Citrus Sinensis ID: 001523

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------1000------1010------1020------1030------1040------1050------1060

MDSPSPFRKIDVVSLVPVHKVPNYDKKDGTSFFSFSLKWWSLFVSSFELFFINSLQQAACSSADGRQLLESSKTALDKGKLEDAVTYGTKALAKLVAVCGPYHRMTAGAYSLLAVVLYHTGDFNQATIYQQKALDINERELGLDHPDTMKSYGDLAVFYYRLQHTELALKYVKRALYLLHLTCGPSHPNTAATYINVAMMEEGLGNVHVALRYLHKALKCNQRLLGPDHIQTAASYHAIAIALSLMEAYPLSVQHEQTTLQILRAKLGPDDLRTQDAAAWLEYFESKAFEQQEAARNGTRKPDASIASKGHLSVSDLLDYINPSHDTKGRNVSTLKRKTYVAKVKGNFYQDNNLTSPDGSSKEVLRESSDEETHAPEPESDTDVNQGSSIPFQQQELVVEESAVEKPNITEEISSAIHEEGDDGWQPVQRLRSAGSYGRRLKQRRATIGKVHSYQKRNADAVIDYSSAKSSHHSSRYYLLKKRAVSHGSSADHHPVTTFHGTKFGRRVVKAVAYRVKSMPSSAKTGTVEASINGSEPSSSPSESRPASAPNDTSSVKNSIISLGKSPSYKEVAVAPPGTIAMLQVRVPQSDNPDNQEFSFGKPEDGTMEEKENVNTNVTGAEKTNEEKSDSVLDATDNLKEETGVHPNREETHISDGLEDNPSVVVSESERGVGSVVDIHKVVQDGILINGIPNSIDSPTSEFYEKDSSESIESHDNTKSTLQVVDDLKEKPSVFNPGDTRGLPNRKLSASAVPFNPSPAVARASAVAINMTLPPGPGAVTAVAPWPVNMTLHPRPATVLPTVNPMCSSPHQPYPSPPSTPNMMQPLPFMYPPYTQPQGVPTSTFPVTTSAFHHNHFSWQCNGNSNVPEFIPGPFLPGYHPMEFSVPPPVVEPILDPIMQPKAQSGDLDSSCSASILPENIDAVGDAEKEVDLLASKSMDNANEVAGIGRETVRGEFVKENGHLNLCGTENAGSEPVHFTSQNQSLRRNVEREIEGEKTFSILVRGRRNRKQTLRIPISLLSRPYGSQSFKVIYNRVIRGSEAPKSFSFSSTGDSTATAV

ccccccHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHcHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHccccccccccccccccccccccccccccHHHHHHHHcccccHHHHHHHHccccccccccccccccccccccccccccccccccccccccccHHHHHHHccccccccccHHHHHHHcccccccccccccccccccccHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccHHccccccccccHHHcccccEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEEEccccccccccccccccccccccccEEEEEEEEccccccccccccccccccccccc

cccccccccHHHHHHHHHHHHHHHHHHHHHcccHHHcHHHHHHHHHHHHHHccccccHHHcHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccHcHHHcccccccHHHHHHccHHHHHHccccHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHcccEEEcccccHHHHccccccccccccEcccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHccHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccEEcccccccccccccccccccccccccccccccccHcccccccccccEccccccccccEEEEcccccEEEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEccccEcccccccccEEccccccEcccccccccccccccccEcccccccccccccccccccccccccccEEEEEEEEccccccEEEEcEEEHcccccccccEEEEEEEEEEcccccccccHccccccccccc

mdspspfrkidvvslvpvhkvpnydkkdgtsffsFSLKWWSLFVSSFELFFINSLQQAACSSADGRQLLESSKtaldkgkledAVTYGTKALAKLVAVCGPYHRMTAGAYSLLAVVLYHtgdfnqatIYQQKALdinerelgldhpdtmksyGDLAVFYYRLQHTELALKYVKRALYLLHltcgpshpntaATYINVAMMEEGLGNVHVALRYLHKALKcnqrllgpdhiQTAASYHAIAIALSLMEAYPLSVQHEQTTLQILRAklgpddlrTQDAAAWLEYFESKAFEQQEAarngtrkpdasiaskghlsvsdlldyinpshdtkgrnvstlkRKTYVAKVKgnfyqdnnltspdgsskevlressdeethapepesdtdvnqgssipfqqqELVVEesavekpnitEEISSAIheegddgwqpvqRLRSAGSYGRRLKQRRATIGKVhsyqkrnadavidyssaksshhssRYYLLKKRAvshgssadhhpvttfhgtkfGRRVVKAVAYRVksmpssaktgtveasingsepssspsesrpasapndtssvKNSIislgkspsykevavappgtiamlqvrvpqsdnpdnqefsfgkpedgtmeekenvntnvtgaektneeksdsvLDATDNlkeetgvhpnreethisdglednpsvvvsesergvgsvvdIHKVVqdgilingipnsidsptsefyekdssesieshdntksTLQVVDdlkekpsvfnpgdtrglpnrklsasavpfnpspaVARASAVAInmtlppgpgavtavapwpvnmtlhprpatvlptvnpmcssphqpypsppstpnmmqplpfmyppytqpqgvptstfpvttsafhhnhfswqcngnsnvpefipgpflpgyhpmefsvpppvvepildpimqpkaqsgdldsscsasilpenidavgdAEKEVDLLASKSMDNAnevagigretvrgefvkenghlnlcgtenagsepvhftsqnqsLRRNVEREIEGEKTFSILVRGrrnrkqtlripisllsrpygsqsfKVIYNRvirgseapksfsfsstgdstatav

mdspspfrkidvvslvpvhkvpnydkkdgtSFFSFSLKWWSLFVSSFELFFINSLQQAACSSADGRQLLESSktaldkgkledAVTYGTKALAKLVAVCGPYHRMTAGAYSLLAVVLYHTGDFNQATIYQQKALDINERELGLDHPDTMKSYGDLAVFYYRLQHTELALKYVKRALYLLHLTCGPSHPNTAATYINVAMMEEGLGNVHVALRYLHKALKCNQRLLGPDHIQTAASYHAIAIALSLMEAYPLSVQHEQTTLQILRAKLGPDDLRTQDAAAWLEYFESKAFEQQEAarngtrkpdasiaskghlsVSDLLDYINPshdtkgrnvstlkrktyvakvkgnfyqdnnltspdgsskEVLRESSDeethapepesdtdvnqgssIPFQQQELVVEESAVEKPNITEEISSaiheegddgwqpvQRLRSagsygrrlkqrratigkvhsyqkrnadavidyssaksshHSSRYYLLKKRAVSHgssadhhpvttfhgtkfgrRVVKAVAYRVksmpssaktgtveasingsepssspsesrpasapndtssVKNSIISLGKSPSYKEVAVAPPGTIAMLQVRVPQSDNPDNQEFsfgkpedgtmeekENVNtnvtgaektneeksdsvlDATDNLkeetgvhpnreethisdglednpsVVVSEsergvgsvvdIHKVVqdgilingipnsidsptSEFYEKDssesieshdntkstlqvvddlkekpsvfnpgdtrglpnRKLSASAVPFNPSPAVARASAVAINMTLPPGPGAVTAVAPWPVNMTLHPRPATVLPTVNPMCSSPHQPYPSPPSTPNMMQPLPFMYPPYTQPQGVPTSTFPVTTSAFHHNHFSWQCNGNSNVPEFIPGPFLPGYHPMEFSVPPPVVEPILDPIMQPKAQSGDLDSSCSASILPENIDAVGDAEKEVDLLASKSMDNANEVAGIGRETVRGEFVKENGHLNLCgtenagsepvhftsqnqslrrnvereiegektfsilvrgrrnrkqtlripisllsrpygsqsFKVIYNRVIRGseapksfsfsstgdstatav

MDSPSPFRKIDVVSLVPVHKVPNYDKKDGTsffsfslkwwslfvssfELFFINSLQQAACSSADGRQLLESSKTALDKGKLEDAVTYGTKALAKLVAVCGPYHRMTAGAYSLLAVVLYHTGDFNQATIYQQKALDINERELGLDHPDTMKSYGDLAVFYYRLQHTELALKYVKRALYLLHLTCGPSHPNTAATYINVAMMEEGLGNVHVALRYLHKALKCNQRLLGPDHIQTAASYHAIAIALSLMEAYPLSVQHEQTTLQILRAKLGPDDLRTQDAAAWLEYFESKAFEQQEAARNGTRKPDASIASKGHLSVSDLLDYINPSHDTKGRNVSTLKRKTYVAKVKGNFYQDNNLTSPDGSSKEVLRESSDEETHAPEPESDTDVNQGSSIPFQQQELVVEESAVEKPNITEEISSAIHEEGDDGWQPVQRLRSAGSYGRRLKQRRATIGKVHSYQKRNADAVIDYssaksshhssRYYLLKKRAVSHGSSADHHPVTTFHGTKFGrrvvkavayrvkSMPSSAKTGTVEASINGsepssspsesrpasapNDTSSVKNSIISLGKSPSYKEVAVAPPGTIAMLQVRVPQSDNPDNQEFSFGKPEDGTMEEKENVNTNVTGAEKTNEEKSDSVLDATDNLKEETGVHPNREETHISDGLEDNPsvvvsesergvgsvvDIHKVVQDGILINGIPNSIDSPTSEFYEKDSSESIESHDNTKSTLQVVDDLKEKPSVFNPGDTRGLPNRKLSASAVPFNpspavarasavaINMTLppgpgavtavapwpvNMTLHPRPATVLPTVNPMCssphqpypsppstpNMMQPLPFMYPPYTQPQGVPTSTFPVTTSAFHHNHFSWQCNGNSNVPEFIPGPFLPGYHPMEFSVPPPVVEPILDPIMQPKAQSGDLDSSCSASILPENIDAVGDAEKEVDLLASKSMDNANEVAGIGRETVRGEFVKENGHLNLCGTENAGSEPVHFTSQNQSLRRNVEREIEGEKTFSILVRGRRNRKQTLRIPISLLSRPYGSQSFKVIYNRVIRGSEAPKSFSFSSTGDSTATAV

********KIDVVSLVPVHKVPNYDKKDGTSFFSFSLKWWSLFVSSFELFFINSLQQAAC*******************KLEDAVTYGTKALAKLVAVCGPYHRMTAGAYSLLAVVLYHTGDFNQATIYQQKALDINERELGLDHPDTMKSYGDLAVFYYRLQHTELALKYVKRALYLLHLTCGPSHPNTAATYINVAMMEEGLGNVHVALRYLHKALKCNQRLLGPDHIQTAASYHAIAIALSLMEAYPLSVQHEQTTLQILRAKLGPDDLRTQDAAAWLEYFE*******************************LLDYI*************LKRKTYVAKVKGNFY*******************************************************************************************************************************YYLLKK***********HPVTTFHGTKFGRRVVKAVAYRV************************************************************************************************************************************************************VGSVVDIHKVVQDGILINGIP************************************************************************AVAINMTLPPGPGAVTAVAPWPVNMTLHPRPATVL*****************************************TSTFPVTTSAFHHNHFSWQCNGNSNVPEFIPGPFLPGYHPMEFSVPPPVVEPIL****************************************************IGRETVRGEFVKENGHLNLCG******************************TFSILVRGRRNRKQTLRIPISLLSRPYGSQSFKVIYNRVIR*********************

****SPFRKIDVVSLVPVHKVPNYDKKDGTSFFSFSLKWWSLFVSSFELFFINSLQQAACSSADGRQLLESSKTALDKGKLEDAVTYGTKALAKLVAVCGPYHRMTAGAYSLLAVVLYHTGDFNQATIYQQKALDINERELGLDHPDTMKSYGDLAVFYYRLQHTELALKYVKRALYLLHLTCGPSHPNTAATYINVAMMEEGLGNVHVALRYLHKALKCNQRLLGPDHIQTAASYHAIAIALSLMEAYPLSVQHEQTTLQILRAKLGPDDLRTQDAAAWLEYFESKAFEQQEAARNGTRKP***IASKGHLSVSDLLDYINPSHDTKGRNVSTLKRKT************************************************************************************************************************************************************************************************************************************SYKEVAVAPPGTIAM****************************************************************************************************************************************************************************FNPSPAVARASAVA*****PPGPGAVTAVAPWPVNMTLHPR******************YPSPPSTPNMMQP******************************FSWQCNGNSNVPEFIPGPFLPGY**************************************************************************************************************************IL**********LRIPISLLSRPYGSQSFKVIYNRVIRGSEA*****************

********KIDVVSLVPVHKVPNYDKKDGTSFFSFSLKWWSLFVSSFELFFINSLQQAACSSADGRQLLESSKTALDKGKLEDAVTYGTKALAKLVAVCGPYHRMTAGAYSLLAVVLYHTGDFNQATIYQQKALDINERELGLDHPDTMKSYGDLAVFYYRLQHTELALKYVKRALYLLHLTCGPSHPNTAATYINVAMMEEGLGNVHVALRYLHKALKCNQRLLGPDHIQTAASYHAIAIALSLMEAYPLSVQHEQTTLQILRAKLGPDDLRTQDAAAWLEYFESKAFE***************IASKGHLSVSDLLDYINPSHDTKGRNVSTLKRKTYVAKVKGNFYQDNNLTS******************************GSSIPFQQQELVVEESAVEKPNITEEISSAIHEEGDDGWQPVQRLRSAGSYGRRLKQRRATIGKVHSYQKRNADAVIDY*********SRYYLLKKR*********HHPVTTFHGTKFGRRVVKAVAYRVK***************************************KNSIISLGKSPSYKEVAVAPPGTIAMLQVRVPQSDNPDNQEFSFGKPEDGTMEEKENVNTNVTGAEKTNEEKSDSVLDATDNLKEETGVHPNREETHISDGLEDNPSVVVSESERGVGSVVDIHKVVQDGILINGIPNSIDSP*******************KSTLQVVDDLKEKPSVFNPGDTRGLPNRKLSASAVPFNPSPAVARASAVAINMTLPPGPGAVTAVAPWPVNMTLHPRPATVLPTVNPM************STPNMMQPLPFMYPPYTQPQGVPTSTFPVTTSAFHHNHFSWQCNGNSNVPEFIPGPFLPGYHPMEFSVPPPVVEPILDPIMQPK*********CSASILPENIDAVGDAEKEVDLLASKSMDNANEVAGIGRETVRGEFVKENGHLNLCGTENAGSEPVHFTSQNQSLRRNVEREIEGEKTFSILVRGRRNRKQTLRIPISLLSRPYGSQSFKVIYNRVIRGSEAPK***************

MDSPSPFRKIDVVSLVPVHKVPNYDKKDGTSFFSFSLKWWSLFVSSFELFFINSLQQAACSSADGRQLLESSKTALDKGKLEDAVTYGTKALAKLVAVCGPYHRMTAGAYSLLAVVLYHTGDFNQATIYQQKALDINERELGLDHPDTMKSYGDLAVFYYRLQHTELALKYVKRALYLLHLTCGPSHPNTAATYINVAMMEEGLGNVHVALRYLHKALKCNQRLLGPDHIQTAASYHAIAIALSLMEAYPLSVQHEQTTLQILRAKLGPDDLRTQDAAAWLEYFESKAFEQQEAARNGTRKPDASIASKGHLSVSDLLDYINPSHDTKGRNVSTLKRKTYVAKVKGNFYQDNNLTSPDGSSKEVLRESSDEETHAPEPES*******************************************************************IGKVHSYQKRNADAVIDYS**************************************************************************************************KSPSYKEVAVAPPGTIAMLQVRVP************************************************************************************************************************************************************************PSPAVARASAVAINMTLPPGPGAVTAVAPWPVNMTLHPRPATVLPTVNPMCSSPHQPYPSPPSTPNMMQPLPFMYPPYTQPQGVPTSTFPVTTSAFHHNHFSWQCNGNSNVPEFIPGPFLPGYHPMEFSVPPPVVEPILD***************************************************************************************************GEKTFSILVRGRRNRKQTLRIPISLLSRPYGSQSFKVIYNRVIRGS*******************

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		1060	2.2.26 [Sep-21-2011]
F4J5S1		1407	Clustered mitochondria pr	no	no	0.223	0.168	0.497	4e-58
O15818		1320	Clustered mitochondria pr	yes	no	0.243	0.195	0.320	8e-29
Q7PZD5		1463	Clustered mitochondria pr	yes	no	0.246	0.178	0.307	2e-27
B4MY63		1441	Protein clueless OS=Droso	N/A	no	0.246	0.181	0.294	3e-27
B4JW99		1494	Protein clueless OS=Droso	N/A	no	0.217	0.154	0.290	4e-26
B4KT50		1487	Protein clueless OS=Droso	N/A	no	0.217	0.155	0.294	4e-26
B4GAM1		1435	Protein clueless OS=Droso	N/A	no	0.217	0.160	0.294	4e-26
Q291J5		1435	Protein clueless OS=Droso	yes	no	0.217	0.160	0.294	5e-26
B4LQ23		1465	Protein clueless OS=Droso	N/A	no	0.217	0.157	0.294	7e-26
B3MIW0		1450	Protein clueless OS=Droso	N/A	no	0.246	0.18	0.283	8e-26

>sp\|F4J5S1\|CLU_ARATH Clustered mitochondria protein OS=Arabidopsis thaliana GN=FMT PE=2 SV=1	Back alignment and function desciption

 Score =  227 bits (578), Expect = 4e-58,   Method: Compositional matrix adjust.
 Identities = 119/239 (49%), Positives = 158/239 (66%), Gaps = 2/239 (0%)

Query: 60   CSSADGRQLLESSKTALDKGKLEDAVTYGTKALAKLVAVCGPYHRMTAGAYSLLAVVLYH 119
            CS A  + L+E  K  L +G L ++ T+ ++A + L  V GP HR  A     LA+VLYH
Sbjct: 1022 CSEA--KDLVEMGKVQLAEGMLSESYTFFSEAFSILQQVTGPMHREVANCCRYLAMVLYH 1079

Query: 120  TGDFNQATIYQQKALDINERELGLDHPDTMKSYGDLAVFYYRLQHTELALKYVKRALYLL 179
             GD   A + Q K L INER LGLDHPDT  SYG++A+FY+ L  TELAL+ + RAL LL
Sbjct: 1080 AGDMAGAIMQQHKELIINERCLGLDHPDTAHSYGNMALFYHGLNQTELALQNMGRALLLL 1139

Query: 180  HLTCGPSHPNTAATYINVAMMEEGLGNVHVALRYLHKALKCNQRLLGPDHIQTAASYHAI 239
             L+ GP HP+ AAT+INVAMM + +G +  ALRYL +ALK N+RLLGP+HIQTA  YHA+
Sbjct: 1140 GLSSGPDHPDVAATFINVAMMYQDMGKMDTALRYLQEALKKNERLLGPEHIQTAVCYHAL 1199

Query: 240  AIALSLMEAYPLSVQHEQTTLQILRAKLGPDDLRTQDAAAWLEYFESKAFEQQEAARNG 298
            AIA + M A+ LS QHE+ T  IL  +LG DD RT+D+  W++ F+ +  +     + G
Sbjct: 1200 AIAFNCMGAFKLSHQHEKKTYDILVKQLGDDDSRTRDSLNWMKTFKMRELQMTAQKQKG 1258

Involved in proper cytoplasmic distribution of mitochondria.
Arabidopsis thaliana (taxid: 3702)

>sp\|O15818\|CLU_DICDI Clustered mitochondria protein homolog OS=Dictyostelium discoideum GN=clua PE=1 SV=2	Back alignment and function description

>sp\|Q7PZD5\|CLU_ANOGA Clustered mitochondria protein homolog OS=Anopheles gambiae GN=AGAP011851 PE=3 SV=4	Back alignment and function description

>sp\|B4MY63\|CLU_DROWI Protein clueless OS=Drosophila willistoni GN=clu PE=3 SV=1	Back alignment and function description

>sp\|B4JW99\|CLU_DROGR Protein clueless OS=Drosophila grimshawi GN=clu PE=3 SV=1	Back alignment and function description

>sp\|B4KT50\|CLU_DROMO Protein clueless OS=Drosophila mojavensis GN=clu PE=3 SV=1	Back alignment and function description

>sp\|B4GAM1\|CLU_DROPE Protein clueless OS=Drosophila persimilis GN=clu PE=3 SV=1	Back alignment and function description

>sp\|Q291J5\|CLU_DROPS Protein clueless OS=Drosophila pseudoobscura pseudoobscura GN=clu PE=3 SV=2	Back alignment and function description

>sp\|B4LQ23\|CLU_DROVI Protein clueless OS=Drosophila virilis GN=clu PE=3 SV=1	Back alignment and function description

>sp\|B3MIW0\|CLU_DROAN Protein clueless OS=Drosophila ananassae GN=clu PE=3 SV=1	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		1060
255564713		1872	eukaryotic translation initiation factor	0.948	0.536	0.646	0.0
359489732		1863	PREDICTED: protein KIAA0664 homolog [Vit	0.943	0.536	0.646	0.0
356520282		1840	PREDICTED: uncharacterized protein LOC10	0.937	0.540	0.608	0.0
356560227		1846	PREDICTED: protein TIF31 homolog [Glycin	0.939	0.539	0.603	0.0
449487415		1856	PREDICTED: LOW QUALITY PROTEIN: uncharac	0.921	0.526	0.594	0.0
358349301		1350	hypothetical protein MTR_139s0028 [Medic	0.932	0.731	0.574	0.0
449445826		1856	PREDICTED: uncharacterized protein LOC10	0.921	0.526	0.594	0.0
42561588		1797	tetratricopeptide repeat-containing prot	0.856	0.505	0.534	0.0
9665146		1483	Unknown protein [Arabidopsis thaliana]	0.849	0.606	0.531	0.0
297842986		1793	tetratricopeptide repeat-containing prot	0.863	0.510	0.537	0.0

>gi\|255564713\|ref\|XP_002523351.1\| eukaryotic translation initiation factor 3 subunit, putative [Ricinus communis] gi\|223537439\|gb\|EEF39067.1\| eukaryotic translation initiation factor 3 subunit, putative [Ricinus communis]	Back alignment and taxonomy information

 Score = 1299 bits (3361), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 686/1061 (64%), Positives = 802/1061 (75%), Gaps = 56/1061 (5%)

Query: 1    MDSPSPFRKIDVVSLVPVHKVPNYDKKDGTSFFSFSLKWWSLFVSSFELFFINSLQQAAC 60
            MDSP PFRK D+VSLVPVHK                                    QAAC
Sbjct: 865  MDSPHPFRKSDIVSLVPVHK------------------------------------QAAC 888

Query: 61   SSADGRQLLESSKTALDKGKLEDAVTYGTKALAKLVAVCGPYHRMTAGAYSLLAVVLYHT 120
            SSADGRQLLESSKTALDKGKLEDAVTYGTKALAKLVAVCGPYHRMTAGAYSLLAVVLYHT
Sbjct: 889  SSADGRQLLESSKTALDKGKLEDAVTYGTKALAKLVAVCGPYHRMTAGAYSLLAVVLYHT 948

Query: 121  GDFNQATIYQQKALDINERELGLDHPDTMKSYGDLAVFYYRLQHTELALKYVKRALYLLH 180
            GDFNQATIYQQKALDINERELGLDHPDTMKSYGDLAVFYYRLQHTELALKYVKRALYLLH
Sbjct: 949  GDFNQATIYQQKALDINERELGLDHPDTMKSYGDLAVFYYRLQHTELALKYVKRALYLLH 1008

Query: 181  LTCGPSHPNTAATYINVAMMEEGLGNVHVALRYLHKALKCNQRLLGPDHIQTAASYHAIA 240
            LTCGPSHPNTAATYINVAMMEEGLGNVH+ALRYLHKALKCNQRLLGPDHIQTAASYHAIA
Sbjct: 1009 LTCGPSHPNTAATYINVAMMEEGLGNVHIALRYLHKALKCNQRLLGPDHIQTAASYHAIA 1068

Query: 241  IALSLMEAYPLSVQHEQTTLQILRAKLGPDDLRTQDAAAWLEYFESKAFEQQEAARNGTR 300
            IALSLMEAYPLSVQHEQTTLQILRAKLGPDDLRTQDAAAWLEYFESKAFEQQEAARNGTR
Sbjct: 1069 IALSLMEAYPLSVQHEQTTLQILRAKLGPDDLRTQDAAAWLEYFESKAFEQQEAARNGTR 1128

Query: 301  KPDASIASKGHLSVSDLLDYINPSHDTKGRNVSTLKRKTYVAKVKGNFYQDNNLTSPDGS 360
            KPDASIASKGHLSVSDLLDYINPS DTKGR+  +++RK+Y+AK+K      ++L S + S
Sbjct: 1129 KPDASIASKGHLSVSDLLDYINPSRDTKGRDFVSVRRKSYIAKMKEKTNPVSDLPSSNES 1188

Query: 361  SKEVLRESSDEETHAPEPESDTDVNQGSSIPFQQQELVVEESAVEKPNITEEISSAIHEE 420
             +E+ +E+ DEETH P    +T     SS   Q Q+ +VEE+A +K  I  E+   I  E
Sbjct: 1189 PQEIPQEAIDEETHMPIASQET-----SSTQVQFQQPIVEETADKKSGIVSEVLPEILAE 1243

Query: 421  GDDGWQPVQRLRSAGSYGRRLKQRRATIGKVHSYQKRNADAVIDYSSAKSSHHSSRYYLL 480
            GDDGWQPVQR RSAGSYGRRLKQRR  I KV  YQK+  DA +DY   K++H ++RYYLL
Sbjct: 1244 GDDGWQPVQRPRSAGSYGRRLKQRRGIISKV--YQKKIVDANMDYPPVKNTHQNNRYYLL 1301

Query: 481  KKRAVSHGSSADHHPVTTFHGTKFGRRVVKAVAYRVKSMPSSAKTGTVEASINGSEPSSS 540
            KKR +SHGS  DHH      GTKFGRR+VKAV YRVKS+PS  KT   E S +G +  SS
Sbjct: 1302 KKRPLSHGSYVDHHASNPSQGTKFGRRIVKAVTYRVKSIPSVNKTAPTENSKSGVKTFSS 1361

Query: 541  PSESRPASAPNDTSSVKNSIISLGKSPSYKEVAVAPPGTIAMLQVRVPQSDNPDNQEFSF 600
              ES   SA +D   VK+S++SLGKSPSYKEVA+APPGTIA  QV +PQ+DN DN++   
Sbjct: 1362 -LESAQLSASSDAGQVKSSVVSLGKSPSYKEVALAPPGTIAKFQVWLPQNDNSDNKDIGV 1420

Query: 601  GKPEDGTMEEKENVNTNVTG-AEKTNEEKSDSVLDATDNLKEETGVHPNREETHISDGLE 659
            G  ++ T+E  EN +  VT  A+K N   +DS     D+LK+ T V   +E++  ++  E
Sbjct: 1421 GGSKEETIEAIENASEVVTVLADKDNSSATDS----NDHLKDVTDVIEEKEDSQSNNAKE 1476

Query: 660  DNPSVVVSESERGVGSVVDIHKVVQDGILINGIPNSIDSPTSE-FYEKDSSESIESHDNT 718
            +N  +V  ++      +V++H V+Q+ I I+ IPNSID P+ E  +EKDS+   E   N+
Sbjct: 1477 ENALMVARKTIESESGIVEVHGVMQNSISIDRIPNSIDFPSKEPPFEKDSAGEFEPQCNS 1536

Query: 719  KSTLQVVDDLKEKPSVFNPGDTRGLPNRKLSASAVPFNPSPAVARASAVAINMTLPPGPG 778
              T   V+DL+++    + G+TRGLPN+KLSASA PFNPSP++ARA+ V++N++LPPGPG
Sbjct: 1537 NPTSPEVEDLRDRSLATSSGETRGLPNKKLSASAAPFNPSPSIARAAPVSMNISLPPGPG 1596

Query: 779  AVTAVAPWPVNMTLHPRPATVLPTVNPMCSSPHQPYPSPPSTPNMMQPLPFMYPPYTQPQ 838
            +V AVAPWPVNMTLHP PATVLP V+PM  SPH PYPSPP+TPNMMQPLPF+YPPY+Q Q
Sbjct: 1597 SVPAVAPWPVNMTLHPGPATVLPPVSPM-PSPHHPYPSPPATPNMMQPLPFIYPPYSQSQ 1655

Query: 839  GVPTSTFPVTTSAFHHNHFSWQCNGNSNVPEFIPGPFLPGYHPMEFSVPPPVVEPILDPI 898
             VPTSTFPVT++AFH NHFSWQCN N  V EFIP    PG H MEFSV PPV EPI D  
Sbjct: 1656 AVPTSTFPVTSNAFHPNHFSWQCNVNHRVNEFIPSTIWPGCHGMEFSVLPPVTEPIPDSA 1715

Query: 899  MQPKAQSGDLDSSCSASILPENIDAVGDAEKEVDLLASKSMDNANEVAGIGRETVRGEFV 958
            ++PK Q  +  S+    +LP +I  V +A++EV+LLA ++ DNAN++AG     VR E V
Sbjct: 1716 LEPKVQFENPGSASPPPVLPADIVNVEEAKREVNLLAPEATDNANDLAG-----VRLENV 1770

Query: 959  KENGHLNLCGTENAGSEPVHFTSQNQSLRRNVEREIEGEKTFSILVRGRRNRKQTLRIPI 1018
            KENGH NL   E +G++  H+ S  +      ER+I+GEKTFSIL+RGRRNRKQTLR+PI
Sbjct: 1771 KENGHSNLGEVEISGNDSSHYKSFKKDGSNTDERKIDGEKTFSILIRGRRNRKQTLRMPI 1830

Query: 1019 SLLSRPYGSQSFKVIYNRVIRGSEAPKSFSFSSTGDSTATA 1059
            SLL+RPYGSQSFKVIYNRV+RGSEAPKS  F S  D TA+A
Sbjct: 1831 SLLNRPYGSQSFKVIYNRVVRGSEAPKSTCFPSAKDCTASA 1871

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|359489732\|ref\|XP_002278370.2\| PREDICTED: protein KIAA0664 homolog [Vitis vinifera]	Back alignment and taxonomy information

>gi\|356520282\|ref\|XP_003528792.1\| PREDICTED: uncharacterized protein LOC100808136 [Glycine max]	Back alignment and taxonomy information

>gi\|356560227\|ref\|XP_003548395.1\| PREDICTED: protein TIF31 homolog [Glycine max]	Back alignment and taxonomy information

>gi\|449487415\|ref\|XP_004157615.1\| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC101229361 [Cucumis sativus]	Back alignment and taxonomy information

>gi\|358349301\|ref\|XP_003638677.1\| hypothetical protein MTR_139s0028 [Medicago truncatula] gi\|355504612\|gb\|AES85815.1\| hypothetical protein MTR_139s0028 [Medicago truncatula]	Back alignment and taxonomy information

>gi\|449445826\|ref\|XP_004140673.1\| PREDICTED: uncharacterized protein LOC101210514 [Cucumis sativus]	Back alignment and taxonomy information

>gi\|42561588\|ref\|NP_171639.3\| tetratricopeptide repeat-containing protein [Arabidopsis thaliana] gi\|332189150\|gb\|AEE27271.1\| tetratricopeptide repeat-containing protein [Arabidopsis thaliana]	Back alignment and taxonomy information

>gi\|9665146\|gb\|AAF97330.1\|AC023628_11 Unknown protein [Arabidopsis thaliana]	Back alignment and taxonomy information

>gi\|297842986\|ref\|XP_002889374.1\| tetratricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] gi\|297335216\|gb\|EFH65633.1\| tetratricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		1060
TAIR\|locus:2035327		1797	AT1G01320 [Arabidopsis thalian	0.646	0.381	0.590	3.4e-247
TAIR\|locus:2037783		1608	AT1G15290 [Arabidopsis thalian	0.371	0.245	0.629	3.1e-138
UNIPROTKB\|B4MY63		1441	clu "Protein clueless" [Drosop	0.246	0.181	0.291	9.6e-23
UNIPROTKB\|B4JW99		1494	clu "Protein clueless" [Drosop	0.306	0.217	0.260	1.6e-22
UNIPROTKB\|B3MIW0		1450	clu "Protein clueless" [Drosop	0.308	0.225	0.255	5.5e-22
UNIPROTKB\|B4LQ23		1465	clu "Protein clueless" [Drosop	0.312	0.225	0.263	5.5e-22
UNIPROTKB\|B4GAM1		1435	clu "Protein clueless" [Drosop	0.246	0.181	0.283	6.9e-22
UNIPROTKB\|Q291J5		1435	clu "Protein clueless" [Drosop	0.246	0.181	0.283	6.9e-22
DICTYBASE\|DDB_G0292806		1320	cluA "CluA protein" [Dictyoste	0.327	0.262	0.278	6.9e-22
UNIPROTKB\|B4KT50		1487	clu "Protein clueless" [Drosop	0.246	0.175	0.287	7.2e-22

TAIR\|locus:2035327 AT1G01320 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 1906 (676.0 bits), Expect = 3.4e-247, Sum P(4) = 3.4e-247
 Identities = 432/731 (59%), Positives = 505/731 (69%)

Query:    50 FFINSLQQAACSSADGRQLLESSKTALDKGKLEDAVTYGTKALAKLVAVCGPYHRMTAGA 109
             F+  S+QQAACSSADGRQLLESSKTALDKGKLEDAVTYGTKALAKLVAVCGPYHRMTAGA
Sbjct:   865 FYFKSMQQAACSSADGRQLLESSKTALDKGKLEDAVTYGTKALAKLVAVCGPYHRMTAGA 924

Query:   110 YSLLAVVLYHTGDFNQATIYQQKALDINERELGLDHPDTMKSYGDLAVFYYRLQHTELAL 169
             YSLLAVVLYHTGDFNQATIYQQKALDINERELGLDHPDTMKSYGDLAVFYYRLQHTELAL
Sbjct:   925 YSLLAVVLYHTGDFNQATIYQQKALDINERELGLDHPDTMKSYGDLAVFYYRLQHTELAL 984

Query:   170 KYVKRALYLLHLTCGPSHPNTAATYINVAMMEEGLGNVHVALRYLHKALKCNQRLLGPDH 229
             KYVKRALYLLHLTCGPSHPNTAATYINVAMMEEGLGNVHVALRYLHKALKCNQRLLGPDH
Sbjct:   985 KYVKRALYLLHLTCGPSHPNTAATYINVAMMEEGLGNVHVALRYLHKALKCNQRLLGPDH 1044

Query:   230 IQTAASYHAIAIALSLMEAYPLSVQHEQTTLQILRAKLGPDDLRTQDAAAWLEYFESKAF 289
             IQTAASYHAIAIALSLMEAY LSVQHEQTTL+ILRAKLGPDDLRTQDAAAWLEYFESKAF
Sbjct:  1045 IQTAASYHAIAIALSLMEAYHLSVQHEQTTLRILRAKLGPDDLRTQDAAAWLEYFESKAF 1104

Query:   290 EQQEAARNGTRKPDASIASKGHLSVSDLLDYINPSHDTKGRNVSTLKRKTYVAKVKGNFY 349
             EQQEAARNGT KPDASIASKGHLSVSDLLDYINPSH+ KG+     KRK Y+ K+K    
Sbjct:  1105 EQQEAARNGTPKPDASIASKGHLSVSDLLDYINPSHNAKGKESVAAKRKNYILKLKEKSK 1164

Query:   350 QDN---NLTS-PDGSSKEVLRESSDEETHAPEPESDTDVNQGSSIPFQQQEL--VVEESA 403
             Q N   +L   P    KE+  E + EET + E +S  + ++    P ++     V+E++ 
Sbjct:  1165 QSNVSEHLVEIPREKQKEMSEEDT-EETGSEEGKSSEENHETILAPVEEPPSPPVIEDAT 1223

Query:   404 VEKPN-ITE-EISSAI-HEEG-DDGWQPVQRLRSAGSYGRRLKQRRATIGKVHSYQKRNA 459
             ++  N IT  ++S+   H +G +DGWQPVQR RSAGSYGRR+KQRRA+IGKV++YQK+N 
Sbjct:  1224 MDNSNPITSSDVSTEPQHPDGSEDGWQPVQRPRSAGSYGRRMKQRRASIGKVYTYQKKNV 1283

Query:   460 DAVIDY-XXXXXXXXXXRYYLLKKRAVSHGSSADHH-PVTTFHGTKFGXXXXXXXXXXXX 517
             +A ID            +YY+LKKR  S+ S ADHH P  T  GTKFG            
Sbjct:  1284 EADIDNPLFQNATQQNDKYYILKKRTASYSSYADHHSPGLTTQGTKFGRKIVKTLAYRVK 1343

Query:   518 S-MPSS--AKTGTVEASINGXXXXXXXXX--XXXXXXXNDTSSVKNSIISLGKSPSYKEV 572
             S  PSS  AKT    +  +G                  ++    KNS++SLGKSPSYKEV
Sbjct:  1344 STQPSSGNAKTAGETSEEDGLKTDASSVEPPTLSSTVQSEAYHTKNSVVSLGKSPSYKEV 1403

Query:   573 AVAPPGTIAMLQVRVPQSDNPDNQEFSFGKPEDGTMEEKENVNTNVTGAEKTNEEKSDSV 632
             A+APPG+IA  QV VPQ++  D QE       D  ME+K    T++   E T +E+  + 
Sbjct:  1404 ALAPPGSIAKYQVWVPQAEVSDKQE-------DDEMEKKTEQGTSM---ELTRDEQMITG 1453

Query:   633 LDATDNLKEETGVHPNREETHISDGLEDNPXXXXXXXXXXXXXXXDIHKVVQDGILINGI 692
             L+  + +K+E    P   E++I+ G E+                  I++  + G    GI
Sbjct:  1454 LE--EEVKKEISADP---ESNITQGEEE--IKVELQPSEGVLGGSHINENDESG---GGI 1503

Query:   693 PNSIDSPTSEFYEKDSSESIESHDNTKSTLQVV---DDLKEKPSVF--NPGD-TRGL-PN 745
                 +    E      ++ I S    +   Q+    +DLK K S+   + GD +RGL PN
Sbjct:  1504 QVE-EQVEVELINDGVTDMIHSTREQQVIDQLAADSEDLKAKLSISTTDSGDASRGLLPN 1562

Query:   746 RKLSASAVPFN 756
             +KLSASA PFN
Sbjct:  1563 KKLSASAAPFN 1573

GO:0005737 "cytoplasm" evidence=ISM

GO:0016556 "mRNA modification" evidence=RCA

TAIR\|locus:2037783 AT1G15290 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

UNIPROTKB\|B4MY63 clu "Protein clueless" [Drosophila willistoni (taxid:7260)]	Back alignment and assigned GO terms

UNIPROTKB\|B4JW99 clu "Protein clueless" [Drosophila grimshawi (taxid:7222)]	Back alignment and assigned GO terms

UNIPROTKB\|B3MIW0 clu "Protein clueless" [Drosophila ananassae (taxid:7217)]	Back alignment and assigned GO terms

UNIPROTKB\|B4LQ23 clu "Protein clueless" [Drosophila virilis (taxid:7244)]	Back alignment and assigned GO terms

UNIPROTKB\|B4GAM1 clu "Protein clueless" [Drosophila persimilis (taxid:7234)]	Back alignment and assigned GO terms

UNIPROTKB\|Q291J5 clu "Protein clueless" [Drosophila pseudoobscura pseudoobscura (taxid:46245)]	Back alignment and assigned GO terms

DICTYBASE\|DDB_G0292806 cluA "CluA protein" [Dictyostelium discoideum (taxid:44689)]	Back alignment and assigned GO terms

UNIPROTKB\|B4KT50 clu "Protein clueless" [Drosophila mojavensis (taxid:7230)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		1060
pfam13424		78	pfam13424, TPR_12, Tetratricopeptide repeat	2e-15
pfam13424		78	pfam13424, TPR_12, Tetratricopeptide repeat	1e-13
pfam13424		78	pfam13424, TPR_12, Tetratricopeptide repeat	2e-12
cd00189		100	cd00189, TPR, Tetratricopeptide repeat domain; typ	2e-11
COG0457		291	COG0457, NrfG, FOG: TPR repeat [General function p	7e-10
COG0457		291	COG0457, NrfG, FOG: TPR repeat [General function p	2e-09
cd00189		100	cd00189, TPR, Tetratricopeptide repeat domain; typ	2e-08
pfam13374		42	pfam13374, TPR_10, Tetratricopeptide repeat	2e-08
COG0457		291	COG0457, NrfG, FOG: TPR repeat [General function p	3e-08
pfam13424		78	pfam13424, TPR_12, Tetratricopeptide repeat	8e-08
pfam13374		42	pfam13374, TPR_10, Tetratricopeptide repeat	5e-07
cd00189		100	cd00189, TPR, Tetratricopeptide repeat domain; typ	7e-07
pfam13414		69	pfam13414, TPR_11, TPR repeat	6e-05
pfam13908		177	pfam13908, Shisa, Wnt and FGF inhibitory regulator	1e-04
PRK10263		1355	PRK10263, PRK10263, DNA translocase FtsK; Provisio	6e-04
TIGR02521		234	TIGR02521, type_IV_pilW, type IV pilus biogenesis/	0.001
pfam13432		65	pfam13432, TPR_16, Tetratricopeptide repeat	0.003

>gnl\|CDD\|205602 pfam13424, TPR_12, Tetratricopeptide repeat	Back alignment and domain information

 Score = 71.6 bits (176), Expect = 2e-15
 Identities = 30/74 (40%), Positives = 47/74 (63%), Gaps = 1/74 (1%)

Query: 103 HRMTAGAYSLLAVVLYHTGDFNQATIYQQKALDINERELGLDHPDTMKSYGDLAVFYYRL 162
           H   A A + LA+VL   GD+++A    +KAL++  RELG DHP+T ++  +LA  Y  L
Sbjct: 1   HPDLAAALNNLALVLRRLGDYDEALELLEKALEL-ARELGEDHPETARALNNLARLYLAL 59

Query: 163 QHTELALKYVKRAL 176
              + AL+Y+++AL
Sbjct: 60  GDYDEALEYLEKAL 73

Length = 78

>gnl\|CDD\|205602 pfam13424, TPR_12, Tetratricopeptide repeat	Back alignment and domain information

>gnl\|CDD\|205602 pfam13424, TPR_12, Tetratricopeptide repeat	Back alignment and domain information

>gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here

Back alignment and domain information

>gnl\|CDD\|223533 COG0457, NrfG, FOG: TPR repeat [General function prediction only]	Back alignment and domain information

>gnl\|CDD\|223533 COG0457, NrfG, FOG: TPR repeat [General function prediction only]	Back alignment and domain information

Back alignment and domain information

>gnl\|CDD\|205553 pfam13374, TPR_10, Tetratricopeptide repeat	Back alignment and domain information

>gnl\|CDD\|223533 COG0457, NrfG, FOG: TPR repeat [General function prediction only]	Back alignment and domain information

>gnl\|CDD\|205602 pfam13424, TPR_12, Tetratricopeptide repeat	Back alignment and domain information

>gnl\|CDD\|205553 pfam13374, TPR_10, Tetratricopeptide repeat	Back alignment and domain information

Back alignment and domain information

>gnl\|CDD\|222112 pfam13414, TPR_11, TPR repeat	Back alignment and domain information

>gnl\|CDD\|222449 pfam13908, Shisa, Wnt and FGF inhibitory regulator	Back alignment and domain information

>gnl\|CDD\|236669 PRK10263, PRK10263, DNA translocase FtsK; Provisional	Back alignment and domain information

>gnl\|CDD\|131573 TIGR02521, type_IV_pilW, type IV pilus biogenesis/stability protein PilW	Back alignment and domain information

>gnl\|CDD\|222123 pfam13432, TPR_16, Tetratricopeptide repeat	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		1060
KOG1840		508	consensus Kinesin light chain [Cytoskeleton]	99.95
KOG4626		966	consensus O-linked N-acetylglucosamine transferase	99.88
KOG1840		508	consensus Kinesin light chain [Cytoskeleton]	99.87
KOG4626		966	consensus O-linked N-acetylglucosamine transferase	99.86
TIGR00990		615	3a0801s09 mitochondrial precursor proteins import	99.78
KOG1130		639	consensus Predicted G-alpha GTPase interaction pro	99.73
TIGR00990		615	3a0801s09 mitochondrial precursor proteins import	99.72
KOG2002		1018	consensus TPR-containing nuclear phosphoprotein th	99.72
KOG1126		638	consensus DNA-binding cell division cycle control	99.7
KOG1130		639	consensus Predicted G-alpha GTPase interaction pro	99.63
TIGR02521		234	type_IV_pilW type IV pilus biogenesis/stability pr	99.63
PRK11788		389	tetratricopeptide repeat protein; Provisional	99.63
PRK11788		389	tetratricopeptide repeat protein; Provisional	99.6
PRK15174		656	Vi polysaccharide export protein VexE; Provisional	99.59
TIGR02917		899	PEP_TPR_lipo putative PEP-CTERM system TPR-repeat	99.56
PRK15174		656	Vi polysaccharide export protein VexE; Provisional	99.55
PRK11447		1157	cellulose synthase subunit BcsC; Provisional	99.54
PRK11189		296	lipoprotein NlpI; Provisional	99.53
TIGR02917		899	PEP_TPR_lipo putative PEP-CTERM system TPR-repeat	99.52
COG3063		250	PilF Tfp pilus assembly protein PilF [Cell motilit	99.5
KOG1155		559	consensus Anaphase-promoting complex (APC), Cdc23	99.5
PRK11447		1157	cellulose synthase subunit BcsC; Provisional	99.49
PRK09782		987	bacteriophage N4 receptor, outer membrane subunit;	99.47
PRK12370		553	invasion protein regulator; Provisional	99.46
PRK12370		553	invasion protein regulator; Provisional	99.46
KOG1126		638	consensus DNA-binding cell division cycle control	99.45
KOG1839		1236	consensus Uncharacterized protein CLU1/cluA/TIF31	99.45
KOG0547		606	consensus Translocase of outer mitochondrial membr	99.44
KOG1155		559	consensus Anaphase-promoting complex (APC), Cdc23	99.43
TIGR03302		235	OM_YfiO outer membrane assembly lipoprotein YfiO.	99.43
TIGR02521		234	type_IV_pilW type IV pilus biogenesis/stability pr	99.42
PRK09782		987	bacteriophage N4 receptor, outer membrane subunit;	99.39
PRK11189		296	lipoprotein NlpI; Provisional	99.38
KOG1941		518	consensus Acetylcholine receptor-associated protei	99.38
PRK04841		903	transcriptional regulator MalT; Provisional	99.37
KOG1173		611	consensus Anaphase-promoting complex (APC), Cdc16	99.37
KOG1129		478	consensus TPR repeat-containing protein [General f	99.35
KOG2002		1018	consensus TPR-containing nuclear phosphoprotein th	99.34
COG3063		250	PilF Tfp pilus assembly protein PilF [Cell motilit	99.32
KOG1125		579	consensus TPR repeat-containing protein [General f	99.32
PRK10049		765	pgaA outer membrane protein PgaA; Provisional	99.32
KOG2003		840	consensus TPR repeat-containing protein [General f	99.31
KOG1941		518	consensus Acetylcholine receptor-associated protei	99.31
TIGR03302		235	OM_YfiO outer membrane assembly lipoprotein YfiO.	99.28
PRK10049		765	pgaA outer membrane protein PgaA; Provisional	99.28
cd05804		355	StaR_like StaR_like; a well-conserved protein foun	99.27
KOG2003		840	consensus TPR repeat-containing protein [General f	99.27
KOG1125		579	consensus TPR repeat-containing protein [General f	99.25
PF14938		282	SNAP: Soluble NSF attachment protein, SNAP; PDB: 1	99.22
PF13429		280	TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2	99.21
PF14938		282	SNAP: Soluble NSF attachment protein, SNAP; PDB: 1	99.21
PRK04841		903	transcriptional regulator MalT; Provisional	99.2
KOG1173		611	consensus Anaphase-promoting complex (APC), Cdc16	99.18
COG2956		389	Predicted N-acetylglucosaminyl transferase [Carboh	99.18
KOG0547		606	consensus Translocase of outer mitochondrial membr	99.15
KOG1174		564	consensus Anaphase-promoting complex (APC), subuni	99.15
KOG2076		895	consensus RNA polymerase III transcription factor	99.13
KOG1839		1236	consensus Uncharacterized protein CLU1/cluA/TIF31	99.12
cd05804		355	StaR_like StaR_like; a well-conserved protein foun	99.11
PF13429		280	TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2	99.1
KOG1129		478	consensus TPR repeat-containing protein [General f	99.08
KOG0624		504	consensus dsRNA-activated protein kinase inhibitor	99.07
TIGR00540		409	hemY_coli hemY protein. This is an uncharacterized	99.06
PRK10747		398	putative protoheme IX biogenesis protein; Provisio	99.06
TIGR00540		409	hemY_coli hemY protein. This is an uncharacterized	99.04
COG2956		389	Predicted N-acetylglucosaminyl transferase [Carboh	99.03
KOG0548		539	consensus Molecular co-chaperone STI1 [Posttransla	99.0
PRK15179		694	Vi polysaccharide biosynthesis protein TviE; Provi	99.0
PF13424		78	TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15	98.99
PF13424		78	TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15	98.98
PRK15359		144	type III secretion system chaperone protein SscB;	98.96
KOG0550		486	consensus Molecular chaperone (DnaJ superfamily) [	98.95
PRK15179		694	Vi polysaccharide biosynthesis protein TviE; Provi	98.93
PRK10747		398	putative protoheme IX biogenesis protein; Provisio	98.92
PF12569		517	NARP1: NMDA receptor-regulated protein 1 ; InterPr	98.92
PRK15359		144	type III secretion system chaperone protein SscB;	98.91
KOG0548		539	consensus Molecular co-chaperone STI1 [Posttransla	98.89
KOG0550		486	consensus Molecular chaperone (DnaJ superfamily) [	98.88
CHL00033		168	ycf3 photosystem I assembly protein Ycf3	98.87
PF13525		203	YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M	98.87
KOG2076		895	consensus RNA polymerase III transcription factor	98.87
CHL00033		168	ycf3 photosystem I assembly protein Ycf3	98.86
PLN03218		1060	maturation of RBCL 1; Provisional	98.85
PRK10370		198	formate-dependent nitrite reductase complex subuni	98.85
PRK10370		198	formate-dependent nitrite reductase complex subuni	98.84
PLN03218		1060	maturation of RBCL 1; Provisional	98.84
PRK10866		243	outer membrane biogenesis protein BamD; Provisiona	98.83
KOG0495		913	consensus HAT repeat protein [RNA processing and m	98.82
KOG4162		799	consensus Predicted calmodulin-binding protein [Si	98.78
PLN02789		320	farnesyltranstransferase	98.78
PRK14574		822	hmsH outer membrane protein; Provisional	98.77
PRK14574		822	hmsH outer membrane protein; Provisional	98.75
TIGR02552		135	LcrH_SycD type III secretion low calcium response	98.75
KOG0553		304	consensus TPR repeat-containing protein [General f	98.74
PRK02603		172	photosystem I assembly protein Ycf3; Provisional	98.74
PRK14720		906	transcript cleavage factor/unknown domain fusion p	98.72
PLN03081		697	pentatricopeptide (PPR) repeat-containing protein;	98.69
PF09976		145	TPR_21: Tetratricopeptide repeat; InterPro: IPR018	98.69
PRK02603		172	photosystem I assembly protein Ycf3; Provisional	98.69
KOG2376		652	consensus Signal recognition particle, subunit Srp	98.68
COG5010		257	TadD Flp pilus assembly protein TadD, contains TPR	98.67
TIGR02552		135	LcrH_SycD type III secretion low calcium response	98.67
KOG1156		700	consensus N-terminal acetyltransferase [Chromatin	98.66
KOG1174		564	consensus Anaphase-promoting complex (APC), subuni	98.66
PLN02789		320	farnesyltranstransferase	98.66
TIGR02795		119	tol_pal_ybgF tol-pal system protein YbgF. Members	98.65
PLN03081		697	pentatricopeptide (PPR) repeat-containing protein;	98.65
KOG2376		652	consensus Signal recognition particle, subunit Srp	98.65
PRK15363		157	pathogenicity island 2 chaperone protein SscA; Pro	98.64
PRK15363		157	pathogenicity island 2 chaperone protein SscA; Pro	98.64
PLN03088		356	SGT1, suppressor of G2 allele of SKP1; Provisional	98.62
TIGR02795		119	tol_pal_ybgF tol-pal system protein YbgF. Members	98.62
KOG0553		304	consensus TPR repeat-containing protein [General f	98.62
PRK14720		906	transcript cleavage factor/unknown domain fusion p	98.59
PF09976		145	TPR_21: Tetratricopeptide repeat; InterPro: IPR018	98.57
COG4783		484	Putative Zn-dependent protease, contains TPR repea	98.55
PLN03088		356	SGT1, suppressor of G2 allele of SKP1; Provisional	98.51
COG5010		257	TadD Flp pilus assembly protein TadD, contains TPR	98.5
KOG1127		1238	consensus TPR repeat-containing protein [RNA proce	98.5
KOG1585		308	consensus Protein required for fusion of vesicles	98.5
PLN03077		857	Protein ECB2; Provisional	98.48
PF13525		203	YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M	98.45
KOG0495		913	consensus HAT repeat protein [RNA processing and m	98.45
PRK10866		243	outer membrane biogenesis protein BamD; Provisiona	98.42
KOG3617		1416	consensus WD40 and TPR repeat-containing protein [	98.41
KOG1128		777	consensus Uncharacterized conserved protein, conta	98.4
KOG0624		504	consensus dsRNA-activated protein kinase inhibitor	98.39
PLN03077		857	Protein ECB2; Provisional	98.39
cd00189		100	TPR Tetratricopeptide repeat domain; typically con	98.38
KOG1585		308	consensus Protein required for fusion of vesicles	98.38
cd00189		100	TPR Tetratricopeptide repeat domain; typically con	98.36
PRK10153		517	DNA-binding transcriptional activator CadC; Provis	98.33
KOG1156		700	consensus N-terminal acetyltransferase [Chromatin	98.32
KOG3060		289	consensus Uncharacterized conserved protein [Funct	98.32
PRK10803		263	tol-pal system protein YbgF; Provisional	98.31
KOG1128		777	consensus Uncharacterized conserved protein, conta	98.3
PF12688		120	TPR_5: Tetratrico peptide repeat	98.29
PF12895		84	Apc3: Anaphase-promoting complex, cyclosome, subun	98.28
COG0457		291	NrfG FOG: TPR repeat [General function prediction	98.27
COG3071		400	HemY Uncharacterized enzyme of heme biosynthesis [	98.27
KOG4162		799	consensus Predicted calmodulin-binding protein [Si	98.27
KOG3060		289	consensus Uncharacterized conserved protein [Funct	98.25
PF13414		69	TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A	98.24
KOG3785		557	consensus Uncharacterized conserved protein [Funct	98.23
KOG0543		397	consensus FKBP-type peptidyl-prolyl cis-trans isom	98.22
PRK10803		263	tol-pal system protein YbgF; Provisional	98.21
KOG1127		1238	consensus TPR repeat-containing protein [RNA proce	98.21
PF12688		120	TPR_5: Tetratrico peptide repeat	98.21
PF12895		84	Apc3: Anaphase-promoting complex, cyclosome, subun	98.18
PF13414		69	TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A	98.17
KOG0543		397	consensus FKBP-type peptidyl-prolyl cis-trans isom	98.17
KOG4340		459	consensus Uncharacterized conserved protein [Funct	98.09
KOG3617		1416	consensus WD40 and TPR repeat-containing protein [	98.08
PF12569		517	NARP1: NMDA receptor-regulated protein 1 ; InterPr	98.07
COG4105		254	ComL DNA uptake lipoprotein [General function pred	98.05
KOG4555		175	consensus TPR repeat-containing protein [Function	98.04
KOG2300		629	consensus Uncharacterized conserved protein [Funct	98.03
KOG1586		288	consensus Protein required for fusion of vesicles	98.02
PRK10153		517	DNA-binding transcriptional activator CadC; Provis	98.02
KOG3785		557	consensus Uncharacterized conserved protein [Funct	97.98
KOG3616		1636	consensus Selective LIM binding factor [Transcript	97.98
KOG2300		629	consensus Uncharacterized conserved protein [Funct	97.95
COG2909		894	MalT ATP-dependent transcriptional regulator [Tran	97.94
COG4783		484	Putative Zn-dependent protease, contains TPR repea	97.94
KOG4555		175	consensus TPR repeat-containing protein [Function	97.93
COG1729		262	Uncharacterized protein conserved in bacteria [Fun	97.92
PRK11906		458	transcriptional regulator; Provisional	97.91
PF13432		65	TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL	97.9
COG4785		297	NlpI Lipoprotein NlpI, contains TPR repeats [Gener	97.9
PF13432		65	TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL	97.9
COG0457		291	NrfG FOG: TPR repeat [General function prediction	97.89
PF08631		278	SPO22: Meiosis protein SPO22/ZIP4 like; InterPro:	97.87
KOG1586		288	consensus Protein required for fusion of vesicles	97.87
COG3071		400	HemY Uncharacterized enzyme of heme biosynthesis [	97.82
PF04733		290	Coatomer_E: Coatomer epsilon subunit; InterPro: IP	97.8
KOG2047		835	consensus mRNA splicing factor [RNA processing and	97.79
PF09295		395	ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter	97.75
COG4785		297	NlpI Lipoprotein NlpI, contains TPR repeats [Gener	97.74
COG1729		262	Uncharacterized protein conserved in bacteria [Fun	97.71
PRK11906		458	transcriptional regulator; Provisional	97.71
COG4700		251	Uncharacterized protein conserved in bacteria cont	97.7
PF09295		395	ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter	97.69
PRK15331		165	chaperone protein SicA; Provisional	97.68
KOG1070		1710	consensus rRNA processing protein Rrp5 [RNA proces	97.68
PF10345		608	Cohesin_load: Cohesin loading factor; InterPro: IP	97.64
PLN03098		453	LPA1 LOW PSII ACCUMULATION1; Provisional	97.63
PF13512		142	TPR_18: Tetratricopeptide repeat	97.62
COG2909		894	MalT ATP-dependent transcriptional regulator [Tran	97.61
KOG2047		835	consensus mRNA splicing factor [RNA processing and	97.56
PLN03098		453	LPA1 LOW PSII ACCUMULATION1; Provisional	97.53
COG4235		287	Cytochrome c biogenesis factor [Posttranslational	97.53
KOG4234		271	consensus TPR repeat-containing protein [General f	97.52
KOG2796		366	consensus Uncharacterized conserved protein [Funct	97.5
PRK15331		165	chaperone protein SicA; Provisional	97.5
KOG4340		459	consensus Uncharacterized conserved protein [Funct	97.48
PF13512		142	TPR_18: Tetratricopeptide repeat	97.46
KOG4234		271	consensus TPR repeat-containing protein [General f	97.44
KOG2471		696	consensus TPR repeat-containing protein [General f	97.44
KOG3081		299	consensus Vesicle coat complex COPI, epsilon subun	97.41
KOG4648		536	consensus Uncharacterized conserved protein, conta	97.4
KOG3616		1636	consensus Selective LIM binding factor [Transcript	97.37
COG4235		287	Cytochrome c biogenesis factor [Posttranslational	97.35
PF10300		468	DUF3808: Protein of unknown function (DUF3808); In	97.33
KOG1070		1710	consensus rRNA processing protein Rrp5 [RNA proces	97.33
COG5159		421	RPN6 26S proteasome regulatory complex component [	97.28
PF04733		290	Coatomer_E: Coatomer epsilon subunit; InterPro: IP	97.27
KOG1915		677	consensus Cell cycle control protein (crooked neck	97.27
COG3898		531	Uncharacterized membrane-bound protein [Function u	97.25
KOG2796		366	consensus Uncharacterized conserved protein [Funct	97.24
PF10345		608	Cohesin_load: Cohesin loading factor; InterPro: IP	97.23
PF04184		539	ST7: ST7 protein; InterPro: IPR007311 The ST7 (for	97.19
PF12968		144	DUF3856: Domain of Unknown Function (DUF3856); Int	97.18
PF13371		73	TPR_9: Tetratricopeptide repeat	97.18
PF13374		42	TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT	97.15
KOG2610		491	consensus Uncharacterized conserved protein [Funct	97.15
PF13374		42	TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT	97.14
PF10300		468	DUF3808: Protein of unknown function (DUF3808); In	97.14
PF13371		73	TPR_9: Tetratricopeptide repeat	97.13
COG4105		254	ComL DNA uptake lipoprotein [General function pred	97.13
KOG4642		284	consensus Chaperone-dependent E3 ubiquitin protein	97.1
KOG1463		411	consensus 26S proteasome regulatory complex, subun	97.1
PF14559		68	TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN	97.1
PF14559		68	TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN	97.07
PF12968		144	DUF3856: Domain of Unknown Function (DUF3856); Int	97.07
PF02259		352	FAT: FAT domain; InterPro: IPR003151 The FAT domai	97.06
PF09986		214	DUF2225: Uncharacterized protein conserved in bact	97.04
KOG1915		677	consensus Cell cycle control protein (crooked neck	97.04
COG4700		251	Uncharacterized protein conserved in bacteria cont	97.04
KOG2041		1189	consensus WD40 repeat protein [General function pr	97.03
KOG4648		536	consensus Uncharacterized conserved protein, conta	96.92
PF09986		214	DUF2225: Uncharacterized protein conserved in bact	96.92
PF13281		374	DUF4071: Domain of unknown function (DUF4071)	96.92
PF10602		177	RPN7: 26S proteasome subunit RPN7; InterPro: IPR01	96.76
PF08631		278	SPO22: Meiosis protein SPO22/ZIP4 like; InterPro:	96.72
PF10602		177	RPN7: 26S proteasome subunit RPN7; InterPro: IPR01	96.66
KOG1550		552	consensus Extracellular protein SEL-1 and related	96.65
PF03704		146	BTAD: Bacterial transcriptional activator domain;	96.65
COG2976		207	Uncharacterized protein conserved in bacteria [Fun	96.61
COG2976		207	Uncharacterized protein conserved in bacteria [Fun	96.6
KOG3081		299	consensus Vesicle coat complex COPI, epsilon subun	96.52
PF11817		247	Foie-gras_1: Foie gras liver health family 1; Inte	96.51
KOG2471		696	consensus TPR repeat-containing protein [General f	96.5
PF04184		539	ST7: ST7 protein; InterPro: IPR007311 The ST7 (for	96.5
PF03704		146	BTAD: Bacterial transcriptional activator domain;	96.47
KOG4642		284	consensus Chaperone-dependent E3 ubiquitin protein	96.38
KOG1464		440	consensus COP9 signalosome, subunit CSN2 [Posttran	96.38
KOG0551		390	consensus Hsp90 co-chaperone CNS1 (contains TPR re	96.28
PF12862		94	Apc5: Anaphase-promoting complex subunit 5	96.22
KOG0545		329	consensus Aryl-hydrocarbon receptor-interacting pr	96.14
COG0790		292	FOG: TPR repeat, SEL1 subfamily [General function	96.1
KOG1464		440	consensus COP9 signalosome, subunit CSN2 [Posttran	95.99
KOG1550		552	consensus Extracellular protein SEL-1 and related	95.97
KOG0545		329	consensus Aryl-hydrocarbon receptor-interacting pr	95.87
PF05843		280	Suf: Suppressor of forked protein (Suf); InterPro:	95.78
PF12862		94	Apc5: Anaphase-promoting complex subunit 5	95.75
PF02259		352	FAT: FAT domain; InterPro: IPR003151 The FAT domai	95.73
PF12739		414	TRAPPC-Trs85: ER-Golgi trafficking TRAPP I complex	95.71
COG0790		292	FOG: TPR repeat, SEL1 subfamily [General function	95.66
COG5159		421	RPN6 26S proteasome regulatory complex component [	95.56
KOG0551		390	consensus Hsp90 co-chaperone CNS1 (contains TPR re	95.45
PF04910		360	Tcf25: Transcriptional repressor TCF25; InterPro:	95.45
PF13176		36	TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_	95.44
PF08626		1185	TRAPPC9-Trs120: Transport protein Trs120 or TRAPPC	95.42
KOG3783		546	consensus Uncharacterized conserved protein [Funct	95.38
KOG2041		1189	consensus WD40 repeat protein [General function pr	95.36
KOG2053		932	consensus Mitochondrial inheritance and actin cyto	95.32
PF13281		374	DUF4071: Domain of unknown function (DUF4071)	95.3
PF13176		36	TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_	95.28
PF00515		34	TPR_1: Tetratricopeptide repeat; InterPro: IPR0014	95.25
PF00515		34	TPR_1: Tetratricopeptide repeat; InterPro: IPR0014	95.11
KOG2610		491	consensus Uncharacterized conserved protein [Funct	95.08
PF00244		236	14-3-3: 14-3-3 protein; InterPro: IPR023410 The 14	95.04
PF05843		280	Suf: Suppressor of forked protein (Suf); InterPro:	95.01
COG3118		304	Thioredoxin domain-containing protein [Posttransla	94.88
PF07719		34	TPR_2: Tetratricopeptide repeat; InterPro: IPR0131	94.86
PF07719		34	TPR_2: Tetratricopeptide repeat; InterPro: IPR0131	94.8
PF06552		186	TOM20_plant: Plant specific mitochondrial import r	94.8
KOG1538		1081	consensus Uncharacterized conserved protein WDR10,	94.52
smart00101		244	14_3_3 14-3-3 homologues. 14-3-3 homologues mediat	94.49
KOG0985		1666	consensus Vesicle coat protein clathrin, heavy cha	94.45
PF10579		80	Rapsyn_N: Rapsyn N-terminal myristoylation and lin	94.44
PF06552		186	TOM20_plant: Plant specific mitochondrial import r	94.32
COG3898		531	Uncharacterized membrane-bound protein [Function u	94.32
KOG2053		932	consensus Mitochondrial inheritance and actin cyto	94.29
KOG0376		476	consensus Serine-threonine phosphatase 2A, catalyt	94.24
PF13428		44	TPR_14: Tetratricopeptide repeat	94.13
PF12739		414	TRAPPC-Trs85: ER-Golgi trafficking TRAPP I complex	94.13
KOG4322		482	consensus Anaphase-promoting complex (APC), subuni	94.02
PF13428		44	TPR_14: Tetratricopeptide repeat	93.98
PF08626		1185	TRAPPC9-Trs120: Transport protein Trs120 or TRAPPC	93.92
PF13181		34	TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_	93.91
PF13181		34	TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_	93.86
KOG4322		482	consensus Anaphase-promoting complex (APC), subuni	93.71
COG3118		304	Thioredoxin domain-containing protein [Posttransla	93.38
PF13431		34	TPR_17: Tetratricopeptide repeat	93.33
KOG1308		377	consensus Hsp70-interacting protein Hip/Transient	93.24
KOG1463		411	consensus 26S proteasome regulatory complex, subun	93.22
PF13431		34	TPR_17: Tetratricopeptide repeat	93.19
KOG4814		872	consensus Uncharacterized conserved protein [Funct	93.17
PF04910		360	Tcf25: Transcriptional repressor TCF25; InterPro:	93.14
PF08424		321	NRDE-2: NRDE-2, necessary for RNA interference; In	93.13
KOG0985		1666	consensus Vesicle coat protein clathrin, heavy cha	93.1
KOG2581		493	consensus 26S proteasome regulatory complex, subun	93.05
KOG0376		476	consensus Serine-threonine phosphatase 2A, catalyt	92.97
KOG4014		248	consensus Uncharacterized conserved protein (conta	92.87
KOG4814		872	consensus Uncharacterized conserved protein [Funct	92.83
KOG0890		2382	consensus Protein kinase of the PI-3 kinase family	92.41
PF11817		247	Foie-gras_1: Foie gras liver health family 1; Inte	92.33
PF08424		321	NRDE-2: NRDE-2, necessary for RNA interference; In	92.19
PF09670		379	Cas_Cas02710: CRISPR-associated protein (Cas_Cas02	92.1
KOG3783		546	consensus Uncharacterized conserved protein [Funct	91.81
KOG1914		656	consensus mRNA cleavage and polyadenylation factor	91.12
KOG1538		1081	consensus Uncharacterized conserved protein WDR10,	90.93
COG5187		412	RPN7 26S proteasome regulatory complex component,	90.59
PF07079		549	DUF1347: Protein of unknown function (DUF1347); In	90.36
KOG2581		493	consensus 26S proteasome regulatory complex, subun	90.36
PF11207		203	DUF2989: Protein of unknown function (DUF2989); In	90.34
PF10579		80	Rapsyn_N: Rapsyn N-terminal myristoylation and lin	90.18
KOG1308		377	consensus Hsp70-interacting protein Hip/Transient	89.93
COG4649		221	Uncharacterized protein conserved in bacteria [Fun	89.71
PF04781		111	DUF627: Protein of unknown function (DUF627); Inte	89.37
KOG0687		393	consensus 26S proteasome regulatory complex, subun	89.23
COG5187		412	RPN7 26S proteasome regulatory complex component,	89.19
KOG0686		466	consensus COP9 signalosome, subunit CSN1 [Posttran	89.06
KOG2561		568	consensus Adaptor protein NUB1, contains UBA domai	88.92
PF04190		260	DUF410: Protein of unknown function (DUF410) ; Int	88.88
KOG2561		568	consensus Adaptor protein NUB1, contains UBA domai	88.79
KOG0686		466	consensus COP9 signalosome, subunit CSN1 [Posttran	88.72
KOG0687		393	consensus 26S proteasome regulatory complex, subun	88.61
PF15015		569	NYD-SP12_N: Spermatogenesis-associated, N-terminal	88.35
PF13174		33	TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_	88.16
PF13174		33	TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_	88.14
PF09670		379	Cas_Cas02710: CRISPR-associated protein (Cas_Cas02	87.94
KOG1920		1265	consensus IkappaB kinase complex, IKAP component [	87.6
PF07145		18	PAM2: Ataxin-2 C-terminal region; InterPro: IPR009	87.52
PF10516		38	SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetrat	87.47
KOG3807		556	consensus Predicted membrane protein ST7 (tumor su	87.35
COG4649		221	Uncharacterized protein conserved in bacteria [Fun	87.27
KOG1920		1265	consensus IkappaB kinase complex, IKAP component [	86.98
KOG1258		577	consensus mRNA processing protein [RNA processing	86.85
KOG2114		933	consensus Vacuolar assembly/sorting protein PEP5/V	86.83
smart00028		34	TPR Tetratricopeptide repeats. Repeats present in	86.7
smart00028		34	TPR Tetratricopeptide repeats. Repeats present in	86.62
KOG3024		312	consensus Uncharacterized conserved protein [Funct	86.58
KOG1497		399	consensus COP9 signalosome, subunit CSN4 [Posttran	86.32
PF15015		569	NYD-SP12_N: Spermatogenesis-associated, N-terminal	86.21
KOG2422		665	consensus Uncharacterized conserved protein [Funct	86.21
KOG2422		665	consensus Uncharacterized conserved protein [Funct	86.17
PF10516		38	SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetrat	85.93
KOG4563		400	consensus Cell cycle-regulated histone H1-binding	85.77
KOG4507		886	consensus Uncharacterized conserved protein, conta	85.75
KOG4507		886	consensus Uncharacterized conserved protein, conta	84.67
PF09613		160	HrpB1_HrpK: Bacterial type III secretion protein (	84.6
KOG1924		1102	consensus RhoA GTPase effector DIA/Diaphanous [Sig	83.8
KOG1258		577	consensus mRNA processing protein [RNA processing	83.74
KOG1914		656	consensus mRNA cleavage and polyadenylation factor	83.17
PF10255		404	Paf67: RNA polymerase I-associated factor PAF67; I	82.85
KOG2908		380	consensus 26S proteasome regulatory complex, subun	82.48
smart00101		244	14_3_3 14-3-3 homologues. 14-3-3 homologues mediat	81.99
KOG0890		2382	consensus Protein kinase of the PI-3 kinase family	81.5
PRK13184		932	pknD serine/threonine-protein kinase; Reviewed	81.22
KOG1497		399	consensus COP9 signalosome, subunit CSN4 [Posttran	80.81
PF04781		111	DUF627: Protein of unknown function (DUF627); Inte	80.8
PF12309		371	KBP_C: KIF-1 binding protein C terminal; InterPro:	80.78
PF00244		236	14-3-3: 14-3-3 protein; InterPro: IPR023410 The 14	80.68
PF10952		140	DUF2753: Protein of unknown function (DUF2753); In	80.54
KOG0307		1049	consensus Vesicle coat complex COPII, subunit SEC3	80.33
PF04053		443	Coatomer_WDAD: Coatomer WD associated region ; Int	80.29
KOG4521		1480	consensus Nuclear pore complex, Nup160 component [	80.09
KOG2114		933	consensus Vacuolar assembly/sorting protein PEP5/V	80.09

>KOG1840 consensus Kinesin light chain [Cytoskeleton]	Back alignment and domain information

Probab=99.95  E-value=5.5e-25  Score=258.64  Aligned_cols=296  Identities=25%  Similarity=0.293  Sum_probs=269.9

Q ss_pred             CCcHHHHHHHHHHHHHHHcCCHHHHHHHHHHHHHHHHHhcCCCChhHHHHHHHHHHHHHHcCCHHHHHHHHHHHHHHHHH
Q 001523           60 CSSADGRQLLESSKTALDKGKLEDAVTYGTKALAKLVAVCGPYHRMTAGAYSLLAVVLYHTGDFNQATIYQQKALDINER  139 (1060)
Q Consensus        60 ~~s~dAraLlelA~~yl~qGdyeEAi~~fekALel~ekilg~d~p~~A~A~~~LA~ly~~lGdyeeAle~yqKALeL~ek  139 (1060)
                      ..+...+++..+|..|..+|+|+.|+..|++|+++..+..|.+++..+..+..+|.+|..+++|.+|+.+|++||.+.+.
T Consensus       194 ~~P~~~~~~~~La~~y~~~g~~e~A~~l~k~Al~~l~k~~G~~hl~va~~l~~~a~~y~~~~k~~eAv~ly~~AL~i~e~  273 (508)
T KOG1840|consen  194 EDPERLRTLRNLAEMYAVQGRLEKAEPLCKQALRILEKTSGLKHLVVASMLNILALVYRSLGKYDEAVNLYEEALTIREE  273 (508)
T ss_pred             CCchHHHHHHHHHHHHHHhccHHHHHHHHHHHHHHHHHccCccCHHHHHHHHHHHHHHHHhccHHHHHHHHHHHHHHHHH
Confidence            34555667777999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             hcCCCChhHHHHHHHHHHHHHHcCCHHHHHHHHHHHHHHHHHhCCCCChhHHHHHHHHHHHHHHCCCHHHHHHHHHHHHH
Q 001523          140 ELGLDHPDTMKSYGDLAVFYYRLQHTELALKYVKRALYLLHLTCGPSHPNTAATYINVAMMEEGLGNVHVALRYLHKALK  219 (1060)
Q Consensus       140 ~~g~d~p~~a~ay~nLA~lY~~lGdyeeAleyyekALei~ee~~g~d~p~~a~a~~nLA~iy~~lGdydEAie~yekALe  219 (1060)
                      .+|.+|+.++.++.+||.+|...|+|++|..|+++|++|+++..+..++.+...+.+++.++..++++++|+.+|+++++
T Consensus       274 ~~G~~h~~va~~l~nLa~ly~~~GKf~EA~~~~e~Al~I~~~~~~~~~~~v~~~l~~~~~~~~~~~~~Eea~~l~q~al~  353 (508)
T KOG1840|consen  274 VFGEDHPAVAATLNNLAVLYYKQGKFAEAEEYCERALEIYEKLLGASHPEVAAQLSELAAILQSMNEYEEAKKLLQKALK  353 (508)
T ss_pred             hcCCCCHHHHHHHHHHHHHHhccCChHHHHHHHHHHHHHHHHhhccChHHHHHHHHHHHHHHHHhcchhHHHHHHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHhcCCCcHHHHHHHHHHHHHHHhcCChhHHHHHHHHHHHHHHHHcCCCCHHHHHHHHHHH--HHHHHHHHHHHHHHh
Q 001523          220 CNQRLLGPDHIQTAASYHAIAIALSLMEAYPLSVQHEQTTLQILRAKLGPDDLRTQDAAAWLE--YFESKAFEQQEAARN  297 (1060)
Q Consensus       220 i~eeilG~dhp~~a~a~~nLA~ly~~lGdyeEAie~lqkALeI~rkllg~dh~~t~~al~~La--~l~~k~~e~AeAl~~  297 (1060)
                      +.....|.+++.++..+.+||.+|..+|+|.+|.++|++|+++.++..+..+..+...+..|+  +.+.+.+..+..++.
T Consensus       354 i~~~~~g~~~~~~a~~~~nl~~l~~~~gk~~ea~~~~k~ai~~~~~~~~~~~~~~~~~l~~la~~~~~~k~~~~a~~l~~  433 (508)
T KOG1840|consen  354 IYLDAPGEDNVNLAKIYANLAELYLKMGKYKEAEELYKKAIQILRELLGKKDYGVGKPLNQLAEAYEELKKYEEAEQLFE  433 (508)
T ss_pred             HHHhhccccchHHHHHHHHHHHHHHHhcchhHHHHHHHHHHHHHHhcccCcChhhhHHHHHHHHHHHHhcccchHHHHHH
Confidence            999999999999999999999999999999999999999999999999988888888887776  444445555555555


Q ss_pred             cCCCCchhhhhcCCCcHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHhhhhcCCCCCCC
Q 001523          298 GTRKPDASIASKGHLSVSDLLDYINPSHDTKGRNVSTLKRKTYVAKVKGNFYQDNNLTS  356 (1060)
Q Consensus       298 ~~~~~d~~~a~~~~~svselL~~Lg~~y~~qGqyeEAl~~YeqALkL~~ki~~~~n~~~  356 (1060)
                      ....+- .....+++.+...|.+|+.+|..+|+|++|+++..+++..+....+..+...
T Consensus       434 ~~~~i~-~~~g~~~~~~~~~~~nL~~~Y~~~g~~e~a~~~~~~~~~~~~~~~~~~~~~~  491 (508)
T KOG1840|consen  434 EAKDIM-KLCGPDHPDVTYTYLNLAALYRAQGNYEAAEELEEKVLNAREQRLGTASPTV  491 (508)
T ss_pred             HHHHHH-HHhCCCCCchHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHcCCCCCcch
Confidence            555555 6678889999999999999999999999999999999999988776665544

>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms]	Back alignment and domain information

>KOG1840 consensus Kinesin light chain [Cytoskeleton]	Back alignment and domain information

>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms]	Back alignment and domain information

>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70)	Back alignment and domain information

>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms]	Back alignment and domain information

>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70)	Back alignment and domain information

>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism]	Back alignment and domain information

>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms]	Back alignment and domain information

>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW	Back alignment and domain information

>PRK11788 tetratricopeptide repeat protein; Provisional	Back alignment and domain information

>PRK11788 tetratricopeptide repeat protein; Provisional	Back alignment and domain information

>PRK15174 Vi polysaccharide export protein VexE; Provisional	Back alignment and domain information

>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein	Back alignment and domain information

>PRK15174 Vi polysaccharide export protein VexE; Provisional	Back alignment and domain information

>PRK11447 cellulose synthase subunit BcsC; Provisional	Back alignment and domain information

>PRK11189 lipoprotein NlpI; Provisional	Back alignment and domain information

>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein	Back alignment and domain information

>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion]	Back alignment and domain information

>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK11447 cellulose synthase subunit BcsC; Provisional	Back alignment and domain information

>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional	Back alignment and domain information

>PRK12370 invasion protein regulator; Provisional	Back alignment and domain information

>PRK12370 invasion protein regulator; Provisional	Back alignment and domain information

>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>KOG1839 consensus Uncharacterized protein CLU1/cluA/TIF31 involved in mitochondrial morphology/distribution, also found associated with eIF-3 [General function prediction only]	Back alignment and domain information

>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO	Back alignment and domain information

>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW	Back alignment and domain information

>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional	Back alignment and domain information

>PRK11189 lipoprotein NlpI; Provisional	Back alignment and domain information

>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures]	Back alignment and domain information

>PRK04841 transcriptional regulator MalT; Provisional	Back alignment and domain information

>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG1129 consensus TPR repeat-containing protein [General function prediction only]	Back alignment and domain information

>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism]	Back alignment and domain information

>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion]	Back alignment and domain information

>KOG1125 consensus TPR repeat-containing protein [General function prediction only]	Back alignment and domain information

>PRK10049 pgaA outer membrane protein PgaA; Provisional	Back alignment and domain information

>KOG2003 consensus TPR repeat-containing protein [General function prediction only]	Back alignment and domain information

>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures]	Back alignment and domain information

>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO	Back alignment and domain information

>PRK10049 pgaA outer membrane protein PgaA; Provisional	Back alignment and domain information

>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals	Back alignment and domain information

>KOG2003 consensus TPR repeat-containing protein [General function prediction only]	Back alignment and domain information

>KOG1125 consensus TPR repeat-containing protein [General function prediction only]	Back alignment and domain information

>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A	Back alignment and domain information

>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B	Back alignment and domain information

>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A	Back alignment and domain information

>PRK04841 transcriptional regulator MalT; Provisional	Back alignment and domain information

>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism]	Back alignment and domain information

>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription]	Back alignment and domain information

>KOG1839 consensus Uncharacterized protein CLU1/cluA/TIF31 involved in mitochondrial morphology/distribution, also found associated with eIF-3 [General function prediction only]	Back alignment and domain information

>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals	Back alignment and domain information

>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B	Back alignment and domain information

>KOG1129 consensus TPR repeat-containing protein [General function prediction only]	Back alignment and domain information

>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms]	Back alignment and domain information

>TIGR00540 hemY_coli hemY protein	Back alignment and domain information

>PRK10747 putative protoheme IX biogenesis protein; Provisional	Back alignment and domain information

>TIGR00540 hemY_coli hemY protein	Back alignment and domain information

>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism]	Back alignment and domain information

>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional	Back alignment and domain information

>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H	Back alignment and domain information

>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H	Back alignment and domain information

>PRK15359 type III secretion system chaperone protein SscB; Provisional	Back alignment and domain information

>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional	Back alignment and domain information

>PRK10747 putative protoheme IX biogenesis protein; Provisional	Back alignment and domain information

>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala	Back alignment and domain information

>PRK15359 type III secretion system chaperone protein SscB; Provisional	Back alignment and domain information

>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>CHL00033 ycf3 photosystem I assembly protein Ycf3	Back alignment and domain information

>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A	Back alignment and domain information

>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription]	Back alignment and domain information

>CHL00033 ycf3 photosystem I assembly protein Ycf3	Back alignment and domain information

>PLN03218 maturation of RBCL 1; Provisional	Back alignment and domain information

>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional	Back alignment and domain information

>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional	Back alignment and domain information

>PLN03218 maturation of RBCL 1; Provisional	Back alignment and domain information

>PRK10866 outer membrane biogenesis protein BamD; Provisional	Back alignment and domain information

>KOG0495 consensus HAT repeat protein [RNA processing and modification]	Back alignment and domain information

>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms]	Back alignment and domain information

>PLN02789 farnesyltranstransferase	Back alignment and domain information

>PRK14574 hmsH outer membrane protein; Provisional	Back alignment and domain information

>PRK14574 hmsH outer membrane protein; Provisional	Back alignment and domain information

>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD	Back alignment and domain information

>KOG0553 consensus TPR repeat-containing protein [General function prediction only]	Back alignment and domain information

>PRK02603 photosystem I assembly protein Ycf3; Provisional	Back alignment and domain information

>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional	Back alignment and domain information

>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional	Back alignment and domain information

>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function	Back alignment and domain information

>PRK02603 photosystem I assembly protein Ycf3; Provisional	Back alignment and domain information

>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion]	Back alignment and domain information

>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD	Back alignment and domain information

>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics]	Back alignment and domain information

>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PLN02789 farnesyltranstransferase	Back alignment and domain information

>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF	Back alignment and domain information

>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional	Back alignment and domain information

>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional	Back alignment and domain information

>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional	Back alignment and domain information

>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional	Back alignment and domain information

>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF	Back alignment and domain information

>KOG0553 consensus TPR repeat-containing protein [General function prediction only]	Back alignment and domain information

>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional	Back alignment and domain information

>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function	Back alignment and domain information

>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only]	Back alignment and domain information

>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional	Back alignment and domain information

>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion]	Back alignment and domain information

>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification]	Back alignment and domain information

>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>PLN03077 Protein ECB2; Provisional	Back alignment and domain information

>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A	Back alignment and domain information

>KOG0495 consensus HAT repeat protein [RNA processing and modification]	Back alignment and domain information

>PRK10866 outer membrane biogenesis protein BamD; Provisional	Back alignment and domain information

>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only]	Back alignment and domain information

>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only]	Back alignment and domain information

>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms]	Back alignment and domain information

>PLN03077 Protein ECB2; Provisional	Back alignment and domain information

>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C

Back alignment and domain information

>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

Back alignment and domain information

>PRK10153 DNA-binding transcriptional activator CadC; Provisional	Back alignment and domain information

>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics]	Back alignment and domain information

>KOG3060 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>PRK10803 tol-pal system protein YbgF; Provisional	Back alignment and domain information

>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only]	Back alignment and domain information

>PF12688 TPR_5: Tetratrico peptide repeat	Back alignment and domain information

>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A	Back alignment and domain information

>COG0457 NrfG FOG: TPR repeat [General function prediction only]	Back alignment and domain information

>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism]	Back alignment and domain information

>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms]	Back alignment and domain information

>KOG3060 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A	Back alignment and domain information

>KOG3785 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK10803 tol-pal system protein YbgF; Provisional	Back alignment and domain information

>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification]	Back alignment and domain information

>PF12688 TPR_5: Tetratrico peptide repeat	Back alignment and domain information

>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A	Back alignment and domain information

>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A	Back alignment and domain information

>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG4340 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only]	Back alignment and domain information

>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala	Back alignment and domain information

>COG4105 ComL DNA uptake lipoprotein [General function prediction only]	Back alignment and domain information

>KOG4555 consensus TPR repeat-containing protein [Function unknown]	Back alignment and domain information

>KOG2300 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG1586 consensus Protein required for fusion of vesicles in vesicular transport, alpha-SNAP [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>PRK10153 DNA-binding transcriptional activator CadC; Provisional	Back alignment and domain information

>KOG3785 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG3616 consensus Selective LIM binding factor [Transcription]	Back alignment and domain information

>KOG2300 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>COG2909 MalT ATP-dependent transcriptional regulator [Transcription]	Back alignment and domain information

>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only]	Back alignment and domain information

>KOG4555 consensus TPR repeat-containing protein [Function unknown]	Back alignment and domain information

>COG1729 Uncharacterized protein conserved in bacteria [Function unknown]	Back alignment and domain information

>PRK11906 transcriptional regulator; Provisional	Back alignment and domain information

>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B	Back alignment and domain information

>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only]	Back alignment and domain information

>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B	Back alignment and domain information

>COG0457 NrfG FOG: TPR repeat [General function prediction only]	Back alignment and domain information

>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis []	Back alignment and domain information

>KOG1586 consensus Protein required for fusion of vesicles in vesicular transport, alpha-SNAP [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism]	Back alignment and domain information

>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment	Back alignment and domain information

>KOG2047 consensus mRNA splicing factor [RNA processing and modification]	Back alignment and domain information

>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi	Back alignment and domain information

>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only]	Back alignment and domain information

>COG1729 Uncharacterized protein conserved in bacteria [Function unknown]	Back alignment and domain information

>PRK11906 transcriptional regulator; Provisional	Back alignment and domain information

>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown]	Back alignment and domain information

>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi	Back alignment and domain information

>PRK15331 chaperone protein SicA; Provisional	Back alignment and domain information

>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification]	Back alignment and domain information

>PF10345 Cohesin_load: Cohesin loading factor; InterPro: IPR019440 Cohesin loading factor is a conserved protein that has been characterised in fungi	Back alignment and domain information

>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional	Back alignment and domain information

>PF13512 TPR_18: Tetratricopeptide repeat	Back alignment and domain information

>COG2909 MalT ATP-dependent transcriptional regulator [Transcription]	Back alignment and domain information

>KOG2047 consensus mRNA splicing factor [RNA processing and modification]	Back alignment and domain information

>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional	Back alignment and domain information

>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG4234 consensus TPR repeat-containing protein [General function prediction only]	Back alignment and domain information

>KOG2796 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>PRK15331 chaperone protein SicA; Provisional	Back alignment and domain information

>KOG4340 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>PF13512 TPR_18: Tetratricopeptide repeat	Back alignment and domain information

>KOG4234 consensus TPR repeat-containing protein [General function prediction only]	Back alignment and domain information

>KOG2471 consensus TPR repeat-containing protein [General function prediction only]	Back alignment and domain information

>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown]	Back alignment and domain information

>KOG3616 consensus Selective LIM binding factor [Transcription]	Back alignment and domain information

>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans	Back alignment and domain information

>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification]	Back alignment and domain information

>COG5159 RPN6 26S proteasome regulatory complex component [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment	Back alignment and domain information

>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>COG3898 Uncharacterized membrane-bound protein [Function unknown]	Back alignment and domain information

>KOG2796 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>PF10345 Cohesin_load: Cohesin loading factor; InterPro: IPR019440 Cohesin loading factor is a conserved protein that has been characterised in fungi	Back alignment and domain information

>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene	Back alignment and domain information

>PF12968 DUF3856: Domain of Unknown Function (DUF3856); InterPro: IPR024552 This domain of unknown function is found in a small group of tetratricopeptide-like proteins, which includes the uncharacterised protein Q8KAL8 from SWISSPROT	Back alignment and domain information

>PF13371 TPR_9: Tetratricopeptide repeat	Back alignment and domain information

>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A	Back alignment and domain information

>KOG2610 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A	Back alignment and domain information

>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans	Back alignment and domain information

>PF13371 TPR_9: Tetratricopeptide repeat	Back alignment and domain information

>COG4105 ComL DNA uptake lipoprotein [General function prediction only]	Back alignment and domain information

>KOG4642 consensus Chaperone-dependent E3 ubiquitin protein ligase (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG1463 consensus 26S proteasome regulatory complex, subunit RPN6/PSMD11 [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A	Back alignment and domain information

>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A	Back alignment and domain information

>PF12968 DUF3856: Domain of Unknown Function (DUF3856); InterPro: IPR024552 This domain of unknown function is found in a small group of tetratricopeptide-like proteins, which includes the uncharacterised protein Q8KAL8 from SWISSPROT	Back alignment and domain information

>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases	Back alignment and domain information

>PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function	Back alignment and domain information

>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown]	Back alignment and domain information

>KOG2041 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown]	Back alignment and domain information

>PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function	Back alignment and domain information

>PF13281 DUF4071: Domain of unknown function (DUF4071)	Back alignment and domain information

>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome	Back alignment and domain information

>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis []	Back alignment and domain information

>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome	Back alignment and domain information

>KOG1550 consensus Extracellular protein SEL-1 and related proteins [Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms]	Back alignment and domain information

>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production	Back alignment and domain information

>COG2976 Uncharacterized protein conserved in bacteria [Function unknown]	Back alignment and domain information

>COG2976 Uncharacterized protein conserved in bacteria [Function unknown]	Back alignment and domain information

>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>PF11817 Foie-gras_1: Foie gras liver health family 1; InterPro: IPR021773 Mutating the gene foie gras in zebrafish has been shown to affect development; the mutants develop large, lipid-filled hepatocytes in the liver, resembling those in individuals with fatty liver disease []	Back alignment and domain information

>KOG2471 consensus TPR repeat-containing protein [General function prediction only]	Back alignment and domain information

>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene	Back alignment and domain information

>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production	Back alignment and domain information

>KOG4642 consensus Chaperone-dependent E3 ubiquitin protein ligase (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG1464 consensus COP9 signalosome, subunit CSN2 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms]	Back alignment and domain information

>KOG0551 consensus Hsp90 co-chaperone CNS1 (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF12862 Apc5: Anaphase-promoting complex subunit 5	Back alignment and domain information

>KOG0545 consensus Aryl-hydrocarbon receptor-interacting protein [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>COG0790 FOG: TPR repeat, SEL1 subfamily [General function prediction only]	Back alignment and domain information

>KOG1464 consensus COP9 signalosome, subunit CSN2 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms]	Back alignment and domain information

>KOG1550 consensus Extracellular protein SEL-1 and related proteins [Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms]	Back alignment and domain information

>KOG0545 consensus Aryl-hydrocarbon receptor-interacting protein [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins	Back alignment and domain information

>PF12862 Apc5: Anaphase-promoting complex subunit 5	Back alignment and domain information

>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases	Back alignment and domain information

>PF12739 TRAPPC-Trs85: ER-Golgi trafficking TRAPP I complex 85 kDa subunit; InterPro: IPR024420 This entry represents Trs85, a subunit of the TRAPP III complex []	Back alignment and domain information

>COG0790 FOG: TPR repeat, SEL1 subfamily [General function prediction only]	Back alignment and domain information

>COG5159 RPN6 26S proteasome regulatory complex component [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0551 consensus Hsp90 co-chaperone CNS1 (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF04910 Tcf25: Transcriptional repressor TCF25; InterPro: IPR006994 This entry appears to represent a novel family of basic helix-loop-helix (bHLH) proteins that control differentiation and development of a variety of organs [, ]	Back alignment and domain information

>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A	Back alignment and domain information

>PF08626 TRAPPC9-Trs120: Transport protein Trs120 or TRAPPC9, TRAPP II complex subunit; InterPro: IPR013935 The trafficking protein particle complex TRAPP is a multi-protein complex needed in the early stages of the secretory pathway	Back alignment and domain information

>KOG3783 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG2041 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton]	Back alignment and domain information

>PF13281 DUF4071: Domain of unknown function (DUF4071)	Back alignment and domain information

>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A	Back alignment and domain information

>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ]	Back alignment and domain information

>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ]	Back alignment and domain information

>KOG2610 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>PF00244 14-3-3: 14-3-3 protein; InterPro: IPR023410 The 14-3-3 proteins are a large family of approximately 30kDa acidic proteins which exist primarily as homo- and heterodimeric within all eukaryotic cells [, ]	Back alignment and domain information

>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins	Back alignment and domain information

>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ]	Back alignment and domain information

>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ]	Back alignment and domain information

>PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins	Back alignment and domain information

>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only]	Back alignment and domain information

>smart00101 14_3_3 14-3-3 homologues	Back alignment and domain information

>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>PF10579 Rapsyn_N: Rapsyn N-terminal myristoylation and linker region; InterPro: IPR019568 Neuromuscular junction formation relies upon the clustering of acetylcholine receptors and other proteins in the muscle membrane	Back alignment and domain information

>PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins	Back alignment and domain information

>COG3898 Uncharacterized membrane-bound protein [Function unknown]	Back alignment and domain information

>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton]	Back alignment and domain information

>KOG0376 consensus Serine-threonine phosphatase 2A, catalytic subunit [General function prediction only]	Back alignment and domain information

>PF13428 TPR_14: Tetratricopeptide repeat	Back alignment and domain information

>PF12739 TRAPPC-Trs85: ER-Golgi trafficking TRAPP I complex 85 kDa subunit; InterPro: IPR024420 This entry represents Trs85, a subunit of the TRAPP III complex []	Back alignment and domain information

>KOG4322 consensus Anaphase-promoting complex (APC), subunit 5 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF13428 TPR_14: Tetratricopeptide repeat	Back alignment and domain information

>PF08626 TRAPPC9-Trs120: Transport protein Trs120 or TRAPPC9, TRAPP II complex subunit; InterPro: IPR013935 The trafficking protein particle complex TRAPP is a multi-protein complex needed in the early stages of the secretory pathway	Back alignment and domain information

>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A	Back alignment and domain information

>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A	Back alignment and domain information

>KOG4322 consensus Anaphase-promoting complex (APC), subunit 5 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF13431 TPR_17: Tetratricopeptide repeat	Back alignment and domain information

>KOG1308 consensus Hsp70-interacting protein Hip/Transient component of progesterone receptor complexes and an Hsp70-binding protein [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms]	Back alignment and domain information

>KOG1463 consensus 26S proteasome regulatory complex, subunit RPN6/PSMD11 [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF13431 TPR_17: Tetratricopeptide repeat	Back alignment and domain information

>KOG4814 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>PF04910 Tcf25: Transcriptional repressor TCF25; InterPro: IPR006994 This entry appears to represent a novel family of basic helix-loop-helix (bHLH) proteins that control differentiation and development of a variety of organs [, ]	Back alignment and domain information

>PF08424 NRDE-2: NRDE-2, necessary for RNA interference; InterPro: IPR013633 This is domain is found in eukaryotic proteins of unknown function	Back alignment and domain information

>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG2581 consensus 26S proteasome regulatory complex, subunit RPN3/PSMD3 [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0376 consensus Serine-threonine phosphatase 2A, catalytic subunit [General function prediction only]	Back alignment and domain information

>KOG4014 consensus Uncharacterized conserved protein (contains TPR repeat) [Function unknown]	Back alignment and domain information

>KOG4814 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG0890 consensus Protein kinase of the PI-3 kinase family involved in mitotic growth, DNA repair and meiotic recombination [Signal transduction mechanisms; Chromatin structure and dynamics; Replication, recombination and repair; Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>PF11817 Foie-gras_1: Foie gras liver health family 1; InterPro: IPR021773 Mutating the gene foie gras in zebrafish has been shown to affect development; the mutants develop large, lipid-filled hepatocytes in the liver, resembling those in individuals with fatty liver disease []	Back alignment and domain information

>PF08424 NRDE-2: NRDE-2, necessary for RNA interference; InterPro: IPR013633 This is domain is found in eukaryotic proteins of unknown function	Back alignment and domain information

>PF09670 Cas_Cas02710: CRISPR-associated protein (Cas_Cas02710)	Back alignment and domain information

>KOG3783 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification]	Back alignment and domain information

>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only]	Back alignment and domain information

>COG5187 RPN7 26S proteasome regulatory complex component, contains PCI domain [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length	Back alignment and domain information

>KOG2581 consensus 26S proteasome regulatory complex, subunit RPN3/PSMD3 [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF11207 DUF2989: Protein of unknown function (DUF2989); InterPro: IPR021372 Some members in this bacterial family of proteins are annotated as lipoproteins however this cannot be confirmed	Back alignment and domain information

>PF10579 Rapsyn_N: Rapsyn N-terminal myristoylation and linker region; InterPro: IPR019568 Neuromuscular junction formation relies upon the clustering of acetylcholine receptors and other proteins in the muscle membrane	Back alignment and domain information

>KOG1308 consensus Hsp70-interacting protein Hip/Transient component of progesterone receptor complexes and an Hsp70-binding protein [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms]	Back alignment and domain information

>COG4649 Uncharacterized protein conserved in bacteria [Function unknown]	Back alignment and domain information

>PF04781 DUF627: Protein of unknown function (DUF627); InterPro: IPR006866 This domain represents the N-terminal region of several plant proteins of unknown function	Back alignment and domain information

>KOG0687 consensus 26S proteasome regulatory complex, subunit RPN7/PSMD6 [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>COG5187 RPN7 26S proteasome regulatory complex component, contains PCI domain [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0686 consensus COP9 signalosome, subunit CSN1 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms]	Back alignment and domain information

>KOG2561 consensus Adaptor protein NUB1, contains UBA domain [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms]	Back alignment and domain information

>PF04190 DUF410: Protein of unknown function (DUF410) ; InterPro: IPR007317 This is a family of conserved eukaryotic proteins with undetermined function	Back alignment and domain information

>KOG2561 consensus Adaptor protein NUB1, contains UBA domain [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms]	Back alignment and domain information

>KOG0686 consensus COP9 signalosome, subunit CSN1 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms]	Back alignment and domain information

>KOG0687 consensus 26S proteasome regulatory complex, subunit RPN7/PSMD6 [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF15015 NYD-SP12_N: Spermatogenesis-associated, N-terminal	Back alignment and domain information

>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A	Back alignment and domain information

>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A	Back alignment and domain information

>PF09670 Cas_Cas02710: CRISPR-associated protein (Cas_Cas02710)	Back alignment and domain information

>KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription]	Back alignment and domain information

>PF07145 PAM2: Ataxin-2 C-terminal region; InterPro: IPR009818 This entry represents a conserved region approximately 250 residues long located towards the C terminus of eukaryotic ataxin-2	Back alignment and domain information

>PF10516 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetratrico peptide repeat region (TPR) is a structural motif present in a wide range of proteins [, , ]	Back alignment and domain information

>KOG3807 consensus Predicted membrane protein ST7 (tumor suppressor in humans) [General function prediction only]	Back alignment and domain information

>COG4649 Uncharacterized protein conserved in bacteria [Function unknown]	Back alignment and domain information

>KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription]	Back alignment and domain information

>KOG1258 consensus mRNA processing protein [RNA processing and modification]	Back alignment and domain information

>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>smart00028 TPR Tetratricopeptide repeats	Back alignment and domain information

>smart00028 TPR Tetratricopeptide repeats	Back alignment and domain information

>KOG3024 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG1497 consensus COP9 signalosome, subunit CSN4 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms]	Back alignment and domain information

>PF15015 NYD-SP12_N: Spermatogenesis-associated, N-terminal	Back alignment and domain information

>KOG2422 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG2422 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>PF10516 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetratrico peptide repeat region (TPR) is a structural motif present in a wide range of proteins [, , ]	Back alignment and domain information

>KOG4563 consensus Cell cycle-regulated histone H1-binding protein [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>KOG4507 consensus Uncharacterized conserved protein, contains TPR repeats [Function unknown]	Back alignment and domain information

>KOG4507 consensus Uncharacterized conserved protein, contains TPR repeats [Function unknown]	Back alignment and domain information

>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia	Back alignment and domain information

>KOG1924 consensus RhoA GTPase effector DIA/Diaphanous [Signal transduction mechanisms; Cytoskeleton]	Back alignment and domain information

>KOG1258 consensus mRNA processing protein [RNA processing and modification]	Back alignment and domain information

>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification]	Back alignment and domain information

>PF10255 Paf67: RNA polymerase I-associated factor PAF67; InterPro: IPR019382 RNA polymerase I is a multi-subunit enzyme and its transcription competence is dependent on the presence of PAF67 []	Back alignment and domain information

>KOG2908 consensus 26S proteasome regulatory complex, subunit RPN9/PSMD13 [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>smart00101 14_3_3 14-3-3 homologues	Back alignment and domain information

>KOG0890 consensus Protein kinase of the PI-3 kinase family involved in mitotic growth, DNA repair and meiotic recombination [Signal transduction mechanisms; Chromatin structure and dynamics; Replication, recombination and repair; Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>PRK13184 pknD serine/threonine-protein kinase; Reviewed	Back alignment and domain information

>KOG1497 consensus COP9 signalosome, subunit CSN4 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms]	Back alignment and domain information

>PF04781 DUF627: Protein of unknown function (DUF627); InterPro: IPR006866 This domain represents the N-terminal region of several plant proteins of unknown function	Back alignment and domain information

>PF12309 KBP_C: KIF-1 binding protein C terminal; InterPro: IPR022083 This family of proteins is found in bacteria and eukaryotes	Back alignment and domain information

>PF00244 14-3-3: 14-3-3 protein; InterPro: IPR023410 The 14-3-3 proteins are a large family of approximately 30kDa acidic proteins which exist primarily as homo- and heterodimeric within all eukaryotic cells [, ]	Back alignment and domain information

>PF10952 DUF2753: Protein of unknown function (DUF2753); InterPro: IPR020206 This entry represents a group of uncharacterised proteins	Back alignment and domain information

>KOG0307 consensus Vesicle coat complex COPII, subunit SEC31 [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment	Back alignment and domain information

>KOG4521 consensus Nuclear pore complex, Nup160 component [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

Homologous Structure Templates