Citrus Sinensis ID: 001455

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------1000------1010------1020------1030------1040------1050------1060------1070----
MLYAKVHPLDPQEDVTNDTTVGTKACRKIPEIQEYGKDIKNLDEVPRLQLRTAGLRKKSSTKCLYDMLQESESDRSTTVGSCSTEIEEESDSEANMGIVKSLIANEGTSAVDRRPENFDQKLQAYCSSSGSESAKISFLRAPKRPMYKESNGTNSNRNFSRRFLSSSGHFNLSILELRDKISNGSCHVEGKISKQHKVQPSDCVLSSSPQQSCRFTEMDYRGSSERKKNSSGRKKFNEECLNGEKDAKSELLEIIEKAISSLFFSGDLRKCNKDYVVEVTTLYKMLNSKTGVKYDMLQDVILEQLLTAISASKEETVIRASVSILTTIILANESVIEDIKKKGLRLSDLATALKRNVPEAAILIYLIKPSPTEIKTLELLPTLVEVICTSKLYKGKLESVRLTPPAASLMIIEVLVTAFDYATNNMHLAAINSPRVLCGLLDVARHQNLEELISLATILVKCIQFDGQCRKYLSEFTAVAPLACLLQSGEKRAIMIALEFFHEILRIPRSSAIDLLQRIHKEGNINILHILKLSLQQLQSDYQLLAANLLLQLDTLENTTGKSVFTEEAMQVILKAVASEESSTMQLLSSFILSNIGGTFSWTGEPYTVAWLVKKAGLNSSWLQNMIRNFDWLDQSLQDRGVDSWSSKIAKSIIEIGKPIYYALEKGLKSKTKSVCRDSLTTIAWLSFEVSKSPNSVRHSACQILLDGVEQFLHPGLELEERLLACLCIYNYASGKGMQKLIRSSEGVRESLRRLSNVTWMAEELHKAADYYLPNISRISCVHTQILEASHKCSGAVTALIYYKGLLCSGFSDGSIKMWDIKKQSAMLVWDVKEHRKAVTSFSLFEPGESLLSGSADKTIGVWQMVQRKLELIEVIATKEPIRKLDTYGKTIFASTQGHRMKVIDSSRTLKDIYRSKGIKSMSVVQGKIYIGCMDSSIQELAVSNNVEREIKAPFKSWRLQSKPINSLVVYKDWLYSASSSVEGSNIKEWRRHRKPQISIAPEKGTTIQAMAVVEDFIYLNYNSSASSLQIWLRGTQQKVGRISAGSKITSLLTANDIVLCGTETGLIKGWIPL
ccccccccccccccccccccccccccccccHHHHcccccccccccHHHHHHHccccccccHHHHHHHHHcccccccccccccccccccccHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHcccccccEEcccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHccccHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHccccHHHHHHcccHHHHHHHHHccccccccccccccccHHHHHHHHHHHHHcccccccHHHHHHHccHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHcccccHHHHHHHcccHHHHHHHHHcccHHHHHHHHHHHHHHcccccHHHHHHHHHHHcccHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHcccccccEEHHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccccccHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEHHccccccccccccccHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHcccccccccHHHHHEEHHHHccccccHHHHHccccHHHHccccEEEEccccccccccccccccccEEEccccEEEEEccccccEEEEEEEcccEEEEEEccccEEEEccccccEEEEEEcccccccEEEEEEcccccEEEEEcccccEEEEEccccEEEEEEEccccccEEEEEEcccEEEEEEccccEEEEEcccccEEEEccccEEEEEEEccEEEEEEEcccccEEEcccccccEEccccEEEEcccccEEEEEEEcccEEEEEEEccccEEEEEEccccccccccccccccEEEEEEcccccEEEEEcccccEEEEEcccccEEEEccccccEEEEEEcccEEEEEEccccEEEEccc
ccccccccccccccccccccccccHccHHHHHHHHHHHHHcHHHcHHHHHHcccccccccHHHHHHHHHHHcccccccccccccccccccccHccccccccccHHHcccHHccccHHHHHHHcccccccccccHHHHccccccccccccccHccccccccccccccccccccHHHHccccccccccccccccccccccccHcccccccccccccccHccccccHHHHcccccccccccccccccccHHHHHHHHHHHHHHHHHccccHHHcHHHHHHHHHHHHHHHccccccHHHHccHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHccHHHHHHHccccccHHHHHHHHHHcHHHHHHHHHHccccHHHHHHHcHHHHHHHHHHccccccccccEEcccHHHHHHHHHHHHHHcccccccHHHHHHHccHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHcccHHHHHHHHcccHHHHHHHHccccHHHHHHHHHHHHHHHccHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccHcHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHccccccccHHHHHHHHHHHccccccHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHccccccccEEccccccccHHHHEccccccccHHHHcccccEEcccccccccccEEEEEEcccccEEEEEEEEcccEEEEEccccEEEEEEcccccEEEEEEEEcccccEEEEEEcccccEEEEcccccEEEEEEcccccEEEEEEcccccEEEEEEEcccEEEEEccccEEEEEEcccccEEEEEEccEEEEEEcccEEEEEccccEEEEEEcccccEEEEEcccccEEEEcccEEEEEEccccEEEEEEcccccEEEEEEcccccEEEEEccccccEEEEEEEccccEEEEcccccEEEEEEcccccEEEEEEcccEEEEEEEcccEEEEEccccEEEEEEcc
mlyakvhpldpqedvtndttvgtkacrkiPEIQeygkdiknldevprlqlrtaglrkkssTKCLYDMLQesesdrsttvgscsteieeesdseaNMGIVKSLIanegtsavdrrpenfdQKLQAYCSssgsesakisflrapkrpmykesngtnsnrnFSRRFLsssghfnlSILELRDkisngschvegkiskqhkvqpsdcvlssspqqscrftemdyrgsserkknssgrkkfNEECLNGEKDAKSELLEIIEKAISSLffsgdlrkcnKDYVVEVTTLYKMLnsktgvkydMLQDVILEQLLTAISASKEETVIRASVSILTTIILANESVIEDIKKKGLRLSDLATALKRNVPEAAILIYLikpspteiktlelLPTLVEVICTSklykgklesvrltppaaSLMIIEVLVTAFDYATNNMHLAAINSPRVLCGLLDVARHQNLEELISLATILVKCIQFDGQCRKYLSEFTAVAPLACLLQSGEKRAIMIALEFFHEILRIPRSSAIDLLQRIHKEGNINILHILKLSLQQLQSDYQLLAANLLLQLDtlenttgksvfTEEAMQVILKAVASEESSTMQLLSSFILsniggtfswtgepYTVAWLVKKAGLNSSWLQNMIRNFDWLDQslqdrgvdswSSKIAKSIIEIGKPIYYALEKGLKSKTKSVCRDSLTTIAWLSFevskspnsvrhSACQILLDGVEQFLHPGLELEERLLACLCIYNYASGKGMQKLIRSSEGVRESLRRLSNVTWMAEELHKAAdyylpnisrisCVHTQILEASHKCSGAVTALIYYKGLlcsgfsdgsikmWDIKKQSAMLVWDVKEHrkavtsfslfepgesllsgsadkTIGVWQMVQRKLELIEVIATkepirkldtygktifastqghrmkvidssrTLKDIYRSKGIKSMSVVQGKIYIGCMDSSIQELAVSNnvereikapfkswrlqskpinslvVYKDWLYSasssvegsnikewrrhrkpqisiapekgttIQAMAVVEDFIYLNYNSSASSLQIWLRGTqqkvgrisagsKITSLLTANDIVLCgtetglikgwipl
mlyakvhpldpqedvtndttvgtkacrkipeiqeygkdiknldevprlqlrtaglrkksstkCLYDMlqesesdrsttvgSCSTEieeesdseanMGIVKSLIANEGTSAVDRRPENFDQKLQAYcsssgsesakisflrapkrpmykesngtnsnrnFSRRFLSSSGHFNLSILELRDKISNGSCHVEGKIskqhkvqpsdcvlssspqqscrftemdyrgsserkknssgrkkfneeclngEKDAKSELLEIIEKAISslffsgdlrkcNKDYVVEVTTLYKMLNSKTGVKYDMLQDVILEQLLTAISASKEETVIRASVSILTTIILANESVIEDIKKKGLRLSDLATALKRNVPEAAILIYLIKPSPTEIKTLELLPTLVEVICTSKlykgklesvrltpPAASLMIIEVLVTAFDYATNNMHLAAINSPRVLCGLLDVARHQNLEELISLATILVKCIQFDGQCRKYLSEFTAVAPLACLLQSGEKRAIMIALEFFHEILRIPRSSAIDLLQRIHKEGNINILHILKLSLQQLQSDYQLLAANLLLQLDTLENTTGKSVFTEEAMQVILKAVASEESSTMQLLSSFILSNIGGTFSWTGEPYTVAWLVKKAGLNSSWLQNMIRNFDWLDQSLQDRGVDSWSSKIAKSIIEIGKPIYYALEKGLKSKTKSVCRDSLTTIAWLSFEVSKSPNSVRHSACQILLDGVEQFLHPGLELEERLLACLCIYNYASGKGMQKLIRSSEGVRESLRRLSNVTWMAEELHKAADYYLPNISRISCVHTQILEASHKCSGAVTALIYYKGLLCSGFSDGSIKMWDIKKQSAMLVWDVKEHRKAVTsfslfepgesllsgsadkTIGVWQMVQRKLELIEViatkepirkldtygktifastqghrmkvidssrtlkdiyrskgiksmsvVQGKIYIGCMDSSIQELAVSNNVEREIKapfkswrlqskpiNSLVVYKDWLYSASSsvegsnikewrrhrkpqisiapekgttIQAMAVVEDFIYLNYNSSASSLQIWLRGTQQKVGRISAGSKITSLLTANDIVLCgtetglikgwipl
MLYAKVHPLDPQEDVTNDTTVGTKACRKIPEIQEYGKDIKNLDEVPRLQLRTAGLRKKSSTKCLYDMLQESESDRSTTVGSCSTEIEEESDSEANMGIVKSLIANEGTSAVDRRPENFDQKLQAYCSSSGSESAKISFLRAPKRPMYKEsngtnsnrnfsrrflsssgHFNLSILELRDKISNGSCHVEGKISKQHKVQPSDCVLSSSPQQSCRFTEMDYRGSSERKKNSSGRKKFNEECLNGEKDAKSELLEIIEKAISSLFFSGDLRKCNKDYVVEVTTLYKMLNSKTGVKYDMLQDVILEQLLTAISASKEETVIRASVSILTTIILANESVIEDIKKKGLRLSDLATALKRNVPEAAILIYLIKPSPTEIKTLELLPTLVEVICTSKLYKGKLESVRLTPPAASLMIIEVLVTAFDYATNNMHLAAINSPRVLCGLLDVARHQNLEELISLATILVKCIQFDGQCRKYLSEFTAVAPLACLLQSGEKRAIMIALEFFHEILRIPRSSAIDLLQRIHKEGNINIlhilklslqqlqsdyqllaanlllqldtlentTGKSVFTEEAMQVILKAVASEESSTMQLLSSFILSNIGGTFSWTGEPYTVAWLVKKAGLNSSWLQNMIRNFDWLDQSLQDRGVDSWSSKIAKSIIEIGKPIYYALEKGLKSKTKSVCRDSLTTIAWLSFEVSKSPNSVRHSACQILLDGVEQFLHPGleleerllACLCIYNYASGKGMQKLIRSSEGVRESLRRLSNVTWMAEELHKAADYYLPNISRISCVHTQILEASHKCSGAVTALIYYKGLLCSGFSDGSIKMWDIKKQSAMLVWDVKEHRKAVTSFSLFEPGESLLSGSADKTIGVWQMVQRKLELIEVIATKEPIRKLDTYGKTIFASTQGHRMKVIDSSRTLKDIYRSKGIKSMSVVQGKIYIGCMDSSIQELAVSNNVEREIKAPFKSWRLQSKPINSLVVYKDWLYSASSSVEGSNIKEWRRHRKPQISIAPEKGTTIQAMAVVEDFIYLNYNSSASSLQIWLRGTQQKVGRISAGSKITSLLTANDIVLCGTETGLIKGWIPL
***********************KACRKIPEIQEYGKDIKNLDEV**L************************************************************************************************************************HFNLSILELRDKI*********************************************************************LLEIIEKAISSLFFSGDLRKCNKDYVVEVTTLYKMLNSKTGVKYDMLQDVILEQLLTAISASKEETVIRASVSILTTIILANESVIEDIKKKGLRLSDLATALKRNVPEAAILIYLIKPSPTEIKTLELLPTLVEVICTSKLYKGKLESVRLTPPAASLMIIEVLVTAFDYATNNMHLAAINSPRVLCGLLDVARHQNLEELISLATILVKCIQFDGQCRKYLSEFTAVAPLACLLQSGEKRAIMIALEFFHEILRIPRSSAIDLLQRIHKEGNINILHILKLSLQQLQSDYQLLAANLLLQLDTLENTTGKSVFTEEAMQVILKAVASEESSTMQLLSSFILSNIGGTFSWTGEPYTVAWLVKKAGLNSSWLQNMIRNFDWLDQSLQDRGVDSWSSKIAKSIIEIGKPIYYALEKGLKSKTKSVCRDSLTTIAWLSFEVSKSPNSVRHSACQILLDGVEQFLHPGLELEERLLACLCIYNYASGKGMQKLIRS**GVRESLRRLSNVTWMAEELHKAADYYLPNISRISCVHTQILEASHKCSGAVTALIYYKGLLCSGFSDGSIKMWDIKKQSAMLVWDVKEHRKAVTSFSLFEPGESLLSGSADKTIGVWQMVQRKLELIEVIATKEPIRKLDTYGKTIFASTQGHRMKVIDSSRTLKDIYRSKGIKSMSVVQGKIYIGCMDSSIQELAVSNNVEREIKAPFKSWRLQSKPINSLVVYKDWLYSAS**********W*******ISIAPEKGTTIQAMAVVEDFIYLNYNSSASSLQIWLRGTQQKVGRISAGSKITSLLTANDIVLCGTETGLIKGWI**
******H**************************************************************************************************************FDQKLQ***********************************************N*SILELRDK***********************************************************************LEIIEKAISSLFFSGDLRKCNKDYVVEVTTLYKMLNSKTGVKYDMLQDVILEQLLTAISASKEETVIRASVSILTTIILANESVIEDIKKKGLRLSDLATALKRNVPEAAILIYLIKPSPTEIKTLELLPTLVEVICTSKLYKGKLESVRLTPPAASLMIIEVLVTAFDYATNNMHLAAINSPRVLCGLLDVARHQNLEELISLATILVKCIQFDGQCRKYLSEFTAVAPLACLLQSGEKRAIMIALEFFHEILRIPRSSAIDLLQRIHKEGNINILHILKLSLQQLQSDYQLLAANLLLQLDTLENTTGKSVFTEEAMQVILKAVASEESSTMQLLSSFILSNIGGTFSWTGEPYTVAWLVKKAG*******************LQ*RGVDSWSSKIAKSIIEIGKPIY************SVCRDSLTTIAWLSFEVSKSPNSVRHSACQILLDGVEQFLHPGLELEERLLACLCIYNYASGKGMQKLIRSSEGVRESLRRLSNVTWMAEELHKAADYYLPNISRISCVHTQILEASHKCSGAVTALIYYKGLLCSGFSDGSIKMWDIKKQSAMLVWDVKEHRKAVTSFSLFEPGESLLSGSADKTIGVWQMVQRKLELIEVIATKEPIRKLDTYGKTIFASTQGHRMKVIDSSRTLKDIYRSKGIKSMSVVQGKIYIGCMDSSIQELAVSNNVEREIKAPFKSWRLQSKPINSLVVYKDWLYSASSSVEGSNIKEWRRHRKPQISIAPEKGTTIQAMAVVEDFIYLNYNSSASSLQIWLRGTQQKVGRISAGSKITSLLTANDIVLCGTETGLIKGWIPL
MLYAKVHPLDPQEDVTNDTTVGTKACRKIPEIQEYGKDIKNLDEVPRLQLRTAGLRKKSSTKCLYDMLQ************************ANMGIVKSLIANEGTSAVDRRPENFDQKLQAY**********ISFLRAPKRPMYKESNGTNSNRNFSRRFLSSSGHFNLSILELRDKISNGSCHVEGK*********************CRFT*********************EECLNGEKDAKSELLEIIEKAISSLFFSGDLRKCNKDYVVEVTTLYKMLNSKTGVKYDMLQDVILEQLLTAISASKEETVIRASVSILTTIILANESVIEDIKKKGLRLSDLATALKRNVPEAAILIYLIKPSPTEIKTLELLPTLVEVICTSKLYKGKLESVRLTPPAASLMIIEVLVTAFDYATNNMHLAAINSPRVLCGLLDVARHQNLEELISLATILVKCIQFDGQCRKYLSEFTAVAPLACLLQSGEKRAIMIALEFFHEILRIPRSSAIDLLQRIHKEGNINILHILKLSLQQLQSDYQLLAANLLLQLDTLENTTGKSVFTEEAMQVILKAVASEESSTMQLLSSFILSNIGGTFSWTGEPYTVAWLVKKAGLNSSWLQNMIRNFDWLDQSLQDRGVDSWSSKIAKSIIEIGKPIYYALEKGLKSKTKSVCRDSLTTIAWLSFEVSKSPNSVRHSACQILLDGVEQFLHPGLELEERLLACLCIYNYASGKGMQKLIRSSEGVRESLRRLSNVTWMAEELHKAADYYLPNISRISCVHTQILEASHKCSGAVTALIYYKGLLCSGFSDGSIKMWDIKKQSAMLVWDVKEHRKAVTSFSLFEPGESLLSGSADKTIGVWQMVQRKLELIEVIATKEPIRKLDTYGKTIFASTQGHRMKVIDSSRTLKDIYRSKGIKSMSVVQGKIYIGCMDSSIQELAVSNNVEREIKAPFKSWRLQSKPINSLVVYKDWLYSASSSVEGSNIKEWRRHRKPQISIAPEKGTTIQAMAVVEDFIYLNYNSSASSLQIWLRGTQQKVGRISAGSKITSLLTANDIVLCGTETGLIKGWIPL
*****************DT*VGTKACRKIPEIQEYGKDIKNLDEVPRLQLRTAGLRKKSSTKCLYDMLQESES*RS**V*****************************S*VDRRPENFDQKLQAYCSSSGSESAKISFLRAPKRPMYKESNGTN**RNF***FLSSSGHFNLSILELRDKISN*************KVQPSDCVLSSSPQQSCRFT*MDY******************ECLNGEKDAKSELLEIIEKAISSLFFSGDLRKCNKDYVVEVTTLYKMLNSKTGVKYDMLQDVILEQLLTAISASKEETVIRASVSILTTIILANESVIEDIKKKGLRLSDLATALKRNVPEAAILIYLIKPSPTEIKTLELLPTLVEVICTSKLYKGKLESVRLTPPAASLMIIEVLVTAFDYATNNMHLAAINSPRVLCGLLDVARHQNLEELISLATILVKCIQFDGQCRKYLSEFTAVAPLACLLQSGEKRAIMIALEFFHEILRIPRSSAIDLLQRIHKEGNINILHILKLSLQQLQSDYQLLAANLLLQLDTLENTTGKSVFTEEAMQVILKAVASEESSTMQLLSSFILSNIGGTFSWTGEPYTVAWLVKKAGLNSSWLQNMIRNFDWLDQSLQDRGVDSWSSKIAKSIIEIGKPIYYALEKGLKSKTKSVCRDSLTTIAWLSFEVSKSPNSVRHSACQILLDGVEQFLHPGLELEERLLACLCIYNYASGKGMQKLIRSSEGVRESLRRLSNVTWMAEELHKAADYYLPNISRISCVHTQILEASHKCSGAVTALIYYKGLLCSGFSDGSIKMWDIKKQSAMLVWDVKEHRKAVTSFSLFEPGESLLSGSADKTIGVWQMVQRKLELIEVIATKEPIRKLDTYGKTIFASTQGHRMKVIDSSRTLKDIYRSKGIKSMSVVQGKIYIGCMDSSIQELAVSNNVEREIKAPFKSWRLQSKPINSLVVYKDWLYSASSSVEGSNIKEWRRHRKPQISIAPEKGTTIQAMAVVEDFIYLNYNSSASSLQIWLRGTQQKVGRISAGSKITSLLTANDIVLCGTETGLIKGWIPL
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLYAKVHPLDPQEDVTNDTTVGTKACRKIPEIQEYGKDIKNLDEVPRLQLRTAGLRKKSSTKCLYDMLQESESDRSTTVGSCSTEIEEESDSEANMGIVKSLIANEGTSAVDRRPENFDQKLQAYCSSSGSESAKISFLRAPKRPMYKESNGTNSNRNFSRRFLSSSGHFNLSILELRDKISNGSCHVEGKISKQHKVQPSDCVLSSSPQQSCRFTEMDYRGSSERKKNSSGRKKFNEECLNGEKDAKSELLEIIEKAISSLFFSGDLRKCNKDYVVEVTTLYKMLNSKTGVKYDMLQDVILEQLLTAISASKEETVIRASVSILTTIILANESVIEDIKKKGLRLSDLATALKRNVPEAAILIYLIKPSPTEIKTLELLPTLVEVICTSKLYKGKLESVRLTPPAASLMIIEVLVTAFDYATNNMHLAAINSPRVLCGLLDVARHQNLEELISLATILVKCIQFDGQCRKYLSEFTAVAPLACLLQSGEKRAIMIALEFFHEILRIPRSSAIDLLQRIHKEGNINILHILKLSLQQLQSDYQLLAANLLLQLDTLENTTGKSVFTEEAMQVILKAVASEESSTMQLLSSFILSNIGGTFSWTGEPYTVAWLVKKAGLNSSWLQNMIRNFDWLDQSLQDRGVDSWSSKIAKSIIEIGKPIYYALEKGLKSKTKSVCRDSLTTIAWLSFEVSKSPNSVRHSACQILLDGVEQFLHPGLELEERLLACLCIYNYASGKGMQKLIRSSEGVRESLRRLSNVTWMAEELHKAADYYLPNISRISCVHTQILEASHKCSGAVTALIYYKGLLCSGFSDGSIKMWDIKKQSAMLVWDVKEHRKAVTSFSLFEPGESLLSGSADKTIGVWQMVQRKLELIEVIATKEPIRKLDTYGKTIFASTQGHRMKVIDSSRTLKDIYRSKGIKSMSVVQGKIYIGCMDSSIQELAVSNNVEREIKAPFKSWRLQSKPINSLVVYKDWLYSASSSVEGSNIKEWRRHRKPQISIAPEKGTTIQAMAVVEDFIYLNYNSSASSLQIWLRGTQQKVGRISAGSKITSLLTANDIVLCGTETGLIKGWIPL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query1074 2.2.26 [Sep-21-2011]
C6L7U11485 Putative E3 ubiquitin-pro N/A no 0.741 0.536 0.284 6e-75
D1FP571485 Putative E3 ubiquitin-pro N/A no 0.741 0.536 0.284 4e-72
D1FP531488 Putative E3 ubiquitin-pro N/A no 0.803 0.579 0.262 9e-66
P90648732 Myosin heavy chain kinase yes no 0.206 0.303 0.271 1e-08
Q6FT96711 Mitochondrial division pr yes no 0.090 0.136 0.291 8e-06
Q6DRF9387 WD repeat-containing prot yes no 0.126 0.351 0.235 5e-05
A7TNS8669 CCR4-associated factor 4 N/A no 0.101 0.162 0.260 8e-05
P87177 922 Uncharacterized WD repeat yes no 0.081 0.095 0.333 0.0001
P36130643 CCR4-associated factor 4 yes no 0.098 0.164 0.267 0.0001
A6ZZZ8645 CCR4-associated factor 4 N/A no 0.098 0.164 0.267 0.0002
>sp|C6L7U1|LIN1_LOTJA Putative E3 ubiquitin-protein ligase LIN-1 OS=Lotus japonicus GN=CERBERUS PE=2 SV=2 Back     alignment and function desciption
 Score =  283 bits (723), Expect = 6e-75,   Method: Compositional matrix adjust.
 Identities = 238/836 (28%), Positives = 434/836 (51%), Gaps = 40/836 (4%)

Query: 259  ISSLFFSGDLRKCNKDYVVEVTTLYKMLNSKTGVKYDMLQDVILEQLLTAISASKEETVI 318
            ISSL  S +L +C ++ V+++  L K   +   +   + +  I+  L+  +SAS+   V+
Sbjct: 664  ISSLCTSENLPEC-EEAVLKIARLLKDSKTNPQIHSYLSKPTIINGLVEILSASRNREVL 722

Query: 319  RASVSILTTIILANESVIEDIKKKGLRLSDLATALKRNVPEAAILIYLIKPSPTEIKTLE 378
            R S+ IL+ +I  ++SV E +         LAT LK  + EAA+LIY ++P   ++   E
Sbjct: 723  RTSIYILSELIFTDDSVAETLNSVDSDFDCLATLLKNGLAEAALLIYQLRPVFAQLSAHE 782

Query: 379  LLPTLVEVICTSKLYKGKLESVRLTPPAASLMIIEVLVTAFDYATNNMHLAAINSPRVLC 438
            L+P+LV+VI          + V + P  A++ I+E  +   D  + +++ +++ S   + 
Sbjct: 783  LIPSLVDVIQNKNEELDDFQLV-IDPKDAAIAILEQTLMGGDEYSRSLNASSVISANGIP 841

Query: 439  GLLDVARHQNLEELISLATILVKCIQFDGQCRKYLSEFTAVAPLACLLQSGEKRAIMIAL 498
             L  V   + +E   S+ ++L+ C+Q +  C+  ++    ++P+  L  SG        +
Sbjct: 842  TL--VKYLERMEGRRSVVSVLLCCMQAEKSCKNLIANRIELSPVLELFHSGNDSVRGTCV 899

Query: 499  EFFHEILRIPRSSAID-LLQRIHKEGNINILHILKLSLQQLQSDYQLLAANLLLQLDTLE 557
            EF  E++++ R ++ + +L  I  EG  + +H   + LQ    ++QL  A+LLLQLD L 
Sbjct: 900  EFLSELVQLNRRTSCNQILHTIKDEGAFSTMHTFLVYLQMAPMEHQLAVASLLLQLDLLA 959

Query: 558  NTTGKSVFTEEAMQVILKAVASEESSTMQLLSSFILSNIGGTFSWTGEPYTVAWLVKKAG 617
                 S++ EEA++ +++A+  ++ S  Q+ +   L  + G  S +G+ YT AWL+K AG
Sbjct: 960  EPRKMSIYREEAVETLIEALWQKDFSNTQMKALDALLFLIGHISSSGKSYTEAWLLKIAG 1019

Query: 618  LNSSW-----LQNMIRNFDWLDQSLQD--RGVDSWSSKIAKSII--EIGKPIYYALEKGL 668
             +  +     ++ + ++ + L ++++D    ++SW  +IA  +   E G  I+ ALE+ L
Sbjct: 1020 FDQPYNALMKVEQLGQHDNDLIETMEDEKNALNSWQKRIASVLCNHENGS-IFKALEECL 1078

Query: 669  KSKTKSVCRDSLTTIAWLSFEVSKSPNS-VRHSACQILLDGVEQFLHPGLELEERLLACL 727
            KS +  + +  L    WL+  +   P++ VR  A + LL+ V   L     LEE++LA L
Sbjct: 1079 KSNSLKMAKSCLVLATWLTHMLYTLPDTGVRDVARKSLLEEVINVLQSSKNLEEKILATL 1138

Query: 728  CIYNYASGKGMQKLIR-SSEGVRESLRRLSNVTWMAEELHKAADYYLPNISRISCVH--- 783
             +  + S     + +R  ++ +  +LRRL   + +A ++ K     + N+  +       
Sbjct: 1139 ALKTFISDPSTHEALRVYAKSIYRTLRRLKKYSVVAVDIMKV----ILNLKSVDVTELWS 1194

Query: 784  -TQILEASHKCSGAVTALIYYKGLLCSGFSDGSIKMWDIKKQSAMLVWDVKEHRKAVTSF 842
              +++E     +G V +++Y  G + SG +DG+IK+WD +K+   ++ +  EH KAVT  
Sbjct: 1195 CKEVVELDLSSNGEVLSMVYLNGQVLSGHTDGTIKVWDARKRIPRVIQETHEHTKAVT-- 1252

Query: 843  SLFEPGESLLSGSADKTIGVWQMVQRKLELIEVIATKEPIRKLDTYGKTIFASTQGHRMK 902
            SL   G+ L SGS DKTI VW +    ++ I+V   KE + +L    K     +QG  +K
Sbjct: 1253 SLCSSGDRLYSGSLDKTIRVWTIKSDGIKCIDVYDIKEAVHELAANDKLACYVSQGTGVK 1312

Query: 903  VIDSSRTLKDIYRSKGIKSMSVVQGKIYIGCMDSSIQELAVSNNVEREIKAPFKSWR--L 960
            V + S   K I  SK +KS++V   K+Y GC   SIQE+ +S          F   R  L
Sbjct: 1313 VFNWSEAPKLINFSKYVKSLAVAGDKLYCGCSGYSIQEVDLSTYTSNSF---FTGTRKLL 1369

Query: 961  QSKPINSLVVYKDWLYSASSSVEGSNIKEWRRHRKPQISIAPEKGTTIQAMAVVEDFIYL 1020
              + I+SL ++ D+L++  SSV+ +  K +   +K  +  +   G  I  +A+  DFI+ 
Sbjct: 1370 GKQTIHSLQIHDDYLFACGSSVDATAGKIFSLSQKMVVG-SLSTGLDIHRIAINSDFIFA 1428

Query: 1021 NYNSSASSLQIWLRGTQQKVGRIS-AG--SKITSLLTAND--IVLCGTETGLIKGW 1071
               +   ++++WL+    +V  I  AG  +KITSL++  D  ++  G+  G I+ W
Sbjct: 1429 --GTKFGTIEVWLKDKFTRVASIKMAGGHTKITSLVSDVDGMMLFVGSSDGKIQVW 1482
Putative E3 ubiquitin-protein ligase involved in the rhizobial infection process. Plays an important role in the early steps of infection thread formation and in growth and differentiation of nodules.
Lotus japonicus (taxid: 34305)
EC: 6EC: .EC: 3EC: .EC: 2EC: .EC: -
>sp|D1FP57|LIN2_LOTJA Putative E3 ubiquitin-protein ligase LIN-2 OS=Lotus japonicus GN=LIN PE=1 SV=1 Back     alignment and function description
>sp|D1FP53|LIN_MEDTR Putative E3 ubiquitin-protein ligase LIN OS=Medicago truncatula GN=LIN PE=2 SV=1 Back     alignment and function description
>sp|P90648|MHCKB_DICDI Myosin heavy chain kinase B OS=Dictyostelium discoideum GN=mhkB PE=2 SV=1 Back     alignment and function description
>sp|Q6FT96|MDV1_CANGA Mitochondrial division protein 1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=MDV1 PE=3 SV=1 Back     alignment and function description
>sp|Q6DRF9|WDR55_DANRE WD repeat-containing protein 55 OS=Danio rerio GN=wdr55 PE=2 SV=2 Back     alignment and function description
>sp|A7TNS8|CAF4_VANPO CCR4-associated factor 4 homolog OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=CAF4 PE=3 SV=1 Back     alignment and function description
>sp|P87177|YB1C_SCHPO Uncharacterized WD repeat-containing protein C3D6.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC3D6.12 PE=1 SV=1 Back     alignment and function description
>sp|P36130|CAF4_YEAST CCR4-associated factor 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CAF4 PE=1 SV=3 Back     alignment and function description
>sp|A6ZZZ8|CAF4_YEAS7 CCR4-associated factor 4 OS=Saccharomyces cerevisiae (strain YJM789) GN=CAF4 PE=3 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1074
359477261 1339 PREDICTED: putative E3 ubiquitin-protein 0.981 0.787 0.618 0.0
147796407 1378 hypothetical protein VITISV_010257 [Viti 0.976 0.761 0.615 0.0
255551783 1357 nucleotide binding protein, putative [Ri 0.993 0.786 0.616 0.0
296083364 1274 unnamed protein product [Vitis vinifera] 0.954 0.804 0.622 0.0
224130530 1305 predicted protein [Populus trichocarpa] 0.951 0.783 0.596 0.0
449432864 1339 PREDICTED: putative E3 ubiquitin-protein 0.976 0.783 0.569 0.0
356558169 1302 PREDICTED: uncharacterized protein LOC10 0.981 0.809 0.550 0.0
449515345 1313 PREDICTED: putative E3 ubiquitin-protein 0.954 0.780 0.565 0.0
356532569 1362 PREDICTED: uncharacterized protein LOC10 0.899 0.709 0.581 0.0
334185156 1264 transducin/WD-40 repeat-containing prote 0.934 0.794 0.524 0.0
>gi|359477261|ref|XP_002269707.2| PREDICTED: putative E3 ubiquitin-protein ligase LIN-1-like [Vitis vinifera] Back     alignment and taxonomy information
 Score = 1283 bits (3321), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 668/1080 (61%), Positives = 828/1080 (76%), Gaps = 26/1080 (2%)

Query: 3    YAKVHPLDPQEDVTNDTTVGTKACRKIPEIQEYGKDIKNLDEVPRLQLRTAGLRKKSSTK 62
            + KVHPLDPQE + + T    KA R   EIQ+Y K + N D+V R       +++ S+ K
Sbjct: 278  FQKVHPLDPQESIIDSTGDKAKASRDNTEIQDYRKALNNSDQVSR-----QDIKRSSNIK 332

Query: 63   CLYDMLQESESDRSTTVGSCSTEIEEESDSEANMGIVKSLIANEGTSAVDRRPENFDQKL 122
            CL D+L ES+SD  T+  S       + DSEA     +S +      A   R E  DQ+ 
Sbjct: 333  CLQDILMESQSDTPTSDDSFDDNDSADGDSEAYADETQSSMEAARIKADQGRMEISDQRF 392

Query: 123  QAYCSSSGSESAKISFLRAPKRPMYKESNGTNSNRNFSRRFLSSSGHFNLSILELRDKIS 182
            Q  C  S S             P+++E N  N  + FS RF  S    NLSILEL  + S
Sbjct: 393  QNSCCISTSFP-----------PLHEEINEANIKKLFSGRFSRSLNDLNLSILELGVEKS 441

Query: 183  NG--SCHVEGKISKQHKVQPSDC----VLSSSPQQSCRFTEMDY-RGSSERKK-NSSGRK 234
            +   SCH + + + + +++P D      L+++  Q+  F +M++ +G+  RKK NSS RK
Sbjct: 442  HTLWSCHAQEETTWR-RLEPDDFQILDCLAATSLQNYMFAQMEHNQGNGARKKHNSSRRK 500

Query: 235  KFNEECLNGEKDAKSELLEIIEKAISSLFFSGDLRKCNKDYVVEVTTLYKMLNSKTGVKY 294
              +E CL+ EKD+  ELL  ++KAIS L+FS    K ++D  VEVTT+Y+ML +KTGVKY
Sbjct: 501  NLHEVCLHPEKDSHGELLRALDKAISKLWFSEGQGKYDEDSSVEVTTIYEMLTNKTGVKY 560

Query: 295  DMLQDVILEQLLTAISASKEETVIRASVSILTTIILANESVIEDIKKKGLRLSDLATALK 354
             +L+D IL+QLL++IS SK+E ++RASVSIL TII  N+SVI+DIKKKGL+L  LA ALK
Sbjct: 561  TLLKDAILDQLLSSISTSKKEGIVRASVSILLTIIAGNKSVIDDIKKKGLQLGHLANALK 620

Query: 355  RNVPEAAILIYLIKPSPTEIKTLELLPTLVEVICTSKLYKGKLESVRLTPPAASLMIIEV 414
            RNV EAA LIYLI PSPTEIKTLELLPTL+ V+CTS  Y G   S+  TPPAASLMIIE 
Sbjct: 621  RNVYEAATLIYLINPSPTEIKTLELLPTLMNVVCTSNNYAGGPASLP-TPPAASLMIIEA 679

Query: 415  LVTAFDYATNNMHLAAINSPRVLCGLLDVARHQNLEELISLATILVKCIQFDGQCRKYLS 474
            L+ AFDYATN+MHLA I+SP+VL GLLDVAR+ NLEELI LATILVKC+QFDGQCR Y+S
Sbjct: 680  LIAAFDYATNSMHLAEISSPQVLSGLLDVARNNNLEELIPLATILVKCMQFDGQCRNYIS 739

Query: 475  EFTAVAPLACLLQSGEKRAIMIALEFFHEILRIPRSSAIDLLQRIHKEGNINILHILKLS 534
            +FT +AP   LL+S ++R  +IALEFFHEILR+PRSSAI +LQ++ KEG+INI+HIL   
Sbjct: 740  QFTPMAPFIYLLRSNKRRVKLIALEFFHEILRMPRSSAISVLQQMKKEGSINIMHILLPC 799

Query: 535  LQQLQSDYQLLAANLLLQLDTLENTTGKSVFTEEAMQVILKAVASEESSTMQLLSSFILS 594
            LQQ Q+++QLLAANLLLQLD LE+++G+S+F EEAM+V+L+++  EE+S  Q+LS+FILS
Sbjct: 800  LQQSQAEHQLLAANLLLQLDQLEDSSGRSMFREEAMEVLLESMVCEENSATQILSAFILS 859

Query: 595  NIGGTFSWTGEPYTVAWLVKKAGLNSSWLQNMIRNFDWLDQSLQDRGVDSWSSKIAKSII 654
            N+GGT+SWTGEPYTVAWLVKKAGL S + +NMIRNFDWLDQSLQD G D+W SKI +SII
Sbjct: 860  NLGGTYSWTGEPYTVAWLVKKAGLTSLYHRNMIRNFDWLDQSLQDTGTDTWCSKIGRSII 919

Query: 655  EIGKPIYYALEKGLKSKTKSVCRDSLTTIAWLSFEVSKSPNSVRHSACQILLDGVEQFLH 714
            + G P+++ALEKGLKSK + V RD LT IAWL +E++ +PN +R+SAC+ILL G+EQFLH
Sbjct: 920  KGGIPLFHALEKGLKSKVRRVSRDCLTAIAWLGYEIATTPNELRYSACEILLSGIEQFLH 979

Query: 715  PGLELEERLLACLCIYNYASGKGMQKLIRSSEGVRESLRRLSNVTWMAEELHKAADYYLP 774
            PGL+LEERLLACLCIYNY SGKGMQKLI  SEGVRESL RLSN+TWMAEEL K ADY+LP
Sbjct: 980  PGLDLEERLLACLCIYNYTSGKGMQKLIHFSEGVRESLGRLSNITWMAEELLKIADYFLP 1039

Query: 775  NISRISCVHTQILEASHKCSGAVTALIYYKGLLCSGFSDGSIKMWDIKKQSAMLVWDVKE 834
              S ISCVHTQILE   KCSGAVTALIYY+G LCSG+SDGSIK+WDIK QSA LV D+KE
Sbjct: 1040 YKSHISCVHTQILEMGRKCSGAVTALIYYRGQLCSGYSDGSIKVWDIKGQSATLVLDIKE 1099

Query: 835  HRKAVTSFSLFEPGESLLSGSADKTIGVWQMVQRKLELIEVIATKEPIRKLDTYGKTIFA 894
            HRKAVT FS FEPG+SLLSGSADKTI VWQMV+RK+E  EVI+TKEP++ LDT+G+ IF 
Sbjct: 1100 HRKAVTCFSHFEPGDSLLSGSADKTIRVWQMVKRKMECTEVISTKEPVQNLDTHGQLIFT 1159

Query: 895  STQGHRMKVIDSSRTLKDIYRSKGIKSMSVVQGKIYIGCMDSSIQELAVSNNVEREIKAP 954
             T GH +KV D+SR +KDI +SK +K + VVQG++YIGCMDSSIQE+ ++   E+EI+AP
Sbjct: 1160 VTHGHGVKVFDASRKVKDICKSKHVKCVRVVQGRLYIGCMDSSIQEVVITRAREQEIRAP 1219

Query: 955  FKSWRLQSKPINSLVVYKDWLYSASSSVEGSNIKEWRRHRKPQISIAPEKGTTIQAMAVV 1014
             KSWR+Q++PINS+VVYKDWLYSAS  VEGSN KEW+RH KPQ+S+ P+KG ++ AM +V
Sbjct: 1220 AKSWRMQNRPINSIVVYKDWLYSASDIVEGSNFKEWKRHSKPQMSMVPDKGASVLAMGIV 1279

Query: 1015 EDFIYLNYNSSASSLQIWLRGTQQKVGRISAGSKITSLLTANDIVLCGTETGLIKGWIPL 1074
            EDFIYLN +SS S LQIWLRGTQQK GR+SAGS+ITSLLTANDIVLCGTE GLIKGWIPL
Sbjct: 1280 EDFIYLNCSSSTSILQIWLRGTQQKAGRLSAGSRITSLLTANDIVLCGTEMGLIKGWIPL 1339

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|147796407|emb|CAN65866.1| hypothetical protein VITISV_010257 [Vitis vinifera] Back     alignment and taxonomy information
>gi|255551783|ref|XP_002516937.1| nucleotide binding protein, putative [Ricinus communis] gi|223544025|gb|EEF45551.1| nucleotide binding protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|296083364|emb|CBI23000.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|224130530|ref|XP_002328632.1| predicted protein [Populus trichocarpa] gi|222838614|gb|EEE76979.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|449432864|ref|XP_004134218.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN-1-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|356558169|ref|XP_003547380.1| PREDICTED: uncharacterized protein LOC100782870 [Glycine max] Back     alignment and taxonomy information
>gi|449515345|ref|XP_004164710.1| PREDICTED: putative E3 ubiquitin-protein ligase LIN-1-like, partial [Cucumis sativus] Back     alignment and taxonomy information
>gi|356532569|ref|XP_003534844.1| PREDICTED: uncharacterized protein LOC100789287 [Glycine max] Back     alignment and taxonomy information
>gi|334185156|ref|NP_001189833.1| transducin/WD-40 repeat-containing protein [Arabidopsis thaliana] gi|332640951|gb|AEE74472.1| transducin/WD-40 repeat-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1074
DICTYBASE|DDB_G0289115732 mhkB "myosin heavy chain kinas 0.250 0.367 0.268 1.7e-08
TAIR|locus:2148965 876 TOZ "AT5G16750" [Arabidopsis t 0.251 0.308 0.243 2.5e-06
ZFIN|ZDB-GENE-030131-8414368 pak1ip1 "PAK1 interacting prot 0.175 0.513 0.243 4.6e-05
TAIR|locus:2089855 955 AT3G21540 "AT3G21540" [Arabido 0.074 0.083 0.367 7.2e-05
TAIR|locus:2032452415 AT1G24130 "AT1G24130" [Arabido 0.263 0.681 0.231 0.00012
UNIPROTKB|Q9NWT1392 PAK1IP1 "p21-activated protein 0.177 0.487 0.243 0.00014
SGD|S000001744643 CAF4 "WD40 repeat-containing p 0.098 0.164 0.276 0.00015
RGD|1565353382 Pak1ip1 "PAK1 interacting prot 0.075 0.212 0.380 0.00018
UNIPROTKB|F1NWB8367 PAK1IP1 "p21-activated protein 0.133 0.389 0.265 0.00045
UNIPROTKB|Q5ZKU8369 PAK1IP1 "p21-activated protein 0.133 0.387 0.265 0.00045
DICTYBASE|DDB_G0289115 mhkB "myosin heavy chain kinase B" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
 Score = 177 (67.4 bits), Expect = 1.7e-08, Sum P(2) = 1.7e-08
 Identities = 81/302 (26%), Positives = 139/302 (46%)

Query:   740 KLIRSSEG--VRESLRRLSNV--TWMAEELHKAADYYLPNISRISCVHTQILEASHKCSG 795
             KLI + +G  V   L    N+  T  ++   +  DY   N+    CV T  L+  H+  G
Sbjct:   452 KLIETIKGYHVTSHLCICDNLLFTGCSDNSIRVYDYKSQNME---CVQT--LKG-HE--G 503

Query:   796 AVTALIYYKGLLCSGFSDGSIKMWDIKKQSAMLVWDVKEHRKAVTSFSLFEPGESLLSGS 855
              V ++ Y    L SG SD SIK+WD+KK     ++ ++ H K V +  L +  + L SGS
Sbjct:   504 PVESICYNDQYLFSGSSDHSIKVWDLKKLRC--IFTLEGHDKPVHTVLLND--KYLFSGS 559

Query:   856 ADKTIGVWQMVQRKLELIEVIATK-EPIRKLDTYGKTIFASTQGHRMKVIDSSRTLKDIY 914
             +DKTI VW +  + LE    + +    ++ L   G+ +F+ +    +KV D  +T +  Y
Sbjct:   560 SDKTIKVWDL--KTLECKYTLESHARAVKTLCISGQYLFSGSNDKTIKVWDL-KTFRCNY 616

Query:   915 RSKG----IKSMSVVQGKIYIGCMDSSIQELAVSNNVEREIKAPFKSWRLQSKPINSLVV 970
               KG    + ++ ++   +Y G  D +I+   V N    E  A  +      + +  +V+
Sbjct:   617 TLKGHTKWVTTICILGTNLYSGSYDKTIR---VWNLKSLECSATLRG---HDRWVEHMVI 670

Query:   971 YKDWLYSASSSVEGSNIKEWRRHRKPQISIAPEKGTTIQAMAVVEDFIYLNYNSSASSLQ 1030
                 L++AS   + + IK W        +       T+Q +AV ED   +   S   S++
Sbjct:   671 CDKLLFTAS---DDNTIKIWDLETLRCNTTLEGHNATVQCLAVWEDKKCVISCSHDQSIR 727

Query:  1031 IW 1032
             +W
Sbjct:   728 VW 729
GO:0018107 "peptidyl-threonine phosphorylation" evidence=IDA
GO:0031037 "myosin II filament disassembly" evidence=IMP
GO:0005826 "actomyosin contractile ring" evidence=IDA
GO:0005737 "cytoplasm" evidence=IDA
GO:0000910 "cytokinesis" evidence=IMP
GO:0046777 "protein autophosphorylation" evidence=IDA
GO:0045159 "myosin II binding" evidence=IPI
GO:0005524 "ATP binding" evidence=IEA;IC
GO:0004674 "protein serine/threonine kinase activity" evidence=IEA;IDA
GO:0016905 "myosin heavy chain kinase activity" evidence=IEA;IDA
GO:0016772 "transferase activity, transferring phosphorus-containing groups" evidence=IEA
GO:0006468 "protein phosphorylation" evidence=IEA
GO:0016740 "transferase activity" evidence=IEA
GO:0016310 "phosphorylation" evidence=IEA
GO:0016301 "kinase activity" evidence=IEA
GO:0000166 "nucleotide binding" evidence=IEA
TAIR|locus:2148965 TOZ "AT5G16750" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030131-8414 pak1ip1 "PAK1 interacting protein 1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
TAIR|locus:2089855 AT3G21540 "AT3G21540" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2032452 AT1G24130 "AT1G24130" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q9NWT1 PAK1IP1 "p21-activated protein kinase-interacting protein 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
SGD|S000001744 CAF4 "WD40 repeat-containing protein associated with the CCR4-NOT complex" [Saccharomyces cerevisiae (taxid:4932)] Back     alignment and assigned GO terms
RGD|1565353 Pak1ip1 "PAK1 interacting protein 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1NWB8 PAK1IP1 "p21-activated protein kinase-interacting protein 1-like" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q5ZKU8 PAK1IP1 "p21-activated protein kinase-interacting protein 1-like" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
fgenesh4_pg.C_scaffold_77000121
hypothetical protein (1305 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1074
cd00200289 cd00200, WD40, WD40 domain, found in a number of e 5e-09
cd00200289 cd00200, WD40, WD40 domain, found in a number of e 4e-07
cd00200289 cd00200, WD40, WD40 domain, found in a number of e 3e-06
COG2319466 COG2319, COG2319, FOG: WD40 repeat [General functi 2e-04
COG2319466 COG2319, COG2319, FOG: WD40 repeat [General functi 3e-04
>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information 
 Score = 58.5 bits (142), Expect = 5e-09
 Identities = 52/234 (22%), Positives = 86/234 (36%), Gaps = 41/234 (17%)

Query: 806  LLCSGFSDGSIKMWDIKKQSAMLVWDVKEHRKAVTSFSLFEPGESLLSGSADKTIGVWQM 865
             L SG SD +I++WD++      V  +  H   V+S +    G  L S S DKTI VW +
Sbjct: 65   YLASGSSDKTIRLWDLETGE--CVRTLTGHTSYVSSVAFSPDGRILSSSSRDKTIKVWDV 122

Query: 866  VQRKLELIEVIATKEPIR--KLDTYGKTIFASTQGHRMKVIDSSRTLKDIYRSKG----I 919
               K  L  +    + +        G  + +S+Q   +K+ D  RT K +    G    +
Sbjct: 123  ETGKC-LTTLRGHTDWVNSVAFSPDGTFVASSSQDGTIKLWD-LRTGKCVATLTGHTGEV 180

Query: 920  KSMSVV--QGKIYIGCMDSSIQELAVSNNVEREIKAPFKSWRLQS-----------KPIN 966
             S++      K+     D +I                 K W L +             +N
Sbjct: 181  NSVAFSPDGEKLLSSSSDGTI-----------------KLWDLSTGKCLGTLRGHENGVN 223

Query: 967  SLVVYKDWLYSASSSVEGSNIKEWRRHRKPQISIAPEKGTTIQAMAVVEDFIYL 1020
            S+    D    AS S +G+ I+ W       +        ++ ++A   D   L
Sbjct: 224  SVAFSPDGYLLASGSEDGT-IRVWDLRTGECVQTLSGHTNSVTSLAWSPDGKRL 276

Length = 289
>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information
>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information
>gnl|CDD|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 1074
KOG0271480 consensus Notchless-like WD40 repeat-containing pr 100.0
KOG0272459 consensus U4/U6 small nuclear ribonucleoprotein Pr 100.0
KOG0293519 consensus WD40 repeat-containing protein [Function 100.0
KOG0271480 consensus Notchless-like WD40 repeat-containing pr 100.0
KOG0279315 consensus G protein beta subunit-like protein [Sig 99.97
KOG0286343 consensus G-protein beta subunit [General function 99.96
KOG0315311 consensus G-protein beta subunit-like protein (con 99.96
KOG0295406 consensus WD40 repeat-containing protein [Function 99.96
KOG0281499 consensus Beta-TrCP (transducin repeats containing 99.96
KOG0315311 consensus G-protein beta subunit-like protein (con 99.96
KOG0273524 consensus Beta-transducin family (WD-40 repeat) pr 99.96
KOG0265338 consensus U5 snRNP-specific protein-like factor an 99.96
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 99.96
KOG0285460 consensus Pleiotropic regulator 1 [RNA processing 99.96
KOG0263707 consensus Transcription initiation factor TFIID, s 99.96
KOG0272459 consensus U4/U6 small nuclear ribonucleoprotein Pr 99.95
KOG0319 775 consensus WD40-repeat-containing subunit of the 18 99.95
KOG0282503 consensus mRNA splicing factor [Function unknown] 99.95
KOG0273524 consensus Beta-transducin family (WD-40 repeat) pr 99.95
KOG0313423 consensus Microtubule binding protein YTM1 (contai 99.95
KOG0286343 consensus G-protein beta subunit [General function 99.95
PLN00181793 protein SPA1-RELATED; Provisional 99.95
KOG0316307 consensus Conserved WD40 repeat-containing protein 99.95
KOG0266456 consensus WD40 repeat-containing protein [General 99.95
KOG0319 775 consensus WD40-repeat-containing subunit of the 18 99.94
KOG0645312 consensus WD40 repeat protein [General function pr 99.94
KOG0291 893 consensus WD40-repeat-containing subunit of the 18 99.94
KOG0276 794 consensus Vesicle coat complex COPI, beta' subunit 99.94
KOG0284464 consensus Polyadenylation factor I complex, subuni 99.94
KOG0281499 consensus Beta-TrCP (transducin repeats containing 99.93
KOG0263707 consensus Transcription initiation factor TFIID, s 99.93
KOG0274537 consensus Cdc4 and related F-box and WD-40 protein 99.93
KOG0318603 consensus WD40 repeat stress protein/actin interac 99.93
KOG0296399 consensus Angio-associated migratory cell protein 99.93
KOG0279315 consensus G protein beta subunit-like protein [Sig 99.93
KOG1407313 consensus WD40 repeat protein [Function unknown] 99.93
KOG0288459 consensus WD40 repeat protein TipD [General functi 99.93
KOG0306 888 consensus WD40-repeat-containing subunit of the 18 99.93
KOG0318603 consensus WD40 repeat stress protein/actin interac 99.92
KOG0292 1202 consensus Vesicle coat complex COPI, alpha subunit 99.92
KOG0278334 consensus Serine/threonine kinase receptor-associa 99.92
KOG0291 893 consensus WD40-repeat-containing subunit of the 18 99.92
KOG0295406 consensus WD40 repeat-containing protein [Function 99.91
KOG0285460 consensus Pleiotropic regulator 1 [RNA processing 99.91
KOG0284 464 consensus Polyadenylation factor I complex, subuni 99.91
KOG0301 745 consensus Phospholipase A2-activating protein (con 99.9
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 99.9
KOG0643327 consensus Translation initiation factor 3, subunit 99.9
KOG0268433 consensus Sof1-like rRNA processing protein (conta 99.9
PLN00181793 protein SPA1-RELATED; Provisional 99.89
KOG0276 794 consensus Vesicle coat complex COPI, beta' subunit 99.89
KOG0292 1202 consensus Vesicle coat complex COPI, alpha subunit 99.89
KOG0266456 consensus WD40 repeat-containing protein [General 99.89
KOG0645312 consensus WD40 repeat protein [General function pr 99.89
KOG0275508 consensus Conserved WD40 repeat-containing protein 99.89
KOG0306 888 consensus WD40-repeat-containing subunit of the 18 99.89
KOG0647347 consensus mRNA export protein (contains WD40 repea 99.89
KOG0274537 consensus Cdc4 and related F-box and WD-40 protein 99.88
KOG0278334 consensus Serine/threonine kinase receptor-associa 99.88
KOG1446311 consensus Histone H3 (Lys4) methyltransferase comp 99.88
KOG0293519 consensus WD40 repeat-containing protein [Function 99.88
KOG0265338 consensus U5 snRNP-specific protein-like factor an 99.87
KOG0316307 consensus Conserved WD40 repeat-containing protein 99.87
KOG0313423 consensus Microtubule binding protein YTM1 (contai 99.87
KOG0277311 consensus Peroxisomal targeting signal type 2 rece 99.87
KOG0283712 consensus WD40 repeat-containing protein [Function 99.87
KOG1036323 consensus Mitotic spindle checkpoint protein BUB3, 99.86
KOG0305484 consensus Anaphase promoting complex, Cdc20, Cdh1, 99.86
KOG0296399 consensus Angio-associated migratory cell protein 99.86
KOG0772 641 consensus Uncharacterized conserved protein, conta 99.86
KOG0294362 consensus WD40 repeat-containing protein [Function 99.85
KOG0277311 consensus Peroxisomal targeting signal type 2 rece 99.85
KOG0640430 consensus mRNA cleavage stimulating factor complex 99.85
KOG0310 487 consensus Conserved WD40 repeat-containing protein 99.85
PTZ00420 568 coronin; Provisional 99.85
KOG1408 1080 consensus WD40 repeat protein [Function unknown] 99.85
KOG0289506 consensus mRNA splicing factor [General function p 99.85
KOG0283 712 consensus WD40 repeat-containing protein [Function 99.85
KOG0305484 consensus Anaphase promoting complex, Cdc20, Cdh1, 99.84
PTZ00421 493 coronin; Provisional 99.84
KOG0308 735 consensus Conserved WD40 repeat-containing protein 99.84
KOG0282503 consensus mRNA splicing factor [Function unknown] 99.84
KOG0973 942 consensus Histone transcription regulator HIRA, WD 99.84
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 99.83
KOG0299479 consensus U3 snoRNP-associated protein (contains W 99.83
KOG0288459 consensus WD40 repeat protein TipD [General functi 99.83
KOG0641350 consensus WD40 repeat protein [General function pr 99.81
KOG0310 487 consensus Conserved WD40 repeat-containing protein 99.81
PTZ00421 493 coronin; Provisional 99.81
KOG0300481 consensus WD40 repeat-containing protein [Function 99.81
KOG0308 735 consensus Conserved WD40 repeat-containing protein 99.81
KOG0264422 consensus Nucleosome remodeling factor, subunit CA 99.81
PTZ00420 568 coronin; Provisional 99.81
KOG1539 910 consensus WD repeat protein [General function pred 99.81
KOG1407313 consensus WD40 repeat protein [Function unknown] 99.8
KOG0639705 consensus Transducin-like enhancer of split protei 99.8
KOG1332299 consensus Vesicle coat complex COPII, subunit SEC1 99.8
KOG0294362 consensus WD40 repeat-containing protein [Function 99.79
KOG2445361 consensus Nuclear pore complex component (sc Seh1) 99.79
KOG0275508 consensus Conserved WD40 repeat-containing protein 99.79
KOG0301 745 consensus Phospholipase A2-activating protein (con 99.78
KOG2055514 consensus WD40 repeat protein [General function pr 99.78
KOG0643327 consensus Translation initiation factor 3, subunit 99.78
KOG0640430 consensus mRNA cleavage stimulating factor complex 99.78
KOG0289506 consensus mRNA splicing factor [General function p 99.78
KOG0650733 consensus WD40 repeat nucleolar protein Bop1, invo 99.77
KOG0299479 consensus U3 snoRNP-associated protein (contains W 99.77
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 99.76
KOG2048 691 consensus WD40 repeat protein [General function pr 99.76
KOG1036323 consensus Mitotic spindle checkpoint protein BUB3, 99.75
KOG0646 476 consensus WD40 repeat protein [General function pr 99.75
KOG2096420 consensus WD40 repeat protein [General function pr 99.75
KOG1446311 consensus Histone H3 (Lys4) methyltransferase comp 99.75
KOG0300481 consensus WD40 repeat-containing protein [Function 99.75
KOG0647347 consensus mRNA export protein (contains WD40 repea 99.75
KOG1274 933 consensus WD40 repeat protein [General function pr 99.74
KOG0973 942 consensus Histone transcription regulator HIRA, WD 99.74
KOG4283397 consensus Transcription-coupled repair protein CSA 99.74
KOG1273405 consensus WD40 repeat protein [General function pr 99.73
KOG1332299 consensus Vesicle coat complex COPII, subunit SEC1 99.73
KOG4328498 consensus WD40 protein [Function unknown] 99.73
KOG0321 720 consensus WD40 repeat-containing protein L2DTL [Fu 99.73
KOG0269 839 consensus WD40 repeat-containing protein [Function 99.73
KOG0772 641 consensus Uncharacterized conserved protein, conta 99.73
KOG1063 764 consensus RNA polymerase II elongator complex, sub 99.73
KOG1274 933 consensus WD40 repeat protein [General function pr 99.72
KOG0268 433 consensus Sof1-like rRNA processing protein (conta 99.72
KOG0641350 consensus WD40 repeat protein [General function pr 99.72
KOG0646 476 consensus WD40 repeat protein [General function pr 99.72
KOG2106 626 consensus Uncharacterized conserved protein, conta 99.7
KOG0302440 consensus Ribosome Assembly protein [General funct 99.7
KOG0642577 consensus Cell-cycle nuclear protein, contains WD- 99.69
KOG2096 420 consensus WD40 repeat protein [General function pr 99.68
KOG1408 1080 consensus WD40 repeat protein [Function unknown] 99.68
KOG0267 825 consensus Microtubule severing protein katanin p80 99.67
KOG0264422 consensus Nucleosome remodeling factor, subunit CA 99.67
KOG0321 720 consensus WD40 repeat-containing protein L2DTL [Fu 99.67
KOG2106 626 consensus Uncharacterized conserved protein, conta 99.65
KOG0270463 consensus WD40 repeat-containing protein [Function 99.65
KOG1539 910 consensus WD repeat protein [General function pred 99.65
KOG0267 825 consensus Microtubule severing protein katanin p80 99.64
KOG0307 1049 consensus Vesicle coat complex COPII, subunit SEC3 99.63
KOG0269 839 consensus WD40 repeat-containing protein [Function 99.63
KOG4378 673 consensus Nuclear protein COP1 [Signal transductio 99.63
KOG4283397 consensus Transcription-coupled repair protein CSA 99.62
KOG1063 764 consensus RNA polymerase II elongator complex, sub 99.62
COG2319466 FOG: WD40 repeat [General function prediction only 99.62
KOG0322323 consensus G-protein beta subunit-like protein GNB1 99.62
KOG4378 673 consensus Nuclear protein COP1 [Signal transductio 99.61
KOG2048 691 consensus WD40 repeat protein [General function pr 99.61
COG2319 466 FOG: WD40 repeat [General function prediction only 99.61
KOG1538 1081 consensus Uncharacterized conserved protein WDR10, 99.6
KOG0302440 consensus Ribosome Assembly protein [General funct 99.6
KOG0270463 consensus WD40 repeat-containing protein [Function 99.6
KOG1188376 consensus WD40 repeat protein [General function pr 99.6
KOG0639705 consensus Transducin-like enhancer of split protei 99.59
KOG0650733 consensus WD40 repeat nucleolar protein Bop1, invo 99.57
PRK11028330 6-phosphogluconolactonase; Provisional 99.56
KOG4227 609 consensus WD40 repeat protein [General function pr 99.54
KOG1445 1012 consensus Tumor-specific antigen (contains WD repe 99.54
KOG1587555 consensus Cytoplasmic dynein intermediate chain [C 99.54
KOG0644 1113 consensus Uncharacterized conserved protein, conta 99.54
KOG1007370 consensus WD repeat protein TSSC1, WD repeat super 99.53
KOG2055514 consensus WD40 repeat protein [General function pr 99.53
KOG1334559 consensus WD40 repeat protein [General function pr 99.53
KOG1034385 consensus Transcriptional repressor EED/ESC/FIE, r 99.53
KOG15171387 consensus Guanine nucleotide binding protein MIP1 99.53
KOG2919406 consensus Guanine nucleotide-binding protein [Gene 99.53
KOG12401431 consensus Protein kinase containing WD40 repeats [ 99.52
KOG15171387 consensus Guanine nucleotide binding protein MIP1 99.52
KOG4328498 consensus WD40 protein [Function unknown] 99.52
KOG0649325 consensus WD40 repeat protein [General function pr 99.52
KOG0290364 consensus Conserved WD40 repeat-containing protein 99.49
KOG2445361 consensus Nuclear pore complex component (sc Seh1) 99.47
KOG2110 391 consensus Uncharacterized conserved protein, conta 99.46
KOG1963 792 consensus WD40 repeat protein [General function pr 99.44
KOG0303472 consensus Actin-binding protein Coronin, contains 99.44
KOG2919406 consensus Guanine nucleotide-binding protein [Gene 99.43
KOG1034385 consensus Transcriptional repressor EED/ESC/FIE, r 99.42
KOG1188376 consensus WD40 repeat protein [General function pr 99.41
KOG1009434 consensus Chromatin assembly complex 1 subunit B/C 99.41
KOG0642577 consensus Cell-cycle nuclear protein, contains WD- 99.39
KOG1273405 consensus WD40 repeat protein [General function pr 99.39
PRK11028330 6-phosphogluconolactonase; Provisional 99.39
KOG0649325 consensus WD40 repeat protein [General function pr 99.38
KOG0307 1049 consensus Vesicle coat complex COPII, subunit SEC3 99.37
KOG1587555 consensus Cytoplasmic dynein intermediate chain [C 99.36
KOG1538 1081 consensus Uncharacterized conserved protein WDR10, 99.36
KOG0303 472 consensus Actin-binding protein Coronin, contains 99.36
PRK01742429 tolB translocation protein TolB; Provisional 99.35
KOG12401431 consensus Protein kinase containing WD40 repeats [ 99.34
KOG2394 636 consensus WD40 protein DMR-N9 [General function pr 99.32
KOG1009434 consensus Chromatin assembly complex 1 subunit B/C 99.32
KOG0771398 consensus Prolactin regulatory element-binding pro 99.29
KOG1007370 consensus WD repeat protein TSSC1, WD repeat super 99.28
KOG1272 545 consensus WD40-repeat-containing subunit of the 18 99.25
KOG2110 391 consensus Uncharacterized conserved protein, conta 99.25
KOG2111346 consensus Uncharacterized conserved protein, conta 99.25
KOG1963 792 consensus WD40 repeat protein [General function pr 99.25
KOG4497447 consensus Uncharacterized conserved protein WDR8, 99.22
KOG1310 758 consensus WD40 repeat protein [General function pr 99.21
KOG3881412 consensus Uncharacterized conserved protein [Funct 99.2
KOG1524 737 consensus WD40 repeat-containing protein CHE-2 [Ge 99.2
KOG2111346 consensus Uncharacterized conserved protein, conta 99.2
KOG4227 609 consensus WD40 repeat protein [General function pr 99.19
PRK03629429 tolB translocation protein TolB; Provisional 99.19
KOG1523361 consensus Actin-related protein Arp2/3 complex, su 99.18
KOG1524 737 consensus WD40 repeat-containing protein CHE-2 [Ge 99.17
KOG0644 1113 consensus Uncharacterized conserved protein, conta 99.15
KOG1334 559 consensus WD40 repeat protein [General function pr 99.15
PRK01742429 tolB translocation protein TolB; Provisional 99.11
KOG2321 703 consensus WD40 repeat protein [General function pr 99.09
PRK04922433 tolB translocation protein TolB; Provisional 99.08
PRK05137435 tolB translocation protein TolB; Provisional 99.08
PRK02889427 tolB translocation protein TolB; Provisional 99.06
PF02239369 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO 99.05
KOG0290364 consensus Conserved WD40 repeat-containing protein 99.04
KOG14451012 consensus Tumor-specific antigen (contains WD repe 99.03
KOG1354433 consensus Serine/threonine protein phosphatase 2A, 99.03
KOG0771398 consensus Prolactin regulatory element-binding pro 98.99
KOG0322323 consensus G-protein beta subunit-like protein GNB1 98.96
KOG2321 703 consensus WD40 repeat protein [General function pr 98.93
PF10282345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 98.92
KOG0974 967 consensus WD-repeat protein WDR6, WD repeat superf 98.92
KOG3881412 consensus Uncharacterized conserved protein [Funct 98.91
KOG4547 541 consensus WD40 repeat-containing protein [General 98.91
KOG2041 1189 consensus WD40 repeat protein [General function pr 98.91
TIGR03300377 assembly_YfgL outer membrane assembly lipoprotein 98.9
KOG1310 758 consensus WD40 repeat protein [General function pr 98.89
TIGR02800417 propeller_TolB tol-pal system beta propeller repea 98.89
PRK04922433 tolB translocation protein TolB; Provisional 98.89
KOG2139445 consensus WD40 repeat protein [General function pr 98.86
KOG2139 445 consensus WD40 repeat protein [General function pr 98.85
PF10282345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 98.84
PRK03629429 tolB translocation protein TolB; Provisional 98.83
PRK00178430 tolB translocation protein TolB; Provisional 98.81
KOG1523361 consensus Actin-related protein Arp2/3 complex, su 98.81
COG5170460 CDC55 Serine/threonine protein phosphatase 2A, reg 98.78
KOG2394 636 consensus WD40 protein DMR-N9 [General function pr 98.77
TIGR03300377 assembly_YfgL outer membrane assembly lipoprotein 98.77
KOG10642439 consensus RAVE (regulator of V-ATPase assembly) co 98.76
KOG4547 541 consensus WD40 repeat-containing protein [General 98.76
KOG2315 566 consensus Predicted translation initiation factor 98.75
TIGR02658352 TTQ_MADH_Hv methylamine dehydrogenase heavy chain. 98.74
KOG1409404 consensus Uncharacterized conserved protein, conta 98.73
PRK04792448 tolB translocation protein TolB; Provisional 98.73
PF08662194 eIF2A: Eukaryotic translation initiation factor eI 98.72
KOG4497447 consensus Uncharacterized conserved protein WDR8, 98.7
PF02239369 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO 98.7
PRK02889427 tolB translocation protein TolB; Provisional 98.69
PRK05137435 tolB translocation protein TolB; Provisional 98.69
PF08662194 eIF2A: Eukaryotic translation initiation factor eI 98.65
TIGR02800417 propeller_TolB tol-pal system beta propeller repea 98.65
KOG1272 545 consensus WD40-repeat-containing subunit of the 18 98.64
KOG41901034 consensus Uncharacterized conserved protein [Funct 98.61
PRK01029428 tolB translocation protein TolB; Provisional 98.61
KOG10642439 consensus RAVE (regulator of V-ATPase assembly) co 98.6
KOG0974 967 consensus WD-repeat protein WDR6, WD repeat superf 98.6
KOG0280339 consensus Uncharacterized conserved protein [Amino 98.59
KOG1409 404 consensus Uncharacterized conserved protein, conta 98.56
PRK11138394 outer membrane biogenesis protein BamB; Provisiona 98.5
COG2706346 3-carboxymuconate cyclase [Carbohydrate transport 98.48
TIGR02658352 TTQ_MADH_Hv methylamine dehydrogenase heavy chain. 98.43
PRK00178430 tolB translocation protein TolB; Provisional 98.42
PLN02919 1057 haloacid dehalogenase-like hydrolase family protei 98.41
COG5354 561 Uncharacterized protein, contains Trp-Asp (WD) rep 98.39
KOG2315 566 consensus Predicted translation initiation factor 98.39
PRK04792448 tolB translocation protein TolB; Provisional 98.37
KOG0882 558 consensus Cyclophilin-related peptidyl-prolyl cis- 98.36
COG2706346 3-carboxymuconate cyclase [Carbohydrate transport 98.35
KOG41901034 consensus Uncharacterized conserved protein [Funct 98.33
KOG0309 1081 consensus Conserved WD40 repeat-containing protein 98.32
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 98.26
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 98.23
PF04762 928 IKI3: IKI3 family; InterPro: IPR006849 Members of 98.22
KOG4532344 consensus WD40-like repeat containing protein [Gen 98.19
KOG2041 1189 consensus WD40 repeat protein [General function pr 98.18
COG4946 668 Uncharacterized protein related to the periplasmic 98.18
KOG4714319 consensus Nucleoporin [Nuclear structure] 98.17
KOG3914 390 consensus WD repeat protein WDR4 [Function unknown 98.17
KOG0309 1081 consensus Conserved WD40 repeat-containing protein 98.16
KOG2314 698 consensus Translation initiation factor 3, subunit 98.14
KOG2066 846 consensus Vacuolar assembly/sorting protein VPS41 98.09
PRK11138394 outer membrane biogenesis protein BamB; Provisiona 98.09
KOG2695425 consensus WD40 repeat protein [General function pr 98.08
PF0040039 WD40: WD domain, G-beta repeat; InterPro: IPR01978 98.08
PRK04043419 tolB translocation protein TolB; Provisional 98.07
KOG1920 1265 consensus IkappaB kinase complex, IKAP component [ 98.04
PLN02919 1057 haloacid dehalogenase-like hydrolase family protei 98.01
KOG3914 390 consensus WD repeat protein WDR4 [Function unknown 98.01
KOG1354433 consensus Serine/threonine protein phosphatase 2A, 98.0
PRK01029428 tolB translocation protein TolB; Provisional 97.98
PF0040039 WD40: WD domain, G-beta repeat; InterPro: IPR01978 97.97
KOG0280339 consensus Uncharacterized conserved protein [Amino 97.96
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 97.93
PF15492282 Nbas_N: Neuroblastoma-amplified sequence, N termin 97.92
COG4946668 Uncharacterized protein related to the periplasmic 97.89
KOG2114 933 consensus Vacuolar assembly/sorting protein PEP5/V 97.86
PF04762 928 IKI3: IKI3 family; InterPro: IPR006849 Members of 97.84
KOG1832 1516 consensus HIV-1 Vpr-binding protein [Cell cycle co 97.78
KOG4532344 consensus WD40-like repeat containing protein [Gen 97.75
PF00780275 CNH: CNH domain; InterPro: IPR001180 Based on sequ 97.73
KOG1912 1062 consensus WD40 repeat protein [General function pr 97.72
PLN03200 2102 cellulose synthase-interactive protein; Provisiona 97.7
PF07433305 DUF1513: Protein of unknown function (DUF1513); In 97.68
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 97.66
COG5354 561 Uncharacterized protein, contains Trp-Asp (WD) rep 97.64
KOG4649354 consensus PQQ (pyrrolo-quinoline quinone) repeat p 97.63
PF07433305 DUF1513: Protein of unknown function (DUF1513); In 97.63
KOG2695425 consensus WD40 repeat protein [General function pr 97.56
KOG1275 1118 consensus PAB-dependent poly(A) ribonuclease, subu 97.56
KOG1645463 consensus RING-finger-containing E3 ubiquitin liga 97.55
KOG2066 846 consensus Vacuolar assembly/sorting protein VPS41 97.54
cd00216488 PQQ_DH Dehydrogenases with pyrrolo-quinoline quino 97.49
KOG4714319 consensus Nucleoporin [Nuclear structure] 97.44
KOG3621 726 consensus WD40 repeat-containing protein [General 97.42
KOG1912 1062 consensus WD40 repeat protein [General function pr 97.42
PLN03200 2102 cellulose synthase-interactive protein; Provisiona 97.41
PRK04043419 tolB translocation protein TolB; Provisional 97.4
COG5170 460 CDC55 Serine/threonine protein phosphatase 2A, reg 97.38
cd00216488 PQQ_DH Dehydrogenases with pyrrolo-quinoline quino 97.37
KOG1645463 consensus RING-finger-containing E3 ubiquitin liga 97.36
KOG1920 1265 consensus IkappaB kinase complex, IKAP component [ 97.21
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 97.18
PF15492282 Nbas_N: Neuroblastoma-amplified sequence, N termin 97.16
KOG4649354 consensus PQQ (pyrrolo-quinoline quinone) repeat p 97.13
KOG0882 558 consensus Cyclophilin-related peptidyl-prolyl cis- 97.08
KOG2314 698 consensus Translation initiation factor 3, subunit 97.06
PF11768 545 DUF3312: Protein of unknown function (DUF3312); In 97.05
KOG2114 933 consensus Vacuolar assembly/sorting protein PEP5/V 97.05
PF04053 443 Coatomer_WDAD: Coatomer WD associated region ; Int 97.01
PF08596395 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; 96.98
KOG1832 1516 consensus HIV-1 Vpr-binding protein [Cell cycle co 96.96
PF06433342 Me-amine-dh_H: Methylamine dehydrogenase heavy cha 96.95
PF04841 410 Vps16_N: Vps16, N-terminal region; InterPro: IPR00 96.93
PF03178321 CPSF_A: CPSF A subunit region; InterPro: IPR004871 96.9
PF08553794 VID27: VID27 cytoplasmic protein; InterPro: IPR013 96.89
KOG1275 1118 consensus PAB-dependent poly(A) ribonuclease, subu 96.85
PF11768545 DUF3312: Protein of unknown function (DUF3312); In 96.77
PRK02888 635 nitrous-oxide reductase; Validated 96.6
smart0032040 WD40 WD40 repeats. Note that these repeats are per 96.57
PF06433342 Me-amine-dh_H: Methylamine dehydrogenase heavy cha 96.43
KOG1008 783 consensus Uncharacterized conserved protein, conta 96.33
PF04053 443 Coatomer_WDAD: Coatomer WD associated region ; Int 96.31
smart0032040 WD40 WD40 repeats. Note that these repeats are per 96.3
PF00780275 CNH: CNH domain; InterPro: IPR001180 Based on sequ 96.21
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 96.16
PHA02713557 hypothetical protein; Provisional 96.16
COG3386307 Gluconolactonase [Carbohydrate transport and metab 96.1
PRK02888 635 nitrous-oxide reductase; Validated 96.06
PHA02713557 hypothetical protein; Provisional 96.05
KOG4441571 consensus Proteins containing BTB/POZ and Kelch do 95.92
PF14783111 BBS2_Mid: Ciliary BBSome complex subunit 2, middle 95.91
KOG4441571 consensus Proteins containing BTB/POZ and Kelch do 95.86
PF06977248 SdiA-regulated: SdiA-regulated; InterPro: IPR00972 95.82
PF04841410 Vps16_N: Vps16, N-terminal region; InterPro: IPR00 95.75
KOG4640 665 consensus Anaphase-promoting complex (APC), subuni 95.62
PF03178321 CPSF_A: CPSF A subunit region; InterPro: IPR004871 95.5
COG3490366 Uncharacterized protein conserved in bacteria [Fun 95.46
PRK13616591 lipoprotein LpqB; Provisional 95.35
PF14783111 BBS2_Mid: Ciliary BBSome complex subunit 2, middle 95.3
TIGR03075 527 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methan 95.28
PF00930353 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-termin 95.18
PF08596395 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; 95.11
KOG2395644 consensus Protein involved in vacuole import and d 94.95
COG3391381 Uncharacterized conserved protein [Function unknow 94.93
COG0823425 TolB Periplasmic component of the Tol biopolymer t 94.81
KOG4640 665 consensus Anaphase-promoting complex (APC), subuni 94.8
KOG2444238 consensus WD40 repeat protein [General function pr 94.77
KOG2079 1206 consensus Vacuolar assembly/sorting protein VPS8 [ 94.66
KOG3621 726 consensus WD40 repeat-containing protein [General 94.64
PF05804708 KAP: Kinesin-associated protein (KAP) 94.43
KOG1897 1096 consensus Damage-specific DNA binding complex, sub 94.11
COG3490366 Uncharacterized protein conserved in bacteria [Fun 94.11
PF05096264 Glu_cyclase_2: Glutamine cyclotransferase; InterPr 94.02
PHA03098534 kelch-like protein; Provisional 94.01
COG0823425 TolB Periplasmic component of the Tol biopolymer t 94.01
PF08553 794 VID27: VID27 cytoplasmic protein; InterPro: IPR013 94.01
KOG1008 783 consensus Uncharacterized conserved protein, conta 93.85
COG5276370 Uncharacterized conserved protein [Function unknow 93.57
KOG2444238 consensus WD40 repeat protein [General function pr 93.54
KOG2395644 consensus Protein involved in vacuole import and d 93.36
PF02897414 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal 93.34
PHA03098534 kelch-like protein; Provisional 93.33
KOG2079 1206 consensus Vacuolar assembly/sorting protein VPS8 [ 92.93
COG3391381 Uncharacterized conserved protein [Function unknow 92.88
KOG2160342 consensus Armadillo/beta-catenin-like repeat-conta 92.86
TIGR03075 527 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methan 92.77
PF05804708 KAP: Kinesin-associated protein (KAP) 92.26
COG3386307 Gluconolactonase [Carbohydrate transport and metab 91.72
PRK13800897 putative oxidoreductase/HEAT repeat-containing pro 91.68
PF14583386 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C 91.54
KOG4499310 consensus Ca2+-binding protein Regucalcin/SMP30 [I 91.44
PHA02790480 Kelch-like protein; Provisional 90.78
PF01602526 Adaptin_N: Adaptin N terminal region; InterPro: IP 90.38
COG3292 671 Predicted periplasmic ligand-binding sensor domain 90.0
TIGR03074 764 PQQ_membr_DH membrane-bound PQQ-dependent dehydrog 89.87
KOG4499310 consensus Ca2+-binding protein Regucalcin/SMP30 [I 89.75
PF1289447 Apc4_WD40: Anaphase-promoting complex subunit 4 WD 89.58
cd00020120 ARM Armadillo/beta-catenin-like repeats. An approx 89.56
KOG2280 829 consensus Vacuolar assembly/sorting protein VPS16 89.28
PF1289447 Apc4_WD40: Anaphase-promoting complex subunit 4 WD 89.2
PF12234 631 Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR0 88.87
PHA02790480 Kelch-like protein; Provisional 88.53
PF12234 631 Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR0 87.25
PF00930353 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-termin 87.08
PF10508503 Proteasom_PSMB: Proteasome non-ATPase 26S subunit; 86.76
PF05096264 Glu_cyclase_2: Glutamine cyclotransferase; InterPr 86.4
PF02897414 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal 86.23
KOG1897 1096 consensus Damage-specific DNA binding complex, sub 85.87
PF14761215 HPS3_N: Hermansky-Pudlak syndrome 3 85.71
cd00020120 ARM Armadillo/beta-catenin-like repeats. An approx 84.14
COG3823262 Glutamine cyclotransferase [Posttranslational modi 83.93
COG3204316 Uncharacterized protein conserved in bacteria [Fun 83.76
PF14727418 PHTB1_N: PTHB1 N-terminus 82.11
COG5276370 Uncharacterized conserved protein [Function unknow 81.26
PRK14131376 N-acetylneuraminic acid mutarotase; Provisional 81.07
PRK09687280 putative lyase; Provisional 80.33
>KOG0271 consensus Notchless-like WD40 repeat-containing protein [Function unknown] Back     alignment and domain information 
Probab=100.00  E-value=1.7e-36  Score=329.42  Aligned_cols=273  Identities=16%  Similarity=0.264  Sum_probs=242.4

Q ss_pred             CCCCcEEEEEEe--CCEEEEEECCCcEEEEECCCCCeeEEEEeccCCCCEEEEEEcCCCCEEEEEeCCCeEEEEEccCCc
Q 001455          792 KCSGAVTALIYY--KGLLCSGFSDGSIKMWDIKKQSAMLVWDVKEHRKAVTSFSLFEPGESLLSGSADKTIGVWQMVQRK  869 (1074)
Q Consensus       792 gH~~~VtsLafS--~~~LaSGs~DGtVrIWDl~t~~~~~i~tl~gH~~~VtsLafSpdg~~LaSGS~DGtIrIWDl~tg~  869 (1074)
                      ||.++|.|++|+  +..++||+.|.++|+||..+..  +.++.++|...|.|++|+|||+.|+||+.||+|++||..+|+
T Consensus       113 GH~e~Vl~~~fsp~g~~l~tGsGD~TvR~WD~~TeT--p~~t~KgH~~WVlcvawsPDgk~iASG~~dg~I~lwdpktg~  190 (480)
T KOG0271|consen  113 GHGEAVLSVQFSPTGSRLVTGSGDTTVRLWDLDTET--PLFTCKGHKNWVLCVAWSPDGKKIASGSKDGSIRLWDPKTGQ  190 (480)
T ss_pred             CCCCcEEEEEecCCCceEEecCCCceEEeeccCCCC--cceeecCCccEEEEEEECCCcchhhccccCCeEEEecCCCCC
Confidence            999999999999  5589999999999999999874  489999999999999999999999999999999999999999


Q ss_pred             eEEEEEeccCCCeEEEc-------cCCCeEEEEecCCeEEEEeCCC--ceeeeec-CCCeEEEEEe-CCEEEEEECCCcE
Q 001455          870 LELIEVIATKEPIRKLD-------TYGKTIFASTQGHRMKVIDSSR--TLKDIYR-SKGIKSMSVV-QGKIYIGCMDSSI  938 (1074)
Q Consensus       870 ~~~~~~~~h~~~V~s~s-------~dg~~L~sgS~DgtI~VWDl~~--~l~~l~~-~~~V~sLa~s-dgkLlaGs~DgsI  938 (1074)
                      ..-..+.+|+..|++++       +..+++++++.||.|+|||+..  +...+.+ ...|+|+.|- +|.+++|+.|++|
T Consensus       191 ~~g~~l~gH~K~It~Lawep~hl~p~~r~las~skDg~vrIWd~~~~~~~~~lsgHT~~VTCvrwGG~gliySgS~DrtI  270 (480)
T KOG0271|consen  191 QIGRALRGHKKWITALAWEPLHLVPPCRRLASSSKDGSVRIWDTKLGTCVRTLSGHTASVTCVRWGGEGLIYSGSQDRTI  270 (480)
T ss_pred             cccccccCcccceeEEeecccccCCCccceecccCCCCEEEEEccCceEEEEeccCccceEEEEEcCCceEEecCCCceE
Confidence            88888889999999864       4567999999999999999884  5555554 4579999998 8899999999999


Q ss_pred             EEEEccCCceeeeccccccccCCCCCeEEEEEcCC-----------ce-------------------------EEEEEec
Q 001455          939 QELAVSNNVEREIKAPFKSWRLQSKPINSLVVYKD-----------WL-------------------------YSASSSV  982 (1074)
Q Consensus       939 ~IwDl~tg~~~~i~~~~r~~~~h~~~I~sL~~spd-----------~i-------------------------~las~S~  982 (1074)
                      ++|+...|...      +.+.+|...|+.++.+.+           +.                         .+++++ 
T Consensus       271 kvw~a~dG~~~------r~lkGHahwvN~lalsTdy~LRtgaf~~t~~~~~~~se~~~~Al~rY~~~~~~~~erlVSgs-  343 (480)
T KOG0271|consen  271 KVWRALDGKLC------RELKGHAHWVNHLALSTDYVLRTGAFDHTGRKPKSFSEEQKKALERYEAVLKDSGERLVSGS-  343 (480)
T ss_pred             EEEEccchhHH------HhhcccchheeeeeccchhhhhccccccccccCCChHHHHHHHHHHHHHhhccCcceeEEec-
Confidence            99999987654      445788889988887722           22                         367666 


Q ss_pred             CCCeEEEEEC-CCCCeEEEccCCCCCeEEEEEecCCCEEEEEECCCcEEEEECCCCcEEEEEeCC-CCeEEEEEcC--CE
Q 001455          983 EGSNIKEWRR-HRKPQISIAPEKGTTIQAMAVVEDFIYLNYNSSASSLQIWLRGTQQKVGRISAG-SKITSLLTAN--DI 1058 (1074)
Q Consensus       983 dDgtI~IWDl-~t~~~i~~l~gH~~~VtsLafSPDG~~LaSGS~DGtIrIWDl~tg~~l~tL~~h-s~VtsLa~dg--~~ 1058 (1074)
                      +|.++.+|+. .+.+++..+.+|..-|+.+.||||++|||++|.|..|++|+.++|+.+.+|.+| ..|..++|+.  +.
T Consensus       344 Dd~tlflW~p~~~kkpi~rmtgHq~lVn~V~fSPd~r~IASaSFDkSVkLW~g~tGk~lasfRGHv~~VYqvawsaDsRL  423 (480)
T KOG0271|consen  344 DDFTLFLWNPFKSKKPITRMTGHQALVNHVSFSPDGRYIASASFDKSVKLWDGRTGKFLASFRGHVAAVYQVAWSADSRL  423 (480)
T ss_pred             CCceEEEecccccccchhhhhchhhheeeEEECCCccEEEEeecccceeeeeCCCcchhhhhhhccceeEEEEeccCccE
Confidence            9999999995 455678889999999999999999999999999999999999999999999999 6799999974  49


Q ss_pred             EEEEECCCcEEEEec
Q 001455         1059 VLCGTETGLIKGWIP 1073 (1074)
Q Consensus      1059 LaSGs~DG~IrIWdi 1073 (1074)
                      |++|+.|.++++|++
T Consensus       424 lVS~SkDsTLKvw~V  438 (480)
T KOG0271|consen  424 LVSGSKDSTLKVWDV  438 (480)
T ss_pred             EEEcCCCceEEEEEe
Confidence            999999999999986

>KOG0272 consensus U4/U6 small nuclear ribonucleoprotein Prp4 (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0293 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0271 consensus Notchless-like WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0279 consensus G protein beta subunit-like protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG0286 consensus G-protein beta subunit [General function prediction only] Back     alignment and domain information
>KOG0315 consensus G-protein beta subunit-like protein (contains WD40 repeats) [General function prediction only] Back     alignment and domain information
>KOG0295 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0281 consensus Beta-TrCP (transducin repeats containing)/Slimb proteins [Function unknown] Back     alignment and domain information
>KOG0315 consensus G-protein beta subunit-like protein (contains WD40 repeats) [General function prediction only] Back     alignment and domain information
>KOG0273 consensus Beta-transducin family (WD-40 repeat) protein [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0265 consensus U5 snRNP-specific protein-like factor and related proteins [RNA processing and modification] Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>KOG0285 consensus Pleiotropic regulator 1 [RNA processing and modification] Back     alignment and domain information
>KOG0263 consensus Transcription initiation factor TFIID, subunit TAF5 (also component of histone acetyltransferase SAGA) [Transcription] Back     alignment and domain information
>KOG0272 consensus U4/U6 small nuclear ribonucleoprotein Prp4 (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0319 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0282 consensus mRNA splicing factor [Function unknown] Back     alignment and domain information
>KOG0273 consensus Beta-transducin family (WD-40 repeat) protein [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0313 consensus Microtubule binding protein YTM1 (contains WD40 repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0286 consensus G-protein beta subunit [General function prediction only] Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>KOG0316 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0266 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0319 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0645 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0291 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0276 consensus Vesicle coat complex COPI, beta' subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0284 consensus Polyadenylation factor I complex, subunit PFS2 [RNA processing and modification] Back     alignment and domain information
>KOG0281 consensus Beta-TrCP (transducin repeats containing)/Slimb proteins [Function unknown] Back     alignment and domain information
>KOG0263 consensus Transcription initiation factor TFIID, subunit TAF5 (also component of histone acetyltransferase SAGA) [Transcription] Back     alignment and domain information
>KOG0274 consensus Cdc4 and related F-box and WD-40 proteins [General function prediction only] Back     alignment and domain information
>KOG0318 consensus WD40 repeat stress protein/actin interacting protein [Cytoskeleton] Back     alignment and domain information
>KOG0296 consensus Angio-associated migratory cell protein (contains WD40 repeats) [Function unknown] Back     alignment and domain information
>KOG0279 consensus G protein beta subunit-like protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG1407 consensus WD40 repeat protein [Function unknown] Back     alignment and domain information
>KOG0288 consensus WD40 repeat protein TipD [General function prediction only] Back     alignment and domain information
>KOG0306 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0318 consensus WD40 repeat stress protein/actin interacting protein [Cytoskeleton] Back     alignment and domain information
>KOG0292 consensus Vesicle coat complex COPI, alpha subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0278 consensus Serine/threonine kinase receptor-associated protein [Lipid transport and metabolism] Back     alignment and domain information
>KOG0291 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0295 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0285 consensus Pleiotropic regulator 1 [RNA processing and modification] Back     alignment and domain information
>KOG0284 consensus Polyadenylation factor I complex, subunit PFS2 [RNA processing and modification] Back     alignment and domain information
>KOG0301 consensus Phospholipase A2-activating protein (contains WD40 repeats) [Lipid transport and metabolism] Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>KOG0643 consensus Translation initiation factor 3, subunit i (eIF-3i)/TGF-beta receptor-interacting protein (TRIP-1) [Translation, ribosomal structure and biogenesis; Signal transduction mechanisms] Back     alignment and domain information
>KOG0268 consensus Sof1-like rRNA processing protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>KOG0276 consensus Vesicle coat complex COPI, beta' subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0292 consensus Vesicle coat complex COPI, alpha subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0266 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0645 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0275 consensus Conserved WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0306 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0647 consensus mRNA export protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0274 consensus Cdc4 and related F-box and WD-40 proteins [General function prediction only] Back     alignment and domain information
>KOG0278 consensus Serine/threonine kinase receptor-associated protein [Lipid transport and metabolism] Back     alignment and domain information
>KOG1446 consensus Histone H3 (Lys4) methyltransferase complex and RNA cleavage factor II complex, subunit SWD2 [RNA processing and modification; Chromatin structure and dynamics; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0293 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0265 consensus U5 snRNP-specific protein-like factor and related proteins [RNA processing and modification] Back     alignment and domain information
>KOG0316 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0313 consensus Microtubule binding protein YTM1 (contains WD40 repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0277 consensus Peroxisomal targeting signal type 2 receptor [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0283 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG1036 consensus Mitotic spindle checkpoint protein BUB3, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0305 consensus Anaphase promoting complex, Cdc20, Cdh1, and Ama1 subunits [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0296 consensus Angio-associated migratory cell protein (contains WD40 repeats) [Function unknown] Back     alignment and domain information
>KOG0772 consensus Uncharacterized conserved protein, contains WD40 repeat [Function unknown] Back     alignment and domain information
>KOG0294 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0277 consensus Peroxisomal targeting signal type 2 receptor [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0640 consensus mRNA cleavage stimulating factor complex; subunit 1 [RNA processing and modification] Back     alignment and domain information
>KOG0310 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>PTZ00420 coronin; Provisional Back     alignment and domain information
>KOG1408 consensus WD40 repeat protein [Function unknown] Back     alignment and domain information
>KOG0289 consensus mRNA splicing factor [General function prediction only] Back     alignment and domain information
>KOG0283 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0305 consensus Anaphase promoting complex, Cdc20, Cdh1, and Ama1 subunits [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>KOG0308 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0282 consensus mRNA splicing factor [Function unknown] Back     alignment and domain information
>KOG0973 consensus Histone transcription regulator HIRA, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning; Transcription] Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>KOG0299 consensus U3 snoRNP-associated protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0288 consensus WD40 repeat protein TipD [General function prediction only] Back     alignment and domain information
>KOG0641 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0310 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>KOG0300 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0308 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0264 consensus Nucleosome remodeling factor, subunit CAF1/NURF55/MSI1 [Chromatin structure and dynamics] Back     alignment and domain information
>PTZ00420 coronin; Provisional Back     alignment and domain information
>KOG1539 consensus WD repeat protein [General function prediction only] Back     alignment and domain information
>KOG1407 consensus WD40 repeat protein [Function unknown] Back     alignment and domain information
>KOG0639 consensus Transducin-like enhancer of split protein (contains WD40 repeats) [Chromatin structure and dynamics] Back     alignment and domain information
>KOG1332 consensus Vesicle coat complex COPII, subunit SEC13 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0294 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG2445 consensus Nuclear pore complex component (sc Seh1) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0275 consensus Conserved WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0301 consensus Phospholipase A2-activating protein (contains WD40 repeats) [Lipid transport and metabolism] Back     alignment and domain information
>KOG2055 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0643 consensus Translation initiation factor 3, subunit i (eIF-3i)/TGF-beta receptor-interacting protein (TRIP-1) [Translation, ribosomal structure and biogenesis; Signal transduction mechanisms] Back     alignment and domain information
>KOG0640 consensus mRNA cleavage stimulating factor complex; subunit 1 [RNA processing and modification] Back     alignment and domain information
>KOG0289 consensus mRNA splicing factor [General function prediction only] Back     alignment and domain information
>KOG0650 consensus WD40 repeat nucleolar protein Bop1, involved in ribosome biogenesis [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0299 consensus U3 snoRNP-associated protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>KOG2048 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1036 consensus Mitotic spindle checkpoint protein BUB3, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0646 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG2096 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1446 consensus Histone H3 (Lys4) methyltransferase complex and RNA cleavage factor II complex, subunit SWD2 [RNA processing and modification; Chromatin structure and dynamics; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0300 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0647 consensus mRNA export protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG1274 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0973 consensus Histone transcription regulator HIRA, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning; Transcription] Back     alignment and domain information
>KOG4283 consensus Transcription-coupled repair protein CSA, contains WD40 domain [Transcription; Replication, recombination and repair] Back     alignment and domain information
>KOG1273 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1332 consensus Vesicle coat complex COPII, subunit SEC13 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4328 consensus WD40 protein [Function unknown] Back     alignment and domain information
>KOG0321 consensus WD40 repeat-containing protein L2DTL [Function unknown] Back     alignment and domain information
>KOG0269 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0772 consensus Uncharacterized conserved protein, contains WD40 repeat [Function unknown] Back     alignment and domain information
>KOG1063 consensus RNA polymerase II elongator complex, subunit ELP2, WD repeat superfamily [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>KOG1274 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0268 consensus Sof1-like rRNA processing protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0641 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0646 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG2106 consensus Uncharacterized conserved protein, contains HELP and WD40 domains [Function unknown] Back     alignment and domain information
>KOG0302 consensus Ribosome Assembly protein [General function prediction only] Back     alignment and domain information
>KOG0642 consensus Cell-cycle nuclear protein, contains WD-40 repeats [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG2096 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1408 consensus WD40 repeat protein [Function unknown] Back     alignment and domain information
>KOG0267 consensus Microtubule severing protein katanin p80 subunit B (contains WD40 repeats) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0264 consensus Nucleosome remodeling factor, subunit CAF1/NURF55/MSI1 [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0321 consensus WD40 repeat-containing protein L2DTL [Function unknown] Back     alignment and domain information
>KOG2106 consensus Uncharacterized conserved protein, contains HELP and WD40 domains [Function unknown] Back     alignment and domain information
>KOG0270 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG1539 consensus WD repeat protein [General function prediction only] Back     alignment and domain information
>KOG0267 consensus Microtubule severing protein katanin p80 subunit B (contains WD40 repeats) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0307 consensus Vesicle coat complex COPII, subunit SEC31 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0269 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG4378 consensus Nuclear protein COP1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4283 consensus Transcription-coupled repair protein CSA, contains WD40 domain [Transcription; Replication, recombination and repair] Back     alignment and domain information
>KOG1063 consensus RNA polymerase II elongator complex, subunit ELP2, WD repeat superfamily [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>COG2319 FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>KOG0322 consensus G-protein beta subunit-like protein GNB1L, contains WD repeats [General function prediction only] Back     alignment and domain information
>KOG4378 consensus Nuclear protein COP1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG2048 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>COG2319 FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>KOG0302 consensus Ribosome Assembly protein [General function prediction only] Back     alignment and domain information
>KOG0270 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG1188 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0639 consensus Transducin-like enhancer of split protein (contains WD40 repeats) [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0650 consensus WD40 repeat nucleolar protein Bop1, involved in ribosome biogenesis [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>KOG4227 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1445 consensus Tumor-specific antigen (contains WD repeats) [Cytoskeleton] Back     alignment and domain information
>KOG1587 consensus Cytoplasmic dynein intermediate chain [Cytoskeleton] Back     alignment and domain information
>KOG0644 consensus Uncharacterized conserved protein, contains WD40 repeat and BROMO domains [General function prediction only] Back     alignment and domain information
>KOG1007 consensus WD repeat protein TSSC1, WD repeat superfamily [Function unknown] Back     alignment and domain information
>KOG2055 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1334 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1034 consensus Transcriptional repressor EED/ESC/FIE, required for transcriptional silencing, WD repeat superfamily [Transcription] Back     alignment and domain information
>KOG1517 consensus Guanine nucleotide binding protein MIP1 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG2919 consensus Guanine nucleotide-binding protein [General function prediction only] Back     alignment and domain information
>KOG1240 consensus Protein kinase containing WD40 repeats [Signal transduction mechanisms] Back     alignment and domain information
>KOG1517 consensus Guanine nucleotide binding protein MIP1 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG4328 consensus WD40 protein [Function unknown] Back     alignment and domain information
>KOG0649 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0290 consensus Conserved WD40 repeat-containing protein AN11 [Function unknown] Back     alignment and domain information
>KOG2445 consensus Nuclear pore complex component (sc Seh1) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2110 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] Back     alignment and domain information
>KOG1963 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0303 consensus Actin-binding protein Coronin, contains WD40 repeats [Cytoskeleton] Back     alignment and domain information
>KOG2919 consensus Guanine nucleotide-binding protein [General function prediction only] Back     alignment and domain information
>KOG1034 consensus Transcriptional repressor EED/ESC/FIE, required for transcriptional silencing, WD repeat superfamily [Transcription] Back     alignment and domain information
>KOG1188 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1009 consensus Chromatin assembly complex 1 subunit B/CAC2 (contains WD40 repeats) [Chromatin structure and dynamics; Replication, recombination and repair] Back     alignment and domain information
>KOG0642 consensus Cell-cycle nuclear protein, contains WD-40 repeats [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1273 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>KOG0649 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0307 consensus Vesicle coat complex COPII, subunit SEC31 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1587 consensus Cytoplasmic dynein intermediate chain [Cytoskeleton] Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>KOG0303 consensus Actin-binding protein Coronin, contains WD40 repeats [Cytoskeleton] Back     alignment and domain information
>PRK01742 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1240 consensus Protein kinase containing WD40 repeats [Signal transduction mechanisms] Back     alignment and domain information
>KOG2394 consensus WD40 protein DMR-N9 [General function prediction only] Back     alignment and domain information
>KOG1009 consensus Chromatin assembly complex 1 subunit B/CAC2 (contains WD40 repeats) [Chromatin structure and dynamics; Replication, recombination and repair] Back     alignment and domain information
>KOG0771 consensus Prolactin regulatory element-binding protein/Protein transport protein SEC12p [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1007 consensus WD repeat protein TSSC1, WD repeat superfamily [Function unknown] Back     alignment and domain information
>KOG1272 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG2110 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] Back     alignment and domain information
>KOG2111 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] Back     alignment and domain information
>KOG1963 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG4497 consensus Uncharacterized conserved protein WDR8, contains WD repeats [General function prediction only] Back     alignment and domain information
>KOG1310 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG3881 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1524 consensus WD40 repeat-containing protein CHE-2 [General function prediction only] Back     alignment and domain information
>KOG2111 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] Back     alignment and domain information
>KOG4227 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PRK03629 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1523 consensus Actin-related protein Arp2/3 complex, subunit ARPC1/p41-ARC [Cytoskeleton] Back     alignment and domain information
>KOG1524 consensus WD40 repeat-containing protein CHE-2 [General function prediction only] Back     alignment and domain information
>KOG0644 consensus Uncharacterized conserved protein, contains WD40 repeat and BROMO domains [General function prediction only] Back     alignment and domain information
>KOG1334 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PRK01742 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG2321 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK02889 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A Back     alignment and domain information
>KOG0290 consensus Conserved WD40 repeat-containing protein AN11 [Function unknown] Back     alignment and domain information
>KOG1445 consensus Tumor-specific antigen (contains WD repeats) [Cytoskeleton] Back     alignment and domain information
>KOG1354 consensus Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms] Back     alignment and domain information
>KOG0771 consensus Prolactin regulatory element-binding protein/Protein transport protein SEC12p [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0322 consensus G-protein beta subunit-like protein GNB1L, contains WD repeats [General function prediction only] Back     alignment and domain information
>KOG2321 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>KOG0974 consensus WD-repeat protein WDR6, WD repeat superfamily [General function prediction only] Back     alignment and domain information
>KOG3881 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4547 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>KOG1310 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG2139 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG2139 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>PRK03629 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1523 consensus Actin-related protein Arp2/3 complex, subunit ARPC1/p41-ARC [Cytoskeleton] Back     alignment and domain information
>COG5170 CDC55 Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms] Back     alignment and domain information
>KOG2394 consensus WD40 protein DMR-N9 [General function prediction only] Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>KOG1064 consensus RAVE (regulator of V-ATPase assembly) complex subunit RAV1/DMX protein, WD repeat superfamily [General function prediction only] Back     alignment and domain information
>KOG4547 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG2315 consensus Predicted translation initiation factor related to eIF-3a [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain Back     alignment and domain information
>KOG1409 consensus Uncharacterized conserved protein, contains WD40 repeats and FYVE domains [Function unknown] Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF08662 eIF2A: Eukaryotic translation initiation factor eIF2A; InterPro: IPR013979 This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins Back     alignment and domain information
>KOG4497 consensus Uncharacterized conserved protein WDR8, contains WD repeats [General function prediction only] Back     alignment and domain information
>PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A Back     alignment and domain information
>PRK02889 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF08662 eIF2A: Eukaryotic translation initiation factor eIF2A; InterPro: IPR013979 This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>KOG1272 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG4190 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK01029 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1064 consensus RAVE (regulator of V-ATPase assembly) complex subunit RAV1/DMX protein, WD repeat superfamily [General function prediction only] Back     alignment and domain information
>KOG0974 consensus WD-repeat protein WDR6, WD repeat superfamily [General function prediction only] Back     alignment and domain information
>KOG0280 consensus Uncharacterized conserved protein [Amino acid transport and metabolism] Back     alignment and domain information
>KOG1409 consensus Uncharacterized conserved protein, contains WD40 repeats and FYVE domains [Function unknown] Back     alignment and domain information
>PRK11138 outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>COG5354 Uncharacterized protein, contains Trp-Asp (WD) repeat [General function prediction only] Back     alignment and domain information
>KOG2315 consensus Predicted translation initiation factor related to eIF-3a [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG0882 consensus Cyclophilin-related peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG4190 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0309 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>PF04762 IKI3: IKI3 family; InterPro: IPR006849 Members of this family are components of the elongator multi-subunit component of a novel RNA polymerase II holoenzyme for transcriptional elongation [] Back     alignment and domain information
>KOG4532 consensus WD40-like repeat containing protein [General function prediction only] Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>COG4946 Uncharacterized protein related to the periplasmic component of the Tol biopolymer transport system [Function unknown] Back     alignment and domain information
>KOG4714 consensus Nucleoporin [Nuclear structure] Back     alignment and domain information
>KOG3914 consensus WD repeat protein WDR4 [Function unknown] Back     alignment and domain information
>KOG0309 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG2314 consensus Translation initiation factor 3, subunit b (eIF-3b) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG2066 consensus Vacuolar assembly/sorting protein VPS41 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK11138 outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>KOG2695 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF00400 WD40: WD domain, G-beta repeat; InterPro: IPR019781 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide Back     alignment and domain information
>PRK04043 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>KOG3914 consensus WD repeat protein WDR4 [Function unknown] Back     alignment and domain information
>KOG1354 consensus Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms] Back     alignment and domain information
>PRK01029 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF00400 WD40: WD domain, G-beta repeat; InterPro: IPR019781 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide Back     alignment and domain information
>KOG0280 consensus Uncharacterized conserved protein [Amino acid transport and metabolism] Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>PF15492 Nbas_N: Neuroblastoma-amplified sequence, N terminal Back     alignment and domain information
>COG4946 Uncharacterized protein related to the periplasmic component of the Tol biopolymer transport system [Function unknown] Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF04762 IKI3: IKI3 family; InterPro: IPR006849 Members of this family are components of the elongator multi-subunit component of a novel RNA polymerase II holoenzyme for transcriptional elongation [] Back     alignment and domain information
>KOG1832 consensus HIV-1 Vpr-binding protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG4532 consensus WD40-like repeat containing protein [General function prediction only] Back     alignment and domain information
>PF00780 CNH: CNH domain; InterPro: IPR001180 Based on sequence similarities a domain of homology has been identified in the following proteins []: Citron and Citron kinase Back     alignment and domain information
>KOG1912 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PLN03200 cellulose synthase-interactive protein; Provisional Back     alignment and domain information
>PF07433 DUF1513: Protein of unknown function (DUF1513); InterPro: IPR008311 There are currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>COG5354 Uncharacterized protein, contains Trp-Asp (WD) repeat [General function prediction only] Back     alignment and domain information
>KOG4649 consensus PQQ (pyrrolo-quinoline quinone) repeat protein [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PF07433 DUF1513: Protein of unknown function (DUF1513); InterPro: IPR008311 There are currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>KOG2695 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1275 consensus PAB-dependent poly(A) ribonuclease, subunit PAN2 [Replication, recombination and repair] Back     alignment and domain information
>KOG1645 consensus RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2066 consensus Vacuolar assembly/sorting protein VPS41 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd00216 PQQ_DH Dehydrogenases with pyrrolo-quinoline quinone (PQQ) as cofactor, like ethanol, methanol, and membrane bound glucose dehydrogenases Back     alignment and domain information
>KOG4714 consensus Nucleoporin [Nuclear structure] Back     alignment and domain information
>KOG3621 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1912 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PLN03200 cellulose synthase-interactive protein; Provisional Back     alignment and domain information
>PRK04043 tolB translocation protein TolB; Provisional Back     alignment and domain information
>COG5170 CDC55 Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms] Back     alignment and domain information
>cd00216 PQQ_DH Dehydrogenases with pyrrolo-quinoline quinone (PQQ) as cofactor, like ethanol, methanol, and membrane bound glucose dehydrogenases Back     alignment and domain information
>KOG1645 consensus RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF15492 Nbas_N: Neuroblastoma-amplified sequence, N terminal Back     alignment and domain information
>KOG4649 consensus PQQ (pyrrolo-quinoline quinone) repeat protein [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>KOG0882 consensus Cyclophilin-related peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2314 consensus Translation initiation factor 3, subunit b (eIF-3b) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF11768 DUF3312: Protein of unknown function (DUF3312); InterPro: IPR024511 This is a eukaryotic family of uncharacterised proteins that contain WD40 repeats Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF08596 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; InterPro: IPR013905 The Lethal giant larvae (Lgl) tumour suppressor protein is conserved from yeast to mammals Back     alignment and domain information
>KOG1832 consensus HIV-1 Vpr-binding protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF06433 Me-amine-dh_H: Methylamine dehydrogenase heavy chain (MADH); InterPro: IPR009451 Methylamine dehydrogenase (1 Back     alignment and domain information
>PF04841 Vps16_N: Vps16, N-terminal region; InterPro: IPR006926 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>PF03178 CPSF_A: CPSF A subunit region; InterPro: IPR004871 This family includes a region that lies towards the C terminus of the cleavage and polyadenylation specificity factor (CPSF) A (160 kDa) subunit Back     alignment and domain information
>PF08553 VID27: VID27 cytoplasmic protein; InterPro: IPR013863 This entry represents fungal and plant proteins and contains many hypothetical proteins Back     alignment and domain information
>KOG1275 consensus PAB-dependent poly(A) ribonuclease, subunit PAN2 [Replication, recombination and repair] Back     alignment and domain information
>PF11768 DUF3312: Protein of unknown function (DUF3312); InterPro: IPR024511 This is a eukaryotic family of uncharacterised proteins that contain WD40 repeats Back     alignment and domain information
>PRK02888 nitrous-oxide reductase; Validated Back     alignment and domain information
>smart00320 WD40 WD40 repeats Back     alignment and domain information
>PF06433 Me-amine-dh_H: Methylamine dehydrogenase heavy chain (MADH); InterPro: IPR009451 Methylamine dehydrogenase (1 Back     alignment and domain information
>KOG1008 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>smart00320 WD40 WD40 repeats Back     alignment and domain information
>PF00780 CNH: CNH domain; InterPro: IPR001180 Based on sequence similarities a domain of homology has been identified in the following proteins []: Citron and Citron kinase Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PHA02713 hypothetical protein; Provisional Back     alignment and domain information
>COG3386 Gluconolactonase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK02888 nitrous-oxide reductase; Validated Back     alignment and domain information
>PHA02713 hypothetical protein; Provisional Back     alignment and domain information
>KOG4441 consensus Proteins containing BTB/POZ and Kelch domains, involved in regulatory/signal transduction processes [Signal transduction mechanisms; General function prediction only] Back     alignment and domain information
>PF14783 BBS2_Mid: Ciliary BBSome complex subunit 2, middle region Back     alignment and domain information
>KOG4441 consensus Proteins containing BTB/POZ and Kelch domains, involved in regulatory/signal transduction processes [Signal transduction mechanisms; General function prediction only] Back     alignment and domain information
>PF06977 SdiA-regulated: SdiA-regulated; InterPro: IPR009722 This entry represents a conserved region approximately 100 residues long within a number of hypothetical bacterial proteins that may be regulated by SdiA, a member of the LuxR family of transcriptional regulators [] Back     alignment and domain information
>PF04841 Vps16_N: Vps16, N-terminal region; InterPro: IPR006926 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>KOG4640 consensus Anaphase-promoting complex (APC), subunit 4 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF03178 CPSF_A: CPSF A subunit region; InterPro: IPR004871 This family includes a region that lies towards the C terminus of the cleavage and polyadenylation specificity factor (CPSF) A (160 kDa) subunit Back     alignment and domain information
>COG3490 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PRK13616 lipoprotein LpqB; Provisional Back     alignment and domain information
>PF14783 BBS2_Mid: Ciliary BBSome complex subunit 2, middle region Back     alignment and domain information
>TIGR03075 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methanol/ethanol family Back     alignment and domain information
>PF00930 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-terminal region; InterPro: IPR002469 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF08596 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; InterPro: IPR013905 The Lethal giant larvae (Lgl) tumour suppressor protein is conserved from yeast to mammals Back     alignment and domain information
>KOG2395 consensus Protein involved in vacuole import and degradation [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG3391 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG0823 TolB Periplasmic component of the Tol biopolymer transport system [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG4640 consensus Anaphase-promoting complex (APC), subunit 4 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2444 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG2079 consensus Vacuolar assembly/sorting protein VPS8 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG3621 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF05804 KAP: Kinesin-associated protein (KAP) Back     alignment and domain information
>KOG1897 consensus Damage-specific DNA binding complex, subunit DDB1 [Replication, recombination and repair] Back     alignment and domain information
>COG3490 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF05096 Glu_cyclase_2: Glutamine cyclotransferase; InterPro: IPR007788 This family of enzymes 2 Back     alignment and domain information
>PHA03098 kelch-like protein; Provisional Back     alignment and domain information
>COG0823 TolB Periplasmic component of the Tol biopolymer transport system [Intracellular trafficking and secretion] Back     alignment and domain information
>PF08553 VID27: VID27 cytoplasmic protein; InterPro: IPR013863 This entry represents fungal and plant proteins and contains many hypothetical proteins Back     alignment and domain information
>KOG1008 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] Back     alignment and domain information
>COG5276 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2444 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG2395 consensus Protein involved in vacuole import and degradation [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF02897 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal beta-propeller domain; InterPro: IPR004106 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PHA03098 kelch-like protein; Provisional Back     alignment and domain information
>KOG2079 consensus Vacuolar assembly/sorting protein VPS8 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG3391 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2160 consensus Armadillo/beta-catenin-like repeat-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03075 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methanol/ethanol family Back     alignment and domain information
>PF05804 KAP: Kinesin-associated protein (KAP) Back     alignment and domain information
>COG3386 Gluconolactonase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK13800 putative oxidoreductase/HEAT repeat-containing protein; Provisional Back     alignment and domain information
>PF14583 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C5M_C 3PE7_A Back     alignment and domain information
>KOG4499 consensus Ca2+-binding protein Regucalcin/SMP30 [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>PHA02790 Kelch-like protein; Provisional Back     alignment and domain information
>PF01602 Adaptin_N: Adaptin N terminal region; InterPro: IPR002553 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>COG3292 Predicted periplasmic ligand-binding sensor domain [Signal transduction mechanisms] Back     alignment and domain information
>TIGR03074 PQQ_membr_DH membrane-bound PQQ-dependent dehydrogenase, glucose/quinate/shikimate family Back     alignment and domain information
>KOG4499 consensus Ca2+-binding protein Regucalcin/SMP30 [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>PF12894 Apc4_WD40: Anaphase-promoting complex subunit 4 WD40 domain Back     alignment and domain information
>cd00020 ARM Armadillo/beta-catenin-like repeats Back     alignment and domain information
>KOG2280 consensus Vacuolar assembly/sorting protein VPS16 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF12894 Apc4_WD40: Anaphase-promoting complex subunit 4 WD40 domain Back     alignment and domain information
>PF12234 Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR022033 This domain family is found in eukaryotes, and is typically between 621 and 644 amino acids in length Back     alignment and domain information
>PHA02790 Kelch-like protein; Provisional Back     alignment and domain information
>PF12234 Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR022033 This domain family is found in eukaryotes, and is typically between 621 and 644 amino acids in length Back     alignment and domain information
>PF00930 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-terminal region; InterPro: IPR002469 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF10508 Proteasom_PSMB: Proteasome non-ATPase 26S subunit; InterPro: IPR019538 The 26S proteasome is an enzymatic complex that degrades ubiquitinated proteins in eukaryotic cells Back     alignment and domain information
>PF05096 Glu_cyclase_2: Glutamine cyclotransferase; InterPro: IPR007788 This family of enzymes 2 Back     alignment and domain information
>PF02897 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal beta-propeller domain; InterPro: IPR004106 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>KOG1897 consensus Damage-specific DNA binding complex, subunit DDB1 [Replication, recombination and repair] Back     alignment and domain information
>PF14761 HPS3_N: Hermansky-Pudlak syndrome 3 Back     alignment and domain information
>cd00020 ARM Armadillo/beta-catenin-like repeats Back     alignment and domain information
>COG3823 Glutamine cyclotransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG3204 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF14727 PHTB1_N: PTHB1 N-terminus Back     alignment and domain information
>COG5276 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK14131 N-acetylneuraminic acid mutarotase; Provisional Back     alignment and domain information
>PRK09687 putative lyase; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1074
1erj_A393 Crystal Structure Of The C-Terminal Wd40 Domain Of 4e-05
>pdb|1ERJ|A Chain A, Crystal Structure Of The C-Terminal Wd40 Domain Of Tup1 Length = 393 Back     alignment and structure 
Iteration: 1

 Score = 47.8 bits (112), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 30/104 (28%), Positives = 53/104 (50%), Gaps = 7/104 (6%)
Query: 806 LLCSGFSDGSIKMWDIKKQSAMLVWDVKEHRKAVTSFSLFEPGESLLSGSADKTIGVWQM 865
            L +G  D  I++WDI+ +  +++  ++ H + + S   F  G+ L+SGS D+T+ +W +
Sbjct: 137 FLATGAEDRLIRIWDIENRKIVMI--LQGHEQDIYSLDYFPSGDKLVSGSGDRTVRIWDL 194
Query: 866 VQRKLEL---IEVIATKEPIRKLDTYGKTIFASTQGHRMKVIDS 906
              +  L   IE   T   +   D  GK I A +    ++V DS
Sbjct: 195 RTGQCSLTLSIEDGVTTVAVSPGD--GKYIAAGSLDRAVRVWDS 236

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

No hit with probability above 80.00

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 1074
d1tbga_340 b.69.4.1 (A:) beta1-subunit of the signal-transduc 2e-08
d1tbga_340 b.69.4.1 (A:) beta1-subunit of the signal-transduc 3e-05
d1tbga_340 b.69.4.1 (A:) beta1-subunit of the signal-transduc 1e-04
d1k8kc_371 b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 3e-08
d1nr0a2299 b.69.4.1 (A:313-611) Actin interacting protein 1 { 4e-08
d1nr0a2299 b.69.4.1 (A:313-611) Actin interacting protein 1 { 0.001
d1pgua1325 b.69.4.1 (A:2-326) Actin interacting protein 1 {Ba 7e-08
d1pgua2287 b.69.4.1 (A:327-613) Actin interacting protein 1 { 9e-08
d1vyhc1317 b.69.4.1 (C:92-408) Platelet-activating factor ace 9e-08
d1vyhc1317 b.69.4.1 (C:92-408) Platelet-activating factor ace 4e-06
d1vyhc1317 b.69.4.1 (C:92-408) Platelet-activating factor ace 1e-05
d1vyhc1317 b.69.4.1 (C:92-408) Platelet-activating factor ace 0.004
d1gxra_337 b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Hum 2e-07
d1gxra_337 b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Hum 7e-04
d1erja_388 b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yea 1e-06
d1erja_388 b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yea 0.004
d1erja_388 b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yea 0.004
d1p22a2293 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (be 2e-06
d1p22a2293 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (be 0.001
d1p22a2293 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (be 0.003
d1nr0a1311 b.69.4.1 (A:2-312) Actin interacting protein 1 {Ne 4e-06
d1nr0a1311 b.69.4.1 (A:2-312) Actin interacting protein 1 {Ne 0.001
d1nexb2355 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker' 2e-05
d1nexb2355 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker' 6e-05
d1nexb2355 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker' 0.003
d2ovrb2342 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing 3e-05
d2ovrb2342 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing 0.002
d1sq9a_393 b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Bake 1e-04
d1yfqa_342 b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Bake 1e-04
d1k32a3360 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Ar 3e-04
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Length = 340 Back     information, alignment and structure

class: All beta proteins
fold: 7-bladed beta-propeller
superfamily: WD40 repeat-like
family: WD40-repeat
domain: beta1-subunit of the signal-transducing G protein heterotrimer
species: Cow (Bos taurus) [TaxId: 9913]

 Score = 54.7 bits (130), Expect = 2e-08
 Identities = 21/140 (15%), Positives = 49/140 (35%), Gaps = 9/140 (6%)

Query: 726 CLCIYNYASGKGMQKLIRSSEGVRESLRRLSNVTWMAEELHKAADYYLPNISRISCVHTQ 785
              +++   G   Q        +  ++    N    A      +D     +  +      
Sbjct: 207 SAKLWDVREGMCRQTFTGHESDIN-AICFFPNGNAFA----TGSDDATCRLFDLRADQEL 261

Query: 786 ILEASHKCSGAVTALIYYKG--LLCSGFSDGSIKMWDIKKQSAMLVWDVKEHRKAVTSFS 843
           +  +       +T++ + K   LL +G+ D +  +WD  K        +  H   V+   
Sbjct: 262 MTYSHDNIICGITSVSFSKSGRLLLAGYDDFNCNVWDALKAD--RAGVLAGHDNRVSCLG 319

Query: 844 LFEPGESLLSGSADKTIGVW 863
           + + G ++ +GS D  + +W
Sbjct: 320 VTDDGMAVATGSWDSFLKIW 339
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Length = 340 Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Length = 340 Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Length = 371 Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 299 Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 299 Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 325 Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 287 Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 388 Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 388 Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 388 Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 311 Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 311 Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 355 Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 355 Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 355 Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Length = 342 Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Length = 342 Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 393 Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 342 Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 360 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query1074
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 100.0
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 100.0
d1vyhc1317 Platelet-activating factor acetylhydrolase IB subu 100.0
d1tbga_340 beta1-subunit of the signal-transducing G protein 100.0
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 100.0
d1k8kc_371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 100.0
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 100.0
d1p22a2293 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 100.0
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 100.0
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 100.0
d1sq9a_393 Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac 99.98
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 99.97
d1yfqa_342 Cell cycle arrest protein BUB3 {Baker's yeast (Sac 99.97
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 99.97
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 99.97
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 99.97
d1pgua2287 Actin interacting protein 1 {Baker's yeast (Saccha 99.97
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 99.96
d1k8kc_371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 99.96
d1tbga_340 beta1-subunit of the signal-transducing G protein 99.96
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 99.96
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 99.95
d1vyhc1317 Platelet-activating factor acetylhydrolase IB subu 99.95
d1p22a2293 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 99.93
d1sq9a_393 Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac 99.93
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 99.93
d1pgua2287 Actin interacting protein 1 {Baker's yeast (Saccha 99.91
d1yfqa_342 Cell cycle arrest protein BUB3 {Baker's yeast (Sac 99.88
d1hzua2426 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.88
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 99.87
d1k32a3360 Tricorn protease domain 2 {Archaeon Thermoplasma a 99.86
d1k32a3360 Tricorn protease domain 2 {Archaeon Thermoplasma a 99.84
d1pbyb_337 Quinohemoprotein amine dehydrogenase B chain {Para 99.82
d1qksa2432 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.8
d1jmxb_346 Quinohemoprotein amine dehydrogenase B chain {Pseu 99.79
d1hzua2426 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.79
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 99.78
d1qksa2432 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.76
d2madh_373 Methylamine dehydrogenase, H-chain {Gram negative 99.74
d1ri6a_333 Putative isomerase YbhE {Escherichia coli [TaxId: 99.74
d1pbyb_337 Quinohemoprotein amine dehydrogenase B chain {Para 99.69
d2bbkh_355 Methylamine dehydrogenase, H-chain {Paracoccus den 99.64
d2madh_373 Methylamine dehydrogenase, H-chain {Gram negative 99.63
d1ri6a_333 Putative isomerase YbhE {Escherichia coli [TaxId: 99.63
d1jmxb_346 Quinohemoprotein amine dehydrogenase B chain {Pseu 99.56
d2bbkh_355 Methylamine dehydrogenase, H-chain {Paracoccus den 99.49
d1mdah_368 Methylamine dehydrogenase, H-chain {Paracoccus den 99.44
d1mdah_368 Methylamine dehydrogenase, H-chain {Paracoccus den 99.33
d2bgra1 470 Dipeptidyl peptidase IV/CD26, N-terminal domain {P 99.28
d2bgra1470 Dipeptidyl peptidase IV/CD26, N-terminal domain {P 99.01
d1qnia2441 Nitrous oxide reductase, N-terminal domain {Pseudo 98.95
d1qnia2441 Nitrous oxide reductase, N-terminal domain {Pseudo 98.9
d2hqsa1269 TolB, C-terminal domain {Escherichia coli [TaxId: 98.69
d1jofa_365 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu 98.49
d1jdha_529 beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} 98.48
d1q1sc_434 Importin alpha {Mouse (Mus musculus) [TaxId: 10090 98.42
d2p4oa1302 Hypothetical protein All0351 homologue {Nostoc pun 98.4
d2p4oa1302 Hypothetical protein All0351 homologue {Nostoc pun 98.4
d1jdha_529 beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} 98.28
d1rwia_260 Serine/threonine-protein kinase PknD {Mycobacteriu 98.21
d1jofa_365 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu 98.18
d1rwia_260 Serine/threonine-protein kinase PknD {Mycobacteriu 98.15
d1q1sc_434 Importin alpha {Mouse (Mus musculus) [TaxId: 10090 98.14
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 97.97
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 97.87
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 97.85
d1wa5b_503 Karyopherin alpha {Baker's yeast (Saccharomyces ce 97.76
d1xfda1 465 Dipeptidyl aminopeptidase-like protein 6, DPP6, N- 97.76
d1xqra1264 Hsp70-binding protein 1 (HspBP1) {Human (Homo sapi 97.63
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 97.5
d1wa5b_503 Karyopherin alpha {Baker's yeast (Saccharomyces ce 97.07
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 97.06
d1xqra1264 Hsp70-binding protein 1 (HspBP1) {Human (Homo sapi 97.01
d1k32a2281 Tricorn protease N-terminal domain {Archaeon Therm 96.77
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 96.64
d1xfda1465 Dipeptidyl aminopeptidase-like protein 6, DPP6, N- 96.61
d1xm9a1457 Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} 96.48
d1xm9a1457 Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} 96.37
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 95.81
d1k3ia3387 Galactose oxidase, central domain {Fungi (Fusarium 93.25
d1k32a2281 Tricorn protease N-terminal domain {Archaeon Therm 92.08
d2hqsa1269 TolB, C-terminal domain {Escherichia coli [TaxId: 89.19
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 89.17
d1kb0a2573 Quinoprotein alcohol dehydrogenase, N-terminal dom 88.36
d2ad6a1571 Methanol dehydrogenase, heavy chain {Methylophilus 86.4
d1utca2327 Clathrin heavy-chain terminal domain {Rat (Rattus 82.14
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All beta proteins
fold: 7-bladed beta-propeller
superfamily: WD40 repeat-like
family: WD40-repeat
domain: Groucho/tle1, C-terminal domain
species: Human (Homo sapiens) [TaxId: 9606]

Probab=100.00  E-value=2.8e-33  Score=253.65  Aligned_cols=280  Identities=14%  Similarity=0.216  Sum_probs=229.6

Q ss_pred             CCEEEEEEEEECCCCCCCEEEEEEE--CCEEEEEECCCCEEEEECCCCCEE---EEEEECCCCCCEEEEEECCCCCEEEE
Q ss_conf             2213689974047788768999992--989999988992999977999713---79985147887799999479998999
Q 001455          779 ISCVHTQILEASHKCSGAVTALIYY--KGLLCSGFSDGSIKMWDIKKQSAM---LVWDVKEHRKAVTSFSLFEPGESLLS  853 (1074)
Q Consensus       779 ~~~vhtl~le~~~gH~~~VtsIafS--~~~LaSGs~DGtVrIWDi~s~~~~---~i~tl~gH~~~VtsIafSpdg~~LaS  853 (1074)
                      ...++++      +|.+.|++++|+  +.+|++|+ ||.|+|||+......   ......+|.+.|.+++|+|++++|++
T Consensus        42 ~~~~~~~------~H~~~V~~v~fs~~g~~latg~-dg~V~iWd~~~~~~~~~~~~~~~~~h~~~I~~v~~s~dg~~l~s  114 (337)
T d1gxra_          42 ARQINTL------NHGEVVCAVTISNPTRHVYTGG-KGCVKVWDISHPGNKSPVSQLDCLNRDNYIRSCKLLPDGCTLIV  114 (337)
T ss_dssp             EEEEEEE------CCSSCCCEEEECSSSSEEEEEC-BSEEEEEETTSTTCCSCSEEEECSCTTSBEEEEEECTTSSEEEE
T ss_pred             CEEEEEC------CCCCCEEEEEECCCCCEEEEEE-CCEEEEEECCCCCCCCEEEEEEECCCCCCEEEEEECCCCCEEEE
T ss_conf             5499987------9999289999989999999997-99889977367763311687640488996899998679988988


Q ss_pred             EECCCEEEEEECCCCCEEE-EEEECCCCCEEE--ECCCCCEEEEEECCCEEEEEECCCCE--EEEE-CCCCEEEEEEE-C
Q ss_conf             9589809999866891688-887336888689--71599959997349819999679951--4310-59984899973-9
Q 001455          854 GSADKTIGVWQMVQRKLEL-IEVIATKEPIRK--LDTYGKTIFASTQGHRMKVIDSSRTL--KDIY-RSKGIKSMSVV-Q  926 (1074)
Q Consensus       854 GS~DGtIrIWDi~tg~~~~-~~~~~h~~~V~s--ls~dg~~LvsgS~DgtI~IWDl~~~~--~~l~-~~~~V~sIafs-d  926 (1074)
                      |+.||+|++||+....... .....|...+..  +++++..+++++.++.+++|++....  .... +...+.+++|+ +
T Consensus       115 ~~~dg~i~iwd~~~~~~~~~~~~~~~~~~v~~~~~~~~~~~l~s~~~d~~i~~~~~~~~~~~~~~~~~~~~v~~l~~s~~  194 (337)
T d1gxra_         115 GGEASTLSIWDLAAPTPRIKAELTSSAPACYALAISPDSKVCFSCCSDGNIAVWDLHNQTLVRQFQGHTDGASCIDISND  194 (337)
T ss_dssp             EESSSEEEEEECCCC--EEEEEEECSSSCEEEEEECTTSSEEEEEETTSCEEEEETTTTEEEEEECCCSSCEEEEEECTT
T ss_pred             EECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
T ss_conf             61233211111111111111111111111111111111111111111111111111111111111111111110123444


Q ss_pred             C-EEEEEECCCCEEEEECCCCCEEEECCCCCCCCCCCCCEEEEEECCCCEEEEEEECCCCEEEEEECCCCCEEEECCCCC
Q ss_conf             9-899997799299998337820000156533347898838999818951999995499939999799997179706789
Q 001455          927 G-KIYIGCMDSSIQELAVSNNVEREIKAPFKSWRLQSKPINSLVVYKDWLYSASSSVEGSNIKEWRRHRKPQISIAPEKG 1005 (1074)
Q Consensus       927 g-kLlsGs~DgsI~IwDl~tg~~~~i~~~~r~~~~h~~~I~sL~~spd~i~lvs~S~dDgtIkIWDl~s~~~i~~l~gH~ 1005 (1074)
                      + .+++++.|+.+++||+.+++.....       .+...+.++.+++++.++++++ .|+.+++||...+.... ...|.
T Consensus       195 ~~~~~~~~~d~~v~i~d~~~~~~~~~~-------~~~~~i~~l~~~~~~~~l~~~~-~d~~i~i~d~~~~~~~~-~~~~~  265 (337)
T d1gxra_         195 GTKLWTGGLDNTVRSWDLREGRQLQQH-------DFTSQIFSLGYCPTGEWLAVGM-ESSNVEVLHVNKPDKYQ-LHLHE  265 (337)
T ss_dssp             SSEEEEEETTSEEEEEETTTTEEEEEE-------ECSSCEEEEEECTTSSEEEEEE-TTSCEEEEETTSSCEEE-ECCCS
T ss_pred             CCCCCCCCCCCCCCCCCCCCCEEECCC-------CCCCCEEEEEECCCCCCCCEEC-CCCCCCCCCCCCCCCCC-CCCCC
T ss_conf             321122356655321111110000024-------6666157999715303000000-25642111111111000-01245


Q ss_pred             CCEEEEEEECCCCEEEEEECCCCEEEEECCCCCEEEEEECCCCEEEEEEC--CCEEEEEECCCCEEEEECC
Q ss_conf             87579999159999999979992999988999079998079976999972--9999999799919998229
Q 001455         1006 TTIQAMAVVEDFIYLNYNSSASSLQIWLRGTQQKVGRISAGSKITSLLTA--NDIVLCGTETGLIKGWIPL 1074 (1074)
Q Consensus      1006 ~~VtsIafSPDG~~LaSGS~DGtIrIWDl~tg~~I~tL~~h~~Vtsla~s--g~~LaSGs~DG~IrIWdil 1074 (1074)
                      ..|++++|+|+++++++++.||.|++|+..+++.+..+..++.|++++|+  +++|++|+.||+|++|+++
T Consensus       266 ~~i~~v~~s~~g~~l~s~s~Dg~i~iwd~~~~~~~~~~~~~~~v~~~~~s~d~~~l~t~s~D~~I~vWdl~  336 (337)
T d1gxra_         266 SCVLSLKFAYCGKWFVSTGKDNLLNAWRTPYGASIFQSKESSSVLSCDISVDDKYIVTGSGDKKATVYEVI  336 (337)
T ss_dssp             SCEEEEEECTTSSEEEEEETTSEEEEEETTTCCEEEEEECSSCEEEEEECTTSCEEEEEETTSCEEEEEEE
T ss_pred             CCCCEEEECCCCCEEEEEECCCEEEEEECCCCCEEEECCCCCCEEEEEEECCCCEEEEEECCCEEEEEEEE
T ss_conf             65416999899999999948996999989999799992699987999992799999999089969999778
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2bgra1 b.70.3.1 (A:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2bgra1 b.70.3.1 (A:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]} Back     information, alignment and structure
>d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]} Back     information, alignment and structure
>d2hqsa1 b.68.4.1 (A:163-431) TolB, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q1sc_ a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1q1sc_ a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1wa5b_ a.118.1.1 (B:) Karyopherin alpha {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1xfda1 b.70.3.1 (A:127-591) Dipeptidyl aminopeptidase-like protein 6, DPP6, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xqra1 a.118.1.21 (A:87-350) Hsp70-binding protein 1 (HspBP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1wa5b_ a.118.1.1 (B:) Karyopherin alpha {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1xqra1 a.118.1.21 (A:87-350) Hsp70-binding protein 1 (HspBP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k32a2 b.68.7.1 (A:39-319) Tricorn protease N-terminal domain {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1xfda1 b.70.3.1 (A:127-591) Dipeptidyl aminopeptidase-like protein 6, DPP6, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xm9a1 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xm9a1 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Back     information, alignment and structure
>d1k32a2 b.68.7.1 (A:39-319) Tricorn protease N-terminal domain {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d2hqsa1 b.68.4.1 (A:163-431) TolB, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1kb0a2 b.70.1.1 (A:1-573) Quinoprotein alcohol dehydrogenase, N-terminal domain {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d2ad6a1 b.70.1.1 (A:1-571) Methanol dehydrogenase, heavy chain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1utca2 b.69.6.1 (A:4-330) Clathrin heavy-chain terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure