRECVGLVELSLEHNRLVRPLLDFRAMAELKILRLFGNPLEFLPEILPLLKLRHLSLANIRIVADENLRSVNVQIEMENNSYFGASRHKLSAFFSLIFRFSSCHHPLLASALAKIMQDQENRVVVGKDENAVRQLISMISSDNRHVVEQACSALSSLAGDVSVAMLLMKCDIMQPIIAVLKSFAPEEVKSVLQVVGQLAFASDTVAQKMLTKDVLKSLKLLCAHKNPEVQRFALLAVGNLAFCLENRRILVTSESLRDLLMRLTVGPEPRVNKAAARALAILGENESLRRAIRGRQVPKQGLRILSMDGGGMKGLATVQILKEIEKGTGKRIHELFDLVCGTSTGGMLAIALAVKLMTLDQCEEIYKNLGKLVFAEPFPKDNEAATWREKLDQIYKSSSQSFRVVVHGSKHSADQFERLLKEMCADEDGDLLIESSVKNIPKVFTVSTLVNVMPAQPFIFRNYQYPAGTPEVPFSISENSGITVLGSPTTGAQVGYKRSAFIGSCKHQVWQAIRASSAAPYYLDDFSDDVFRWQDGAIVANNPTIFAIREAQLLWPDTRIDCLVSIGCGSVPTKTRRGGWRYLDTGQVLIESACSVDRAEEALSTLLPMLPEIQYYRFNPVDERCEMELDETDPAEWLKLEAAVDEYINNNSESFKNVCERLLLPFQQDEKWSENLKSQHFPRGKVSNTDEISPSLGWRRNTLLVEAMHSPDSGRVGHHARALESFCASNGIRLSLLHGISGIGKSMPGATFPTPFSSPLITGSFPSSPLLYSPDVGPQRIGRIDMVPPLSLDGLQAGKTFSSPPVSPKAHRQLSLHVRSLHEKLQSLPQVGIVHLCLQNDTVGSILRSA
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query1088 2.2.26 [Sep-21-2011]
Q8K1N1776 Calcium-independent phosp yes no 0.318 0.445 0.314 6e-47
Q5XTS1786 Calcium-independent phosp yes no 0.322 0.446 0.307 1e-45
Q9NP80782 Calcium-independent phosp yes no 0.320 0.446 0.313 4e-45
P97819807 85/88 kDa calcium-indepen no no 0.277 0.374 0.272 3e-19
P97570807 85/88 kDa calcium-indepen yes no 0.274 0.370 0.272 4e-19
O60733806 85/88 kDa calcium-indepen no no 0.277 0.374 0.259 4e-15
O74874690 Glucose-repressible alcoh yes no 0.094 0.149 0.359 1e-09
Q5B778675 Glucose-repressible alcoh no no 0.113 0.183 0.346 2e-09
Q7KRY7 1851 Protein lap4 OS=Drosophil no no 0.141 0.083 0.356 1e-08
Q6XHA7 3365 Probable serine/threonine no no 0.083 0.027 0.397 2e-08
>sp|Q8K1N1|PLPL8_MOUSE Calcium-independent phospholipase A2-gamma OS=Mus musculus GN=Pnpla8 PE=2 SV=1 Back     alignment and function desciption
 Score =  190 bits (482), Expect = 6e-47,   Method: Compositional matrix adjust.
 Identities = 130/413 (31%), Positives = 203/413 (49%), Gaps = 67/413 (16%)

Query: 492 ESLRDLLMRLTVGPEPRVNKAAARALAILGENESLRRAIRGRQVPKQGLRILSMDGGGMK 551
           E +   L+RL    +  +  A    LA++G  +     ++GR     G+RIL++DGGG +
Sbjct: 397 EKIIPYLLRLRQVKDETLQAAVREILALIGYVD----PVKGR-----GIRILTIDGGGTR 447

Query: 552 GLATVQILKEIEKGTGKRIHELFDLVCGTSTGGMLAIALAVKLMTLDQCEEIYKNLGKLV 611
           G+  +Q L+++ + T K IH+LFD +CG STG +LA  L +  M LD+CEE+Y+ LG  V
Sbjct: 448 GVVALQTLRKLVELTQKPIHQLFDYICGVSTGAILAFMLGLFHMPLDECEELYRKLGSDV 507

Query: 612 FAEPFPKDNEAATWREKLDQIYKSSSQSFRVVVHGSKHSADQFERLLKEMCADEDGDLLI 671
           F +         +W           S +F        + ++ +E++LK    D  G  L+
Sbjct: 508 FTQNVIVGTVKMSW-----------SHAF--------YDSNTWEKILK----DRIGSALM 544

Query: 672 ESSVKN--IPKVFTVSTLVNV-MPAQPFIFRNYQYPAGTPEVPFSISENSGITVLGSPTT 728
             + +N   PKV  +ST+VN     + F+FRNY +  GT                     
Sbjct: 545 IETARNPACPKVAAISTIVNRGQTPKAFVFRNYGHFPGT--------------------- 583

Query: 729 GAQVGYKRSAFIGSCKHQVWQAIRASSAAPYYLDDFSDDVFRWQDGAIVANNPTIFAIRE 788
                   S ++G C++++WQAIRASSAAP Y  +++      QDG ++ NNP+  A+ E
Sbjct: 584 -------NSHYLGGCQYKMWQAIRASSAAPGYFAEYALGSDLHQDGGLLLNNPSALALHE 636

Query: 789 AQLLWPDTRIDCLVSIGCGSVPTKTRRGGWRYLDTGQVLIESACSVDRAEEALSTLLPML 848
            + +WPDT ++C+VS+G G   +  R     Y      L     S    EE    L  +L
Sbjct: 637 CKCIWPDTPLECIVSLGTGRYESDVRNTS-TYTSLKTKLSNVISSATDTEEVHIMLDGLL 695

Query: 849 PEIQYYRFNPVDERCE-MELDETDPAEWLKLEAAVDEYINNNSESFKNVCERL 900
           P   Y+RFNPV   CE + LDE+   +  +L+    +YI  N +  K V + L
Sbjct: 696 PSDTYFRFNPVI--CENIPLDESRDEKLDQLQLEGMKYIERNDQKMKKVAKIL 746
Calcium-independent phospholipase A2, which catalyzes the hydrolysis of the sn-2 position of glycerophospholipids, PtdSer and to a lower extent PtdCho. Cleaves membrane phospholipids.
Mus musculus (taxid: 10090)
EC: 3EC: .EC: 1EC: .EC: 1EC: .EC: 5
>sp|Q5XTS1|PLPL8_RABIT Calcium-independent phospholipase A2-gamma OS=Oryctolagus cuniculus GN=PNPLA8 PE=1 SV=1 Back     alignment and function description
>sp|Q9NP80|PLPL8_HUMAN Calcium-independent phospholipase A2-gamma OS=Homo sapiens GN=PNPLA8 PE=1 SV=1 Back     alignment and function description
>sp|P97819|PLPL9_MOUSE 85/88 kDa calcium-independent phospholipase A2 OS=Mus musculus GN=Pla2g6 PE=1 SV=3 Back     alignment and function description
>sp|P97570|PLPL9_RAT 85/88 kDa calcium-independent phospholipase A2 OS=Rattus norvegicus GN=Pla2g6 PE=1 SV=2 Back     alignment and function description
>sp|O60733|PLPL9_HUMAN 85/88 kDa calcium-independent phospholipase A2 OS=Homo sapiens GN=PLA2G6 PE=1 SV=2 Back     alignment and function description
>sp|O74874|CCR4_SCHPO Glucose-repressible alcohol dehydrogenase transcriptional effector OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ccr4 PE=3 SV=1 Back     alignment and function description
>sp|Q5B778|CCR4_EMENI Glucose-repressible alcohol dehydrogenase transcriptional effector OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=ccr4 PE=3 SV=1 Back     alignment and function description
>sp|Q7KRY7|LAP4_DROME Protein lap4 OS=Drosophila melanogaster GN=scrib PE=1 SV=1 Back     alignment and function description
>sp|Q6XHA7|ROCO9_DICDI Probable serine/threonine-protein kinase roco9 OS=Dictyostelium discoideum GN=roco9 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1088
255554945 1318 conserved hypothetical protein [Ricinus 0.979 0.808 0.803 0.0
449488466 1563 PREDICTED: tryptophan synthase beta chai 0.988 0.688 0.775 0.0
449454722 1328 PREDICTED: uncharacterized protein LOC10 0.988 0.810 0.775 0.0
302144085 1286 unnamed protein product [Vitis vinifera] 0.949 0.803 0.764 0.0
147833190 1286 hypothetical protein VITISV_030806 [Viti 0.949 0.803 0.763 0.0
356520053 1332 PREDICTED: uncharacterized protein LOC10 0.983 0.803 0.762 0.0
356564518 1333 PREDICTED: uncharacterized protein LOC10 0.983 0.802 0.760 0.0
357480239 1425 Calcium-independent phospholipase A2-gam 0.983 0.750 0.733 0.0
305696361 1353 Ca2+-independent phospholipase A2 [Physa 0.992 0.798 0.745 0.0
334183567 1309 galactolipase/ phospholipase [Arabidopsi 0.952 0.791 0.761 0.0
>gi|255554945|ref|XP_002518510.1| conserved hypothetical protein [Ricinus communis] gi|223542355|gb|EEF43897.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
 Score = 1745 bits (4519), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 870/1083 (80%), Positives = 956/1083 (88%), Gaps = 17/1083 (1%)

Query: 3    SWGLGWKRPLEIFKLTLSYGTEEAGYDPFNRLSTSSSSSTSTSSLSSPTVMTRDPELGFR 62
            SWGLGWKRP EIF+LTL+YGTEE+  D  NR STSSS S S+SS +S +    D + G R
Sbjct: 2    SWGLGWKRPSEIFRLTLNYGTEES-EDDLNRTSTSSSGSFSSSSPTSLSSPPHDQDPGLR 60

Query: 63   IDLEWTSGEEEDQVALKLQSQLMVALPVPEDTVVVELAPQEEGDVATDAANVGVEMRVVK 122
            IDL+WT G++EDQVAL+LQSQLMVALP+P+D V V+L  +E         NVGVEM+VVK
Sbjct: 61   IDLDWTVGDDEDQVALRLQSQLMVALPLPQDCVTVDLNVKE-------GENVGVEMKVVK 113

Query: 123  RREPLRAVVLTKGVGSGHLSDGIGVLTRLMRSDLSTSGPGNNMGSGFCDHWKTVTAVSLC 182
            RREPLR ++L+KG GSG  SDGIG+LTRL+RS+L T G  +  G    +HW+ VT +SLC
Sbjct: 114  RREPLRGMILSKG-GSGQQSDGIGILTRLLRSNLVTDGVVSTCG----EHWRNVTLLSLC 168

Query: 183  GLGLSALPVDLTRLPVLEKLYLDNNKLSTLPPELGAMKNLKVLIVDNNMLVCVPVELREC 242
            G  LS LP +L  LP+LEKLYLDNN+LS LPPELG +K LKVL VD+N LV VPVELR+C
Sbjct: 169  GCCLSVLPAELIGLPLLEKLYLDNNRLSVLPPELGELKALKVLSVDHNALVSVPVELRQC 228

Query: 243  VGLVELSLEHNRLVRPLLDFRAMAELKILRLFGNPLEFLPEILPLLKLRHLSLANIRIVA 302
            VGLVELSLEHN+LVRPLLDFRAMAEL+ILRLFGNPLEFLPEILPL KLRHLSLANIRIVA
Sbjct: 229  VGLVELSLEHNKLVRPLLDFRAMAELQILRLFGNPLEFLPEILPLHKLRHLSLANIRIVA 288

Query: 303  DENLRSVNVQIEMENNSYFGASRHKLSAFFSLIFRFSSCHHPLLASALAKIMQDQENRVV 362
            DENLRSVNVQIEMEN+SYFGASRHKLSAFF+LIFRFSSCHHPLLASALAKI+QDQ NR+V
Sbjct: 289  DENLRSVNVQIEMENSSYFGASRHKLSAFFALIFRFSSCHHPLLASALAKIIQDQGNRIV 348

Query: 363  VGKDENAVRQLISMISSDNRHVVEQACSALSSLAGDVSVAMLLMKCDIMQPIIAVLKSFA 422
            VGKDENAVRQLISMISSDN+HVVEQACSALSSL+GDVSVAM LMKCDIMQPI +VLKS A
Sbjct: 349  VGKDENAVRQLISMISSDNQHVVEQACSALSSLSGDVSVAMQLMKCDIMQPIESVLKSVA 408

Query: 423  PEEVKSVLQVVGQLAFASDTVAQKMLTKDVLKSLKLLCAHKNPEVQRFALLAVGNLAFCL 482
             EEV SVLQVV  LAFASDTVAQKMLTKD+  + + +      +VQR ALLAVGNLAFCL
Sbjct: 409  QEEVISVLQVVATLAFASDTVAQKMLTKDIHLTFQFVF----DQVQRLALLAVGNLAFCL 464

Query: 483  ENRRILVTSESLRDLLMRLTVGPEPRVNKAAARALAILGENESLRRAIRGRQVPKQGLRI 542
            ENRRILVTSESLRDLL+RLTV  EP VNKAAARALAILGENE+LRRAIRGRQV KQGLRI
Sbjct: 465  ENRRILVTSESLRDLLLRLTVTSEPLVNKAAARALAILGENENLRRAIRGRQVAKQGLRI 524

Query: 543  LSMDGGGMKGLATVQILKEIEKGTGKRIHELFDLVCGTSTGGMLAIALAVKLMTLDQCEE 602
            L+MDGGGMKGLATVQILK IEKGTGKRIHELFDL+CGTSTGGMLA+AL +KLMTL QCEE
Sbjct: 525  LAMDGGGMKGLATVQILKAIEKGTGKRIHELFDLICGTSTGGMLAVALGIKLMTLSQCEE 584

Query: 603  IYKNLGKLVFAEPFPKDNEAATWREKLDQIYKSSSQSFRVVVHGSKHSADQFERLLKEMC 662
            IYKNLGKLVFAEP PKDNEAA+WREKLDQ+YKSSSQSFRVVVHGSKHSADQFERLLKEMC
Sbjct: 585  IYKNLGKLVFAEPTPKDNEAASWREKLDQLYKSSSQSFRVVVHGSKHSADQFERLLKEMC 644

Query: 663  ADEDGDLLIESSVKNIPKVFTVSTLVNVMPAQPFIFRNYQYPAGTPEVPFSISENSGITV 722
            ADEDGDLLI+S+VKNIPKVF VSTLV+VMPAQP++FRNYQYPAGTPEVP   SE+SG+TV
Sbjct: 645  ADEDGDLLIDSAVKNIPKVFVVSTLVSVMPAQPYVFRNYQYPAGTPEVPMPNSESSGVTV 704

Query: 723  LGSPTTGAQVGYKRSAFIGSCKHQVWQAIRASSAAPYYLDDFSDDVFRWQDGAIVANNPT 782
            LGSPT GAQVGYKRSAFIGSCKH VWQAIRASSAAPYYLDDFSDDV RWQDGAIVANNPT
Sbjct: 705  LGSPTIGAQVGYKRSAFIGSCKHHVWQAIRASSAAPYYLDDFSDDVNRWQDGAIVANNPT 764

Query: 783  IFAIREAQLLWPDTRIDCLVSIGCGSVPTKTRRGGWRYLDTGQVLIESACSVDRAEEALS 842
            IFA+REAQLLWPDT+IDCLVSIGCGSVPTK RRGGWRYLDTGQVLIESACSVDR EEALS
Sbjct: 765  IFAVREAQLLWPDTKIDCLVSIGCGSVPTKVRRGGWRYLDTGQVLIESACSVDRVEEALS 824

Query: 843  TLLPMLPEIQYYRFNPVDERCEMELDETDPAEWLKLEAAVDEYINNNSESFKNVCERLLL 902
            TLLPMLPEIQYYRFNPVDERC+MELDETDPA WLKLEAAVDEYI  NS++FKNVCERLLL
Sbjct: 825  TLLPMLPEIQYYRFNPVDERCDMELDETDPAVWLKLEAAVDEYIQTNSDAFKNVCERLLL 884

Query: 903  PFQQDEKWSENLKSQHFPRGKVSNTDEISPSLGWRRNTLLVEAMHSPDSGRVGHHARALE 962
            P+Q D+K+SENL++  FP+ KV+N+D  SPSLGWRRN LLVEA+HSPDSGRV HHARALE
Sbjct: 885  PYQHDDKFSENLRNHQFPKPKVANSDGSSPSLGWRRNVLLVEALHSPDSGRVMHHARALE 944

Query: 963  SFCASNGIRLSLLHGISGIGKSMPGATFPTPFSSPLITGSFPSSPLLYSPDVGPQRIGRI 1022
            SFC +NGIRLSL+ G SGI K  P  TFP+PF+SPLITGSFPSSPLL+SPD GP RIGRI
Sbjct: 945  SFCTNNGIRLSLMLGASGIAKIAPATTFPSPFTSPLITGSFPSSPLLFSPDFGPHRIGRI 1004

Query: 1023 DMVPPLSLDGLQAGKTFSSPPVSPKAHRQLSLHVRSLHEKLQSLPQVGIVHLCLQNDTVG 1082
            DMVPPLSLDG+Q+ K  +SPP SP   RQLSL VRSLHEKLQ+ PQVGIVHL LQND+VG
Sbjct: 1005 DMVPPLSLDGVQSVKNAASPPRSPSGRRQLSLPVRSLHEKLQNTPQVGIVHLALQNDSVG 1064

Query: 1083 SIL 1085
            SI+
Sbjct: 1065 SII 1067

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|449488466|ref|XP_004158047.1| PREDICTED: tryptophan synthase beta chain 2, chloroplastic-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449454722|ref|XP_004145103.1| PREDICTED: uncharacterized protein LOC101211840 [Cucumis sativus] gi|449471727|ref|XP_004153391.1| PREDICTED: tryptophan synthase beta chain 2, chloroplastic-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|302144085|emb|CBI23190.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|147833190|emb|CAN68639.1| hypothetical protein VITISV_030806 [Vitis vinifera] Back     alignment and taxonomy information
>gi|356520053|ref|XP_003528680.1| PREDICTED: uncharacterized protein LOC100788345 [Glycine max] Back     alignment and taxonomy information
>gi|356564518|ref|XP_003550500.1| PREDICTED: uncharacterized protein LOC100818519 [Glycine max] Back     alignment and taxonomy information
>gi|357480239|ref|XP_003610405.1| Calcium-independent phospholipase A2-gamma [Medicago truncatula] gi|355511460|gb|AES92602.1| Calcium-independent phospholipase A2-gamma [Medicago truncatula] Back     alignment and taxonomy information
>gi|305696361|gb|ADM67342.1| Ca2+-independent phospholipase A2 [Physaria fendleri] gi|306977649|gb|ADN18711.1| Ca2+-independent phospholipase A2 [Physaria fendleri] Back     alignment and taxonomy information
>gi|334183567|ref|NP_001185288.1| galactolipase/ phospholipase [Arabidopsis thaliana] gi|332195775|gb|AEE33896.1| galactolipase/ phospholipase [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1088
TAIR|locus:2036808 1311 AT1G61850 [Arabidopsis thalian 0.944 0.784 0.750 0.0
UNIPROTKB|E1BVG7782 E1BVG7 "Uncharacterized protei 0.147 0.205 0.335 3.3e-39
ZFIN|ZDB-GENE-070705-553694 pnpla8 "patatin-like phospholi 0.148 0.233 0.383 9.7e-39
MGI|MGI:1914702776 Pnpla8 "patatin-like phospholi 0.146 0.204 0.365 2.3e-38
UNIPROTKB|Q9NP80782 PNPLA8 "Calcium-independent ph 0.144 0.200 0.372 1.8e-37
UNIPROTKB|E1BE78784 PNPLA8 "Uncharacterized protei 0.146 0.202 0.365 3.9e-35
UNIPROTKB|F6Y4R5713 PNPLA8 "Uncharacterized protei 0.146 0.223 0.365 7.6e-35
RGD|1311444776 Pnpla8 "patatin-like phospholi 0.162 0.228 0.343 9.9e-35
UNIPROTKB|E2QZP1784 PNPLA8 "Uncharacterized protei 0.146 0.202 0.365 1.1e-34
WB|WBGene00022233546 Y73B6BL.4 [Caenorhabditis eleg 0.151 0.302 0.365 4.1e-34
TAIR|locus:2036808 AT1G61850 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 3931 (1388.8 bits), Expect = 0., P = 0.
 Identities = 780/1039 (75%), Positives = 877/1039 (84%)

Query:    56 DPELGFRIDLEWTSGEEEDQVALKLQSQLMVALPVPEDTVVVELAPQEEGDVATDAANVG 115
             DPELGFRIDL+WT+G+ EDQVAL+L+SQLMVALP P DTVVVEL    + D      NVG
Sbjct:    13 DPELGFRIDLDWTAGDSEDQVALRLESQLMVALPAPHDTVVVELKGIGDDDEG-GLENVG 71

Query:   116 VEMRVVKRREPLRAVVLTKGVGSGHLSDGIGVLTRLMRSDLSTSG---PGNNMGSGFCDH 172
             +EMRV KRREPLRAV L K VGSG   DG+GVLTRLMRSD+  +    P  ++ S    H
Sbjct:    72 LEMRVEKRREPLRAVTLMKAVGSGQQYDGVGVLTRLMRSDMMPAAIPAPAIDVASSCGVH 131

Query:   173 WKTVTAVSLCGLGLSALPVDLTRLPVLEKLYLDNNKLSTLPPELGAMKNLKVLIVDNNML 232
             WKTVT++SL G GL  +PV++T LP+LEKL L++NKLS LPPE+G +KNLK+L VDNNML
Sbjct:   132 WKTVTSLSLSGCGLLVMPVEVTELPLLEKLCLEHNKLSVLPPEIGKLKNLKILRVDNNML 191

Query:   233 VCVPVELRECVGLVELSLEHNRLVRPLLDFRAMAELKILRLFGNXXXXXXXXXXXXXXXX 292
             + VPVELR+CVGLVELSLEHN+LVRPLLDFRAMA L+ILRLFGN                
Sbjct:   192 ISVPVELRQCVGLVELSLEHNKLVRPLLDFRAMAGLRILRLFGNPLEFLPEILPLHQLRH 251

Query:   293 XSLANIRIVADENLRSVNVQIEMENNSYFGASRHKLSAFFSLIFRFSSCHHPLLASALAK 352
              SL NIRIV+DENLRSVNVQIE EN SYFGASRHKLSAF  LIFR SSCHHPLLAS L K
Sbjct:   252 LSLVNIRIVSDENLRSVNVQIETENTSYFGASRHKLSAFSPLIFRSSSCHHPLLASTLVK 311

Query:   353 IMQDQENRVVVGKDENAVRQLISMISSDNRHVVEQACSALSSLAGDVSVAMLLMKCDIMQ 412
             IMQD+ NR V+GKDENAVRQLISMI+SDN+HVVEQAC ALSSLA DV VAM LMKCDIM+
Sbjct:   312 IMQDEGNRSVIGKDENAVRQLISMITSDNQHVVEQACVALSSLARDVGVAMQLMKCDIMK 371

Query:   413 PIIAVLKSFAPEEVKSVLQVVGQLAFASDTVAQKMLTKDVLKSLKLLCAHKNPEVQRFAL 472
             P   VLKS +P+EV SVLQVV  LAF SD+V+QKMLTKD+LK+LK LCAHKNPEVQR AL
Sbjct:   372 PTETVLKSSSPDEVISVLQVVVTLAFVSDSVSQKMLTKDMLKALKSLCAHKNPEVQRQAL 431

Query:   473 LAVGNLAFCLENRRILVTSESLRDLLMRLTVGPEPRVNKAAARALAILGENESLRRAIRG 532
             LAVGNLAFCLENRRIL+TSESLR+LLMRL V PEPRVNKAAARALAILGENE LRR+I+G
Sbjct:   432 LAVGNLAFCLENRRILITSESLRELLMRLIVTPEPRVNKAAARALAILGENEILRRSIKG 491

Query:   533 RQVPKQGLRILSMDGGGMKGLATVQILKEIEKGTGKRIHELFDLVCGTSTGGMLAIALAV 592
             RQVPKQGLRIL+MDGGGMKGLATVQILKEIEKG+GK IHELFDL+CGTSTGGMLAIAL V
Sbjct:   492 RQVPKQGLRILTMDGGGMKGLATVQILKEIEKGSGKPIHELFDLICGTSTGGMLAIALGV 551

Query:   593 KLMTLDQCEEIYKNLGKLVFAEPFPKDNEAATWREKLDQIYKSSSQSFRVVVHGSKHSAD 652
             KLMTL+QCEEIYKNLGKLVFAE  PKDNEAA+WREKLDQ+YKSSSQSFRVV+HGSKHSA+
Sbjct:   552 KLMTLEQCEEIYKNLGKLVFAESVPKDNEAASWREKLDQLYKSSSQSFRVVIHGSKHSAN 611

Query:   653 QFERLLKEMCADEDGDLLIESSVKNIPKVFTVSTLVNVMPAQPFIFRNYQYPAGTPEVPF 712
             +FERLLKEMCADEDGDLLIES+VKN+PKVF VSTLV+VMPAQPFIFRNYQYP GTPE+ +
Sbjct:   612 EFERLLKEMCADEDGDLLIESAVKNVPKVFVVSTLVSVMPAQPFIFRNYQYPVGTPEMSY 671

Query:   713 SISENSGITVLGSPTTGAQVGY-KRSAFIGSCKHQVWQAIRASSAAPYYLDDFS--DDVF 769
             + S++SG + L S T   Q GY K+SAF+GSCKHQVWQAIRASSAAPYYLDDFS   + +
Sbjct:   672 AFSDHSGGSTLTSSTASDQAGYYKQSAFMGSCKHQVWQAIRASSAAPYYLDDFSVGTNSY 731

Query:   770 RWQDGAIVANNPTIFAIREAQLLWPDTRIDCLVSIGCGSVPTKTRRGGWRYLDTGQVLIE 829
             RWQDGAIVANNPTIFAIREAQLLWPDT+IDCLVSIG GSVPT+ R+GGWRYLDTGQVLIE
Sbjct:   732 RWQDGAIVANNPTIFAIREAQLLWPDTKIDCLVSIGSGSVPTRVRKGGWRYLDTGQVLIE 791

Query:   830 SACSVDRAEEALSTLLPMLPEIQYYRFNPVDERCEMELDETDPAEWLKLEAAVDEYINNN 889
             SACSV+R EEALSTLLPMLPEIQY+RFNPVD+RC MELDETDPA WLKLEAA++E+I +N
Sbjct:   792 SACSVERVEEALSTLLPMLPEIQYFRFNPVDDRCGMELDETDPAIWLKLEAAIEEFIQSN 851

Query:   890 SESFKNVCERLLLPFQQDEKWSENLKSQHFPRGKVSNTD-EISPSLGWRRNTLLVEAMHS 948
              + FKNVCERL LPF  DEKW +NLK + F  GK+ N+  E SPSLGWRRN LL+EA HS
Sbjct:   852 PQVFKNVCERLTLPFLNDEKWCDNLKPR-FMNGKLPNSRVESSPSLGWRRNVLLMEAQHS 910

Query:   949 PDSGRVGHHARALESFCASNGIRLSLLHGIS--GIGKSMPGATFPTPFSSPLITGSFPSS 1006
             PDSGRV +HARALESFC++NGI+LS LH  +  G  K  PG  FPTPF+SPLITGS P S
Sbjct:   911 PDSGRVKYHARALESFCSNNGIKLSSLHTTATPGCQKPSPGTAFPTPFTSPLITGSLPPS 970

Query:  1007 PLLYSPDVGPQRIGRIDMVPPLSLDGLQAGKTFSSPPVSPKAHRQLSLHVRSLHEKLQSL 1066
             PLL++P++GPQ+  RIDMVPPLSLDG   GKT  SPP SP   RQL L +R +HEKLQ+L
Sbjct:   971 PLLFTPELGPQKFNRIDMVPPLSLDGGHVGKTVMSPPSSPPRQRQLYLPLRQMHEKLQNL 1030

Query:  1067 PQVGIVHLCLQNDTVGSIL 1085
             PQVGI+HL LQND+ GSIL
Sbjct:  1031 PQVGILHLSLQNDSNGSIL 1049
GO:0005634 "nucleus" evidence=ISM
GO:0006629 "lipid metabolic process" evidence=IEA
GO:0008152 "metabolic process" evidence=IEA
GO:0004620 "phospholipase activity" evidence=IDA
GO:0009620 "response to fungus" evidence=IMP
GO:0009695 "jasmonic acid biosynthetic process" evidence=IMP
GO:0047714 "galactolipase activity" evidence=IDA
GO:0010228 "vegetative to reproductive phase transition of meristem" evidence=RCA
GO:0016926 "protein desumoylation" evidence=RCA
GO:0050665 "hydrogen peroxide biosynthetic process" evidence=RCA
UNIPROTKB|E1BVG7 E1BVG7 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-070705-553 pnpla8 "patatin-like phospholipase domain containing 8" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
MGI|MGI:1914702 Pnpla8 "patatin-like phospholipase domain containing 8" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|Q9NP80 PNPLA8 "Calcium-independent phospholipase A2-gamma" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E1BE78 PNPLA8 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F6Y4R5 PNPLA8 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
RGD|1311444 Pnpla8 "patatin-like phospholipase domain containing 8" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|E2QZP1 PNPLA8 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
WB|WBGene00022233 Y73B6BL.4 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1088
cd07211308 cd07211, Pat_PNPLA8, Patatin-like phospholipase do 1e-147
cd07216309 cd07216, Pat17_PNPLA8_PNPLA9_like3, Patatin-like p 6e-40
cd07212312 cd07212, Pat_PNPLA9, Patatin-like phospholipase do 4e-39
cd07199258 cd07199, Pat17_PNPLA8_PNPLA9_like, Patatin-like ph 8e-26
cd07199258 cd07199, Pat17_PNPLA8_PNPLA9_like, Patatin-like ph 5e-20
pfam01734189 pfam01734, Patatin, Patatin-like phospholipase 9e-18
COG3621394 COG3621, COG3621, Patatin [General function predic 7e-16
cd07217344 cd07217, Pat17_PNPLA8_PNPLA9_like4, Patatin-like p 2e-13
cd07214349 cd07214, Pat17_isozyme_like, Patatin-like phosphol 1e-12
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 1e-11
cd00020120 cd00020, ARM, Armadillo/beta-catenin-like repeats 3e-10
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 7e-10
cd07215329 cd07215, Pat17_PNPLA8_PNPLA9_like2, Patatin-like p 2e-09
cd07213288 cd07213, Pat17_PNPLA8_PNPLA9_like1, Patatin-like p 7e-09
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 4e-07
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 2e-06
PRK15370754 PRK15370, PRK15370, E3 ubiquitin-protein ligase Sl 3e-06
cd07215329 cd07215, Pat17_PNPLA8_PNPLA9_like2, Patatin-like p 5e-06
COG5064526 COG5064, SRP1, Karyopherin (importin) alpha [Intra 3e-05
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 9e-05
pfam1279943 pfam12799, LRR_4, Leucine Rich repeats (2 copies) 2e-04
pfam1364688 pfam13646, HEAT_2, HEAT repeats 3e-04
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 4e-04
PLN00113968 PLN00113, PLN00113, leucine-rich repeat receptor-l 5e-04
cd07207194 cd07207, Pat_ExoU_VipD_like, ExoU and VipD-like pr 7e-04
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 0.001
PRK15370754 PRK15370, PRK15370, E3 ubiquitin-protein ligase Sl 0.001
pfam0051441 pfam00514, Arm, Armadillo/beta-catenin-like repeat 0.001
cd00020120 cd00020, ARM, Armadillo/beta-catenin-like repeats 0.002
cd13394597 cd13394, Syo1_like, Fungal symportin 1 (syo1) and 0.002
PRK15370754 PRK15370, PRK15370, E3 ubiquitin-protein ligase Sl 0.003
PLN00113968 PLN00113, PLN00113, leucine-rich repeat receptor-l 0.004
>gnl|CDD|132850 cd07211, Pat_PNPLA8, Patatin-like phospholipase domain containing protein 8 Back     alignment and domain information 
 Score =  440 bits (1135), Expect = e-147
 Identities = 151/360 (41%), Positives = 208/360 (57%), Gaps = 55/360 (15%)

Query: 533 RQVPKQGLRILSMDGGGMKGLATVQILKEIEKGTGKRIHELFDLVCGTSTGGMLAIALAV 592
             V  +G+RILS+DGGG +G+  ++IL++IEK TGK IHELFD +CG STG +LA  L +
Sbjct: 1   PPVKGRGIRILSIDGGGTRGVVALEILRKIEKLTGKPIHELFDYICGVSTGAILAFLLGL 60

Query: 593 KLMTLDQCEEIYKNLGKLVFAEPFPKDNEAATWREKLDQIYKSSSQSFRVVVHGSKHSAD 652
           K M+LD+CEE+Y+ LGK VF++                      S + R+V+  + +  +
Sbjct: 61  KKMSLDECEELYRKLGKDVFSQNTY------------------ISGTSRLVLSHAYYDTE 102

Query: 653 QFERLLKEMCADEDGDLLIESSVKNIPKVFTVSTLVNVMPAQPFIFRNYQYPAGTPEVPF 712
            +E++LKEM   ++  L+  S+  N PKV  VST VN  P +P++FRNY +P GT     
Sbjct: 103 TWEKILKEMMGSDE--LIDTSADPNCPKVACVSTQVNRTPLKPYVFRNYNHPPGT----- 155

Query: 713 SISENSGITVLGSPTTGAQVGYKRSAFIGSCKHQVWQAIRASSAAPYYLDDFSDDVFRWQ 772
                                  RS ++GSCKH++W+AIRASSAAP Y ++F       Q
Sbjct: 156 -----------------------RSHYLGSCKHKLWEAIRASSAAPGYFEEFKLGNNLHQ 192

Query: 773 DGAIVANNPTIFAIREAQLLWPDTRIDCLVSIGCGSVPTKTR--RGGWRYLDTGQV-LIE 829
           DG ++ANNPT  A+ EA+LLWPDT I CLVS+G G  P+  R   GG+  L T  + LI+
Sbjct: 193 DGGLLANNPTALALHEAKLLWPDTPIQCLVSVGTGRYPSSVRLETGGYTSLKTKLLNLID 252

Query: 830 SACSVDRAEEALSTLLPMLPEIQYYRFNPVDERCEMELDETDPAEWLKLEAAVDEYINNN 889
           SA   +R   AL  L   LP   Y+RFNPV   C +ELDET P +  +L+    EYI  N
Sbjct: 253 SATDTERVHTALDDL---LPPDVYFRFNPVMSEC-VELDETRPEKLDQLQDDTLEYIKRN 308

PNPLA8 is a Ca-independent myocardial phospholipase which maintains mitochondrial integrity. PNPLA8 is also known as iPLA2-gamma. In humans, it is predominantly expressed in heart tissue. iPLA2-gamma can catalyze both phospholipase A1 and A2 reactions (PLA1 and PLA2 respectively). This family includes PNPLA8 (iPLA2-gamma) from Homo sapiens and iPLA2-2 from Mus musculus. Length = 308
>gnl|CDD|132855 cd07216, Pat17_PNPLA8_PNPLA9_like3, Patatin-like phospholipase Back     alignment and domain information
>gnl|CDD|132851 cd07212, Pat_PNPLA9, Patatin-like phospholipase domain containing protein 9 Back     alignment and domain information
>gnl|CDD|132838 cd07199, Pat17_PNPLA8_PNPLA9_like, Patatin-like phospholipase; includes PNPLA8, PNPLA9, and Pat17 Back     alignment and domain information
>gnl|CDD|132838 cd07199, Pat17_PNPLA8_PNPLA9_like, Patatin-like phospholipase; includes PNPLA8, PNPLA9, and Pat17 Back     alignment and domain information
>gnl|CDD|216671 pfam01734, Patatin, Patatin-like phospholipase Back     alignment and domain information
>gnl|CDD|226148 COG3621, COG3621, Patatin [General function prediction only] Back     alignment and domain information
>gnl|CDD|132856 cd07217, Pat17_PNPLA8_PNPLA9_like4, Patatin-like phospholipase Back     alignment and domain information
>gnl|CDD|132853 cd07214, Pat17_isozyme_like, Patatin-like phospholipase of plants Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|237987 cd00020, ARM, Armadillo/beta-catenin-like repeats Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|132854 cd07215, Pat17_PNPLA8_PNPLA9_like2, Patatin-like phospholipase of bacteria Back     alignment and domain information
>gnl|CDD|132852 cd07213, Pat17_PNPLA8_PNPLA9_like1, Patatin-like phospholipase Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|185268 PRK15370, PRK15370, E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>gnl|CDD|132854 cd07215, Pat17_PNPLA8_PNPLA9_like2, Patatin-like phospholipase of bacteria Back     alignment and domain information
>gnl|CDD|227396 COG5064, SRP1, Karyopherin (importin) alpha [Intracellular trafficking and secretion] Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|205079 pfam12799, LRR_4, Leucine Rich repeats (2 copies) Back     alignment and domain information
>gnl|CDD|222285 pfam13646, HEAT_2, HEAT repeats Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|132846 cd07207, Pat_ExoU_VipD_like, ExoU and VipD-like proteins; homologus to patatin, cPLA2, and iPLA2 Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|185268 PRK15370, PRK15370, E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>gnl|CDD|201276 pfam00514, Arm, Armadillo/beta-catenin-like repeat Back     alignment and domain information
>gnl|CDD|237987 cd00020, ARM, Armadillo/beta-catenin-like repeats Back     alignment and domain information
>gnl|CDD|240521 cd13394, Syo1_like, Fungal symportin 1 (syo1) and similar proteins Back     alignment and domain information
>gnl|CDD|185268 PRK15370, PRK15370, E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 1088
KOG4231763 consensus Intracellular membrane-bound Ca2+-indepe 100.0
cd07211308 Pat_PNPLA8 Patatin-like phospholipase domain conta 100.0
cd07215329 Pat17_PNPLA8_PNPLA9_like2 Patatin-like phospholipa 100.0
cd07216309 Pat17_PNPLA8_PNPLA9_like3 Patatin-like phospholipa 100.0
cd07214349 Pat17_isozyme_like Patatin-like phospholipase of p 100.0
cd07212312 Pat_PNPLA9 Patatin-like phospholipase domain conta 100.0
cd07213288 Pat17_PNPLA8_PNPLA9_like1 Patatin-like phospholipa 100.0
cd07199258 Pat17_PNPLA8_PNPLA9_like Patatin-like phospholipas 100.0
cd07217344 Pat17_PNPLA8_PNPLA9_like4 Patatin-like phospholipa 100.0
COG3621394 Patatin [General function prediction only] 99.98
cd07225306 Pat_PNPLA6_PNPLA7 Patatin-like phospholipase domai 99.95
cd07207194 Pat_ExoU_VipD_like ExoU and VipD-like proteins; ho 99.94
cd07205175 Pat_PNPLA6_PNPLA7_NTE1_like Patatin-like phospholi 99.94
cd07210221 Pat_hypo_W_succinogenes_WS1459_like Hypothetical p 99.93
cd07228175 Pat_NTE_like_bacteria Bacterial patatin-like phosp 99.93
cd07209215 Pat_hypo_Ecoli_Z1214_like Hypothetical patatin sim 99.91
cd07230421 Pat_TGL4-5_like Triacylglycerol lipase 4 and 5. TG 99.91
cd07227269 Pat_Fungal_NTE1 Fungal patatin-like phospholipase 99.9
PRK10279300 hypothetical protein; Provisional 99.9
cd07232407 Pat_PLPL Patain-like phospholipase. Patatin-like p 99.89
cd07208266 Pat_hypo_Ecoli_yjju_like Hypothetical patatin simi 99.88
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.86
cd07198172 Patatin Patatin-like phospholipase. Patatin is a s 99.86
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.84
COG1752306 RssA Predicted esterase of the alpha-beta hydrolas 99.84
cd07222246 Pat_PNPLA4 Patatin-like phospholipase domain conta 99.84
cd07221252 Pat_PNPLA3 Patatin-like phospholipase domain conta 99.83
KOG4194873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.83
cd07229391 Pat_TGL3_like Triacylglycerol lipase 3. Triacylgly 99.83
PF01734204 Patatin: Patatin-like phospholipase This Prosite f 99.83
PLN00113968 leucine-rich repeat receptor-like protein kinase; 99.82
PLN00113968 leucine-rich repeat receptor-like protein kinase; 99.82
cd07218245 Pat_iPLA2 Calcium-independent phospholipase A2; Cl 99.82
KOG4194873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.82
cd07206298 Pat_TGL3-4-5_SDP1 Triacylglycerol lipase 3, 4, and 99.82
cd07219382 Pat_PNPLA1 Patatin-like phospholipase domain conta 99.82
cd07231323 Pat_SDP1-like Sugar-Dependent 1 like lipase. Sugar 99.81
cd07204243 Pat_PNPLA_like Patatin-like phospholipase domain c 99.81
cd07220249 Pat_PNPLA2 Patatin-like phospholipase domain conta 99.79
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.78
cd07224233 Pat_like Patatin-like phospholipase. Patatin-like 99.77
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.76
COG5064526 SRP1 Karyopherin (importin) alpha [Intracellular t 99.75
KOG29681158 consensus Predicted esterase of the alpha-beta hyd 99.72
KOG0617264 consensus Ras suppressor protein (contains leucine 99.69
COG4667292 Predicted esterase of the alpha-beta hydrolase sup 99.68
KOG0166514 consensus Karyopherin (importin) alpha [Intracellu 99.68
cd07223405 Pat_PNPLA5-mammals Patatin-like phospholipase doma 99.67
PRK15387788 E3 ubiquitin-protein ligase SspH2; Provisional 99.66
cd01819155 Patatin_and_cPLA2 Patatins and Phospholipases. Pat 99.66
KOG0617264 consensus Ras suppressor protein (contains leucine 99.66
KOG2214543 consensus Predicted esterase of the alpha-beta hyd 99.65
PRK15370754 E3 ubiquitin-protein ligase SlrP; Provisional 99.64
TIGR03607 739 patatin-related protein. This bacterial protein fa 99.6
PRK15370754 E3 ubiquitin-protein ligase SlrP; Provisional 99.59
PRK15387788 E3 ubiquitin-protein ligase SspH2; Provisional 99.58
COG5064526 SRP1 Karyopherin (importin) alpha [Intracellular t 99.58
KOG0513503 consensus Ca2+-independent phospholipase A2 [Lipid 99.57
KOG06181081 consensus Serine/threonine phosphatase 2C containi 99.56
KOG06181081 consensus Serine/threonine phosphatase 2C containi 99.55
PLN032101153 Resistant to P. syringae 6; Provisional 99.53
KOG0166514 consensus Karyopherin (importin) alpha [Intracellu 99.49
KOG0532722 consensus Leucine-rich repeat (LRR) protein, conta 99.48
KOG4237498 consensus Extracellular matrix protein slit, conta 99.46
KOG4237498 consensus Extracellular matrix protein slit, conta 99.44
PLN032101153 Resistant to P. syringae 6; Provisional 99.43
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.41
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.4
KOG0513503 consensus Ca2+-independent phospholipase A2 [Lipid 99.36
KOG0532722 consensus Leucine-rich repeat (LRR) protein, conta 99.29
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.28
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 99.21
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.19
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 99.19
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.19
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.18
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.14
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.13
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.11
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.95
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.83
PLN03200 2102 cellulose synthase-interactive protein; Provisiona 98.8
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.8
KOG18591096 consensus Leucine-rich repeat proteins [General fu 98.77
PLN03150623 hypothetical protein; Provisional 98.65
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.65
PLN03200 2102 cellulose synthase-interactive protein; Provisiona 98.64
PLN03150623 hypothetical protein; Provisional 98.6
KOG18591096 consensus Leucine-rich repeat proteins [General fu 98.59
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.51
KOG4224550 consensus Armadillo repeat protein VAC8 required f 98.51
cd00020120 ARM Armadillo/beta-catenin-like repeats. An approx 98.5
KOG4224550 consensus Armadillo repeat protein VAC8 required f 98.46
KOG3773354 consensus Adiponutrin and related vesicular transp 98.38
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.33
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.31
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.29
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.23
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.21
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.17
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.14
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.08
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 98.07
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.0
cd00020120 ARM Armadillo/beta-catenin-like repeats. An approx 97.95
PF04826254 Arm_2: Armadillo-like; InterPro: IPR006911 This en 97.87
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.86
PRK15386426 type III secretion protein GogB; Provisional 97.84
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.8
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.78
PF05804708 KAP: Kinesin-associated protein (KAP) 97.73
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 97.72
PRK15386426 type III secretion protein GogB; Provisional 97.71
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 97.68
cd00147438 cPLA2_like Cytosolic phospholipase A2, catalytic d 97.66
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 97.62
PF05804708 KAP: Kinesin-associated protein (KAP) 97.48
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 97.35
KOG4199461 consensus Uncharacterized conserved protein [Funct 97.33
KOG1048717 consensus Neural adherens junction protein Plakoph 97.23
PF10508503 Proteasom_PSMB: Proteasome non-ATPase 26S subunit; 97.22
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 97.16
KOG2123388 consensus Uncharacterized conserved protein [Funct 97.0
PF0051441 Arm: Armadillo/beta-catenin-like repeat; InterPro: 96.99
KOG2123388 consensus Uncharacterized conserved protein [Funct 96.79
KOG4199461 consensus Uncharacterized conserved protein [Funct 96.61
KOG4308478 consensus LRR-containing protein [Function unknown 96.32
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 95.78
PF04826254 Arm_2: Armadillo-like; InterPro: IPR006911 This en 95.74
KOG4308478 consensus LRR-containing protein [Function unknown 95.73
PF10508503 Proteasom_PSMB: Proteasome non-ATPase 26S subunit; 95.72
KOG2160342 consensus Armadillo/beta-catenin-like repeat-conta 95.64
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 95.47
PF1364688 HEAT_2: HEAT repeats; PDB: 1OYZ_A 3FGA_A 2PF4_C 2I 95.09
KOG2160342 consensus Armadillo/beta-catenin-like repeat-conta 94.9
KOG4500604 consensus Rho/Rac GTPase guanine nucleotide exchan 94.88
KOG4500604 consensus Rho/Rac GTPase guanine nucleotide exchan 94.82
KOG4646173 consensus Uncharacterized conserved protein, conta 94.7
PF1351355 HEAT_EZ: HEAT-like repeat; PDB: 2Z5J_A 2OT8_B 2Z5O 94.65
PRK09687280 putative lyase; Provisional 94.51
smart0018541 ARM Armadillo/beta-catenin-like repeats. Approx. 4 94.5
PF0051441 Arm: Armadillo/beta-catenin-like repeat; InterPro: 94.41
KOG3678832 consensus SARM protein (with sterile alpha and arm 94.3
PRK09687280 putative lyase; Provisional 93.98
KOG0473326 consensus Leucine-rich repeat protein [Function un 93.97
KOG0473326 consensus Leucine-rich repeat protein [Function un 93.84
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 93.65
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 93.27
KOG1048717 consensus Neural adherens junction protein Plakoph 93.1
PF1351355 HEAT_EZ: HEAT-like repeat; PDB: 2Z5J_A 2OT8_B 2Z5O 92.86
KOG4341483 consensus F-box protein containing LRR [General fu 92.31
KOG1947482 consensus Leucine rich repeat proteins, some prote 92.01
KOG1222791 consensus Kinesin associated protein KAP [Intracel 91.48
cd07202430 cPLA2_Grp-IVC Group IVC cytoplasmic phospholipase 91.47
KOG1293678 consensus Proteins containing armadillo/beta-caten 91.4
KOG2122 2195 consensus Beta-catenin-binding protein APC, contai 91.34
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 91.15
KOG1947482 consensus Leucine rich repeat proteins, some prote 90.97
KOG0168 1051 consensus Putative ubiquitin fusion degradation pr 90.63
PF11698119 V-ATPase_H_C: V-ATPase subunit H; InterPro: IPR011 90.28
PF1364688 HEAT_2: HEAT repeats; PDB: 1OYZ_A 3FGA_A 2PF4_C 2I 89.59
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 89.5
cd07201541 cPLA2_Grp-IVB-IVD-IVE-IVF Group IVB, IVD, IVE, and 87.85
PRK13800897 putative oxidoreductase/HEAT repeat-containing pro 87.01
smart0018541 ARM Armadillo/beta-catenin-like repeats. Approx. 4 86.83
KOG1293678 consensus Proteins containing armadillo/beta-caten 86.42
PRK13800897 putative oxidoreductase/HEAT repeat-containing pro 86.32
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 85.6
smart0037026 LRR Leucine-rich repeats, outliers. 85.6
KOG2122 2195 consensus Beta-catenin-binding protein APC, contai 84.81
PF03224312 V-ATPase_H_N: V-ATPase subunit H; InterPro: IPR004 83.6
smart0037026 LRR Leucine-rich repeats, outliers. 83.38
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 83.38
KOG4646173 consensus Uncharacterized conserved protein, conta 82.82
PF14664371 RICTOR_N: Rapamycin-insensitive companion of mTOR, 82.53
cd07200505 cPLA2_Grp-IVA Group IVA cytosolic phospholipase A2 82.5
TIGR02270410 conserved hypothetical protein. Members are found 82.4
KOG4341483 consensus F-box protein containing LRR [General fu 81.65
KOG2023885 consensus Nuclear transport receptor Karyopherin-b 81.63
KOG21711075 consensus Karyopherin (importin) beta 3 [Nuclear s 81.21
PF0298531 HEAT: HEAT repeat; InterPro: IPR000357 The HEAT re 80.04
>KOG4231 consensus Intracellular membrane-bound Ca2+-independent phospholipase A2 [Lipid transport and metabolism] Back     alignment and domain information 
Probab=100.00  E-value=1.5e-93  Score=770.92  Aligned_cols=762  Identities=69%  Similarity=1.063  Sum_probs=601.9

Q ss_pred             ccCCCchhHHHHHHHHHHHHhCCCCCCceEEeccCCCCCcccccccccccchhhcCCCCCccEEEeeCCCCCCCCccccc
Q 001385           67 WTSGEEEDQVALKLQSQLMVALPVPEDTVVVELAPQEEGDVATDAANVGVEMRVVKRREPLRAVVLTKGVGSGHLSDGIG  146 (1088)
Q Consensus        67 ~~~~~~~~~~~~~l~s~l~~~lp~~~~~~~v~l~~~~~~~~~~~~~~~~~~~~~~~~l~~L~~L~Ls~n~i~~~~p~~l~  146 (1088)
                      |+.++.+|++++++.+++++++|.+++.+++.++....   + +.+++.+++..-.+...++...+..-.-++.--+..+
T Consensus         1 ~t~~~s~d~~~~~l~~~~~v~~~~~~~~~~~~~~~~~~---~-~l~~v~l~~~~~~~~~~~r~~~~~~~~~s~~~y~~~~   76 (763)
T KOG4231|consen    1 WTAGDSEDQVALRLESQLMVALPAPHDTVVVELKDDDE---G-GLENVGLEMRVEKRREPLRAVTLMKAVGSGQQYDGVG   76 (763)
T ss_pred             CCcccchhHHHHHhhhhhhhccCCCCceEEEEeccccc---c-ccchhhhhhhhhhcccchhhhHHHhhhcCCcccCCcc
Confidence            78889999999999999999999999999999974432   3 5777888876666666666554443322333223344


Q ss_pred             cCccccEEeCcCCCCCCCCccccccCCCCccEEEccCCCCCCccccccCCCCCcEEEccCCCCCCCchhhcCCCCCcEEE
Q 001385          147 VLTRLMRSDLSTSGPGNNMGSGFCDHWKTVTAVSLCGLGLSALPVDLTRLPVLEKLYLDNNKLSTLPPELGAMKNLKVLI  226 (1088)
Q Consensus       147 ~l~~L~~L~Ls~N~l~~~~~~~~~~~l~~L~~L~Ls~n~l~~lp~~l~~l~~L~~L~L~~N~l~~lp~~l~~l~~L~~L~  226 (1088)
                      .+.+|-.+-++--.--........-.......+.+++|.+-..|..+..|+.|+.+.+-+|++..+|..++++.++..+.
T Consensus        77 ~~~~l~~~~~a~~ap~~~~~~~~~~~~~~~t~~s~s~~~~~~~~~~vt~l~~~~~~~~~~~k~s~~~~li~k~~~~~i~r  156 (763)
T KOG4231|consen   77 VLTRLMMMPAAIPAPAIDVASSCGVHWKTVTSLSLSGCGLLVMPVEVTELPLLEKLCLEHNKLSVLPPLIGKLKNLKILR  156 (763)
T ss_pred             hheeeeeeeccCCCcchhhhhceeeeeeeeeecccccceeccChHHHHhhhhhhHHHHHHhhhccchhhhhhhhhHHHhc
Confidence            44555444433211000000011112334445555555555555555555555555555555555554444444433332


Q ss_pred             ccCCcCcccchhccCCCCCCEEEeccCCCCCCcccccCCccccEEEecCCCCCCCccccCCCCCCeEEeeCCCCCCCccc
Q 001385          227 VDNNMLVCVPVELRECVGLVELSLEHNRLVRPLLDFRAMAELKILRLFGNPLEFLPEILPLLKLRHLSLANIRIVADENL  306 (1088)
Q Consensus       227 Ls~N~l~~lp~~l~~l~~L~~L~Ls~N~l~~~~~~l~~l~~L~~L~Ls~N~l~~l~~l~~l~~L~~L~L~~N~l~~~~~l  306 (1088)
                      +.     +.|+.+..+.-+-++.+..|.....+.++                      ..+             ..    
T Consensus       157 ~~-----s~~d~l~~~~pf~e~s~~~~~~~~p~g~~----------------------~~~-------------~~----  192 (763)
T KOG4231|consen  157 VD-----SVPDELRQCVPFVELSLEHNKLVRPLGDF----------------------RSL-------------GQ----  192 (763)
T ss_pred             cC-----CccccccccCCchhhhhhccCccCCCccc----------------------ccc-------------cC----
Confidence            22     22222222222222222222222111000                      000             00    


Q ss_pred             cchhhhhcCcCCccccccccchhhhHHhhhcccCCCCcchhHHHhhhhcCCCCccccccccccccccceeeccCChhhhh
Q 001385          307 RSVNVQIEMENNSYFGASRHKLSAFFSLIFRFSSCHHPLLASALAKIMQDQENRVVVGKDENAVRQLISMISSDNRHVVE  386 (1088)
Q Consensus       307 ~~l~~~~~l~~l~~l~l~~n~l~~~~~~l~~l~~l~~l~l~~~L~~i~~l~~N~l~ip~~~~~Lp~L~~L~Ls~N~~v~~  386 (1088)
                             .-.+-.++.-+...++...+.+|+-+++.++..+..+.+..++..|...+...-.....++...-|+ .++.+
T Consensus       193 -------~~~~ts~fg~S~~~lSn~~~~~Fk~~~~~~~~~~~~fv~k~e~e~n~~~iGk~~~~I~~~~~~ieS~-~hvVe  264 (763)
T KOG4231|consen  193 -------RAENTSYFGASRHKLSNFSPLIFKSSSCHHPLLASTFVKKMEDEGNRSVIGKDENAIRQLISMIESD-QHVVE  264 (763)
T ss_pred             -------cccccccccchhhhhhccchHhhccccccchhHHHHHHHHhhCcccceeecccchhhhhhccccccc-chhhc
Confidence                   0122334555666777777888888889888888889999889888876666655566676666655 77889


Q ss_pred             hHHHHhccccCCchhhHHHHHCCCcHHHHHHhccCChHHHHHHHHHHHhhhccChHHHHHHhhhhhHHHHHHHhcCCChh
Q 001385          387 QACSALSSLAGDVSVAMLLMKCDIMQPIIAVLKSFAPEEVKSVLQVVGQLAFASDTVAQKMLTKDVLKSLKLLCAHKNPE  466 (1088)
Q Consensus       387 ~a~~~L~~L~~~~~~~~~l~~~~~~~~Ll~lL~~~~~~~~~~~l~~L~~L~~~sd~~~~~v~~~g~lp~L~~Ll~~~~~~  466 (1088)
                      .++.++..++.+.....+++.+..+.+-...++...+. +...++.+..+.+.++...|+.........|+.++.+.+++
T Consensus       265 k~~~~~~s~~~~~~~t~ql~k~~l~~pTe~v~~l~~~~-I~~l~~~v~~~~~~s~s~~Qe~~~K~~~~~lk~~~a~~n~~  343 (763)
T KOG4231|consen  265 KACVALSSLARDVGVTMQLMKCDLMKPTETVLKLSSPD-IISLLQVVVTLAFVSDSVSQEMLTKDMLKALKSLCAHKNPE  343 (763)
T ss_pred             ccccccccHHHHHHHHHHHHHHHhcCcchhhhhhcccc-HhhHHHHHhcCCchhhhHHhhhhHHHHHHHHHHHhcccChH
Confidence            99988888887766668888888888766555555555 66678999999999999999999889999999999999999


Q ss_pred             HHHHHHHHHhhhhccccccceeecccChhhhhHhhhcCCchhHHHHHHHHHHhhcchHHHHHhhhcCCCCCCCceEEEec
Q 001385          467 VQRFALLAVGNLAFCLENRRILVTSESLRDLLMRLTVGPEPRVNKAAARALAILGENESLRRAIRGRQVPKQGLRILSMD  546 (1088)
Q Consensus       467 vq~~Al~algnla~~~~~~~~~v~~~~~~~~L~~ll~~~~~~v~~~a~~aL~~l~~~~~~r~~~~~~~~~~~~~riLsLd  546 (1088)
                      +|+.|+.+++|+++|.++|+....+..+...+++++...++++.+.+..|++.+++++-+++.+++++++++|+|||++|
T Consensus       344 l~~qa~~~v~~~~~~~~~r~~~~tsp~l~~~~~~~i~~~~~~~~~~~~~a~~~~~~~eil~~~~~~~~vkg~G~rILSiD  423 (763)
T KOG4231|consen  344 LQRQALLAVGNLAFCLENRRILITSPSLRELLMRLIVTPEPRVNKAAARALAILGENEILRRSIKGRQVKGQGLRILSID  423 (763)
T ss_pred             HHHHHHHHHHHheecccccccccCChHHHHHHHHHhcccccccchhhhHHHHHhhhhHHHHhhccccccCCCceEEEEec
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCCchHHHHHHHHHHHHHhcCCCCCcccceEEecchHHHHHHHHhcCCCCHHHHHHHHHHhhccccCCCCCCCchhhhHH
Q 001385          547 GGGMKGLATVQILKEIEKGTGKRIHELFDLVCGTSTGGMLAIALAVKLMTLDQCEEIYKNLGKLVFAEPFPKDNEAATWR  626 (1088)
Q Consensus       547 GGG~RG~~~~~vL~~Le~~~~~~i~~~FDli~GTStG~iiA~~l~~~~~s~~e~~~~y~~~~~~iF~~~~~~~~~~~~w~  626 (1088)
                      |||+||++++++|+.||+..|++||+.||+|||+|||||+|++|+..+|+.+||+++|+++++.+|++..+.+++..+|.
T Consensus       424 GGGtrG~~~lqiL~kieklsgKpIheLFD~ICGvSTG~ilA~~Lg~k~m~l~eCeEiY~~lgk~vFsq~v~~g~~~~sw~  503 (763)
T KOG4231|consen  424 GGGTRGLATLQILKKIEKLSGKPIHELFDLICGVSTGGILAIALGVKLMTLEECEEIYKNLGKLVFSQSVPKGNEAASWI  503 (763)
T ss_pred             CCCccchhHHHHHHHHHHhcCCcHHHHHHHHhccCchHHHHHHHHhcCccHHHHHHHHHHHhHHHhhccccccchhheeh
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999988887774


Q ss_pred             HHHHHHhhcccccceeEeccCCCCHHHHHHHHHHHhcCCCCCchhccccCCCCEEEEEEeeeccC-CCccEEeecCCCCC
Q 001385          627 EKLDQIYKSSSQSFRVVVHGSKHSADQFERLLKEMCADEDGDLLIESSVKNIPKVFTVSTLVNVM-PAQPFIFRNYQYPA  705 (1088)
Q Consensus       627 ~~~~~~~~~~~~~~~~~~~~~~~~~~~le~~Lk~~~~~~~g~~~~~~~~~~~~k~~vv~t~~d~~-~~~~~lf~ny~~~~  705 (1088)
                                         .++|++..++.+||++++ +++++......+++||+++|+|-++.. +.+||+||||++|.
T Consensus       504 -------------------Hs~y~~n~we~iLKem~g-ed~~mi~tsr~~~~PkvavVStiVn~~pT~qpfIFRNY~hp~  563 (763)
T KOG4231|consen  504 -------------------HSKYSANEWERILKEMCG-EDGDMIITSRVKNVPKVAVVSTIVNVMPTAQPFIFRNYQHPV  563 (763)
T ss_pred             -------------------hhhcchHHHHHHHHHHhh-hhhhHHHhhccCCCCceeehhhhhhcCCCccceeeeccCCCC
Confidence                               478999999999999998 557777777788999999999998855 48999999999997


Q ss_pred             CCCCCCccccCCCCccccCCCCCCCccccccccccCCCcchHHHHHHHhcCCCCCCCCccCCCceeeeCcccCCChHHHH
Q 001385          706 GTPEVPFSISENSGITVLGSPTTGAQVGYKRSAFIGSCKHQVWQAIRASSAAPYYLDDFSDDVFRWQDGAIVANNPTIFA  785 (1088)
Q Consensus       706 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~dA~rASsAaP~yF~p~~~~~~~~vDGGl~~NNP~~~A  785 (1088)
                      +.                            .++|.|+|++.+|+|+|||+|||+||..|..++..|+|||+++|||+..|
T Consensus       564 G~----------------------------~Shy~Ggc~h~~WqAIrASsAAP~Yf~e~~lgn~l~QDGgi~aNNPta~A  615 (763)
T KOG4231|consen  564 GT----------------------------QSHYMGGCKHQVWQAIRASSAAPYYFDEFSLGNYLWQDGGIVANNPTAFA  615 (763)
T ss_pred             Cc----------------------------chhhcccchHHHHHHHHhcccCCcchhhhccccceeccCcEeecCccHHH
Confidence            64                            35788999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHhCCCCCCCEEEEECCCCCCCCCCCCCccccccCccchhcccchHHHHHHHHHHcCCCCCCCEEEEccCCCCCCC
Q 001385          786 IREAQLLWPDTRIDCLVSIGCGSVPTKTRRGGWRYLDTGQVLIESACSVDRAEEALSTLLPMLPEIQYYRFNPVDERCEM  865 (1088)
Q Consensus       786 i~Ea~~~~p~~~i~~vvSlGTG~~~~~~~~~~w~~~~~~~~li~~~~~~d~~~~~~~~~~~~~~~~~YfR~np~~~~~~~  865 (1088)
                      |+||+.+||+.+++|+||||||..+...+.+.|.+...++.|+++.++...+++.+.++.+++++..||||||.+.++ +
T Consensus       616 ~hEaklLWPD~~i~C~VSiGsGr~~t~Vr~~tv~yts~~~kL~~~i~SatdtEevh~~l~~mLPe~~YfRFNPvm~~~-~  694 (763)
T KOG4231|consen  616 IHEAKLLWPDTKIDCLVSIGSGRVPTRVRKGTVRYTSTGQKLIESICSATDTEEVHSTLLPMLPEIQYFRFNPVMDRC-M  694 (763)
T ss_pred             hhhhhccCCCCCccEEEEecCCcccccccCCceEEecHHHHHHHHHhcccchHHHHHhhhccCCchheEecchhhhcc-c
Confidence            999999999999999999999999999989999999999999998888888888888899999999999999999865 9


Q ss_pred             CCCCCCHHHHHHHHHHHHHHHHhcHHHHHHHHHHhcCCcCCchhhhhhhccCCCCCCCCCCCCCCCCCcccc
Q 001385          866 ELDETDPAEWLKLEAAVDEYINNNSESFKNVCERLLLPFQQDEKWSENLKSQHFPRGKVSNTDEISPSLGWR  937 (1088)
Q Consensus       866 ~lD~~~~~~~~~l~~~t~~yl~~~~~~l~~~~~~Ll~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  937 (1088)
                      +|||++++.|.+|+.++++|++.|.+.|+++|++|..++..+++|.++..  .+.+.|.+. -+..+.++|+
T Consensus       695 ~LDE~d~e~l~ql~~~~e~yI~rN~qk~k~vaerL~l~~~~~qk~~~~~~--~wm~lK~~~-ye~~p~~~~~  763 (763)
T KOG4231|consen  695 ELDETDPEILLQLEAAIEEYIQRNPQKFKNVAERLTLPFLNDQKWCDLKP--RWMNLKLPR-YESSPSLGWR  763 (763)
T ss_pred             CcCccCHHHHHHHHHHHHHHHHhChHHHHHHHHHhcCCcchhHHHhhhhH--HHHhccCcc-ccCCcccccC
Confidence            99999999999999999999999999999999999999999999995322  233445432 2345677775

>cd07211 Pat_PNPLA8 Patatin-like phospholipase domain containing protein 8 Back     alignment and domain information
>cd07215 Pat17_PNPLA8_PNPLA9_like2 Patatin-like phospholipase of bacteria Back     alignment and domain information
>cd07216 Pat17_PNPLA8_PNPLA9_like3 Patatin-like phospholipase Back     alignment and domain information
>cd07214 Pat17_isozyme_like Patatin-like phospholipase of plants Back     alignment and domain information
>cd07212 Pat_PNPLA9 Patatin-like phospholipase domain containing protein 9 Back     alignment and domain information
>cd07213 Pat17_PNPLA8_PNPLA9_like1 Patatin-like phospholipase Back     alignment and domain information
>cd07199 Pat17_PNPLA8_PNPLA9_like Patatin-like phospholipase; includes PNPLA8, PNPLA9, and Pat17 Back     alignment and domain information
>cd07217 Pat17_PNPLA8_PNPLA9_like4 Patatin-like phospholipase Back     alignment and domain information
>COG3621 Patatin [General function prediction only] Back     alignment and domain information
>cd07225 Pat_PNPLA6_PNPLA7 Patatin-like phospholipase domain containing protein 6 and protein 7 Back     alignment and domain information
>cd07207 Pat_ExoU_VipD_like ExoU and VipD-like proteins; homologus to patatin, cPLA2, and iPLA2 Back     alignment and domain information
>cd07205 Pat_PNPLA6_PNPLA7_NTE1_like Patatin-like phospholipase domain containing protein 6, protein 7, and fungal NTE1 Back     alignment and domain information
>cd07210 Pat_hypo_W_succinogenes_WS1459_like Hypothetical patatin similar to WS1459 of Wolinella succinogenes Back     alignment and domain information
>cd07228 Pat_NTE_like_bacteria Bacterial patatin-like phospholipase domain containing protein 6 Back     alignment and domain information
>cd07209 Pat_hypo_Ecoli_Z1214_like Hypothetical patatin similar to Z1214 protein of Escherichia coli Back     alignment and domain information
>cd07230 Pat_TGL4-5_like Triacylglycerol lipase 4 and 5 Back     alignment and domain information
>cd07227 Pat_Fungal_NTE1 Fungal patatin-like phospholipase domain containing protein 6 Back     alignment and domain information
>PRK10279 hypothetical protein; Provisional Back     alignment and domain information
>cd07232 Pat_PLPL Patain-like phospholipase Back     alignment and domain information
>cd07208 Pat_hypo_Ecoli_yjju_like Hypothetical patatin similar to yjju protein of Escherichia coli Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>cd07198 Patatin Patatin-like phospholipase Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>COG1752 RssA Predicted esterase of the alpha-beta hydrolase superfamily [General function prediction only] Back     alignment and domain information
>cd07222 Pat_PNPLA4 Patatin-like phospholipase domain containing protein 4 Back     alignment and domain information
>cd07221 Pat_PNPLA3 Patatin-like phospholipase domain containing protein 3 Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>cd07229 Pat_TGL3_like Triacylglycerol lipase 3 Back     alignment and domain information
>PF01734 Patatin: Patatin-like phospholipase This Prosite family is a subset of the Pfam family; InterPro: IPR002641 This domain is structurally and functionally related to the animal cytosolic phospholipase A2 Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>cd07218 Pat_iPLA2 Calcium-independent phospholipase A2; Classified as Group IVA-1 PLA2 Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>cd07206 Pat_TGL3-4-5_SDP1 Triacylglycerol lipase 3, 4, and 5 and Sugar-Dependent 1 lipase Back     alignment and domain information
>cd07219 Pat_PNPLA1 Patatin-like phospholipase domain containing protein 1 Back     alignment and domain information
>cd07231 Pat_SDP1-like Sugar-Dependent 1 like lipase Back     alignment and domain information
>cd07204 Pat_PNPLA_like Patatin-like phospholipase domain containing protein family Back     alignment and domain information
>cd07220 Pat_PNPLA2 Patatin-like phospholipase domain containing protein 2 Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>cd07224 Pat_like Patatin-like phospholipase Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>COG5064 SRP1 Karyopherin (importin) alpha [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG2968 consensus Predicted esterase of the alpha-beta hydrolase superfamily (Neuropathy target esterase), contains cAMP-binding domains [General function prediction only] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>COG4667 Predicted esterase of the alpha-beta hydrolase superfamily [General function prediction only] Back     alignment and domain information
>KOG0166 consensus Karyopherin (importin) alpha [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd07223 Pat_PNPLA5-mammals Patatin-like phospholipase domain containing protein 5 Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>cd01819 Patatin_and_cPLA2 Patatins and Phospholipases Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG2214 consensus Predicted esterase of the alpha-beta hydrolase superfamily [General function prediction only] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>TIGR03607 patatin-related protein Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>COG5064 SRP1 Karyopherin (importin) alpha [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG0513 consensus Ca2+-independent phospholipase A2 [Lipid transport and metabolism] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG0166 consensus Karyopherin (importin) alpha [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG0513 consensus Ca2+-independent phospholipase A2 [Lipid transport and metabolism] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>PLN03200 cellulose synthase-interactive protein; Provisional Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>PLN03200 cellulose synthase-interactive protein; Provisional Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4224 consensus Armadillo repeat protein VAC8 required for vacuole fusion, inheritance and cytosol-to-vacuole protein targeting [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd00020 ARM Armadillo/beta-catenin-like repeats Back     alignment and domain information
>KOG4224 consensus Armadillo repeat protein VAC8 required for vacuole fusion, inheritance and cytosol-to-vacuole protein targeting [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG3773 consensus Adiponutrin and related vesicular transport proteins; predicted alpha/beta hydrolase [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>cd00020 ARM Armadillo/beta-catenin-like repeats Back     alignment and domain information
>PF04826 Arm_2: Armadillo-like; InterPro: IPR006911 This entry consists of mammalian proteins of unknown function Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PF05804 KAP: Kinesin-associated protein (KAP) Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>cd00147 cPLA2_like Cytosolic phospholipase A2, catalytic domain; hydrolyses arachidonyl phospholipids Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>PF05804 KAP: Kinesin-associated protein (KAP) Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG4199 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1048 consensus Neural adherens junction protein Plakophilin and related Armadillo repeat proteins [Signal transduction mechanisms; Extracellular structures] Back     alignment and domain information
>PF10508 Proteasom_PSMB: Proteasome non-ATPase 26S subunit; InterPro: IPR019538 The 26S proteasome is an enzymatic complex that degrades ubiquitinated proteins in eukaryotic cells Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF00514 Arm: Armadillo/beta-catenin-like repeat; InterPro: IPR000225 The armadillo (Arm) repeat is an approximately 40 amino acid long tandemly repeated sequence motif first identified in the Drosophila melanogaster segment polarity gene armadillo involved in signal transduction through wingless Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4199 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PF04826 Arm_2: Armadillo-like; InterPro: IPR006911 This entry consists of mammalian proteins of unknown function Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>PF10508 Proteasom_PSMB: Proteasome non-ATPase 26S subunit; InterPro: IPR019538 The 26S proteasome is an enzymatic complex that degrades ubiquitinated proteins in eukaryotic cells Back     alignment and domain information
>KOG2160 consensus Armadillo/beta-catenin-like repeat-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PF13646 HEAT_2: HEAT repeats; PDB: 1OYZ_A 3FGA_A 2PF4_C 2IAE_A 3B2A_A Back     alignment and domain information
>KOG2160 consensus Armadillo/beta-catenin-like repeat-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4500 consensus Rho/Rac GTPase guanine nucleotide exchange factor smgGDS/Vimar [Signal transduction mechanisms] Back     alignment and domain information
>KOG4500 consensus Rho/Rac GTPase guanine nucleotide exchange factor smgGDS/Vimar [Signal transduction mechanisms] Back     alignment and domain information
>KOG4646 consensus Uncharacterized conserved protein, contains ARM repeats [Function unknown] Back     alignment and domain information
>PF13513 HEAT_EZ: HEAT-like repeat; PDB: 2Z5J_A 2OT8_B 2Z5O_A 2H4M_A 2QMR_A 1QBK_B 2Z5M_A 2Z5K_A 2Z5N_A 1GCJ_B Back     alignment and domain information
>PRK09687 putative lyase; Provisional Back     alignment and domain information
>smart00185 ARM Armadillo/beta-catenin-like repeats Back     alignment and domain information
>PF00514 Arm: Armadillo/beta-catenin-like repeat; InterPro: IPR000225 The armadillo (Arm) repeat is an approximately 40 amino acid long tandemly repeated sequence motif first identified in the Drosophila melanogaster segment polarity gene armadillo involved in signal transduction through wingless Back     alignment and domain information
>KOG3678 consensus SARM protein (with sterile alpha and armadillo motifs) [Extracellular structures] Back     alignment and domain information
>PRK09687 putative lyase; Provisional Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG1048 consensus Neural adherens junction protein Plakophilin and related Armadillo repeat proteins [Signal transduction mechanisms; Extracellular structures] Back     alignment and domain information
>PF13513 HEAT_EZ: HEAT-like repeat; PDB: 2Z5J_A 2OT8_B 2Z5O_A 2H4M_A 2QMR_A 1QBK_B 2Z5M_A 2Z5K_A 2Z5N_A 1GCJ_B Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG1222 consensus Kinesin associated protein KAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd07202 cPLA2_Grp-IVC Group IVC cytoplasmic phospholipase A2; catalytic domain; Ca-independent Back     alignment and domain information
>KOG1293 consensus Proteins containing armadillo/beta-catenin-like repeat [General function prediction only] Back     alignment and domain information
>KOG2122 consensus Beta-catenin-binding protein APC, contains ARM repeats [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG0168 consensus Putative ubiquitin fusion degradation protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF11698 V-ATPase_H_C: V-ATPase subunit H; InterPro: IPR011987 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane Back     alignment and domain information
>PF13646 HEAT_2: HEAT repeats; PDB: 1OYZ_A 3FGA_A 2PF4_C 2IAE_A 3B2A_A Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>cd07201 cPLA2_Grp-IVB-IVD-IVE-IVF Group IVB, IVD, IVE, and IVF cytosolic phospholipase A2; catalytic domain; Ca-dependent Back     alignment and domain information
>PRK13800 putative oxidoreductase/HEAT repeat-containing protein; Provisional Back     alignment and domain information
>smart00185 ARM Armadillo/beta-catenin-like repeats Back     alignment and domain information
>KOG1293 consensus Proteins containing armadillo/beta-catenin-like repeat [General function prediction only] Back     alignment and domain information
>PRK13800 putative oxidoreductase/HEAT repeat-containing protein; Provisional Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>KOG2122 consensus Beta-catenin-binding protein APC, contains ARM repeats [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PF03224 V-ATPase_H_N: V-ATPase subunit H; InterPro: IPR004908 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>KOG4646 consensus Uncharacterized conserved protein, contains ARM repeats [Function unknown] Back     alignment and domain information
>PF14664 RICTOR_N: Rapamycin-insensitive companion of mTOR, N-term Back     alignment and domain information
>cd07200 cPLA2_Grp-IVA Group IVA cytosolic phospholipase A2; catalytic domain; Ca-dependent Back     alignment and domain information
>TIGR02270 conserved hypothetical protein Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG2023 consensus Nuclear transport receptor Karyopherin-beta2/Transportin (importin beta superfamily) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2171 consensus Karyopherin (importin) beta 3 [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF02985 HEAT: HEAT repeat; InterPro: IPR000357 The HEAT repeat is a tandemly repeated, 37-47 amino acid long module occurring in a number of cytoplasmic proteins, including the four name-giving proteins huntingtin, elongation factor 3 (EF3), the 65 Kd alpha regulatory subunit of protein phosphatase 2A (PP2A) and the yeast PI3-kinase TOR1 [] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1088
4b8c_D727 Nuclease Module Of The Yeast Ccr4-Not Complex Lengt 1e-06
2o6q_A270 Structural Diversity Of The Hagfish Variable Lympho 1e-04
3ukw_B510 Mouse Importin Alpha: Bimax1 Peptide Complex Length 9e-04
4htv_A509 Mouse Importin Alpha: Bfdv Cap Nls Peptide Complex 9e-04
1ejl_I460 Mouse Importin Alpha-Sv40 Large T Antigen Nls Pepti 9e-04
3rz9_A510 Mouse Importin Alpha-Ku80 Nls Peptide Complex Lengt 9e-04
>pdb|4B8C|D Chain D, Nuclease Module Of The Yeast Ccr4-Not Complex Length = 727 Back     alignment and structure 
Iteration: 1

 Score = 52.4 bits (124), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 29/99 (29%), Positives = 49/99 (49%)
Query: 178 AVSLCGLGLSALPVDLTRLPVLEKLYLDNNKLSTLPPELGAMKNLKVLIVDNNMLVCVPV 237
           A+ L  L +  +  ++ +   L +LYL+ N L+ LP E+  + NL+VL + +N L  +P 
Sbjct: 228 ALDLSNLQIFNISANIFKYDFLTRLYLNGNSLTELPAEIKNLSNLRVLDLSHNRLTSLPA 287
Query: 238 ELRECVGLVELSLEHNRLVRPLLDFRAMAELKILRLFGN 276
           EL  C  L       N +     +F  +  L+ L + GN
Sbjct: 288 ELGSCFQLKYFYFFDNMVTTLPWEFGNLCNLQFLGVEGN 326
>pdb|2O6Q|A Chain A, Structural Diversity Of The Hagfish Variable Lymphocyte Receptors A29 Length = 270 Back     alignment and structure
>pdb|3UKW|B Chain B, Mouse Importin Alpha: Bimax1 Peptide Complex Length = 510 Back     alignment and structure
>pdb|4HTV|A Chain A, Mouse Importin Alpha: Bfdv Cap Nls Peptide Complex Length = 509 Back     alignment and structure
>pdb|1EJL|I Chain I, Mouse Importin Alpha-Sv40 Large T Antigen Nls Peptide Complex Length = 460 Back     alignment and structure
>pdb|3RZ9|A Chain A, Mouse Importin Alpha-Ku80 Nls Peptide Complex Length = 510 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1088
1oxw_A373 Patatin; alpha/beta class fold with approximately 9e-44
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 3e-22
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 4e-22
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-20
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-20
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 5e-11
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 4e-06
3now_A810 UNC-45 protein, SD10334P; armadillo repeat, HSP90, 1e-20
3now_A810 UNC-45 protein, SD10334P; armadillo repeat, HSP90, 1e-04
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 5e-19
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-15
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 6e-14
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-09
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 5e-09
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-06
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 1e-17
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 4e-08
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 1e-04
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 4e-17
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-15
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-14
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 5e-14
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-12
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-11
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 9e-11
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-09
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 3e-05
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 6e-17
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-14
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-13
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 5e-13
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 6e-11
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 9e-10
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-09
2z6g_A780 B-catenin; FULL-length, beta-catenin, cell adhesio 1e-16
2z6g_A780 B-catenin; FULL-length, beta-catenin, cell adhesio 2e-15
2z6g_A780 B-catenin; FULL-length, beta-catenin, cell adhesio 6e-15
2z6g_A780 B-catenin; FULL-length, beta-catenin, cell adhesio 1e-13
2z6g_A780 B-catenin; FULL-length, beta-catenin, cell adhesio 1e-11
2z6g_A780 B-catenin; FULL-length, beta-catenin, cell adhesio 5e-11
2z6g_A780 B-catenin; FULL-length, beta-catenin, cell adhesio 1e-09
2z6g_A780 B-catenin; FULL-length, beta-catenin, cell adhesio 8e-08
1wa5_B530 Importin alpha subunit; nuclear transport/complex, 1e-16
1wa5_B530 Importin alpha subunit; nuclear transport/complex, 3e-15
1wa5_B530 Importin alpha subunit; nuclear transport/complex, 5e-09
2jdq_A450 Importin alpha-1 subunit; transport, PB2 subunit, 1e-16
2jdq_A450 Importin alpha-1 subunit; transport, PB2 subunit, 8e-16
2jdq_A450 Importin alpha-1 subunit; transport, PB2 subunit, 4e-11
2jdq_A450 Importin alpha-1 subunit; transport, PB2 subunit, 5e-09
2z6h_A644 Catenin beta-1, beta-catenin; C-terminal domain, a 3e-16
2z6h_A644 Catenin beta-1, beta-catenin; C-terminal domain, a 3e-16
2z6h_A644 Catenin beta-1, beta-catenin; C-terminal domain, a 3e-13
2z6h_A644 Catenin beta-1, beta-catenin; C-terminal domain, a 3e-11
2z6h_A644 Catenin beta-1, beta-catenin; C-terminal domain, a 4e-10
2z6h_A644 Catenin beta-1, beta-catenin; C-terminal domain, a 1e-09
4db8_A252 Armadillo-repeat protein; solenoid repeat, de novo 3e-16
4db8_A252 Armadillo-repeat protein; solenoid repeat, de novo 6e-12
4db8_A252 Armadillo-repeat protein; solenoid repeat, de novo 5e-07
1jdh_A529 Beta-catenin; beta-catenin, protein-protein comple 5e-16
1jdh_A529 Beta-catenin; beta-catenin, protein-protein comple 5e-16
1jdh_A529 Beta-catenin; beta-catenin, protein-protein comple 5e-14
1jdh_A529 Beta-catenin; beta-catenin, protein-protein comple 1e-09
1jdh_A529 Beta-catenin; beta-catenin, protein-protein comple 2e-09
1jdh_A529 Beta-catenin; beta-catenin, protein-protein comple 2e-08
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 6e-16
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 5e-15
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 5e-11
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 3e-10
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 8e-10
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 3e-08
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 6e-05
3oqs_A510 Importin subunit alpha-2; importin alpha, karyophe 7e-16
3oqs_A510 Importin subunit alpha-2; importin alpha, karyophe 7e-12
3oqs_A510 Importin subunit alpha-2; importin alpha, karyophe 1e-08
3oqs_A510 Importin subunit alpha-2; importin alpha, karyophe 3e-07
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 8e-16
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 7e-14
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 2e-13
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 2e-13
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 5e-12
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 9e-12
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 1e-15
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 5e-15
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-14
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 7e-07
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-15
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-14
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 5e-14
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-13
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 9e-13
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 5e-12
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-15
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 8e-15
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-13
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 7e-07
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 8e-15
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-12
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 3e-11
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 3e-10
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 1e-09
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 1e-09
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 7e-09
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 1e-06
4fmz_A347 Internalin; leucine rich repeat, structural genomi 8e-15
4fmz_A347 Internalin; leucine rich repeat, structural genomi 3e-14
4fmz_A347 Internalin; leucine rich repeat, structural genomi 6e-14
4fmz_A347 Internalin; leucine rich repeat, structural genomi 3e-13
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-12
4fmz_A347 Internalin; leucine rich repeat, structural genomi 5e-11
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-10
4fmz_A347 Internalin; leucine rich repeat, structural genomi 4e-08
4fmz_A347 Internalin; leucine rich repeat, structural genomi 3e-07
4fmz_A347 Internalin; leucine rich repeat, structural genomi 5e-04
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 8e-15
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 6e-14
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-13
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 4e-12
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-11
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 3e-11
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 4e-10
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-07
4db6_A210 Armadillo repeat protein; solenoid repeat, armadil 1e-14
4db6_A210 Armadillo repeat protein; solenoid repeat, armadil 7e-14
4db6_A210 Armadillo repeat protein; solenoid repeat, armadil 5e-11
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 1e-14
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 1e-09
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 2e-09
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 2e-14
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 8e-13
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 9e-11
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 6e-09
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 4e-07
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 3e-14
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-13
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 4e-12
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 9e-12
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 7e-09
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 3e-05
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 4e-14
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 4e-14
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 7e-14
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-12
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 4e-09
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 3e-04
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 5e-14
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-13
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-13
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-11
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-10
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 5e-09
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-06
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 6e-05
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-04
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 6e-14
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 4e-12
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-11
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 8e-06
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 3e-05
1o6v_A466 Internalin A; bacterial infection, extracellular r 6e-14
1o6v_A466 Internalin A; bacterial infection, extracellular r 6e-14
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-13
1o6v_A466 Internalin A; bacterial infection, extracellular r 7e-12
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-11
1o6v_A466 Internalin A; bacterial infection, extracellular r 5e-11
1o6v_A466 Internalin A; bacterial infection, extracellular r 7e-10
1o6v_A466 Internalin A; bacterial infection, extracellular r 7e-08
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-07
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 7e-14
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 3e-12
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 4e-12
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 3e-11
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-10
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 9e-10
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-09
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-09
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-09
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 5e-09
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 3e-07
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 6e-06
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-04
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 9e-14
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 3e-12
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 5e-12
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 6e-12
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-11
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 7e-05
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-13
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-13
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 7e-13
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 5e-08
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-05
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 1e-13
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 1e-12
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 2e-12
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 6e-12
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 1e-10
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 7e-06
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-13
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-13
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-11
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-08
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-05
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 2e-13
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 8e-12
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 3e-10
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 1e-08
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 2e-06
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 2e-13
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 4e-11
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 1e-10
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 5e-06
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 3e-13
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 3e-12
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 1e-11
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 1e-10
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 1e-05
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 4e-13
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 4e-13
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 4e-09
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 4e-13
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 8e-12
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 1e-11
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 5e-13
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-12
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-12
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 7e-12
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-11
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 6e-10
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-09
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-08
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-07
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-04
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 6e-13
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 4e-12
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 4e-12
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-11
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-06
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-06
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 9e-13
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-11
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 3e-08
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 7e-08
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-06
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 5e-04
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-12
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 4e-12
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 6e-10
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 6e-10
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 8e-10
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 5e-09
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-06
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 4e-06
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 7e-06
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-12
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-10
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 2e-12
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 3e-10
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 1e-09
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 5e-12
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 4e-11
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 7e-11
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-10
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 6e-09
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-08
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-08
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 4e-04
3nmw_A354 APC variant protein; ARMADIILO repeats domain, cel 2e-11
3nmw_A354 APC variant protein; ARMADIILO repeats domain, cel 8e-11
3nmw_A354 APC variant protein; ARMADIILO repeats domain, cel 2e-10
3nmz_A458 APC variant protein; protein-protein complex, arma 2e-11
3nmz_A458 APC variant protein; protein-protein complex, arma 2e-10
3nmz_A458 APC variant protein; protein-protein complex, arma 3e-09
3nmz_A458 APC variant protein; protein-protein complex, arma 9e-09
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 2e-11
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 4e-09
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 5e-08
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 2e-04
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 2e-11
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 4e-09
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 3e-11
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 6e-10
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 4e-08
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 6e-04
4ezg_A197 Putative uncharacterized protein; internalin-A, le 4e-11
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-09
4ezg_A197 Putative uncharacterized protein; internalin-A, le 9e-08
4ezg_A197 Putative uncharacterized protein; internalin-A, le 5e-04
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 4e-11
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 6e-09
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 6e-07
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-05
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 4e-11
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 7e-11
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 4e-09
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 4e-08
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 5e-11
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 6e-11
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 3e-10
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 5e-10
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 7e-10
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-08
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 3e-06
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 2e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-10
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-10
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-08
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-10
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 3e-10
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 6e-10
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-06
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 2e-10
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-07
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 7e-07
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 5e-04
1xqr_A296 HSPBP1 protein; armadillo repeat, superhelical twi 3e-10
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 5e-10
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 6e-06
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 7e-05
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 4e-04
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 6e-10
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 6e-08
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 7e-04
1xm9_A457 Plakophilin 1; armadillo repeat, cell adhesion; 2. 9e-10
1xm9_A457 Plakophilin 1; armadillo repeat, cell adhesion; 2. 7e-08
1xm9_A457 Plakophilin 1; armadillo repeat, cell adhesion; 2. 3e-06
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 1e-09
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 8e-08
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 2e-05
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 2e-09
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 4e-08
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 2e-07
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 2e-04
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 4e-09
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-08
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 5e-07
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 1e-05
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-04
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 4e-09
3tt9_A233 Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} 8e-09
3tt9_A233 Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} 2e-07
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 2e-08
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 2e-05
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 1e-04
3l6x_A584 Catenin delta-1; catenin, armadillo, ARM, JMD, CE 3e-08
3l6x_A584 Catenin delta-1; catenin, armadillo, ARM, JMD, CE 3e-05
3l6x_A584 Catenin delta-1; catenin, armadillo, ARM, JMD, CE 3e-04
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 4e-08
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 2e-07
2qk1_A249 Protein STU2; STU2P, XMAP215, DIS1, TOG, CH-TOG, h 6e-08
3m19_A251 Variable lymphocyte receptor A diversity region; a 2e-07
3m19_A251 Variable lymphocyte receptor A diversity region; a 2e-06
3m19_A251 Variable lymphocyte receptor A diversity region; a 3e-06
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 6e-07
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 1e-04
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 6e-04
1w8a_A192 SLIT protein; signaling protein, secreted protein, 1e-06
1w8a_A192 SLIT protein; signaling protein, secreted protein, 8e-06
3tu3_B711 EXOU; type III secretion system, SPC infectious di 4e-06
3ltm_A211 Alpha-REP4; protein engineering, heat-like repeat, 5e-06
3ltm_A211 Alpha-REP4; protein engineering, heat-like repeat, 7e-06
3ltm_A211 Alpha-REP4; protein engineering, heat-like repeat, 4e-05
3ltj_A201 Alpharep-4; protein engineering, heat-like repeat, 5e-06
3ltj_A201 Alpharep-4; protein engineering, heat-like repeat, 4e-05
3ltj_A201 Alpharep-4; protein engineering, heat-like repeat, 3e-04
2qk2_A242 LP04448P; mini spindles, MSPS, XMAP215, DIS1, STU2 7e-06
2db0_A253 253AA long hypothetical protein; heat repeats, hel 1e-05
1oyz_A280 Hypothetical protein YIBA; structural genomics, PS 1e-05
1oyz_A280 Hypothetical protein YIBA; structural genomics, PS 1e-04
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 3e-05
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 3e-05
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 2e-04
3e6j_A229 Variable lymphocyte receptor diversity region; var 3e-05
3e6j_A229 Variable lymphocyte receptor diversity region; var 3e-04
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 8e-05
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 9e-05
1b3u_A588 Protein (protein phosphatase PP2A); scaffold prote 9e-05
1te4_A131 Conserved protein MTH187; methanobacterium thermoa 4e-04
3opb_A778 SWI5-dependent HO expression protein 4; heat and a 5e-04
>1oxw_A Patatin; alpha/beta class fold with approximately three layers; 2.20A {Solanum cardiophyllum} SCOP: c.19.1.3 Length = 373 Back     alignment and structure
 Score =  162 bits (411), Expect = 9e-44
 Identities = 64/419 (15%), Positives = 126/419 (30%), Gaps = 118/419 (28%)

Query: 531 RGRQVPKQGLRILSMDGGGMKGLATVQILKEIEK-------GTGKRIHELFDLVCGTSTG 583
                  + + +LS+DGGG++G+    IL+ +E            R+ + FD++ GTSTG
Sbjct: 7   HAMAQLGEMVTVLSIDGGGIRGIIPATILEFLEGQLQEMDNNADARLADYFDVIGGTSTG 66

Query: 584 GMLAIALAVK------LMTLDQCEEIYKNLGKLVFAEPFPKDNEAATWREKLDQIYKSSS 637
           G+L   ++             +    Y   G  +F                         
Sbjct: 67  GLLTAMISTPNENNRPFAAAKEIVPFYFEHGPQIF------------------------- 101

Query: 638 QSFRVVVHGSKHSADQFERLLKEMCADEDGDLLIESSVKNIPKVFTVSTLVNVMPAQPFI 697
            +    + G K+      ++L+E      G+  +  ++        V +  ++   +P I
Sbjct: 102 -NPSGQILGPKYDGKYLMQVLQEKL----GETRVHQALTE-----VVISSFDIKTNKPVI 151

Query: 698 FRNYQYPAGTPEVPFSISENSGITVLGSPTTGAQVGYKRSAFIGSCKHQVWQAIRASSAA 757
           F                                               +++    +++AA
Sbjct: 152 FTKSNLANSP----------------------------------ELDAKMYDISYSTAAA 177

Query: 758 PYYLDDFSDDVFRWQ---------DGAIVA-NNPTIFAIREAQLLWP-----------DT 796
           P Y                     DGA+    +P + +I  A  L             + 
Sbjct: 178 PTYFPPHYFVTNTSNGDEYEFNLVDGAVATVADPALLSISVATRLAQKDPAFASIRSLNY 237

Query: 797 RIDCLVSIGCGSVPTKTRR------GGWRYLDTGQVL--IESACSVDRAEEALSTLLPML 848
           +   L+S+G G+     +         W  +    V+  +  A S    +  LST    L
Sbjct: 238 KKMLLLSLGTGTTSEFDKTYTAKEAATWTAVHWMLVIQKMTDAASSYMTDYYLSTAFQAL 297

Query: 849 -PEIQYYRFN-PVDERCEMELDETDPAEWLKLEAAVDEYIN-----NNSESFKNVCERL 900
             +  Y R           E+D+   A    L    +  +      +N E+++   +R 
Sbjct: 298 DSKNNYLRVQENALTGTTTEMDDASEANMELLVQVGENLLKKPVSEDNPETYEEALKRF 356
>3now_A UNC-45 protein, SD10334P; armadillo repeat, HSP90, myosin, tetra-tricopeptide repeat, binding protein required for myosin function; 2.99A {Drosophila melanogaster} Length = 810 Back     alignment and structure
>3now_A UNC-45 protein, SD10334P; armadillo repeat, HSP90, myosin, tetra-tricopeptide repeat, binding protein required for myosin function; 2.99A {Drosophila melanogaster} Length = 810 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Length = 780 Back     alignment and structure
>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Length = 780 Back     alignment and structure
>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Length = 780 Back     alignment and structure
>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Length = 780 Back     alignment and structure
>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Length = 780 Back     alignment and structure
>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Length = 780 Back     alignment and structure
>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Length = 780 Back     alignment and structure
>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Length = 780 Back     alignment and structure
>1wa5_B Importin alpha subunit; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1un0_A 2c1t_A 1bk5_A 1ee5_A 1bk6_A 1ee4_A Length = 530 Back     alignment and structure
>1wa5_B Importin alpha subunit; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1un0_A 2c1t_A 1bk5_A 1ee5_A 1bk6_A 1ee4_A Length = 530 Back     alignment and structure
>1wa5_B Importin alpha subunit; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1un0_A 2c1t_A 1bk5_A 1ee5_A 1bk6_A 1ee4_A Length = 530 Back     alignment and structure
>2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A Length = 450 Back     alignment and structure
>2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A Length = 450 Back     alignment and structure
>2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A Length = 450 Back     alignment and structure
>2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A Length = 450 Back     alignment and structure
>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Length = 644 Back     alignment and structure
>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Length = 644 Back     alignment and structure
>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Length = 644 Back     alignment and structure
>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Length = 644 Back     alignment and structure
>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Length = 644 Back     alignment and structure
>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Length = 644 Back     alignment and structure
>4db8_A Armadillo-repeat protein; solenoid repeat, de novo protein; 2.50A {Synthetic construct} Length = 252 Back     alignment and structure
>4db8_A Armadillo-repeat protein; solenoid repeat, de novo protein; 2.50A {Synthetic construct} Length = 252 Back     alignment and structure
>4db8_A Armadillo-repeat protein; solenoid repeat, de novo protein; 2.50A {Synthetic construct} Length = 252 Back     alignment and structure
>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Length = 529 Back     alignment and structure
>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Length = 529 Back     alignment and structure
>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Length = 529 Back     alignment and structure
>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Length = 529 Back     alignment and structure
>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Length = 529 Back     alignment and structure
>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Length = 529 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>3oqs_A Importin subunit alpha-2; importin alpha, karyopherin alpha, nuclear localisation SIGN recognition, chloride intracellular channel 4, CLIC4 NLS; 2.00A {Mus musculus} PDB: 3rz9_A 3rzx_A 1q1s_C 1q1t_C 3tpo_A 3knd_A 1ejy_I 1iq1_C 1ejl_I 1pjn_B 1pjm_B 3q5u_A 3fey_C 3fex_C 1ial_A 1y2a_C 3btr_C 3l3q_A* 3ve6_A 2c1m_A ... Length = 510 Back     alignment and structure
>3oqs_A Importin subunit alpha-2; importin alpha, karyopherin alpha, nuclear localisation SIGN recognition, chloride intracellular channel 4, CLIC4 NLS; 2.00A {Mus musculus} PDB: 3rz9_A 3rzx_A 1q1s_C 1q1t_C 3tpo_A 3knd_A 1ejy_I 1iq1_C 1ejl_I 1pjn_B 1pjm_B 3q5u_A 3fey_C 3fex_C 1ial_A 1y2a_C 3btr_C 3l3q_A* 3ve6_A 2c1m_A ... Length = 510 Back     alignment and structure
>3oqs_A Importin subunit alpha-2; importin alpha, karyopherin alpha, nuclear localisation SIGN recognition, chloride intracellular channel 4, CLIC4 NLS; 2.00A {Mus musculus} PDB: 3rz9_A 3rzx_A 1q1s_C 1q1t_C 3tpo_A 3knd_A 1ejy_I 1iq1_C 1ejl_I 1pjn_B 1pjm_B 3q5u_A 3fey_C 3fex_C 1ial_A 1y2a_C 3btr_C 3l3q_A* 3ve6_A 2c1m_A ... Length = 510 Back     alignment and structure
>3oqs_A Importin subunit alpha-2; importin alpha, karyopherin alpha, nuclear localisation SIGN recognition, chloride intracellular channel 4, CLIC4 NLS; 2.00A {Mus musculus} PDB: 3rz9_A 3rzx_A 1q1s_C 1q1t_C 3tpo_A 3knd_A 1ejy_I 1iq1_C 1ejl_I 1pjn_B 1pjm_B 3q5u_A 3fey_C 3fex_C 1ial_A 1y2a_C 3btr_C 3l3q_A* 3ve6_A 2c1m_A ... Length = 510 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>4db6_A Armadillo repeat protein; solenoid repeat, armadillo repeat motif, de novo protein; 1.80A {Synthetic construct} PDB: 4db9_A 4dba_A Length = 210 Back     alignment and structure
>4db6_A Armadillo repeat protein; solenoid repeat, armadillo repeat motif, de novo protein; 1.80A {Synthetic construct} PDB: 4db9_A 4dba_A Length = 210 Back     alignment and structure
>4db6_A Armadillo repeat protein; solenoid repeat, armadillo repeat motif, de novo protein; 1.80A {Synthetic construct} PDB: 4db9_A 4dba_A Length = 210 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3nmw_A APC variant protein; ARMADIILO repeats domain, cell adhesion-cell cycle complex; 1.60A {Homo sapiens} PDB: 3nmx_A 3t7u_A 3au3_A 3qhe_A Length = 354 Back     alignment and structure
>3nmw_A APC variant protein; ARMADIILO repeats domain, cell adhesion-cell cycle complex; 1.60A {Homo sapiens} PDB: 3nmx_A 3t7u_A 3au3_A 3qhe_A Length = 354 Back     alignment and structure
>3nmw_A APC variant protein; ARMADIILO repeats domain, cell adhesion-cell cycle complex; 1.60A {Homo sapiens} PDB: 3nmx_A 3t7u_A 3au3_A 3qhe_A Length = 354 Back     alignment and structure
>3nmz_A APC variant protein; protein-protein complex, armadillo repeats, cell adhesion-CE complex; 3.01A {Homo sapiens} Length = 458 Back     alignment and structure
>3nmz_A APC variant protein; protein-protein complex, armadillo repeats, cell adhesion-CE complex; 3.01A {Homo sapiens} Length = 458 Back     alignment and structure
>3nmz_A APC variant protein; protein-protein complex, armadillo repeats, cell adhesion-CE complex; 3.01A {Homo sapiens} Length = 458 Back     alignment and structure
>3nmz_A APC variant protein; protein-protein complex, armadillo repeats, cell adhesion-CE complex; 3.01A {Homo sapiens} Length = 458 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>1xqr_A HSPBP1 protein; armadillo repeat, superhelical twist, chaperone; 2.10A {Homo sapiens} SCOP: a.118.1.21 PDB: 1xqs_A* Length = 296 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>1xm9_A Plakophilin 1; armadillo repeat, cell adhesion; 2.80A {Homo sapiens} SCOP: a.118.1.24 Length = 457 Back     alignment and structure
>1xm9_A Plakophilin 1; armadillo repeat, cell adhesion; 2.80A {Homo sapiens} SCOP: a.118.1.24 Length = 457 Back     alignment and structure
>1xm9_A Plakophilin 1; armadillo repeat, cell adhesion; 2.80A {Homo sapiens} SCOP: a.118.1.24 Length = 457 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>3tt9_A Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} Length = 233 Back     alignment and structure
>3tt9_A Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} Length = 233 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>3l6x_A Catenin delta-1; catenin, armadillo, ARM, JMD, CE adhesion, complex, cell-CELL adhesion, ARVCF, delta-catenin DP120, JAC-1, cell membrane, membrane; 2.40A {Homo sapiens} PDB: 3l6y_A Length = 584 Back     alignment and structure
>3l6x_A Catenin delta-1; catenin, armadillo, ARM, JMD, CE adhesion, complex, cell-CELL adhesion, ARVCF, delta-catenin DP120, JAC-1, cell membrane, membrane; 2.40A {Homo sapiens} PDB: 3l6y_A Length = 584 Back     alignment and structure
>3l6x_A Catenin delta-1; catenin, armadillo, ARM, JMD, CE adhesion, complex, cell-CELL adhesion, ARVCF, delta-catenin DP120, JAC-1, cell membrane, membrane; 2.40A {Homo sapiens} PDB: 3l6y_A Length = 584 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2qk1_A Protein STU2; STU2P, XMAP215, DIS1, TOG, CH-TOG, heat repeat, microtubule plus END, +TIP, protein binding; 1.70A {Saccharomyces cerevisiae} Length = 249 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>3tu3_B EXOU; type III secretion system, SPC infectious diseases, structural genomics, center for struct genomics of infectious diseases, csgid; 1.92A {Pseudomonas aeruginosa} PDB: 4akx_B* Length = 711 Back     alignment and structure
>3ltm_A Alpha-REP4; protein engineering, heat-like repeat, protein binding; HET: 1PE 12P; 2.15A {Synthetic} Length = 211 Back     alignment and structure
>3ltm_A Alpha-REP4; protein engineering, heat-like repeat, protein binding; HET: 1PE 12P; 2.15A {Synthetic} Length = 211 Back     alignment and structure
>3ltm_A Alpha-REP4; protein engineering, heat-like repeat, protein binding; HET: 1PE 12P; 2.15A {Synthetic} Length = 211 Back     alignment and structure
>3ltj_A Alpharep-4; protein engineering, heat-like repeat, protein binding; 1.80A {Synthetic} Length = 201 Back     alignment and structure
>3ltj_A Alpharep-4; protein engineering, heat-like repeat, protein binding; 1.80A {Synthetic} Length = 201 Back     alignment and structure
>3ltj_A Alpharep-4; protein engineering, heat-like repeat, protein binding; 1.80A {Synthetic} Length = 201 Back     alignment and structure
>2qk2_A LP04448P; mini spindles, MSPS, XMAP215, DIS1, STU2, heat repeat, micro plus END, +TIP, protein binding; 2.10A {Drosophila melanogaster} Length = 242 Back     alignment and structure
>2db0_A 253AA long hypothetical protein; heat repeats, helical structure, structural genomics; 2.20A {Pyrococcus horikoshii} Length = 253 Back     alignment and structure
>1oyz_A Hypothetical protein YIBA; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.10A {Escherichia coli} SCOP: a.118.1.16 Length = 280 Back     alignment and structure
>1oyz_A Hypothetical protein YIBA; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.10A {Escherichia coli} SCOP: a.118.1.16 Length = 280 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>1b3u_A Protein (protein phosphatase PP2A); scaffold protein, phosphorylation, heat repeat; 2.30A {Homo sapiens} SCOP: a.118.1.2 PDB: 2ie4_A* 2ie3_A* 2npp_A* 3k7v_A* 3k7w_A* 3fga_A* 2pf4_A 2iae_A 2nym_A* 2nyl_A* 3dw8_A* 2pkg_A 3c5w_A Length = 588 Back     alignment and structure
>1te4_A Conserved protein MTH187; methanobacterium thermoautotrophicum, structural proteomics, heat-like repeat; NMR {Methanothermobacterthermautotrophicus} SCOP: a.118.1.16 Length = 131 Back     alignment and structure
>3opb_A SWI5-dependent HO expression protein 4; heat and arm fold, myosin folding and function, myosin bindi protein, protein binding; 2.90A {Saccharomyces cerevisiae} Length = 778 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query1088
1oxw_A373 Patatin; alpha/beta class fold with approximately 100.0
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.9
4akf_A577 VIPD; transferase; 2.90A {Legionella pneumophila} 99.9
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.89
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.88
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.88
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.88
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.88
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 99.88
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 99.88
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.87
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.87
3tu3_B711 EXOU; type III secretion system, SPC infectious di 99.87
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.87
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.87
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 99.87
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.87
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.87
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.87
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.87
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.86
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.86
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.86
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.86
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.86
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.86
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.86
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.86
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.86
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.85
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 99.85
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.85
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.85
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.85
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.85
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.85
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 99.85
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 99.84
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.84
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.84
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.84
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.84
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.84
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.84
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 99.84
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.84
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.83
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.83
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.83
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.83
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.83
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.83
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 99.82
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.82
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.82
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.82
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.82
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 99.81
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.81
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 99.81
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 99.81
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.81
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.81
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.81
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.8
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.8
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.8
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.8
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.8
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.8
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 99.8
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.79
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.79
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.79
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.79
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.78
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.78
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.77
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.77
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.76
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.76
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.76
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.75
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.75
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.75
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.75
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 99.74
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 99.73
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.73
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 99.71
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.71
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.7
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 99.7
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.69
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.69
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.68
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.68
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.67
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.66
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.65
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.65
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.65
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.65
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.65
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.63
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.63
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.63
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.63
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.62
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.62
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.61
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.61
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.6
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.6
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.6
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.58
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.57
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.55
4b8c_D727 Glucose-repressible alcohol dehydrogenase transcr 99.54
4b8c_D727 Glucose-repressible alcohol dehydrogenase transcr 99.51
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.51
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.5
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.5
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.5
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.49
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.46
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.45
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.43
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.43
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.41
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.41
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.41
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.38
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.38
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.37
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.26
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.24
4db6_A210 Armadillo repeat protein; solenoid repeat, armadil 99.23
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.23
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.22
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.22
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.21
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.2
4db6_A210 Armadillo repeat protein; solenoid repeat, armadil 99.19
1xqr_A296 HSPBP1 protein; armadillo repeat, superhelical twi 99.18
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.17
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.14
3tpo_A529 Importin subunit alpha-2; nuclear import, protein 99.13
4db8_A252 Armadillo-repeat protein; solenoid repeat, de novo 99.12
3tpo_A529 Importin subunit alpha-2; nuclear import, protein 99.11
3ul1_B510 Importin subunit alpha-2; arm repeat, armadillo re 99.09
3nmw_A354 APC variant protein; ARMADIILO repeats domain, cel 99.09
3ul1_B510 Importin subunit alpha-2; arm repeat, armadillo re 99.08
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.07
4db8_A252 Armadillo-repeat protein; solenoid repeat, de novo 99.06
4hxt_A252 De novo protein OR329; structural genomics, PSI-bi 99.05
3nmz_A458 APC variant protein; protein-protein complex, arma 99.05
4hxt_A252 De novo protein OR329; structural genomics, PSI-bi 99.03
3now_A810 UNC-45 protein, SD10334P; armadillo repeat, HSP90, 99.0
3nmw_A354 APC variant protein; ARMADIILO repeats domain, cel 98.99
1xm9_A457 Plakophilin 1; armadillo repeat, cell adhesion; 2. 98.96
4fdw_A401 Leucine rich hypothetical protein; putative cell s 98.94
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 98.94
3tt9_A233 Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} 98.93
1xqr_A296 HSPBP1 protein; armadillo repeat, superhelical twi 98.92
4fdw_A401 Leucine rich hypothetical protein; putative cell s 98.92
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 98.91
3nmz_A458 APC variant protein; protein-protein complex, arma 98.9
3now_A810 UNC-45 protein, SD10334P; armadillo repeat, HSP90, 98.87
4b8j_A528 Importin subunit alpha-1A; transport protein, nucl 98.86
2jdq_A450 Importin alpha-1 subunit; transport, PB2 subunit, 98.8
3l6x_A584 Catenin delta-1; catenin, armadillo, ARM, JMD, CE 98.78
1wa5_B530 Importin alpha subunit; nuclear transport/complex, 98.77
3tt9_A233 Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} 98.74
3l6x_A584 Catenin delta-1; catenin, armadillo, ARM, JMD, CE 98.71
4b8j_A528 Importin subunit alpha-1A; transport protein, nucl 98.68
1wa5_B530 Importin alpha subunit; nuclear transport/complex, 98.66
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.64
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.64
1xm9_A457 Plakophilin 1; armadillo repeat, cell adhesion; 2. 98.59
2jdq_A450 Importin alpha-1 subunit; transport, PB2 subunit, 98.58
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.48
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.43
2z6h_A644 Catenin beta-1, beta-catenin; C-terminal domain, a 98.41
1jdh_A529 Beta-catenin; beta-catenin, protein-protein comple 98.4
1jdh_A529 Beta-catenin; beta-catenin, protein-protein comple 98.37
2z6g_A780 B-catenin; FULL-length, beta-catenin, cell adhesio 98.33
2z6h_A644 Catenin beta-1, beta-catenin; C-terminal domain, a 98.22
3opb_A778 SWI5-dependent HO expression protein 4; heat and a 98.17
2z6g_A780 B-catenin; FULL-length, beta-catenin, cell adhesio 98.07
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.96
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.94
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 97.91
3opb_A778 SWI5-dependent HO expression protein 4; heat and a 97.85
4gt6_A394 Cell surface protein; leucine rich repeats, putati 97.77
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 97.67
4gt6_A394 Cell surface protein; leucine rich repeats, putati 97.62
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.52
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.42
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.38
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.26
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 97.06
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 97.0
1te4_A131 Conserved protein MTH187; methanobacterium thermoa 96.87
3ltm_A211 Alpha-REP4; protein engineering, heat-like repeat, 96.67
3ltm_A211 Alpha-REP4; protein engineering, heat-like repeat, 96.62
3ltj_A201 Alpharep-4; protein engineering, heat-like repeat, 96.57
3ltj_A201 Alpharep-4; protein engineering, heat-like repeat, 96.49
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 95.81
4gmo_A684 Putative uncharacterized protein; ARM, heat, solen 95.63
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 95.41
1oyz_A280 Hypothetical protein YIBA; structural genomics, PS 95.25
1oyz_A280 Hypothetical protein YIBA; structural genomics, PS 94.96
2qk2_A242 LP04448P; mini spindles, MSPS, XMAP215, DIS1, STU2 94.86
1cjy_A749 CPLA2, protein (cytosolic phospholipase A2); lipid 94.65
4gmo_A684 Putative uncharacterized protein; ARM, heat, solen 93.92
3grl_A651 General vesicular transport factor P115; vesicle t 93.53
3grl_A651 General vesicular transport factor P115; vesicle t 93.45
2qk1_A249 Protein STU2; STU2P, XMAP215, DIS1, TOG, CH-TOG, h 92.71
1b3u_A588 Protein (protein phosphatase PP2A); scaffold prote 92.41
4fdd_A852 Transportin-1; heat repeats, karyopherin, nuclear 92.35
1te4_A131 Conserved protein MTH187; methanobacterium thermoa 91.88
4fdd_A852 Transportin-1; heat repeats, karyopherin, nuclear 91.82
1ibr_B462 P95, importin beta-1 subunit, nuclear factor; smal 91.56
1b3u_A588 Protein (protein phosphatase PP2A); scaffold prote 90.45
3dad_A339 FH1/FH2 domain-containing protein 1; formin, FHOD1 89.82
2vgl_B591 AP-2 complex subunit beta-1; cytoplasmic vesicle, 89.67
2vgl_B591 AP-2 complex subunit beta-1; cytoplasmic vesicle, 89.55
3b2a_A265 TON_1937, putative uncharacterized protein; heat-r 87.33
1qgr_A876 Protein (importin beta subunit); transport recepto 85.37
1ibr_B462 P95, importin beta-1 subunit, nuclear factor; smal 85.06
3b2a_A265 TON_1937, putative uncharacterized protein; heat-r 82.66
1w63_A618 Adapter-related protein complex 1 gamma 1 subunit; 82.33
2qk2_A242 LP04448P; mini spindles, MSPS, XMAP215, DIS1, STU2 80.3
>1oxw_A Patatin; alpha/beta class fold with approximately three layers; 2.20A {Solanum cardiophyllum} SCOP: c.19.1.3 Back     alignment and structure
Probab=100.00  E-value=2.7e-47  Score=436.39  Aligned_cols=303  Identities=20%  Similarity=0.297  Sum_probs=248.4

Q ss_pred             CCCCCceEEEecCCCchHHHHHHHHHHHHHhc----C---CCCCcccceEEecchHHHHHHHHhcCC------CCHHHHH
Q 001385          535 VPKQGLRILSMDGGGMKGLATVQILKEIEKGT----G---KRIHELFDLVCGTSTGGMLAIALAVKL------MTLDQCE  601 (1088)
Q Consensus       535 ~~~~~~riLsLdGGG~RG~~~~~vL~~Le~~~----~---~~i~~~FDli~GTStG~iiA~~l~~~~------~s~~e~~  601 (1088)
                      .++++.++|||||||+||+++++||++||+.+    |   .+++++||+|+|||||||+|++++.+.      |++++|.
T Consensus        11 ~~~~~~~~LsLdGGG~RG~~~~gvL~~Lee~l~~~~G~~~~~i~~~fD~I~GTS~Gaiiaa~la~g~~~~r~~~s~~el~   90 (373)
T 1oxw_A           11 QLGEMVTVLSIDGGGIRGIIPATILEFLEGQLQEMDNNADARLADYFDVIGGTSTGGLLTAMISTPNENNRPFAAAKEIV   90 (373)
T ss_dssp             -CCSCEEEEEECCCGGGGHHHHHHHHHHHHHHHHHTTCTTCCHHHHCSEEEECTHHHHHHHHHHSBCTTSSBSSCGGGHH
T ss_pred             CCCCCeEEEEEcCCcHHHHHHHHHHHHHHHHHHhhcCCccCCchhhCCEEEEECHHHHHHHHHhcCCccCCCcCCHHHHH
Confidence            45678999999999999999999999999985    3   578899999999999999999999763      6899999


Q ss_pred             HHHHHhhccccCCCCCCCchhhhHHHHHHHHhhcccccceeEeccCCCCHHHHHHHHHHHhcCCCCCchhccccCCCCEE
Q 001385          602 EIYKNLGKLVFAEPFPKDNEAATWREKLDQIYKSSSQSFRVVVHGSKHSADQFERLLKEMCADEDGDLLIESSVKNIPKV  681 (1088)
Q Consensus       602 ~~y~~~~~~iF~~~~~~~~~~~~w~~~~~~~~~~~~~~~~~~~~~~~~~~~~le~~Lk~~~~~~~g~~~~~~~~~~~~k~  681 (1088)
                      ++|.++++++|....                          .+.+++|+.+.|+++|++.|+    +..+.+...   ++
T Consensus        91 ~~~~~~~~~iF~~~~--------------------------~l~~~~~~~~~L~~~l~~~~~----~~~l~d~~~---~~  137 (373)
T 1oxw_A           91 PFYFEHGPQIFNPSG--------------------------QILGPKYDGKYLMQVLQEKLG----ETRVHQALT---EV  137 (373)
T ss_dssp             HHHHHHHHHHTCCCC--------------------------CSSSCSCCCHHHHHHHHHHHT----TCBGGGCSS---EE
T ss_pred             HHHHHhhHhhcCCCC--------------------------ccccCCcCcHHHHHHHHHHHC----cCcHHHcCC---CE
Confidence            999999999997530                          124678999999999999994    445555433   44


Q ss_pred             EEEEeeeccCCCccEEeecCCCCCCCCCCCccccCCCCccccCCCCCCCccccccccccCCCcchHHHHHHHhcCCCCCC
Q 001385          682 FTVSTLVNVMPAQPFIFRNYQYPAGTPEVPFSISENSGITVLGSPTTGAQVGYKRSAFIGSCKHQVWQAIRASSAAPYYL  761 (1088)
Q Consensus       682 ~vv~t~~d~~~~~~~lf~ny~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~dA~rASsAaP~yF  761 (1088)
                      +|++  +|+.++++++|++|+.+...                                  ..++++|+|+|||||+|+||
T Consensus       138 ~i~a--td~~~~~~~~f~~~~~~~~~----------------------------------~~~~~l~~av~ASsA~P~~F  181 (373)
T 1oxw_A          138 VISS--FDIKTNKPVIFTKSNLANSP----------------------------------ELDAKMYDISYSTAAAPTYF  181 (373)
T ss_dssp             EEEE--EETTTTEEEEEESSSTTTCG----------------------------------GGCCBHHHHHHHHHCCTTTS
T ss_pred             EEEe--EECCCCCeEEEeCCCCCCCC----------------------------------ccCchHHHHHHHHccCCcCc
Confidence            4444  58999999999999854211                                  23678999999999999999


Q ss_pred             CCccCC-----Cc----eeeeCcccC-CChHHHHHHHHHHhCCCC-----------CCCEEEEECCCCCCCC---C---C
Q 001385          762 DDFSDD-----VF----RWQDGAIVA-NNPTIFAIREAQLLWPDT-----------RIDCLVSIGCGSVPTK---T---R  814 (1088)
Q Consensus       762 ~p~~~~-----~~----~~vDGGl~~-NNP~~~Ai~Ea~~~~p~~-----------~i~~vvSlGTG~~~~~---~---~  814 (1088)
                      +|+.++     |.    .|+|||+.+ |||+..|+.||+.+|++.           +..+|||||||..+..   .   .
T Consensus       182 ~p~~i~~~d~~G~~~~~~~vDGGv~~~NnP~~~a~~ea~~~~~~~~~~~~~~~~~~~~~~vvSlGTG~~~~~~~~~~~~~  261 (373)
T 1oxw_A          182 PPHYFVTNTSNGDEYEFNLVDGAVATVADPALLSISVATRLAQKDPAFASIRSLNYKKMLLLSLGTGTTSEFDKTYTAKE  261 (373)
T ss_dssp             CCEEEEEECTTSCEEEEEEEEGGGGTCSSCHHHHHHHHHHHTTTCGGGTTSTTCCGGGEEEEEECCCCBCTTSSCCCHHH
T ss_pred             CcEEeeccCCCCcccceeeecCcccccCChHHHHHHHHHHHhccCcccccccccccCceEEEEecCCCCCCcccccChhh
Confidence            999874     43    899999999 999999999999988753           2258999999986532   1   1


Q ss_pred             CCCccccccCccchhcc--cchHHHHHHHHHHcCC-CCCCCEEEEcc-CCCCCCCCCCCCCHHHHHHHHHHHHHHHHh--
Q 001385          815 RGGWRYLDTGQVLIESA--CSVDRAEEALSTLLPM-LPEIQYYRFNP-VDERCEMELDETDPAEWLKLEAAVDEYINN--  888 (1088)
Q Consensus       815 ~~~w~~~~~~~~li~~~--~~~d~~~~~~~~~~~~-~~~~~YfR~np-~~~~~~~~lD~~~~~~~~~l~~~t~~yl~~--  888 (1088)
                      ...|+++.|..+++++.  .+.+.++..+..+++. ..+.+|||||| .+..+.+++|+++++++++|...+++|+++  
T Consensus       262 ~~~wG~~~w~~~l~~~~~~~~~~~~d~~~~~~~~~~~~~~~Y~Ri~~~~l~~~~~~lD~~~~~~l~~L~~~~~~~l~~~~  341 (373)
T 1oxw_A          262 AATWTAVHWMLVIQKMTDAASSYMTDYYLSTAFQALDSKNNYLRVQENALTGTTTEMDDASEANMELLVQVGENLLKKPV  341 (373)
T ss_dssp             HTTCCHHHHHTTHHHHHHHHHHHHHHHHHHHHHHHTTCGGGEEEECCCCBCGGGGCTTCCCHHHHHHHHHHHHHHHTSBS
T ss_pred             hhhhhhHhHHHHHHHHHHHhhHHHHHHHHHHHhhccCCCCcEEEEeCCCCCCcccccccCCHHHHHHHHHHHHHHHhccc
Confidence            46899999998998843  4567788887776643 23789999998 455567899999999999999999999998  


Q ss_pred             -------cHHHHHHHHHHhcCCcCC
Q 001385          889 -------NSESFKNVCERLLLPFQQ  906 (1088)
Q Consensus       889 -------~~~~l~~~~~~Ll~~~~~  906 (1088)
                             |.++++++|+.|.+.++.
T Consensus       342 ~~~~~~tn~~~l~~~a~~L~~e~~~  366 (373)
T 1oxw_A          342 SEDNPETYEEALKRFAKLLSDRKKL  366 (373)
T ss_dssp             SSSCCCBHHHHHHHHHHHHHHHHHH
T ss_pred             ccccchhHHHHHHHHHHHHHHHhhc
Confidence                   899999999999877543
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>4akf_A VIPD; transferase; 2.90A {Legionella pneumophila} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3tu3_B EXOU; type III secretion system, SPC infectious diseases, structural genomics, center for struct genomics of infectious diseases, csgid; 1.92A {Pseudomonas aeruginosa} PDB: 4akx_B* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>4db6_A Armadillo repeat protein; solenoid repeat, armadillo repeat motif, de novo protein; 1.80A {Synthetic construct} PDB: 4db9_A 4dba_A Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>4db6_A Armadillo repeat protein; solenoid repeat, armadillo repeat motif, de novo protein; 1.80A {Synthetic construct} PDB: 4db9_A 4dba_A Back     alignment and structure
>1xqr_A HSPBP1 protein; armadillo repeat, superhelical twist, chaperone; 2.10A {Homo sapiens} SCOP: a.118.1.21 PDB: 1xqs_A* Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3tpo_A Importin subunit alpha-2; nuclear import, protein transport; 2.10A {Mus musculus} PDB: 1qgk_B 1qgr_B Back     alignment and structure
>4db8_A Armadillo-repeat protein; solenoid repeat, de novo protein; 2.50A {Synthetic construct} Back     alignment and structure
>3tpo_A Importin subunit alpha-2; nuclear import, protein transport; 2.10A {Mus musculus} PDB: 1qgk_B 1qgr_B Back     alignment and structure
>3ul1_B Importin subunit alpha-2; arm repeat, armadillo repeat, nuclear transport, nuclear LOC signal binding, importin beta binding; 1.90A {Mus musculus} PDB: 3ukx_B 3uky_B 3ukz_B 3ukw_B 3ul0_B 3oqs_A 3rz9_A 3rzx_A 3uvu_A 1q1s_C 1q1t_C 3knd_A 1ejy_I 1iq1_C 1ejl_I 1pjn_B 1pjm_B 3q5u_A 3fey_C 3fex_C ... Back     alignment and structure
>3nmw_A APC variant protein; ARMADIILO repeats domain, cell adhesion-cell cycle complex; 1.60A {Homo sapiens} PDB: 3nmx_A 3t7u_A 3au3_A 3qhe_A Back     alignment and structure
>3ul1_B Importin subunit alpha-2; arm repeat, armadillo repeat, nuclear transport, nuclear LOC signal binding, importin beta binding; 1.90A {Mus musculus} PDB: 3ukx_B 3uky_B 3ukz_B 3ukw_B 3ul0_B 3oqs_A 3rz9_A 3rzx_A 3uvu_A 1q1s_C 1q1t_C 3knd_A 1ejy_I 1iq1_C 1ejl_I 1pjn_B 1pjm_B 3q5u_A 3fey_C 3fex_C ... Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>4db8_A Armadillo-repeat protein; solenoid repeat, de novo protein; 2.50A {Synthetic construct} Back     alignment and structure
>4hxt_A De novo protein OR329; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; 1.95A {Artificial gene} Back     alignment and structure
>3nmz_A APC variant protein; protein-protein complex, armadillo repeats, cell adhesion-CE complex; 3.01A {Homo sapiens} Back     alignment and structure
>4hxt_A De novo protein OR329; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; 1.95A {Artificial gene} Back     alignment and structure
>3now_A UNC-45 protein, SD10334P; armadillo repeat, HSP90, myosin, tetra-tricopeptide repeat, binding protein required for myosin function; 2.99A {Drosophila melanogaster} Back     alignment and structure
>3nmw_A APC variant protein; ARMADIILO repeats domain, cell adhesion-cell cycle complex; 1.60A {Homo sapiens} PDB: 3nmx_A 3t7u_A 3au3_A 3qhe_A Back     alignment and structure
>1xm9_A Plakophilin 1; armadillo repeat, cell adhesion; 2.80A {Homo sapiens} SCOP: a.118.1.24 Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3tt9_A Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} Back     alignment and structure
>1xqr_A HSPBP1 protein; armadillo repeat, superhelical twist, chaperone; 2.10A {Homo sapiens} SCOP: a.118.1.21 PDB: 1xqs_A* Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3nmz_A APC variant protein; protein-protein complex, armadillo repeats, cell adhesion-CE complex; 3.01A {Homo sapiens} Back     alignment and structure
>3now_A UNC-45 protein, SD10334P; armadillo repeat, HSP90, myosin, tetra-tricopeptide repeat, binding protein required for myosin function; 2.99A {Drosophila melanogaster} Back     alignment and structure
>4b8j_A Importin subunit alpha-1A; transport protein, nuclear localization signal; 2.00A {Oryza sativa japonica group} PDB: 4b8o_A 2yns_A 4b8p_A Back     alignment and structure
>2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A Back     alignment and structure
>3l6x_A Catenin delta-1; catenin, armadillo, ARM, JMD, CE adhesion, complex, cell-CELL adhesion, ARVCF, delta-catenin DP120, JAC-1, cell membrane, membrane; 2.40A {Homo sapiens} PDB: 3l6y_A Back     alignment and structure
>1wa5_B Importin alpha subunit; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1un0_A 2c1t_A 1bk5_A 1ee5_A 1bk6_A 1ee4_A Back     alignment and structure
>3tt9_A Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} Back     alignment and structure
>3l6x_A Catenin delta-1; catenin, armadillo, ARM, JMD, CE adhesion, complex, cell-CELL adhesion, ARVCF, delta-catenin DP120, JAC-1, cell membrane, membrane; 2.40A {Homo sapiens} PDB: 3l6y_A Back     alignment and structure
>4b8j_A Importin subunit alpha-1A; transport protein, nuclear localization signal; 2.00A {Oryza sativa japonica group} PDB: 4b8o_A 2yns_A 4b8p_A Back     alignment and structure
>1wa5_B Importin alpha subunit; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1un0_A 2c1t_A 1bk5_A 1ee5_A 1bk6_A 1ee4_A Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>1xm9_A Plakophilin 1; armadillo repeat, cell adhesion; 2.80A {Homo sapiens} SCOP: a.118.1.24 Back     alignment and structure
>2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Back     alignment and structure
>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Back     alignment and structure
>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Back     alignment and structure
>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Back     alignment and structure
>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Back     alignment and structure
>3opb_A SWI5-dependent HO expression protein 4; heat and arm fold, myosin folding and function, myosin bindi protein, protein binding; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>3opb_A SWI5-dependent HO expression protein 4; heat and arm fold, myosin folding and function, myosin bindi protein, protein binding; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>1te4_A Conserved protein MTH187; methanobacterium thermoautotrophicum, structural proteomics, heat-like repeat; NMR {Methanothermobacterthermautotrophicus} SCOP: a.118.1.16 Back     alignment and structure
>3ltm_A Alpha-REP4; protein engineering, heat-like repeat, protein binding; HET: 1PE 12P; 2.15A {Synthetic} Back     alignment and structure
>3ltm_A Alpha-REP4; protein engineering, heat-like repeat, protein binding; HET: 1PE 12P; 2.15A {Synthetic} Back     alignment and structure
>3ltj_A Alpharep-4; protein engineering, heat-like repeat, protein binding; 1.80A {Synthetic} Back     alignment and structure
>3ltj_A Alpharep-4; protein engineering, heat-like repeat, protein binding; 1.80A {Synthetic} Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>4gmo_A Putative uncharacterized protein; ARM, heat, solenoid, nuclear transport, chaperone, RPL5, RPL KAP104, nucleus; 2.10A {Chaetomium thermophilum var} PDB: 4gmn_A Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>1oyz_A Hypothetical protein YIBA; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.10A {Escherichia coli} SCOP: a.118.1.16 Back     alignment and structure
>1oyz_A Hypothetical protein YIBA; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.10A {Escherichia coli} SCOP: a.118.1.16 Back     alignment and structure
>2qk2_A LP04448P; mini spindles, MSPS, XMAP215, DIS1, STU2, heat repeat, micro plus END, +TIP, protein binding; 2.10A {Drosophila melanogaster} Back     alignment and structure
>1cjy_A CPLA2, protein (cytosolic phospholipase A2); lipid-binding, hydrolase; HET: MES; 2.50A {Homo sapiens} SCOP: b.7.1.1 c.19.1.2 PDB: 1bci_A Back     alignment and structure
>4gmo_A Putative uncharacterized protein; ARM, heat, solenoid, nuclear transport, chaperone, RPL5, RPL KAP104, nucleus; 2.10A {Chaetomium thermophilum var} PDB: 4gmn_A Back     alignment and structure
>3grl_A General vesicular transport factor P115; vesicle transport, membrane trafficking, membrane tethering, fusion, snare, RAB GTPase, armadillo repeats; 2.00A {Bos taurus} PDB: 3gq2_A 2w3c_A Back     alignment and structure
>3grl_A General vesicular transport factor P115; vesicle transport, membrane trafficking, membrane tethering, fusion, snare, RAB GTPase, armadillo repeats; 2.00A {Bos taurus} PDB: 3gq2_A 2w3c_A Back     alignment and structure
>2qk1_A Protein STU2; STU2P, XMAP215, DIS1, TOG, CH-TOG, heat repeat, microtubule plus END, +TIP, protein binding; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>1b3u_A Protein (protein phosphatase PP2A); scaffold protein, phosphorylation, heat repeat; 2.30A {Homo sapiens} SCOP: a.118.1.2 PDB: 2ie4_A* 2ie3_A* 2npp_A* 3k7v_A* 3k7w_A* 3fga_A* 2pf4_A 2iae_A 2nym_A* 2nyl_A* 3dw8_A* 2pkg_A 3c5w_A Back     alignment and structure
>4fdd_A Transportin-1; heat repeats, karyopherin, nuclear import, protein transport importin, transportin, transport protein; 2.30A {Homo sapiens} PDB: 2ot8_A 2h4m_A 2z5k_A 2z5j_A 2qmr_A 2z5m_A 2z5n_A 2z5o_A 1qbk_B* Back     alignment and structure
>1te4_A Conserved protein MTH187; methanobacterium thermoautotrophicum, structural proteomics, heat-like repeat; NMR {Methanothermobacterthermautotrophicus} SCOP: a.118.1.16 Back     alignment and structure
>4fdd_A Transportin-1; heat repeats, karyopherin, nuclear import, protein transport importin, transportin, transport protein; 2.30A {Homo sapiens} PDB: 2ot8_A 2h4m_A 2z5k_A 2z5j_A 2qmr_A 2z5m_A 2z5n_A 2z5o_A 1qbk_B* Back     alignment and structure
>1ibr_B P95, importin beta-1 subunit, nuclear factor; small GTPase, nuclear transport receptor, cell cycle, translation; HET: GNP; 2.30A {Homo sapiens} SCOP: a.118.1.1 PDB: 1m5n_S 1gcj_A 1f59_A 1o6o_A 1o6p_A Back     alignment and structure
>1b3u_A Protein (protein phosphatase PP2A); scaffold protein, phosphorylation, heat repeat; 2.30A {Homo sapiens} SCOP: a.118.1.2 PDB: 2ie4_A* 2ie3_A* 2npp_A* 3k7v_A* 3k7w_A* 3fga_A* 2pf4_A 2iae_A 2nym_A* 2nyl_A* 3dw8_A* 2pkg_A 3c5w_A Back     alignment and structure
>3dad_A FH1/FH2 domain-containing protein 1; formin, FHOD1, GTPase-binding domain, ubiquitin-superfold, armadillo repeats, actin-binding, coiled coil; 2.30A {Homo sapiens} Back     alignment and structure
>2vgl_B AP-2 complex subunit beta-1; cytoplasmic vesicle, alternative splicing, endocytosis, lipid-binding, golgi apparatus, adaptor, membrane, transport; HET: IHP; 2.59A {Homo sapiens} SCOP: i.23.1.1 PDB: 2jkt_B 2jkr_B* 2xa7_B 1w63_B Back     alignment and structure
>2vgl_B AP-2 complex subunit beta-1; cytoplasmic vesicle, alternative splicing, endocytosis, lipid-binding, golgi apparatus, adaptor, membrane, transport; HET: IHP; 2.59A {Homo sapiens} SCOP: i.23.1.1 PDB: 2jkt_B 2jkr_B* 2xa7_B 1w63_B Back     alignment and structure
>3b2a_A TON_1937, putative uncharacterized protein; heat-repeats, hypothetical, unknown function; 2.20A {Thermococcus onnurineus} Back     alignment and structure
>1qgr_A Protein (importin beta subunit); transport receptor, nuclear import, heat motif, NLS-binding; 2.30A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qgk_A 2p8q_A 2q5d_A 3lww_A 1ukl_A 2qna_A Back     alignment and structure
>1ibr_B P95, importin beta-1 subunit, nuclear factor; small GTPase, nuclear transport receptor, cell cycle, translation; HET: GNP; 2.30A {Homo sapiens} SCOP: a.118.1.1 PDB: 1m5n_S 1gcj_A 1f59_A 1o6o_A 1o6p_A Back     alignment and structure
>3b2a_A TON_1937, putative uncharacterized protein; heat-repeats, hypothetical, unknown function; 2.20A {Thermococcus onnurineus} Back     alignment and structure
>1w63_A Adapter-related protein complex 1 gamma 1 subunit; endocytosis, clathrin adaptor, transport, coated PITS; 4.0A {Mus musculus} SCOP: i.23.1.1 Back     alignment and structure
>2qk2_A LP04448P; mini spindles, MSPS, XMAP215, DIS1, STU2, heat repeat, micro plus END, +TIP, protein binding; 2.10A {Drosophila melanogaster} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 1088
d1oxwa_360 c.19.1.3 (A:) Patatin {Heartleaf nightshade (Solan 5e-29
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 8e-10
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 5e-07
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 3e-05
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 3e-09
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 1e-07
d1jdha_529 a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) 1e-08
d1jdha_529 a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) 9e-08
d1jdha_529 a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) 2e-06
d1jdha_529 a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) 4e-05
d1jdha_529 a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) 2e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 2e-08
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 1e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 3e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 3e-04
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 9e-08
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 4e-05
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 0.002
d1xm9a1457 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo 1e-07
d1xm9a1457 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo 3e-07
d1xm9a1457 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo 8e-07
d1xqra1264 a.118.1.21 (A:87-350) Hsp70-binding protein 1 (Hsp 4e-07
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 8e-07
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 2e-06
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 6e-05
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 5e-04
d1q1sc_434 a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus 1e-06
d1q1sc_434 a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus 0.001
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 2e-06
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 9e-06
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 4e-05
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 0.004
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 6e-05
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 6e-04
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 0.002
d1ibrb_458 a.118.1.1 (B:) Importin beta {Human (Homo sapiens) 2e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 3e-04
d1b3ua_588 a.118.1.2 (A:) Constant regulatory domain of prote 3e-04
d1b3ua_588 a.118.1.2 (A:) Constant regulatory domain of prote 0.001
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 7e-04
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 7e-04
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 9e-04
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 0.002
d2omxa2199 c.10.2.1 (A:37-235) Internalin B {Listeria monocyt 0.001
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 0.001
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 0.003
>d1oxwa_ c.19.1.3 (A:) Patatin {Heartleaf nightshade (Solanum cardiophyllum) [TaxId: 160510]} Length = 360 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: FabD/lysophospholipase-like
superfamily: FabD/lysophospholipase-like
family: Patatin
domain: Patatin
species: Heartleaf nightshade (Solanum cardiophyllum) [TaxId: 160510]

 Score =  117 bits (294), Expect = 5e-29
 Identities = 64/406 (15%), Positives = 128/406 (31%), Gaps = 106/406 (26%)

Query: 538 QGLRILSMDGGGMKGLATVQILKEIEK-------GTGKRIHELFDLVCGTSTGGMLAIAL 590
           + + +LS+DGGG++G+    IL+ +E            R+ + FD++ GTSTGG+L   +
Sbjct: 3   EMVTVLSIDGGGIRGIIPATILEFLEGQLQEMDNNADARLADYFDVIGGTSTGGLLTAMI 62

Query: 591 AVKLMTLDQCEEIYKNLGKLVFAEPFPKDNEAATWREKLDQIYKSSSQSFRVVVHGSKHS 650
           +      ++     K +    F       N +                       G K+ 
Sbjct: 63  STP-NENNRPFAAAKEIVPFYFEHGPQIFNPSGQIL-------------------GPKYD 102

Query: 651 ADQFERLLKEMCADEDGDLLIESSVKNIPKVFTVSTLVNVMPAQPFIFRNYQYPAGTPEV 710
                ++L+E      G+  +  ++  +          ++   +P IF            
Sbjct: 103 GKYLMQVLQEKL----GETRVHQALTEVVISSF-----DIKTNKPVIFTKSNLANSP--- 150

Query: 711 PFSISENSGITVLGSPTTGAQVGYKRSAFIGSCKHQVWQAIRASSAAP-----YYLDDFS 765
                                              +++    +++AAP     +Y    +
Sbjct: 151 -------------------------------ELDAKMYDISYSTAAAPTYFPPHYFVTNT 179

Query: 766 DD----VFRWQDGAIVAN-NPTIFAIREAQLLWP-----------DTRIDCLVSIGCGSV 809
            +     F   DGA+    +P + +I  A  L             + +   L+S+G G+ 
Sbjct: 180 SNGDEYEFNLVDGAVATVADPALLSISVATRLAQKDPAFASIRSLNYKKMLLLSLGTGTT 239

Query: 810 PTKTRR------GGWRYLDTGQVLIE--SACSVDRAEEALSTLLPML-PEIQYYRFNP-V 859
               +         W  +    V+ +   A S    +  LST    L  +  Y R     
Sbjct: 240 SEFDKTYTAKEAATWTAVHWMLVIQKMTDAASSYMTDYYLSTAFQALDSKNNYLRVQENA 299

Query: 860 DERCEMELDETDPAEWLKLEAAVDEYINN-----NSESFKNVCERL 900
                 E+D+   A    L    +  +       N E+++   +R 
Sbjct: 300 LTGTTTEMDDASEANMELLVQVGENLLKKPVSEDNPETYEEALKRF 345
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} Length = 529 Back     information, alignment and structure
>d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} Length = 529 Back     information, alignment and structure
>d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} Length = 529 Back     information, alignment and structure
>d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} Length = 529 Back     information, alignment and structure
>d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} Length = 529 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1xm9a1 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 457 Back     information, alignment and structure
>d1xm9a1 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 457 Back     information, alignment and structure
>d1xm9a1 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 457 Back     information, alignment and structure
>d1xqra1 a.118.1.21 (A:87-350) Hsp70-binding protein 1 (HspBP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 264 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1q1sc_ a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 434 Back     information, alignment and structure
>d1q1sc_ a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 434 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1ibrb_ a.118.1.1 (B:) Importin beta {Human (Homo sapiens) [TaxId: 9606]} Length = 458 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1b3ua_ a.118.1.2 (A:) Constant regulatory domain of protein phosphatase 2a, pr65alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 588 Back     information, alignment and structure
>d1b3ua_ a.118.1.2 (A:) Constant regulatory domain of protein phosphatase 2a, pr65alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 588 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 199 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query1088
d1oxwa_360 Patatin {Heartleaf nightshade (Solanum cardiophyll 100.0
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.81
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.79
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.78
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.78
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.78
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.76
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.73
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.71
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.71
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.7
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.69
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.69
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.69
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.68
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.68
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.63
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.52
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.49
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.47
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.47
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.44
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.42
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.4
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.39
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.37
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.33
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.25
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.22
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.21
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.18
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.17
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.1
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.07
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.0
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.99
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 98.85
d1xqra1264 Hsp70-binding protein 1 (HspBP1) {Human (Homo sapi 98.74
d1wa5b_503 Karyopherin alpha {Baker's yeast (Saccharomyces ce 98.73
d1wa5b_503 Karyopherin alpha {Baker's yeast (Saccharomyces ce 98.64
d1q1sc_434 Importin alpha {Mouse (Mus musculus) [TaxId: 10090 98.57
d1jdha_529 beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} 98.38
d1xm9a1457 Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} 98.34
d1q1sc_434 Importin alpha {Mouse (Mus musculus) [TaxId: 10090 98.32
d1xqra1264 Hsp70-binding protein 1 (HspBP1) {Human (Homo sapi 98.32
d1jdha_529 beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} 98.32
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.16
d1xm9a1457 Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} 98.13
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.08
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.84
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.76
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.39
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.3
d1te4a_111 MTH187 {Archaeon Methanobacterium thermoautotrophi 96.96
d1b3ua_588 Constant regulatory domain of protein phosphatase 93.16
d1cjya2580 Cytosolic phospholipase A2 catalytic domain {Human 91.83
d1te4a_111 MTH187 {Archaeon Methanobacterium thermoautotrophi 90.0
d2vglb_579 Adaptin beta subunit N-terminal fragment {Human (H 89.13
d1oyza_276 Hypothetical protein YibA {Escherichia coli [TaxId 86.7
d1oyza_276 Hypothetical protein YibA {Escherichia coli [TaxId 83.9
d1b3ua_588 Constant regulatory domain of protein phosphatase 82.66
d1qbkb_888 Karyopherin beta2 {Human (Homo sapiens) [TaxId: 96 82.11
d2vglb_579 Adaptin beta subunit N-terminal fragment {Human (H 80.85
>d1oxwa_ c.19.1.3 (A:) Patatin {Heartleaf nightshade (Solanum cardiophyllum) [TaxId: 160510]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: FabD/lysophospholipase-like
superfamily: FabD/lysophospholipase-like
family: Patatin
domain: Patatin
species: Heartleaf nightshade (Solanum cardiophyllum) [TaxId: 160510]

Probab=100.00  E-value=2.5e-41  Score=387.34  Aligned_cols=302  Identities=21%  Similarity=0.331  Sum_probs=234.4

Q ss_pred             CCCceEEEecCCCchHHHHHHHHHHHHHhc-------CCCCCcccceEEecchHHHHHHHHhcC------CCCHHHHHHH
Q 001385          537 KQGLRILSMDGGGMKGLATVQILKEIEKGT-------GKRIHELFDLVCGTSTGGMLAIALAVK------LMTLDQCEEI  603 (1088)
Q Consensus       537 ~~~~riLsLdGGG~RG~~~~~vL~~Le~~~-------~~~i~~~FDli~GTStG~iiA~~l~~~------~~s~~e~~~~  603 (1088)
                      ++.+|||||||||+||+++++||++||++.       +++++++||+|+|||+|||+|++++.+      .+..+++.+.
T Consensus         2 ~~~v~iLsldGGG~rG~~~~~vL~~L~~~~~~~~~~~~~~~~d~fD~i~GTS~Gaiia~~la~g~~~~~~~~~~~~~~~~   81 (360)
T d1oxwa_           2 GEMVTVLSIDGGGIRGIIPATILEFLEGQLQEMDNNADARLADYFDVIGGTSTGGLLTAMISTPNENNRPFAAAKEIVPF   81 (360)
T ss_dssp             CSCEEEEEECCCGGGGHHHHHHHHHHHHHHHHHTTCTTCCHHHHCSEEEECTHHHHHHHHHHSBCTTSSBSSCGGGHHHH
T ss_pred             CCceEEEEECCCHHHHHHHHHHHHHHHHcCCcccccCCCChhhhCCEEEEecHHHHHHHHHHcCCCchhHHHHHHHHHHH
Confidence            456899999999999999999999999864       678999999999999999999999864      2457788888


Q ss_pred             HHHhhccccCCCCCCCchhhhHHHHHHHHhhcccccceeEeccCCCCHHHHHHHHHHHhcCCCCCchhccccCCCCEEEE
Q 001385          604 YKNLGKLVFAEPFPKDNEAATWREKLDQIYKSSSQSFRVVVHGSKHSADQFERLLKEMCADEDGDLLIESSVKNIPKVFT  683 (1088)
Q Consensus       604 y~~~~~~iF~~~~~~~~~~~~w~~~~~~~~~~~~~~~~~~~~~~~~~~~~le~~Lk~~~~~~~g~~~~~~~~~~~~k~~v  683 (1088)
                      |......+|....                          ...+++|+.+.+++++++.|+    +..+.+..   .++.+
T Consensus        82 ~~~~~~~~f~~~~--------------------------~~~~~~~~~~~l~~~l~~~~~----~~~~~~~~---~~~~~  128 (360)
T d1oxwa_          82 YFEHGPQIFNPSG--------------------------QILGPKYDGKYLMQVLQEKLG----ETRVHQAL---TEVVI  128 (360)
T ss_dssp             HHHHHHHHTCCCC--------------------------CSSSCSCCCHHHHHHHHHHHT----TCBGGGCS---SEEEE
T ss_pred             HHhhcchhhhccc--------------------------cccCcccchHHHHHHHHHHhC----Cchhhhcc---Cccee
Confidence            8877777776421                          124788999999999999994    45555443   23334


Q ss_pred             EEeeeccCCCccEEeecCCCCCCCCCCCccccCCCCccccCCCCCCCccccccccccCCCcchHHHHHHHhcCCCCCCCC
Q 001385          684 VSTLVNVMPAQPFIFRNYQYPAGTPEVPFSISENSGITVLGSPTTGAQVGYKRSAFIGSCKHQVWQAIRASSAAPYYLDD  763 (1088)
Q Consensus       684 v~t~~d~~~~~~~lf~ny~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~dA~rASsAaP~yF~p  763 (1088)
                      +  +++..++++++|++|+....+                                  ..+.++|+|+|||||+|+||||
T Consensus       129 ~--a~~~~~~~~~~~~~~~~~~~~----------------------------------~~~~~l~~a~~ASsA~P~~F~p  172 (360)
T d1oxwa_         129 S--SFDIKTNKPVIFTKSNLANSP----------------------------------ELDAKMYDISYSTAAAPTYFPP  172 (360)
T ss_dssp             E--EEETTTTEEEEEESSSTTTCG----------------------------------GGCCBHHHHHHHHHCCTTTSCC
T ss_pred             E--ecccCCCCeEEEeccccccCC----------------------------------cccchHHHhhhhhhcCCCCCCC
Confidence            4  358899999999999865431                                  1257899999999999999999


Q ss_pred             ccCCC---------ceeeeCcccC-CChHHHHHHHHHHhCCCCC-----------CCEEEEECCCCCCCCCC------CC
Q 001385          764 FSDDV---------FRWQDGAIVA-NNPTIFAIREAQLLWPDTR-----------IDCLVSIGCGSVPTKTR------RG  816 (1088)
Q Consensus       764 ~~~~~---------~~~vDGGl~~-NNP~~~Ai~Ea~~~~p~~~-----------i~~vvSlGTG~~~~~~~------~~  816 (1088)
                      +++.+         ..|+|||+.+ |||+.+|+.|+..+|+...           ..+++|+|||..+....      ..
T Consensus       173 ~~~~~~~~~~~~~~~~~~Dgg~~~~nnp~~~a~~e~~~l~~~~~~~~~~~~~~~~~~~~~s~gtg~~~~~~~~~~~~~~~  252 (360)
T d1oxwa_         173 HYFVTNTSNGDEYEFNLVDGAVATVADPALLSISVATRLAQKDPAFASIRSLNYKKMLLLSLGTGTTSEFDKTYTAKEAA  252 (360)
T ss_dssp             EEEEEECTTSCEEEEEEEEGGGGTCSSCHHHHHHHHHHHTTTCGGGTTSTTCCGGGEEEEEECCCCBCTTSSCCCHHHHT
T ss_pred             EEEecccCCCCceeEEecccchhhccCchHHHHHHHHHhcccCccccccccCCccceeeeccccccccccccccchhhhh
Confidence            97643         3599999986 5899999999999997531           23899999998765432      45


Q ss_pred             CccccccCccchhc--ccchHHHHHHHHHHcCCC-CCCCEEEEccCC-CCCCCCCCCCCHHHHHHHHHHHHHHHHh----
Q 001385          817 GWRYLDTGQVLIES--ACSVDRAEEALSTLLPML-PEIQYYRFNPVD-ERCEMELDETDPAEWLKLEAAVDEYINN----  888 (1088)
Q Consensus       817 ~w~~~~~~~~li~~--~~~~d~~~~~~~~~~~~~-~~~~YfR~np~~-~~~~~~lD~~~~~~~~~l~~~t~~yl~~----  888 (1088)
                      .|+...|..++.++  ....+.+++.++..++.. .+.+||||||.. ....+.+|+++++.+++|+..+++|+++    
T Consensus       253 ~~g~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~Y~R~~~~~~~~~~~~lDd~s~~~l~~l~~~g~~~~~~~~~~  332 (360)
T d1oxwa_         253 TWTAVHWMLVIQKMTDAASSYMTDYYLSTAFQALDSKNNYLRVQENALTGTTTEMDDASEANMELLVQVGENLLKKPVSE  332 (360)
T ss_dssp             TCCHHHHHTTHHHHHHHHHHHHHHHHHHHHHHHTTCGGGEEEECCCCBCGGGGCTTCCCHHHHHHHHHHHHHHHTSBSSS
T ss_pred             hcchHhHHHHHHHHHHhhhHHHHHHHHHHHHHhcCCCCcEEEEcCCccccccccccCCCHHHHHHHHHHHHHHHhhhhhh
Confidence            68888887776552  233445555555554433 367899999864 2345689999999999999999999986    


Q ss_pred             -----cHHHHHHHHHHhcCCcCCc
Q 001385          889 -----NSESFKNVCERLLLPFQQD  907 (1088)
Q Consensus       889 -----~~~~l~~~~~~Ll~~~~~~  907 (1088)
                           +++.++++++.|.+.|+.+
T Consensus       333 ~~~~~~~~~L~~~~~~L~~er~~r  356 (360)
T d1oxwa_         333 DNPETYEEALKRFAKLLSDRKKLR  356 (360)
T ss_dssp             SCCCBHHHHHHHHHHHHHHHHHHH
T ss_pred             hhhhHHHHHHHHHHHHHHHHHHHh
Confidence                 5688999999997665443
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xqra1 a.118.1.21 (A:87-350) Hsp70-binding protein 1 (HspBP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wa5b_ a.118.1.1 (B:) Karyopherin alpha {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wa5b_ a.118.1.1 (B:) Karyopherin alpha {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1q1sc_ a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xm9a1 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q1sc_ a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1xqra1 a.118.1.21 (A:87-350) Hsp70-binding protein 1 (HspBP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xm9a1 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1te4a_ a.118.1.16 (A:) MTH187 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1b3ua_ a.118.1.2 (A:) Constant regulatory domain of protein phosphatase 2a, pr65alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cjya2 c.19.1.2 (A:142-721) Cytosolic phospholipase A2 catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1te4a_ a.118.1.16 (A:) MTH187 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1oyza_ a.118.1.16 (A:) Hypothetical protein YibA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1oyza_ a.118.1.16 (A:) Hypothetical protein YibA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1b3ua_ a.118.1.2 (A:) Constant regulatory domain of protein phosphatase 2a, pr65alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qbkb_ a.118.1.1 (B:) Karyopherin beta2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure