Citrus Sinensis ID: 001536

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------1000------1010------1020------1030------1040------1050------106
MGDYRFSSESGYGPQRSGAGTITRVRLENFMCHSSLQIELGEWVNFITGQNGSGKSAILTALCIAFGCRAKGTQRAATLKDFIKTGCSYAMVEVELKNRGEDAFKPEIFGDSIIIERRITESTSTTVLKDHQGKRVASRKQELLELIDHFNIDVENPCVIMSQDKSREFLHSGNDKDKFKFFFKATLLQQVNDLLQSIYNHLNKGDALVLELEATIKPTEKELSELQRKIRNMEHVEEITQDLQRLKKKLAWSWVYDVDRQLKEQTLKIEKLKDRIPRCQAKIDSRHSILESLRDCFMKKKAEIAVMVEKTSEVRRRKDELQQSISLATKEKLELEGELVRNTSYMQKMVNRVKGLEQQVHDIQEQHVRNTQAEESEIEAKLKELQCEIDAANITLSRMKEEDSALSEKLSKEKNEIRRISDEIEDYDKKCREIRSEIRELQQHQTNKVTAFGGDRVISLLRAIERHHHKFKSPPIGPIGSHVTLVNGDTWAPAVEQAIGRLLNAFIVTDHKDALLLRGCAREANYNHLQIIIYDFSRPRLSLPHHMLPHTKHPTTLSVLQSDNPTVINVLVDMGSAERQVLVRDYDVGKAVAFEQRISNLKEVYTLDGHKMFSRGSVQTILPLNRRLRTGRLCGSYDEKIKDLERAALHVQEEAQQCRKRKRDSEERLQDLQQHQQNVKRRCFSAERNRMSKELAFQDVKNSFAADAGPPSASAVDEISQEISNIQEEIQEKEIILEKLQFSMNEAEAKVEDLKLSFQSLCESAKEEVDTFEAAEKELMEIEKNLQTSESEKAHYEDVMRTRVVGAIKEAESQYRELELLRQDSCRKASVICPESEIEALGGWDGSTPEQLSAQVNRLNQRLKHESHQYSESIEDLRMLYEEKEHKILRKQQTYQAFREKVRACREALDSRWGKFQRNATLLKRQLTWQFNGHLGKKGISGKININYEEKTLSIEVKMPQDASSSNVRDTRGLSGGERSFSTLCFALALHEMTEAPFRAMDEFDVFMDAISRKISLDTLVDFALAQGSQWIFITPHDVGLVKQGERIKKQQMAAPRP
ccccccccccccccccccccEEEEEEEEccccccccEEEcccccEEEEccccccHHHHHHHHHHHHcccccccccHHHHHHcHHccccEEEEEEEEEEcccccccccccccEEEEEEEEEEcccEEEEEccccccccccHHHHHHHHHHccccccccccccccHHHHHHHccccHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHcccccccccccEEEEEEcccccHHHHHHHHHcccccEEEEEcHHHHHHHHHHHHHHcccccEEEEEcccccccccccccccccccccHHcccccccHHHHHHHHHHHccccEEEEccHHHHHHHHHHHcccccEEEEEEcccEEEEcccEEEEcccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEEccccccEEEEEEEccccccccccccccccccHHHHHHHHHHHHHHccccccEEEEEcccccccHHHHHHHHHHHHHHHcccccEEEEEccccccccccccccEEEEcccccc
ccccccccccccccccccccEEEEEEEEEEccEEEEEEEcccEEEEEEEcccccHHHHHHHHHHHHccccccccccccHHHHHHcccccEEEEEEEEccccccccccccccEEEEEEEEEccccEEEEEccccEEEEccHHHHHHHHHHHccccccccEEccHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHcccccHHHHHHHHHHHHHccccccccccccEEEEEccHHHHHHHHHHHHHHHHHHEEEccHHHHHHHHHHHHHccccccEEEEEEccccccccccccccccccccHHEEEEcccHHHHHHHHHcccccEEEEEccHHHHHHHHHcccccccEEEEEccccEEEcccccccEcccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEEEEccccEEEEEEEcccccccccccccccccccccHHHHHHHHHHHHHHHccccEEHcHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEEcccccHcccccccEEEEEcccccc
mgdyrfssesgygpqrsgagtiTRVRLENFMCHSSLQIELGEwvnfitgqngsgkSAILTALCIAFGCRAKGTQRAATLKDFIKTGCSYAMVEVELKnrgedafkpeifgdsiiierriteststtvlkdhqgkrVASRKQELLELIDHfnidvenpcvimsqdksreflhsgndkdkfKFFFKATLLQQVNDLLQSIYNHLNKGDALVLELEATIKPTEKELSELQRKIRNMEHVEEITQDLQRLKKKLAWSWVYDVDRQLKEQTLKIEKLKDRIPRCQAKIDSRHSILESLRDCFMKKKAEIAVMVEKTSEVRRRKDELQQSISLATKEKLELEGELVRNTSYMQKMVNRVKGLEQQVHDIQEQHVRNTQAEESEIEAKLKELQCEIDAANITLSRMKEEDSALSEKLSKEKNEIRRISDEIEDYDKKCREIRSEIRELQQHQTNKVTAFGGDRVISLLRAIERhhhkfksppigpigshvtlvngdtwaPAVEQAIGRLLNAFIVTDHKDALLLRGCAREANYNHLQIIIydfsrprlslphhmlphtkhpttlsvlqsdnptVINVLVDMGSAERQVLVRDYDVGKAVAFEQRISNLKEVytldghkmfsrgsvqtilplnrrlrtgrlcgsydEKIKDLERAALHVQEEAQQCRKRKRDSEERLQDLQQHQQNVKRRCFSAERNRMSKELAFQDvknsfaadagppsasaVDEISQEISNIQEEIQEKEIILEKLQFSMNEAEAKVEDLKLSFQSLCESAKEEVDTFEAAEKELMEIEKNLQTsesekahyeDVMRTRVVGAIKEAESQYRELELLRQDScrkasvicpeseiealggwdgstpeQLSAQVNRLNQRlkheshqysESIEDLRMLYEEKEHKILRKQQTYQAFREKVRACREALDSRWGKFQRNATLLKRQLTWQFnghlgkkgisgkininyeEKTLSIEVkmpqdasssnvrdtrglsggersFSTLCFALALHEMteapframdEFDVFMDAISRKISLDTLVDFALAqgsqwifitphdvglvkqGERIkkqqmaaprp
mgdyrfssesgygpqrsgaGTITRVRLENFMCHSSLQIELGEWVNFITGQNGSGKSAILTALCIAFGCRAKGTQRAATLKDFIKTGCSYAMVEVElknrgedafkpeifgdsiiierriteststtvlkdhqgkrvASRKQELLELIDHFNIDVENPCVIMSQDKSREFLHSGNDKDKFKFFFKATLLQQVNDLLQSIYNHLNKGDALVLELEATIKPTEKELSELQRKIRNMEHVEEITQDLQRLKKKLAWSWVYDVDRQLkeqtlkieklkdriprcqakidsrhsilESLRDCFMKKKAEIAVMvektsevrrrkdelqqsislatkeklelegelvRNTSYMQKMVNRVKGLEQQVHDIQEQHVRNTQAEESEIEAKLKELQCEIDAANItlsrmkeedsalseklskekneirrisdeiedydKKCREIRSEIrelqqhqtnkvtafggDRVISLLRAIERHHhkfksppigpiGSHVTLVNGDTWAPAVEQAIGRLLNAFIVTDHKDALLLRGCAREANYNHLQIIIYDFSRPRLSLPHHMLPHTKHpttlsvlqsdNPTVINVLVDMGSAERQVLVRDYDVGKAVAFEQRISNLKEVYtldghkmfsrgsvqtilplnrrlrtgrlCGSYDEKIKDLERAALHVQEEAQQCRKRKRDSEERLQDlqqhqqnvkrrCFSAERNRMSKELAFQDVKNSFAADAGPPSASAVDEISQEISNIQEEIQEKEIILEKLQFSMNEAEAKVEDLKLSFQSLCESAKEEVDTFEAAEKELMEIEKNlqtsesekahyedVMRTRVVGAIKEAESQYRELELLRQDSCRKASVICPESEIEALGGWDGSTPEQLSAQVNRLNQRLkheshqysesiEDLRMLYEEKEHKILRKQQTYQAFREKVRACREALDSRWGKFQRNATLLKRQLTWqfnghlgkkgisgkiNINYEEKTLSIEvkmpqdasssnvrdtrglsggeRSFSTLCFALALHEMTEAPFRAMDEFDVFMDAISRKISLDTLVDFALAQGSQWIFITPHDVGLVKQGErikkqqmaaprp
MGDYRFSSESGYGPQRSGAGTITRVRLENFMCHSSLQIELGEWVNFITGQNGSGKSAILTALCIAFGCRAKGTQRAATLKDFIKTGCSYAMVEVELKNRGEDAFKPEIFGDSIIIERRITESTSTTVLKDHQGKRVASRKQELLELIDHFNIDVENPCVIMSQDKSREFLHSGNdkdkfkfffkATLLQQVNDLLQSIYNHLNKGDALVLELEATIKPTEKELSELQRKIRNMEHVEEITQDLQRLKKKLAWSWVYDVDRQLKEQTLKIEKLKDRIPRCQAKIDSRHSILESLRDCFMKKKAEIAVMVEKTSEVRRRKDELQQSISLATKEKLELEGELVRNTSYMQKMVNRVKGLEQQVHDIQEQHVRNTQAEESEIEAKLKELQCEIDAANITLSRMKEEDSALSEKLSKEKNEIRRISDEIEDYDKKCREIRSEIRELQQHQTNKVTAFGGDRVISLLRAIERHHHKFKSPPIGPIGSHVTLVNGDTWAPAVEQAIGRLLNAFIVTDHKDALLLRGCAREANYNHLQIIIYDFSRPRLSLPHHMLPHTKHPTTLSVLQSDNPTVINVLVDMGSAERQVLVRDYDVGKAVAFEQRISNLKEVYTLDGHKMFSRGSVQTILPLNRRLRTGRLCGSYDEKIKDLERAALHVQEEAQQCRKRKRDSEERLQDLQQHQQNVKRRCFSAERNRMSKELAFQDVKNSFAADAGPPSASAVDeisqeisniqeeiqekeiileklqFSMNEAEAKVEDLKLSFQSLCESAKEEVDTFEAAEKELMEIEKNLQTSESEKAHYEDVMRTRVVGAIKEAESQYRELELLRQDSCRKASVICPESEIEALGGWDGSTPEQLSAQVNRLNQRLKHESHQYSESIEDLRMLYEEKEHKILRKQQTYQAFREKVRACREALDSRWGKFQRNATLLKRQLTWQFNGHLGKKGISGKININYEEKTLSIEVKMPQDASSSNVRDTRGLSGGERSFSTLCFALALHEMTEAPFRAMDEFDVFMDAISRKISLDTLVDFALAQGSQWIFITPHDVGLVKQGERIKKQQMAAPRP
********************TITRVRLENFMCHSSLQIELGEWVNFITGQNGSGKSAILTALCIAFGCRAKGTQRAATLKDFIKTGCSYAMVEVELKNRGEDAFKPEIFGDSIIIERRITESTSTTVL***********KQELLELIDHFNIDVENPCVIMSQDKSREFLHSGNDKDKFKFFFKATLLQQVNDLLQSIYNHLNKGDALVLELEATIK*****************HVEEITQDLQRLKKKLAWSWVYDVDRQLKEQTLKIEKLKDRIPRCQAKIDSRHSILESLRDCFMKKKAEIAVMV*****************************************************************************************************************************************TNKVTAFGGDRVISLLRAIERHHHKFKSPPIGPIGSHVTLVNGDTWAPAVEQAIGRLLNAFIVTDHKDALLLRGCAREANYNHLQIIIYDFSRPRLSLPHHMLPHTKHPTTLSVLQSDNPTVINVLVDMGSAERQVLVRDYDVGKAVAFEQRISNLKEVYTLDGHKMFSRGSVQTILPLNRRLRTGRLCGSYDEKIKDL******************************************************************************************IILEKLQF********************************************************VMRTRVVGAIKEA**QYRELELLRQDSCRKASVICPESEIEALGGW**********************************MLYE**EHKILRKQQTYQAFREKVRACREALDSRWGKFQRNATLLKRQLTWQFNGHLGKKGISGKININYEEKTL***************************FSTLCFALALHEMTEAPFRAMDEFDVFMDAISRKISLDTLVDFALAQGSQWIFITPHDVGLVK***************
********************TITRVRLENFMCHSSLQIELGEWVNFITGQNGSGKSAILTALCIAFG***************IKTGCSYAMVEVELKNRGEDAFKPEIFGDSIIIERRITESTSTTVLKDHQGKRVASRKQELLELIDHFNIDVENPCVIMSQDKSREFLH**ND*DKFKFFFKATLLQQVNDLLQSI**************************************EEITQDLQRLKKKLAWSWVYDVDRQL**************************************************************************************************************************************************************************************************VISLLRAIERHH*KFKSPPIGPIGSHVTLVNGDTWAPAVEQAIGRLLNAFIVTDHKDALLLRGCAREANYNHLQIIIYD*****************HPTTLSVLQSDNPTVINVLVDMGSAERQVLVRDYDVGKAVAFEQRISNLKEVYTLDGHK**************************************************************************************************************************************EAEAKVEDLKLSFQSLCES**********************Q**ESE*AHYEDVM*T***********************************************EQLSAQVNRLNQR**************LRMLYEEKEHKILRKQQ**QA*REKVRACREALDSRWGKFQRNATLLKRQLTWQFNGHLGKKGISGKININYEEKTLSIEV*********************RSFSTLCFALALHEMTEAPFRAMDEFDVFMDAISRKISLDTLVDFALAQGSQWIFITPHDVGLVKQGERIKKQQMAAP**
******************AGTITRVRLENFMCHSSLQIELGEWVNFITGQNGSGKSAILTALCIAFGCRAKGTQRAATLKDFIKTGCSYAMVEVELKNRGEDAFKPEIFGDSIIIERRITEST**************SRKQELLELIDHFNIDVENPCVIMSQDKSREFLHSGNDKDKFKFFFKATLLQQVNDLLQSIYNHLNKGDALVLELEATIKPTEKELSELQRKIRNMEHVEEITQDLQRLKKKLAWSWVYDVDRQLKEQTLKIEKLKDRIPRCQAKIDSRHSILESLRDCFMKKKAEIAVMVEKTSEVRRRKDELQQSISLATKEKLELEGELVRNTSYMQKMVNRVKGLEQQVHDIQEQHVRNTQAEESEIEAKLKELQCEIDAANITLSR****************NEIRRISDEIEDYDKKCREIRSEIRELQQHQTNKVTAFGGDRVISLLRAIERHHHKFKSPPIGPIGSHVTLVNGDTWAPAVEQAIGRLLNAFIVTDHKDALLLRGCAREANYNHLQIIIYDFSRPRLSLPHHMLPHTKHPTTLSVLQSDNPTVINVLVDMGSAERQVLVRDYDVGKAVAFEQRISNLKEVYTLDGHKMFSRGSVQTILPLNRRLRTGRLCGSYDEKIKDLERAALHV******************************RCFSAERNRMSKELAFQDVKNSFAA***********EISQEISNIQEEIQEKEIILEKLQFSMNEAEAKVEDLKLSFQSLCESAKEEVDTFEAAEKELMEIEKNLQTSESEKAHYEDVMRTRVVGAIKEAESQYRELELLRQDSCRKASVICPESEIEALGGWDGSTPEQLSAQVNRLNQRLKHESHQYSESIEDLRMLYEEKEHKILRKQQTYQAFREKVRACREALDSRWGKFQRNATLLKRQLTWQFNGHLGKKGISGKININYEEKTLSIEVK*****************GGERSFSTLCFALALHEMTEAPFRAMDEFDVFMDAISRKISLDTLVDFALAQGSQWIFITPHDVGLVKQGER***********
****************SGAGTITRVRLENFMCHSSLQIELGEWVNFITGQNGSGKSAILTALCIAFGCRAK***RAATLKDFIKTGCSYAMVEVELKNRGEDAFKPEIFGDSIIIERRITESTSTTVLKDHQGKRVASRKQELLELIDHFNIDVENPCVIMSQDKSREFLHSGNDKDKFKFFFKATLLQQVNDLLQSIYNHLNKGDALVLELEATIKPTEKELSELQRKIRNMEHVEEITQDLQRLKKKLAWSWVYDVDRQLKEQTLKIEKLKDRIPRCQAKIDSRHSILESLRDCFMKKKAEIAVMVEKTSEVRRRKDELQQSISLATKEKLELEGELVRNTSYMQKMVNRVKGLEQQVHDIQEQHVRNTQAEESEIEAKLKELQCEIDAANITLSRMKEEDSALSEKLSKEKNEIRRISDEIEDYDKKCREIRSEIRELQQHQTNKVTAFGGDRVISLLRAIERHHHKFKSPPIGPIGSHVTLVNGDTWAPAVEQAIGRLLNAFIVTDHKDALLLRGCAREANYNHLQIIIYDFSRPRLSLPHHMLPHTKHPTTLSVLQSDNPTVINVLVDMGSAERQVLVRDYDVGKAVAFEQRISNLKEVYTLDGHKMFSRGSVQTILPLNRRLRTGRLCGSYDEKIKDLERAALHVQEEAQQCRKRKRDSEERLQDLQQHQQNVKRRCFSAERNRMSKELAFQDVKNSFAADAGPPSASAVDEISQEISNIQEEIQEKEIILEKLQFSMNEAEAKVEDLKLSFQSLCESAKEEVDTFEAAEKELMEIEKNLQTSESEKAHYEDVMRTRVVGAIKEAESQYRELELLRQDSCRKASVICPESEIEALGGWDGSTPEQLSAQVNRLNQRLKHESHQYSESIEDLRMLYEEKEHKILRKQQTYQAFREKVRACREALDSRWGKFQRNATLLKRQLTWQFNGHLGKKGISGKININYEEKTLSIEVKMPQ*****************RSFSTLCFALALHEMTEAPFRAMDEFDVFMDAISRKISLDTLVDFALAQGSQWIFITPHDVGLVKQGERIKKQQMA****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGDYRFSSESGYGPQRSGAGTITRVRLENFMCHSSLQIELGEWVNFITGQNGSGKSAILTALCIAFGCRAKGTQRAATLKDFIKTGCSYAMVEVELKNRGEDAFKPEIFGDSIIIERRITESTSTTVLKDHQGKRVASRKQELLELIDHFNIDVENPCVIMSQDKSREFLHSGNDKDKFKFFFKATLLQQVNDLLQSIYNHLNKGDALxxxxxxxxxxxxxxxxxxxxxxxxxxxxEEITQDLQRLKKKLAWSWVYDVDRQxxxxxxxxxxxxxxxxxxxxxIDSRHSILESLRDCFMKKKAEIAVMVEKTSEVRRRxxxxxxxxxxxxxxxxxxxxxLVRNTSYxxxxxxxxxxxxxxxxxxxxxHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxQTNKVTAFGGDRVISLLRAIERHHHKFKSPPIGPIGSHVTLVNGDTWAPAVEQAIGRLLNAFIVTDHKDALLLRGCAREANYNHLQIIIYDFSRPRLSLPHHMLPHTKHPTTLSVLQSDNPTVINVLVDMGSAERQVLVRDYDVGKAVAFEQRISNLKEVYTLDGHKMFSRGSVQTILPLNRRLRTGRLCGSYDEKxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxRMSKELAFQDVKNSFAADAGPPSASAxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxMRTRVVGAxxxxxxxxxxxxxxxxxxxxxASVICPESEIEALGGWDGSTPEQLSAQVNRLNQRLKHESHQYSESxxxxxxxxxxxxxxxxxxxxxxxxxxxxVRACREALDSRWGKFQRNATLLKRQLTWQFNGHLGKKGISGKININYEEKTLSIEVKMPQDASSSNVRDTRGLSGGERSFSTLCFALALHEMTEAPFRAMDEFDVFMDAISRKISLDTLVDFALAQGSQWIFITPHDVGLVKQGERIKKQQMAAPRP
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query1058 2.2.26 [Sep-21-2011]
Q96SB81091 Structural maintenance of yes no 0.944 0.915 0.276 1e-105
Q924W51097 Structural maintenance of yes no 0.939 0.906 0.276 1e-104
Q6P9I71128 Structural maintenance of N/A no 0.943 0.884 0.271 1e-103
Q802R81090 Structural maintenance of N/A no 0.932 0.905 0.270 2e-96
P536921140 Structural maintenance of yes no 0.882 0.819 0.270 4e-87
Q127491114 Structural maintenance of yes no 0.915 0.869 0.249 3e-81
Q54I561185 Structural maintenance of yes no 0.529 0.472 0.279 2e-58
O137101076 Structural maintenance of no no 0.129 0.127 0.32 1e-17
Q5ZJY51065 Structural maintenance of no no 0.135 0.134 0.348 1e-16
Q8IY181101 Structural maintenance of no no 0.131 0.126 0.304 1e-13
>sp|Q96SB8|SMC6_HUMAN Structural maintenance of chromosomes protein 6 OS=Homo sapiens GN=SMC6 PE=1 SV=2 Back     alignment and function desciption
 Score =  382 bits (981), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 295/1065 (27%), Positives = 545/1065 (51%), Gaps = 66/1065 (6%)

Query: 19   AGTITRVRLENFMCHSSL-QIELGEWVNFITGQNGSGKSAILTALCIAFGCRAKGTQRAA 77
             G I  + L+NFMCHS L   + G  VNF+ G NGSGKSA+LTAL +  G RA  T R +
Sbjct: 45   VGIIESIHLKNFMCHSMLGPFKFGSNVNFVVGNNGSGKSAVLTALIVGLGGRAVATNRGS 104

Query: 78   TLKDFIKTGCSYAMVEVELKNRGEDAFKPEIFGDSIIIERRIT-ESTSTTVLKDHQGKRV 136
            +LK F+K G + A + + L+NRG+DAFK  ++G+SI+I++ I+ + + +  LK   G  V
Sbjct: 105  SLKGFVKDGQNSADISITLRNRGDDAFKASVYGNSILIQQHISIDGSRSYKLKSATGSVV 164

Query: 137  ASRKQELLELIDHFNIDVENPCVIMSQDKSREFLHSGNDKDKFKFFFKATLLQQVNDLLQ 196
            ++RK+EL+ ++DHFNI V+NP  +++Q+ S++FL S N+ DK+KFF KAT L+Q+ +   
Sbjct: 165  STRKEELIAILDHFNIQVDNPVSVLTQEMSKQFLQSKNEGDKYKFFMKATQLEQMKEDYS 224

Query: 197  SIYNHLNKGDALVLELEATIKPTEKELSELQRKIRNMEHVEEITQDLQRLKKKLAWSWVY 256
             I     +    + + E  +   +++  E + + +++  +  +  +L+ LK ++AW+ V 
Sbjct: 225  YIMETKERTKEQIHQGEERLTELKRQCVEKEERFQSIAGLSTMKTNLESLKHEMAWAVVN 284

Query: 257  DVDRQLKEQTLKIEKLKDRIPRCQAKIDSRHSILESLRDCFMKKKAEIAVMVEKTSEVR- 315
            ++++QL      I+  +DR  R   K++ +   L        +K  +I   +EK SE   
Sbjct: 285  EIEKQLNAIRDNIKIGEDRAARLDRKMEEQQVRLNEAE----QKYKDIQDKLEKISEETN 340

Query: 316  -RRKDELQQSISLATKEKLELEGELVRNTSYMQKMVNRVKGLE-------QQVHDIQEQH 367
             R  + +     +  K++   E E++ N S     +N  K L+       +++ ++++  
Sbjct: 341  ARAPECMALKADVVAKKRAYNEAEVLYNRS-----LNEYKALKKDDEQLCKRIEELKKST 395

Query: 368  VRNTQAEESEIEAKLKELQCEIDAANITLSRMKEEDSALSEKLSKEKNEIRRISDEIEDY 427
             ++ + E  E + K+  L+  + A     + + +E     + + K+K E  +I  E  D 
Sbjct: 396  DQSLEPERLERQKKISWLKERVKAFQNQENSVNQEIEQFQQAIEKDKEEHGKIKREELDV 455

Query: 428  DKKCREIRSEIRELQQHQTNKVTAFGGDRVISLLRAIE---RHHHKFKSPPIGPIGSHVT 484
                   + +++EL+  +T+++  FG + V +LL AI+   R  H F   P+GP+G+ + 
Sbjct: 456  KHALSYNQRQLKELKDSKTDRLKRFGPN-VPALLEAIDDAYRQGH-FTYKPVGPLGACIH 513

Query: 485  LVNGDTWAPAVEQAIGRLLNAFIVTDHKDALLLRGCARE---ANYNHLQIIIYDFSRPRL 541
            L + +  A A+E  +  LL A+   +H D  +L+   +       +   II+ +F     
Sbjct: 514  LRDPE-LALAIESCLKGLLQAYCCHNHADERVLQALMKRFYLPGTSRPPIIVSEFRNEIY 572

Query: 542  SLPHHMLPHTKHPTTLSVLQSDNPTVINVLVDMGSAERQVLVRDYDVGKAVAFEQRIS-N 600
             + H    H   PT L+ L+ DN  V N L+DM   E  +L+++  V +AV   Q+   N
Sbjct: 573  DVRHRAAYHPDFPTVLTALEIDNAVVANSLIDMRGIETVLLIKNNSVARAVMQSQKPPKN 632

Query: 601  LKEVYTLDGHKMFSRGSVQTILPLNRRLRTGRLCGSYDEKIKDLERAA-------LHVQE 653
             +E +T DG ++F+ G   +    +   R   L    D +I DLE          L++Q+
Sbjct: 633  CREAFTADGDQVFA-GRYYS----SENTRPKFLSRDVDSEISDLENEVENKTAQILNLQQ 687

Query: 654  EAQQCRKRKRDSEERLQDLQQHQQNVKRRCFSAERNRMSKELAFQDVKNSFAADAGPPSA 713
                  K  + +EE L+  Q H + +K +     R  +S+    ++++   + D      
Sbjct: 688  HLSALEKDIKHNEELLKRCQLHYKELKMKI----RKNISEIRELENIEEHQSVDIATLED 743

Query: 714  SAVDEISQEISNIQEEIQEKEIILEKLQFSMNEAEAKVEDLKLSFQSLCESAKEEVDTFE 773
             A +  S+ +  ++E +++++  +E L+    EAE K + +K     L E A    D   
Sbjct: 744  EAQENKSK-MKMVEEHMEQQKENMEHLKSLKIEAENKYDAIKFKINQLSELADPLKDELN 802

Query: 774  AAEKELMEIEKNLQTSESEKAHYEDVMRTRVVGAIKEAESQYRELELLRQDSCRKASVIC 833
             A+ E+   ++  +  E ++  + D +  +     +E + + +ELE    +   +A  IC
Sbjct: 803  LADSEVDNQKRGKRHYEEKQKEHLDTLNKKK----RELDMKEKELE----EKMSQARQIC 854

Query: 834  PES-EIEALGGWDGSTPEQLSAQVNRLNQRLKHESHQYSESIEDLRMLYEEKEHKILRKQ 892
            PE  E+E            L  ++NRL Q+++ E   + +  E +R  Y+E     L   
Sbjct: 855  PERIEVEKSASI-------LDKEINRLRQKIQAEHASHGDREEIMRQ-YQEARETYLDLD 906

Query: 893  QTYQAFREKVRACREALDSRWGKFQRNATLLKRQLTWQFNGHLGKKGISGKININYEEKT 952
               +  ++ ++   E ++ R+  +Q+    L  +    F+  L ++   GK+N +++ +T
Sbjct: 907  SKVRTLKKFIKLLGEIMEHRFKTYQQFRRCLTLRCKLYFDNLLSQRAYCGKMNFDHKNET 966

Query: 953  LSIEVKMPQDASSSNVRDTRGLSGGERSFSTLCFALALHEMTEAPFRAMDEFDVFMDAIS 1012
            LSI V+ P + + +   D R LSGGERSFST+CF L+L  + E+PFR +DEFDV+MD ++
Sbjct: 967  LSISVQ-PGEGNKAAFNDMRALSGGERSFSTVCFILSLWSIAESPFRCLDEFDVYMDMVN 1025

Query: 1013 RKISLDTLVDFALAQG-SQWIFITPHDVGLVKQGERIKKQQMAAP 1056
            R+I++D ++  A +Q   Q+I +TP  +  +   + I+  +M+ P
Sbjct: 1026 RRIAMDLILKMADSQRFRQFILLTPQSMSSLPSSKLIRILRMSDP 1070
Core component of the SMC5-SMC6 complex, a complex involved in DNA double-strand breaks by homologous recombination. The complex may promote sister chromatid homologous recombination by recruiting the SMC1-SMC3 cohesin complex to double-strand breaks. The complex is required for telomere maintenance via recombination in ALT (alternative lengthening of telomeres) cell lines and mediates sumoylation of shelterin complex (telosome) components which is proposed to lead to shelterin complex disassembly in ALT-associated PML bodies (APBs). Required for recruitment of telomeres to PML nuclear bodies.
Homo sapiens (taxid: 9606)
>sp|Q924W5|SMC6_MOUSE Structural maintenance of chromosomes protein 6 OS=Mus musculus GN=Smc6 PE=2 SV=1 Back     alignment and function description
>sp|Q6P9I7|SMC6_XENLA Structural maintenance of chromosomes protein 6 OS=Xenopus laevis GN=smc6 PE=2 SV=1 Back     alignment and function description
>sp|Q802R8|SMC6_TAKRU Structural maintenance of chromosomes protein 6 OS=Takifugu rubripes GN=smc6 PE=2 SV=1 Back     alignment and function description
>sp|P53692|SMC6_SCHPO Structural maintenance of chromosomes protein 6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=smc6 PE=1 SV=1 Back     alignment and function description
>sp|Q12749|SMC6_YEAST Structural maintenance of chromosomes protein 6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SMC6 PE=1 SV=1 Back     alignment and function description
>sp|Q54I56|SMC6_DICDI Structural maintenance of chromosomes protein 6 OS=Dictyostelium discoideum GN=smc6 PE=3 SV=1 Back     alignment and function description
>sp|O13710|SMC5_SCHPO Structural maintenance of chromosomes protein 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=smc5 PE=1 SV=3 Back     alignment and function description
>sp|Q5ZJY5|SMC5_CHICK Structural maintenance of chromosomes protein 5 OS=Gallus gallus GN=SMC5 PE=2 SV=1 Back     alignment and function description
>sp|Q8IY18|SMC5_HUMAN Structural maintenance of chromosomes protein 5 OS=Homo sapiens GN=SMC5 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1058
2254549791057 PREDICTED: structural maintenance of chr 0.998 0.999 0.726 0.0
2555398131058 structural maintenance of chromosomes 6 0.999 0.999 0.713 0.0
2977449751027 unnamed protein product [Vitis vinifera] 0.969 0.999 0.735 0.0
4494583651052 PREDICTED: structural maintenance of chr 0.986 0.992 0.705 0.0
2240715091046 predicted protein [Populus trichocarpa] 0.985 0.997 0.700 0.0
152402581057 protein MIM [Arabidopsis thaliana] gi|10 0.984 0.985 0.653 0.0
2977971051057 hypothetical protein ARALYDRAFT_496305 [ 0.984 0.985 0.657 0.0
152408351058 structural maintenance of chromosomes 6A 0.995 0.995 0.622 0.0
58806141055 SMC-like protein [Arabidopsis thaliana] 0.980 0.982 0.634 0.0
449519372969 PREDICTED: LOW QUALITY PROTEIN: structur 0.909 0.992 0.683 0.0
>gi|225454979|ref|XP_002278113.1| PREDICTED: structural maintenance of chromosomes protein 6-like [Vitis vinifera] Back     alignment and taxonomy information
 Score = 1576 bits (4081), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 768/1057 (72%), Positives = 911/1057 (86%), Gaps = 1/1057 (0%)

Query: 1    MGDYRFSSESGYGPQRSGAGTITRVRLENFMCHSSLQIELGEWVNFITGQNGSGKSAILT 60
            MGD    ++      RS AG I ++RLENFMCHSSLQIELGEW+NF+TGQNGSGKSAILT
Sbjct: 1    MGDSTVFTQPLSASHRSSAGIILKIRLENFMCHSSLQIELGEWLNFVTGQNGSGKSAILT 60

Query: 61   ALCIAFGCRAKGTQRAATLKDFIKTGCSYAMVEVELKNRGEDAFKPEIFGDSIIIERRIT 120
            ALC+AFG RAK TQRA TLK+FIKTGCSYA+++VE+KN GEDAFKPEI+GD II+ERRI+
Sbjct: 61   ALCVAFGSRAKETQRATTLKEFIKTGCSYAVIQVEIKNEGEDAFKPEIYGDVIIVERRIS 120

Query: 121  ESTSTTVLKDHQGKRVASRKQELLELIDHFNIDVENPCVIMSQDKSREFLHSGNDKDKFK 180
             STS+TVLKDHQGKRVASRK++L EL++HFNIDVENPCVIMSQDKSREFLHSGNDKDKFK
Sbjct: 121  VSTSSTVLKDHQGKRVASRKEDLHELVEHFNIDVENPCVIMSQDKSREFLHSGNDKDKFK 180

Query: 181  FFFKATLLQQVNDLLQSIYNHLNKGDALVLELEATIKPTEKELSELQRKIRNMEHVEEIT 240
            FFFKATLLQQVNDLL +I   L+  + LV ELE +I+P  KEL+ELQ KIRNMEHVEEI+
Sbjct: 181  FFFKATLLQQVNDLLVNIGTRLDSANTLVEELEKSIEPILKELNELQVKIRNMEHVEEIS 240

Query: 241  QDLQRLKKKLAWSWVYDVDRQLKEQTLKIEKLKDRIPRCQAKIDSRHSILESLRDCFMKK 300
            Q +Q+LKKKLAWSWVYDVDRQL+EQ+ KIEKLKDRIP CQA+ID +   +E LR+C  KK
Sbjct: 241  QQVQQLKKKLAWSWVYDVDRQLQEQSAKIEKLKDRIPTCQARIDRQLGKMEELRECLTKK 300

Query: 301  KAEIAVMVEKTSEVRRRKDELQQSISLATKEKLELEGELVRNTSYMQKMVNRVKGLEQQV 360
            K +IA M+EKT+EVRR K++LQQ +SLATKE+LELE E  R T+ +QKMVN V+ L+QQV
Sbjct: 301  KTQIACMMEKTTEVRRMKEDLQQRLSLATKERLELEEEHCRKTNKIQKMVNLVRRLDQQV 360

Query: 361  HDIQEQHVRNTQAEESEIEAKLKELQCEIDAANITLSRMKEEDSALSEKLSKEKNEIRRI 420
            H++ EQ ++NTQAEESEI+  LK LQ E+D  N+ LSR+KEE+SALS  LS + +EIR+I
Sbjct: 361  HEVHEQDLKNTQAEESEIKEMLKGLQDELDTTNLILSRLKEEESALSASLSIKMDEIRKI 420

Query: 421  SDEIEDYDKKCREIRSEIRELQQHQTNKVTAFGGDRVISLLRAIERHHHKFKSPPIGPIG 480
            SDEI+DY++K RE  S I ELQQHQTNKVTAFGGDRVI LLRAIERHH +FK PPIGPIG
Sbjct: 421  SDEIDDYERKHRENYSYICELQQHQTNKVTAFGGDRVIQLLRAIERHHQRFKRPPIGPIG 480

Query: 481  SHVTLVNGDTWAPAVEQAIGRLLNAFIVTDHKDALLLRGCAREANYNHLQIIIYDFSRPR 540
            +H+TLVNGD WA AVE AIG++LNAFIVTDHKD+LLLRGCAREANYNHLQIIIYDFSRPR
Sbjct: 481  AHLTLVNGDIWAIAVEIAIGKMLNAFIVTDHKDSLLLRGCAREANYNHLQIIIYDFSRPR 540

Query: 541  LSLPHHMLPHTKHPTTLSVLQSDNPTVINVLVDMGSAERQVLVRDYDVGKAVAFEQRISN 600
            L++P+HMLP T+HPT +S L SDNPTV+NVLVDMG+AERQVLVRDY+VGK VAF+QRI N
Sbjct: 541  LNIPYHMLPQTQHPTLISALHSDNPTVMNVLVDMGNAERQVLVRDYEVGKTVAFDQRIPN 600

Query: 601  LKEVYTLDGHKMFSRGSVQTILPLNRRLRTGRLCGSYDEKIKDLERAALHVQEEAQQCRK 660
            LKEVYT DG++MFSRGSVQTILP N++ RTGRLC S+D +IKDLER AL +QE  Q+ ++
Sbjct: 601  LKEVYTSDGYRMFSRGSVQTILPPNKKARTGRLCSSFDSQIKDLERYALDIQEHGQEVKR 660

Query: 661  RKRDSEERLQDLQQHQQNVKRRCFSAERNRMSKELAFQDVKNSFAADAGPPSASAVDEIS 720
            +KR++EE LQDLQ   Q++KRR  +AER+ MSK+L  QDVKNS+ A++ P  AS+VDE+ 
Sbjct: 661  KKRNAEEELQDLQDKLQSIKRRRLNAERDVMSKKLRLQDVKNSYVAESNPAPASSVDELH 720

Query: 721  QEISNIQEEIQEKEIILEKLQFSMNEAEAKVEDLKLSFQSLCESAKEEVDTFEAAEKELM 780
             EIS +Q EI+EKEI+LE  Q  M++A+AK  DLKLSF++LCESAK E+D +EAAE EL+
Sbjct: 721  HEISKVQAEIREKEILLEDFQLRMSKADAKANDLKLSFENLCESAKVEIDAYEAAENELV 780

Query: 781  EIEKNLQTSESEKAHYEDVMRTRVVGAIKEAESQYRELELLRQDSCRKASVICPESEIEA 840
             IE+ L ++E+EK HYE +M  +V+  IKEAE+QY+ELE  R++SCRKAS+ICPESEIEA
Sbjct: 781  VIEQELCSAETEKTHYEGIMNNKVLPDIKEAETQYQELEHNRKESCRKASIICPESEIEA 840

Query: 841  LGGWDGSTPEQLSAQVNRLNQRLKHESHQYSESIEDLRMLYEEKEHKILRKQQTYQAFRE 900
            LGG   STPEQLSAQ+NRLNQRL+ ES +Y+E IEDLRM+Y++KE +ILRKQQTY+AFRE
Sbjct: 841  LGGCK-STPEQLSAQLNRLNQRLQSESQRYAEPIEDLRMIYDKKERRILRKQQTYEAFRE 899

Query: 901  KVRACREALDSRWGKFQRNATLLKRQLTWQFNGHLGKKGISGKININYEEKTLSIEVKMP 960
            K+ AC+EALD RW KFQRNATLLKRQLTWQFN HL KKGISG I ++YEEKTLS+EVKMP
Sbjct: 900  KLNACKEALDLRWSKFQRNATLLKRQLTWQFNAHLRKKGISGHIKVSYEEKTLSVEVKMP 959

Query: 961  QDASSSNVRDTRGLSGGERSFSTLCFALALHEMTEAPFRAMDEFDVFMDAISRKISLDTL 1020
            QDAS++ VRDTRGLSGGERSFSTLCFALALHEMTE+PFRAMDEFDVFMDA+SRKISLDTL
Sbjct: 960  QDASNNIVRDTRGLSGGERSFSTLCFALALHEMTESPFRAMDEFDVFMDAVSRKISLDTL 1019

Query: 1021 VDFALAQGSQWIFITPHDVGLVKQGERIKKQQMAAPR 1057
            V+FALAQGSQWIFITPHD+ +VKQGERIKKQQMAAPR
Sbjct: 1020 VNFALAQGSQWIFITPHDISMVKQGERIKKQQMAAPR 1056

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|255539813|ref|XP_002510971.1| structural maintenance of chromosomes 6 smc6, putative [Ricinus communis] gi|223550086|gb|EEF51573.1| structural maintenance of chromosomes 6 smc6, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|297744975|emb|CBI38567.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|449458365|ref|XP_004146918.1| PREDICTED: structural maintenance of chromosomes protein 6-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|224071509|ref|XP_002303494.1| predicted protein [Populus trichocarpa] gi|222840926|gb|EEE78473.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|15240258|ref|NP_200954.1| protein MIM [Arabidopsis thaliana] gi|10177176|dbj|BAB10445.1| SMC-like protein [Arabidopsis thaliana] gi|332010088|gb|AED97471.1| protein MIM [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297797105|ref|XP_002866437.1| hypothetical protein ARALYDRAFT_496305 [Arabidopsis lyrata subsp. lyrata] gi|297312272|gb|EFH42696.1| hypothetical protein ARALYDRAFT_496305 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|15240835|ref|NP_196383.1| structural maintenance of chromosomes 6A [Arabidopsis thaliana] gi|9759587|dbj|BAB11444.1| SMC-like protein [Arabidopsis thaliana] gi|332003807|gb|AED91190.1| structural maintenance of chromosomes 6A [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|5880614|gb|AAD54769.1|AF120932_1 SMC-like protein [Arabidopsis thaliana] gi|5880616|gb|AAD54770.1|AF120933_1 SMC-like protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|449519372|ref|XP_004166709.1| PREDICTED: LOW QUALITY PROTEIN: structural maintenance of chromosomes protein 6-like, partial [Cucumis sativus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1058
TAIR|locus:21611631057 MIM "AT5G61460" [Arabidopsis t 0.983 0.984 0.631 0.0
TAIR|locus:21602891058 SMC6A "structural maintenance 0.995 0.995 0.602 0.0
ZFIN|ZDB-GENE-070705-2871090 si:dkey-119f1.1 "si:dkey-119f1 0.948 0.921 0.288 6.3e-108
UNIPROTKB|E1BFH71101 SMC6 "Uncharacterized protein" 0.949 0.912 0.273 2.5e-104
UNIPROTKB|F1SCS41098 SMC6 "Uncharacterized protein" 0.948 0.914 0.272 6.7e-104
RGD|13112141097 Smc6 "structural maintenance o 0.948 0.915 0.270 1.1e-103
UNIPROTKB|Q96SB81091 SMC6 "Structural maintenance o 0.948 0.919 0.270 2.9e-103
MGI|MGI:19144911097 Smc6 "structural maintenance o 0.948 0.915 0.270 3.7e-103
UNIPROTKB|E2QUA01097 SMC6 "Uncharacterized protein" 0.949 0.916 0.269 6e-103
UNIPROTKB|Q6P9I71128 smc6 "Structural maintenance o 0.958 0.898 0.260 4.2e-102
TAIR|locus:2161163 MIM "AT5G61460" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 3389 (1198.0 bits), Expect = 0., P = 0.
 Identities = 659/1044 (63%), Positives = 818/1044 (78%)

Query:    15 QRSGAGTITRVRLENFMCHSSLQIELGEWVNFITGQNGSGKSAILTALCIAFGCRAKGTQ 74
             QRSG+G+I R+++ENFMCHS+LQIE GEWVNFITGQNGSGKSAILTALC+AFGCRA+GTQ
Sbjct:    15 QRSGSGSILRIKVENFMCHSNLQIEFGEWVNFITGQNGSGKSAILTALCVAFGCRARGTQ 74

Query:    75 RAATLKDFIKTGCSYAMVEVELKNRGEDAFKPEIFGDSIIIERRITESTSTTVLKDHQGK 134
             RAATLKDFIKTGCSYA+V+VE+KN GEDAFKPEI+G  IIIERRITES + TVLKD+ GK
Sbjct:    75 RAATLKDFIKTGCSYAVVQVEMKNSGEDAFKPEIYGGVIIIERRITESATATVLKDYLGK 134

Query:   135 RVASRKQELLELIDHFNIDVENPCVIMSQDKSREFLHSGNXXXXXXXXXXATLLQQVNDL 194
             +V++++ EL EL++HFNIDVENPCV+MSQDKSREFLHSGN          ATLLQQVNDL
Sbjct:   135 KVSNKRDELRELVEHFNIDVENPCVVMSQDKSREFLHSGNDKDKFKFFFKATLLQQVNDL 194

Query:   195 LQSIYNHLNKGDALVLELEATIKPTEKELSELQRKIRNMEHVEEITQDLQRLKKKLAWSW 254
             LQSIY HL K  A+V ELE TIKP EKE+SEL+ KI+NME VEEI Q LQ+LKKKLAWSW
Sbjct:   195 LQSIYEHLTKATAIVDELENTIKPIEKEISELRGKIKNMEQVEEIAQRLQQLKKKLAWSW 254

Query:   255 VYDVDRQLKEQTLKIEKLKDRIPRCQAKIDSRHSILESLRDCFMKKKAEIAVMVEKTSEV 314
             VYDVDRQL+EQT KI KLK+RIP CQAKID     +ESLRD   KKKA++A ++++++ +
Sbjct:   255 VYDVDRQLQEQTEKIVKLKERIPTCQAKIDWELGKVESLRDTLTKKKAQVACLMDESTAM 314

Query:   315 RRRKDELQQSISLATKEKLELEGELVRNTSYMQKMVNRVKGLEQQVHDIQEQHVRNTQAE 374
             +R  +   QS   A +EK+ L+ E     +Y+QK+ +RV+ LE+QV DI EQ ++NTQAE
Sbjct:   315 KREIESFHQSAKTAVREKIALQEEFNHKCNYVQKIKDRVRRLERQVGDINEQTMKNTQAE 374

Query:   375 ESEIEAKLKELQCEIDAANITLSRMKEEDSALSEKLSKEKNEIRRISDEIEDYDKKCREI 434
             +SEIE KLK L+ E++      SR+KEE++   EK  + + ++  I D I+++ K+ R I
Sbjct:   375 QSEIEEKLKYLEQEVEKVETLRSRLKEEENCFLEKAFEGRKKMEHIEDMIKNHQKRQRFI 434

Query:   435 RSEIRELQQHQTNKVTAFGGDRVISLLRAIERHHHKFKSPPIGPIGSHVTLVNGDTWAPA 494
              S I +L++HQTNKVTAFGGDRVI+LL+AIER+H +F+ PPIGPIGSHVTLVNG+ WA +
Sbjct:   435 TSNINDLKKHQTNKVTAFGGDRVINLLQAIERNHRRFRKPPIGPIGSHVTLVNGNKWASS 494

Query:   495 VEQAIGRLLNAFIVTDHKDALLLRGCAREANYNHLQIIIYDFSRPRLSLPHHMLPHTKHP 554
             VEQA+G LLNAFIVTDHKD+L LRGCA EANY +L+IIIYDFSRPRL++P HM+P T+HP
Sbjct:   495 VEQALGTLLNAFIVTDHKDSLTLRGCANEANYRNLKIIIYDFSRPRLNIPRHMVPQTEHP 554

Query:   555 TTLSVLQSDNPTVINVLVDMGSAERQVLVRDYDVGKAVAFEQRISNLKEVYTLDGHKMFS 614
             T  SV+ SDNPTV+NVLVD    ERQVL  +Y+ GKAVAF +R+SNLKEVYTLDG+KMF 
Sbjct:   555 TIFSVIDSDNPTVLNVLVDQSGVERQVLAENYEEGKAVAFGKRLSNLKEVYTLDGYKMFF 614

Query:   615 RGSVQTILP-LNRRLRTGRLCGSYDEKIKDLERAALHVQEEAQQCRKRKRDSEERLQDLQ 673
             RG VQT LP L+RR    RLC S+D++IKDLE  A   Q E  QC +RKR++EE L++L+
Sbjct:   615 RGPVQTTLPPLSRR--PSRLCASFDDQIKDLEIEASKEQNEINQCMRRKREAEENLEELE 672

Query:   674 QHQQNVKRRCFSAERNRMSKELAFQDVKNSFAADAGPPSASAVDXXXXXXXXXXXXXXXX 733
                + +K+    AE+   +KEL   D+KN+ AA+     +S+V+                
Sbjct:   673 LKVRQLKKHRSQAEKVLTTKELEMHDLKNTVAAEIEALPSSSVNELQREIMKDLEEIDEK 732

Query:   734 XXXXXXXXFSMNEAEAKVEDLKLSFQSLCESAKEEVDTFEAAEKELMEIEKNLQTSESEK 793
                       + EAE K   L   F+++ ESAK E+D FE AE EL +IEK+LQ++E+EK
Sbjct:   733 EAFLEKLQNCLKEAELKANKLTALFENMRESAKGEIDAFEEAENELKKIEKDLQSAEAEK 792

Query:   794 AHYEDVMRTRVVGAIKEAESQYRELELLRQDSCRKASVICPESEIEALGGWDGSTPEQLS 853
              HYE++M+ +V+  IK AE+ Y EL+  R++S +KAS ICPESEIE+LG WDGSTPEQLS
Sbjct:   793 IHYENIMKNKVLPDIKNAEANYEELKNKRKESDQKASEICPESEIESLGPWDGSTPEQLS 852

Query:   854 AQVNRLNQRLKHESHQYSESIEDLRMLYEEKEHKILRKQQTYQAFREKVRACREALDSRW 913
             AQ+ R+NQRL  E+ Q+SESI+DLRM+YE  E KI +K+++YQ  REK+ AC+ ALDSRW
Sbjct:   853 AQITRMNQRLHRENQQFSESIDDLRMMYESLERKIAKKRKSYQDHREKLMACKNALDSRW 912

Query:   914 GKFQRNATLLKRQLTWQFNGHLGKKGISGKININYEEKTLSIEVKMPQDASSSNVRDTRG 973
              KFQRNA+LL+RQLTWQFN HLGKKGISG I ++YE KTLSIEVKMPQDA+S+ VRDT+G
Sbjct:   913 AKFQRNASLLRRQLTWQFNAHLGKKGISGHIKVSYENKTLSIEVKMPQDATSNVVRDTKG 972

Query:   974 LSGGERSFSTLCFALALHEMTEAPFRAMDEFDVFMDAISRKISLDTLVDFALAQGSQWIF 1033
             LSGGERSFSTLCFALALHEMTEAPFRAMDEFDVFMDA+SRKISLD LVDFA+ +GSQW+F
Sbjct:   973 LSGGERSFSTLCFALALHEMTEAPFRAMDEFDVFMDAVSRKISLDALVDFAIGEGSQWMF 1032

Query:  1034 ITPHDVGLVKQGERIKKQQMAAPR 1057
             ITPHD+ +VK  ERIKKQQMAAPR
Sbjct:  1033 ITPHDISMVKSHERIKKQQMAAPR 1056
GO:0005524 "ATP binding" evidence=ISS
GO:0005634 "nucleus" evidence=ISM;ISS
GO:0007059 "chromosome segregation" evidence=ISS
GO:0006302 "double-strand break repair" evidence=IMP
GO:0000724 "double-strand break repair via homologous recombination" evidence=RCA;IMP
GO:0007062 "sister chromatid cohesion" evidence=RCA;IMP
GO:0010165 "response to X-ray" evidence=IMP
GO:0000278 "mitotic cell cycle" evidence=RCA
GO:0006259 "DNA metabolic process" evidence=RCA
GO:0006261 "DNA-dependent DNA replication" evidence=RCA
GO:0006275 "regulation of DNA replication" evidence=RCA
GO:0006306 "DNA methylation" evidence=RCA
GO:0006355 "regulation of transcription, DNA-dependent" evidence=RCA
GO:0007126 "meiosis" evidence=RCA
GO:0009555 "pollen development" evidence=RCA
GO:0016444 "somatic cell DNA recombination" evidence=RCA
GO:0016568 "chromatin modification" evidence=RCA
GO:0031047 "gene silencing by RNA" evidence=RCA
GO:0031048 "chromatin silencing by small RNA" evidence=RCA
GO:0033044 "regulation of chromosome organization" evidence=RCA
GO:0043687 "post-translational protein modification" evidence=RCA
GO:0045132 "meiotic chromosome segregation" evidence=RCA
GO:0045893 "positive regulation of transcription, DNA-dependent" evidence=RCA
GO:0051726 "regulation of cell cycle" evidence=RCA
TAIR|locus:2160289 SMC6A "structural maintenance of chromosomes 6A" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-070705-287 si:dkey-119f1.1 "si:dkey-119f1.1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|E1BFH7 SMC6 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1SCS4 SMC6 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
RGD|1311214 Smc6 "structural maintenance of chromosomes 6" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q96SB8 SMC6 "Structural maintenance of chromosomes protein 6" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:1914491 Smc6 "structural maintenance of chromosomes 6" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|E2QUA0 SMC6 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q6P9I7 smc6 "Structural maintenance of chromosomes protein 6" [Xenopus laevis (taxid:8355)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1058
cd03276198 cd03276, ABC_SMC6_euk, ATP-binding cassette domain 3e-47
cd03276198 cd03276, ABC_SMC6_euk, ATP-binding cassette domain 1e-42
COG11961163 COG1196, Smc, Chromosome segregation ATPases [Cell 4e-35
TIGR021681179 TIGR02168, SMC_prok_B, chromosome segregation prot 4e-25
COG11961163 COG1196, Smc, Chromosome segregation ATPases [Cell 2e-21
COG0419908 COG0419, SbcC, ATPase involved in DNA repair [DNA 3e-19
cd03277213 cd03277, ABC_SMC5_euk, ATP-binding cassette domain 3e-19
TIGR021691164 TIGR02169, SMC_prok_A, chromosome segregation prot 1e-15
COG11961163 COG1196, Smc, Chromosome segregation ATPases [Cell 6e-15
cd03239178 cd03239, ABC_SMC_head, The SMC head domain belongs 5e-14
TIGR021691164 TIGR02169, SMC_prok_A, chromosome segregation prot 6e-14
pfam13476204 pfam13476, AAA_23, AAA domain 2e-13
cd03239178 cd03239, ABC_SMC_head, The SMC head domain belongs 4e-13
TIGR00634563 TIGR00634, recN, DNA repair protein RecN 2e-12
TIGR021691164 TIGR02169, SMC_prok_A, chromosome segregation prot 3e-12
pfam02463 1162 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain 1e-11
PRK03918880 PRK03918, PRK03918, chromosome segregation protein 5e-11
cd03277213 cd03277, ABC_SMC5_euk, ATP-binding cassette domain 1e-10
COG11961163 COG1196, Smc, Chromosome segregation ATPases [Cell 2e-10
PRK01156895 PRK01156, PRK01156, chromosome segregation protein 4e-10
COG0497557 COG0497, RecN, ATPase involved in DNA repair [DNA 2e-09
cd03227162 cd03227, ABC_Class2, ATP-binding cassette domain o 2e-09
cd03241276 cd03241, ABC_RecN, ATP-binding cassette domain of 3e-09
COG11961163 COG1196, Smc, Chromosome segregation ATPases [Cell 3e-08
TIGR021691164 TIGR02169, SMC_prok_A, chromosome segregation prot 4e-08
TIGR021691164 TIGR02169, SMC_prok_A, chromosome segregation prot 5e-08
TIGR02168 1179 TIGR02168, SMC_prok_B, chromosome segregation prot 1e-07
cd03240204 cd03240, ABC_Rad50, ATP-binding cassette domain of 1e-07
COG1195363 COG1195, RecF, Recombinational DNA repair ATPase ( 2e-07
PRK02224880 PRK02224, PRK02224, chromosome segregation protein 2e-07
TIGR02168 1179 TIGR02168, SMC_prok_B, chromosome segregation prot 3e-07
pfam024631162 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain 3e-07
PRK03918880 PRK03918, PRK03918, chromosome segregation protein 3e-07
TIGR021681179 TIGR02168, SMC_prok_B, chromosome segregation prot 6e-07
PRK00064361 PRK00064, recF, recombination protein F; Reviewed 8e-07
TIGR021691164 TIGR02169, SMC_prok_A, chromosome segregation prot 1e-06
PRK03918880 PRK03918, PRK03918, chromosome segregation protein 3e-06
PRK03918880 PRK03918, PRK03918, chromosome segregation protein 8e-06
cd03273251 cd03273, ABC_SMC2_euk, ATP-binding cassette domain 8e-06
TIGR021691164 TIGR02169, SMC_prok_A, chromosome segregation prot 1e-05
cd03227162 cd03227, ABC_Class2, ATP-binding cassette domain o 1e-05
TIGR00611365 TIGR00611, recf, recF protein 1e-05
pfam08317321 pfam08317, Spc7, Spc7 kinetochore protein 1e-05
TIGR021681179 TIGR02168, SMC_prok_B, chromosome segregation prot 3e-05
TIGR021691164 TIGR02169, SMC_prok_A, chromosome segregation prot 3e-05
PRK03918880 PRK03918, PRK03918, chromosome segregation protein 3e-05
pfam01496707 pfam01496, V_ATPase_I, V-type ATPase 116kDa subuni 4e-05
PTZ00491850 PTZ00491, PTZ00491, major vault protein; Provision 4e-05
PRK03918880 PRK03918, PRK03918, chromosome segregation protein 5e-05
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 7e-05
PRK03918880 PRK03918, PRK03918, chromosome segregation protein 7e-05
cd03242270 cd03242, ABC_RecF, ATP-binding cassette domain of 1e-04
COG0419908 COG0419, SbcC, ATPase involved in DNA repair [DNA 2e-04
cd03279213 cd03279, ABC_sbcCD, ATP-binding cassette domain of 3e-04
PHA02562562 PHA02562, 46, endonuclease subunit; Provisional 4e-04
pfam13166713 pfam13166, AAA_13, AAA domain 4e-04
pfam13304256 pfam13304, AAA_21, AAA domain 4e-04
cd00267157 cd00267, ABC_ATPase, ATP-binding cassette transpor 6e-04
COG3593581 COG3593, COG3593, Predicted ATP-dependent endonucl 7e-04
TIGR02169 1164 TIGR02169, SMC_prok_A, chromosome segregation prot 8e-04
PRK01156895 PRK01156, PRK01156, chromosome segregation protein 0.001
cd03275247 cd03275, ABC_SMC1_euk, ATP-binding cassette domain 0.001
cd03278197 cd03278, ABC_SMC_barmotin, ATP-binding cassette do 0.001
COG1106371 COG1106, COG1106, Predicted ATPases [General funct 0.001
cd03274212 cd03274, ABC_SMC4_euk, ATP-binding cassette domain 0.001
TIGR02169 1164 TIGR02169, SMC_prok_A, chromosome segregation prot 0.002
cd03272243 cd03272, ABC_SMC3_euk, ATP-binding cassette domain 0.002
smart00787312 smart00787, Spc7, Spc7 kinetochore protein 0.002
pfam01576859 pfam01576, Myosin_tail_1, Myosin tail 0.002
COG1269660 COG1269, NtpI, Archaeal/vacuolar-type H+-ATPase su 0.003
cd03278197 cd03278, ABC_SMC_barmotin, ATP-binding cassette do 0.004
pfam01576859 pfam01576, Myosin_tail_1, Myosin tail 0.004
pfam13175320 pfam13175, AAA_15, AAA ATPase domain 0.004
COG1340294 COG1340, COG1340, Uncharacterized archaeal coiled- 0.004
>gnl|CDD|213243 cd03276, ABC_SMC6_euk, ATP-binding cassette domain of eukaryotic SM6 proteins Back     alignment and domain information 
 Score =  167 bits (424), Expect = 3e-47
 Identities = 58/155 (37%), Positives = 68/155 (43%), Gaps = 52/155 (33%)

Query: 22  ITRVRLENFMCHSSLQIELGEWVNFITGQNGSGKSAILTALCIAFGCRAKGTQRAATLKD 81
           I  + L+NFMCH  LQIE G  VNFI G NGSGKSAILTAL I  G +A  T R ++LKD
Sbjct: 1   IESITLKNFMCHRHLQIEFGPRVNFIVGNNGSGKSAILTALTIGLGGKASDTNRGSSLKD 60

Query: 82  FIKTGCSYAMVEVELKNRGEDAFKPEIFGDSIIIERRITESTSTTVLKDHQGKRVASRKQ 141
            IK G S A + V LKN+G DA                                      
Sbjct: 61  LIKDGESSAKITVTLKNQGLDA-------------------------------------- 82

Query: 142 ELLELIDHFNIDVENPCVIMSQDKSREFLHSGNDK 176
                         NP  ++SQD +R FL S    
Sbjct: 83  --------------NPLCVLSQDMARSFLTSNKAA 103

The structural maintenance of chromosomes (SMC) proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains. Amino-acid sequence homology of SMC proteins between species is largely confined to the amino- and carboxy-terminal globular domains. The amino-terminal domain contains a 'Walker A' nucleotide-binding domain (GxxGxGKS/T, in the single-letter amino-acid code), which by mutational studies has been shown to be essential in several proteins. The carboxy-terminal domain contains a sequence (the DA-box) that resembles a 'Walker B' motif, and a motif with homology to the signature sequence of the ATP-binding cassette (ABC) family of ATPases. The sequence homology within the carboxy-terminal domain is relatively high within the SMC1-SMC4 group, whereas SMC5 and SMC6 show some divergence in both of these sequences. In eukaryotic cells, the proteins are found as heterodimers of SMC1 paired with SMC3, SMC2 with SMC4, and SMC5 with SMC6 (formerly known as Rad18). Length = 198
>gnl|CDD|213243 cd03276, ABC_SMC6_euk, ATP-binding cassette domain of eukaryotic SM6 proteins Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|213244 cd03277, ABC_SMC5_euk, ATP-binding cassette domain of eukaryotic SMC5 proteins Back     alignment and domain information
>gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|213206 cd03239, ABC_SMC_head, The SMC head domain belongs to the ATP-binding cassette superfamily Back     alignment and domain information
>gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>gnl|CDD|222160 pfam13476, AAA_23, AAA domain Back     alignment and domain information
>gnl|CDD|213206 cd03239, ABC_SMC_head, The SMC head domain belongs to the ATP-binding cassette superfamily Back     alignment and domain information
>gnl|CDD|233065 TIGR00634, recN, DNA repair protein RecN Back     alignment and domain information
>gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain Back     alignment and domain information
>gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional Back     alignment and domain information
>gnl|CDD|213244 cd03277, ABC_SMC5_euk, ATP-binding cassette domain of eukaryotic SMC5 proteins Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|100796 PRK01156, PRK01156, chromosome segregation protein; Provisional Back     alignment and domain information
>gnl|CDD|223571 COG0497, RecN, ATPase involved in DNA repair [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|213194 cd03227, ABC_Class2, ATP-binding cassette domain of non-transporter proteins Back     alignment and domain information
>gnl|CDD|213208 cd03241, ABC_RecN, ATP-binding cassette domain of RecN Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|213207 cd03240, ABC_Rad50, ATP-binding cassette domain of Rad50 Back     alignment and domain information
>gnl|CDD|224116 COG1195, RecF, Recombinational DNA repair ATPase (RecF pathway) [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|179385 PRK02224, PRK02224, chromosome segregation protein; Provisional Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain Back     alignment and domain information
>gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|234608 PRK00064, recF, recombination protein F; Reviewed Back     alignment and domain information
>gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional Back     alignment and domain information
>gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional Back     alignment and domain information
>gnl|CDD|213240 cd03273, ABC_SMC2_euk, ATP-binding cassette domain of eukaryotic SMC2 proteins Back     alignment and domain information
>gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>gnl|CDD|213194 cd03227, ABC_Class2, ATP-binding cassette domain of non-transporter proteins Back     alignment and domain information
>gnl|CDD|233051 TIGR00611, recf, recF protein Back     alignment and domain information
>gnl|CDD|219791 pfam08317, Spc7, Spc7 kinetochore protein Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional Back     alignment and domain information
>gnl|CDD|216531 pfam01496, V_ATPase_I, V-type ATPase 116kDa subunit family Back     alignment and domain information
>gnl|CDD|240439 PTZ00491, PTZ00491, major vault protein; Provisional Back     alignment and domain information
>gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional Back     alignment and domain information
>gnl|CDD|213209 cd03242, ABC_RecF, ATP-binding cassette domain of RecF Back     alignment and domain information
>gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|213246 cd03279, ABC_sbcCD, ATP-binding cassette domain of sbcCD Back     alignment and domain information
>gnl|CDD|222878 PHA02562, 46, endonuclease subunit; Provisional Back     alignment and domain information
>gnl|CDD|221952 pfam13166, AAA_13, AAA domain Back     alignment and domain information
>gnl|CDD|222036 pfam13304, AAA_21, AAA domain Back     alignment and domain information
>gnl|CDD|213179 cd00267, ABC_ATPase, ATP-binding cassette transporter nucleotide-binding domain Back     alignment and domain information
>gnl|CDD|226121 COG3593, COG3593, Predicted ATP-dependent endonuclease of the OLD family [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>gnl|CDD|100796 PRK01156, PRK01156, chromosome segregation protein; Provisional Back     alignment and domain information
>gnl|CDD|213242 cd03275, ABC_SMC1_euk, ATP-binding cassette domain of eukaryotic SMC1 proteins Back     alignment and domain information
>gnl|CDD|213245 cd03278, ABC_SMC_barmotin, ATP-binding cassette domain of barmotin, a member of the SMC protein family Back     alignment and domain information
>gnl|CDD|224031 COG1106, COG1106, Predicted ATPases [General function prediction only] Back     alignment and domain information
>gnl|CDD|213241 cd03274, ABC_SMC4_euk, ATP-binding cassette domain of eukaryotic SMC4 proteins Back     alignment and domain information
>gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>gnl|CDD|213239 cd03272, ABC_SMC3_euk, ATP-binding cassette domain of eukaryotic SMC3 proteins Back     alignment and domain information
>gnl|CDD|197874 smart00787, Spc7, Spc7 kinetochore protein Back     alignment and domain information
>gnl|CDD|144972 pfam01576, Myosin_tail_1, Myosin tail Back     alignment and domain information
>gnl|CDD|224188 COG1269, NtpI, Archaeal/vacuolar-type H+-ATPase subunit I [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|213245 cd03278, ABC_SMC_barmotin, ATP-binding cassette domain of barmotin, a member of the SMC protein family Back     alignment and domain information
>gnl|CDD|144972 pfam01576, Myosin_tail_1, Myosin tail Back     alignment and domain information
>gnl|CDD|221957 pfam13175, AAA_15, AAA ATPase domain Back     alignment and domain information
>gnl|CDD|224259 COG1340, COG1340, Uncharacterized archaeal coiled-coil protein [Function unknown] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 1058
KOG02501074 consensus DNA repair protein RAD18 (SMC family pro 100.0
COG11961163 Smc Chromosome segregation ATPases [Cell division 100.0
KOG09791072 consensus Structural maintenance of chromosome pro 100.0
KOG09961293 consensus Structural maintenance of chromosome pro 100.0
KOG09331174 consensus Structural maintenance of chromosome pro 100.0
KOG09641200 consensus Structural maintenance of chromosome pro 100.0
KOG00181141 consensus Structural maintenance of chromosome pro 100.0
TIGR021691164 SMC_prok_A chromosome segregation protein SMC, pri 100.0
TIGR021681179 SMC_prok_B chromosome segregation protein SMC, com 100.0
PRK02224880 chromosome segregation protein; Provisional 100.0
PRK03918880 chromosome segregation protein; Provisional 100.0
PRK01156895 chromosome segregation protein; Provisional 100.0
COG0419908 SbcC ATPase involved in DNA repair [DNA replicatio 100.0
PRK102461047 exonuclease subunit SbcC; Provisional 100.0
TIGR00606 1311 rad50 rad50. This family is based on the phylogeno 100.0
PRK048631486 mukB cell division protein MukB; Provisional 100.0
TIGR006181042 sbcc exonuclease SbcC. This family is based on the 100.0
COG4717984 Uncharacterized conserved protein [Function unknow 100.0
PF135141111 AAA_27: AAA domain 100.0
TIGR026801353 conserved hypothetical protein TIGR02680. Members 100.0
COG49131104 Uncharacterized protein conserved in bacteria [Fun 100.0
KOG0962 1294 consensus DNA repair protein RAD50, ABC-type ATPas 100.0
TIGR03185650 DNA_S_dndD DNA sulfur modification protein DndD. T 100.0
PRK10869553 recombination and repair protein; Provisional 99.97
COG0497557 RecN ATPase involved in DNA repair [DNA replicatio 99.96
PHA02562562 46 endonuclease subunit; Provisional 99.95
PF02463220 SMC_N: RecF/RecN/SMC N terminal domain; InterPro: 99.94
PF121281201 DUF3584: Protein of unknown function (DUF3584); In 99.92
TIGR00634563 recN DNA repair protein RecN. All proteins in this 99.91
COG30961480 MukB Uncharacterized protein involved in chromosom 99.9
COG11961163 Smc Chromosome segregation ATPases [Cell division 99.89
KOG02501074 consensus DNA repair protein RAD18 (SMC family pro 99.88
KOG09961293 consensus Structural maintenance of chromosome pro 99.88
TIGR021691164 SMC_prok_A chromosome segregation protein SMC, pri 99.86
KOG09331174 consensus Structural maintenance of chromosome pro 99.82
TIGR02168 1179 SMC_prok_B chromosome segregation protein SMC, com 99.81
cd03273251 ABC_SMC2_euk Eukaryotic SMC2 proteins; SMC protein 99.78
TIGR00634563 recN DNA repair protein RecN. All proteins in this 99.77
cd03275247 ABC_SMC1_euk Eukaryotic SMC1 proteins; SMC protein 99.75
PRK02224880 chromosome segregation protein; Provisional 99.75
PRK14079349 recF recombination protein F; Provisional 99.74
PHA02562562 46 endonuclease subunit; Provisional 99.73
PRK00064361 recF recombination protein F; Reviewed 99.73
cd03242270 ABC_RecF RecF is a recombinational DNA repair ATPa 99.71
cd03241276 ABC_RecN RecN ATPase involved in DNA repair; ABC ( 99.69
PF1355562 AAA_29: P-loop containing region of AAA domain 99.68
cd03277213 ABC_SMC5_euk Eukaryotic SMC5 proteins; SMC protein 99.68
KOG0964 1200 consensus Structural maintenance of chromosome pro 99.65
KOG0161 1930 consensus Myosin class II heavy chain [Cytoskeleto 99.64
KOG00181141 consensus Structural maintenance of chromosome pro 99.63
KOG0161 1930 consensus Myosin class II heavy chain [Cytoskeleto 99.62
cd03272243 ABC_SMC3_euk Eukaryotic SMC3 proteins; SMC protein 99.62
cd03239178 ABC_SMC_head The structural maintenance of chromos 99.62
TIGR00611365 recf recF protein. All proteins in this family for 99.61
COG1195363 RecF Recombinational DNA repair ATPase (RecF pathw 99.59
cd03276198 ABC_SMC6_euk Eukaryotic SMC6 proteins; SMC protein 99.58
KOG09791072 consensus Structural maintenance of chromosome pro 99.57
PF13476202 AAA_23: AAA domain; PDB: 3AV0_B 3AUY_B 3AUX_A 2O5V 99.52
cd03279213 ABC_sbcCD SbcCD and other Mre11/Rad50 (MR) complex 99.47
PRK03918880 chromosome segregation protein; Provisional 99.44
cd03240204 ABC_Rad50 The catalytic domains of Rad50 are simil 99.43
cd03278197 ABC_SMC_barmotin Barmotin is a tight junction-asso 99.28
cd03274212 ABC_SMC4_euk Eukaryotic SMC4 proteins; SMC protein 99.22
PRK04863 1486 mukB cell division protein MukB; Provisional 99.21
PF12128 1201 DUF3584: Protein of unknown function (DUF3584); In 99.18
TIGR006061311 rad50 rad50. This family is based on the phylogeno 99.14
PF11398373 DUF2813: Protein of unknown function (DUF2813); In 99.1
PF13166 712 AAA_13: AAA domain 99.09
cd03276198 ABC_SMC6_euk Eukaryotic SMC6 proteins; SMC protein 99.07
KOG4674 1822 consensus Uncharacterized conserved coiled-coil pr 99.01
COG3950440 Predicted ATP-binding protein involved in virulenc 99.01
PRK01156895 chromosome segregation protein; Provisional 98.98
COG5293591 Predicted ATPase [General function prediction only 98.93
cd03277213 ABC_SMC5_euk Eukaryotic SMC5 proteins; SMC protein 98.87
PF00261237 Tropomyosin: Tropomyosin; InterPro: IPR000533 Trop 98.87
PF10174775 Cast: RIM-binding protein of the cytomatrix active 98.86
PF01576859 Myosin_tail_1: Myosin tail; InterPro: IPR002928 Mu 98.84
cd03227162 ABC_Class2 ABC-type Class 2 contains systems invol 98.84
cd03278197 ABC_SMC_barmotin Barmotin is a tight junction-asso 98.78
PF00261237 Tropomyosin: Tropomyosin; InterPro: IPR000533 Trop 98.75
cd03239178 ABC_SMC_head The structural maintenance of chromos 98.74
COG3840231 ThiQ ABC-type thiamine transport system, ATPase co 98.73
PF04310227 MukB: MukB N-terminal; InterPro: IPR007406 This is 98.73
PF13166712 AAA_13: AAA domain 98.66
cd03240204 ABC_Rad50 The catalytic domains of Rad50 are simil 98.65
COG1122235 CbiO ABC-type cobalt transport system, ATPase comp 98.64
COG1136226 SalX ABC-type antimicrobial peptide transport syst 98.64
PRK04778569 septation ring formation regulator EzrA; Provision 98.63
PF01576859 Myosin_tail_1: Myosin tail; InterPro: IPR002928 Mu 98.63
cd03275247 ABC_SMC1_euk Eukaryotic SMC1 proteins; SMC protein 98.61
COG1121254 ZnuC ABC-type Mn/Zn transport systems, ATPase comp 98.58
COG3593581 Predicted ATP-dependent endonuclease of the OLD fa 98.56
PF07888546 CALCOCO1: Calcium binding and coiled-coil domain ( 98.55
COG4637373 Predicted ATPase [General function prediction only 98.54
COG1106371 Predicted ATPases [General function prediction onl 98.54
PF1355890 SbcCD_C: Putative exonuclease SbcCD, C subunit; PD 98.54
cd03274212 ABC_SMC4_euk Eukaryotic SMC4 proteins; SMC protein 98.54
cd03273251 ABC_SMC2_euk Eukaryotic SMC2 proteins; SMC protein 98.51
KOG09941758 consensus Extracellular matrix glycoprotein Lamini 98.49
PF13175415 AAA_15: AAA ATPase domain 98.49
cd03259213 ABC_Carb_Solutes_like ABC Carbohydrate and Solute 98.48
COG3910233 Predicted ATPase [General function prediction only 98.48
COG1120258 FepC ABC-type cobalamin/Fe3+-siderophores transpor 98.47
KOG09941758 consensus Extracellular matrix glycoprotein Lamini 98.46
cd03293220 ABC_NrtD_SsuB_transporters NrtD and SsuB are the A 98.46
COG1126240 GlnQ ABC-type polar amino acid transport system, A 98.45
cd03235213 ABC_Metallic_Cations ABC component of the metal-ty 98.45
TIGR01184230 ntrCD nitrate transport ATP-binding subunits C and 98.42
cd03225211 ABC_cobalt_CbiO_domain1 Domain I of the ABC compon 98.42
cd00267157 ABC_ATPase ABC (ATP-binding cassette) transporter 98.42
COG1116248 TauB ABC-type nitrate/sulfonate/bicarbonate transp 98.41
cd03256241 ABC_PhnC_transporter ABC-type phosphate/phosphonat 98.41
cd03237246 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 o 98.41
PRK11247257 ssuB aliphatic sulfonates transport ATP-binding su 98.4
TIGR00960216 3a0501s02 Type II (General) Secretory Pathway (IIS 98.4
TIGR01277213 thiQ thiamine ABC transporter, ATP-binding protein 98.39
cd03214180 ABC_Iron-Siderophores_B12_Hemin ABC transporters, 98.39
COG1124252 DppF ABC-type dipeptide/oligopeptide/nickel transp 98.39
cd03255218 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of 98.38
cd03261235 ABC_Org_Solvent_Resistant ABC (ATP-binding cassett 98.38
PRK11248255 tauB taurine transporter ATP-binding subunit; Prov 98.38
TIGR01166190 cbiO cobalt transport protein ATP-binding subunit. 98.38
cd03265220 ABC_DrrA DrrA is the ATP-binding protein component 98.38
cd03298211 ABC_ThiQ_thiamine_transporter ABC-type thiamine tr 98.38
cd03296239 ABC_CysA_sulfate_importer Part of the ABC transpor 98.38
TIGR02211221 LolD_lipo_ex lipoprotein releasing system, ATP-bin 98.38
cd03226205 ABC_cobalt_CbiO_domain2 Domain II of the ABC compo 98.37
TIGR02673214 FtsE cell division ATP-binding protein FtsE. This 98.37
cd03230173 ABC_DR_subfamily_A This family of ATP-binding prot 98.37
cd03220224 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transpo 98.37
PF07888546 CALCOCO1: Calcium binding and coiled-coil domain ( 98.37
COG1125309 OpuBA ABC-type proline/glycine betaine transport s 98.36
cd03227162 ABC_Class2 ABC-type Class 2 contains systems invol 98.36
cd03297214 ABC_ModC_molybdenum_transporter ModC is an ABC-typ 98.36
PRK13538204 cytochrome c biogenesis protein CcmA; Provisional 98.36
PRK11629233 lolD lipoprotein transporter ATP-binding subunit; 98.36
cd03268208 ABC_BcrA_bacitracin_resist The BcrA subfamily repr 98.36
cd03231201 ABC_CcmA_heme_exporter CcmA, the ATP-binding compo 98.36
cd03257228 ABC_NikE_OppD_transporters The ABC transporter sub 98.36
TIGR02315243 ABC_phnC phosphonate ABC transporter, ATP-binding 98.35
cd03260227 ABC_PstB_phosphate_transporter Phosphate uptake is 98.35
cd03229178 ABC_Class3 This class is comprised of all BPD (Bin 98.35
TIGR02680 1353 conserved hypothetical protein TIGR02680. Members 98.35
TIGR03864236 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, 98.34
cd03269210 ABC_putative_ATPase This subfamily is involved in 98.34
cd03301213 ABC_MalK_N The N-terminal ATPase domain of the mal 98.34
TIGR02770230 nickel_nikD nickel import ATP-binding protein NikD 98.33
PRK14245250 phosphate ABC transporter ATP-binding protein; Pro 98.33
cd03218232 ABC_YhbG The ABC transporters belonging to the Yhb 98.32
COG4181228 Predicted ABC-type transport system involved in ly 98.32
cd03262213 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP- 98.32
cd03258233 ABC_MetN_methionine_transporter MetN (also known a 98.32
cd03219236 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC trans 98.32
cd03263220 ABC_subfamily_A The ABCA subfamily mediates the tr 98.32
PRK11831269 putative ABC transporter ATP-binding protein YrbF; 98.32
cd03264211 ABC_drug_resistance_like ABC-type multidrug transp 98.31
PRK10584228 putative ABC transporter ATP-binding protein YbbA; 98.31
PRK10771232 thiQ thiamine transporter ATP-binding subunit; Pro 98.31
cd03266218 ABC_NatA_sodium_exporter NatA is the ATPase compon 98.31
PRK13637287 cbiO cobalt transporter ATP-binding subunit; Provi 98.31
PRK14250241 phosphate ABC transporter ATP-binding protein; Pro 98.31
cd03294269 ABC_Pro_Gly_Bertaine This family comprises the gly 98.31
cd03267236 ABC_NatA_like Similar in sequence to NatA, this is 98.31
COG0444316 DppD ABC-type dipeptide/oligopeptide/nickel transp 98.31
PRK15112267 antimicrobial peptide ABC system ATP-binding prote 98.3
PRK10575265 iron-hydroxamate transporter ATP-binding subunit; 98.3
TIGR01188302 drrA daunorubicin resistance ABC transporter ATP-b 98.29
cd03241276 ABC_RecN RecN ATPase involved in DNA repair; ABC ( 98.29
PRK14258261 phosphate ABC transporter ATP-binding protein; Pro 98.29
cd03216163 ABC_Carb_Monos_I This family represents the domain 98.29
COG4525259 TauB ABC-type taurine transport system, ATPase com 98.29
PRK13645289 cbiO cobalt transporter ATP-binding subunit; Provi 98.29
PRK14247250 phosphate ABC transporter ATP-binding protein; Pro 98.29
PRK10619257 histidine/lysine/arginine/ornithine transporter su 98.28
PRK14268258 phosphate ABC transporter ATP-binding protein; Pro 98.28
TIGR00972247 3a0107s01c2 phosphate ABC transporter, ATP-binding 98.28
PRK11614237 livF leucine/isoleucine/valine transporter ATP-bin 98.28
TIGR01186 363 proV glycine betaine/L-proline transport ATP bindi 98.28
PRK11022326 dppD dipeptide transporter ATP-binding subunit; Pr 98.28
TIGR01187 325 potA spermidine/putrescine ABC transporter ATP-bin 98.28
PRK13643288 cbiO cobalt transporter ATP-binding subunit; Provi 98.28
cd03295242 ABC_OpuCA_Osmoprotection OpuCA is a the ATP bindin 98.28
cd03245220 ABCC_bacteriocin_exporters ABC-type bacteriocin ex 98.28
cd03292214 ABC_FtsE_transporter FtsE is a hydrophilic nucleot 98.28
PRK10253265 iron-enterobactin transporter ATP-binding protein; 98.27
PRK14242253 phosphate transporter ATP-binding protein; Provisi 98.27
cd03215182 ABC_Carb_Monos_II This family represents domain II 98.27
PRK13540200 cytochrome c biogenesis protein CcmA; Provisional 98.27
TIGR01189198 ccmA heme ABC exporter, ATP-binding protein CcmA. 98.27
PRK14269246 phosphate ABC transporter ATP-binding protein; Pro 98.27
PRK13646286 cbiO cobalt transporter ATP-binding subunit; Provi 98.27
PRK10070 400 glycine betaine transporter ATP-binding subunit; P 98.27
cd03224222 ABC_TM1139_LivF_branched LivF (TM1139) is part of 98.27
TIGR02323253 CP_lyasePhnK phosphonate C-P lyase system protein 98.27
TIGR03410230 urea_trans_UrtE urea ABC transporter, ATP-binding 98.27
PRK13634290 cbiO cobalt transporter ATP-binding subunit; Provi 98.27
PRK11264250 putative amino-acid ABC transporter ATP-binding pr 98.26
PRK13543214 cytochrome c biogenesis protein CcmA; Provisional 98.26
PRK14273254 phosphate ABC transporter ATP-binding protein; Pro 98.26
PRK14262250 phosphate ABC transporter ATP-binding protein; Pro 98.26
COG4674249 Uncharacterized ABC-type transport system, ATPase 98.26
PRK11308327 dppF dipeptide transporter ATP-binding subunit; Pr 98.25
PRK10418254 nikD nickel transporter ATP-binding protein NikD; 98.25
cd03222177 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibi 98.25
PRK13631320 cbiO cobalt transporter ATP-binding subunit; Provi 98.25
PRK09544251 znuC high-affinity zinc transporter ATPase; Review 98.25
PRK13548258 hmuV hemin importer ATP-binding subunit; Provision 98.25
TIGR03740223 galliderm_ABC gallidermin-class lantibiotic protec 98.25
PRK13539207 cytochrome c biogenesis protein CcmA; Provisional 98.25
PRK11701258 phnK phosphonate C-P lyase system protein PhnK; Pr 98.25
PRK11650 356 ugpC glycerol-3-phosphate transporter ATP-binding 98.25
PRK10908222 cell division protein FtsE; Provisional 98.25
TIGR03005252 ectoine_ehuA ectoine/hydroxyectoine ABC transporte 98.25
PRK14274259 phosphate ABC transporter ATP-binding protein; Pro 98.25
PRK14270251 phosphate ABC transporter ATP-binding protein; Pro 98.25
PRK10744260 pstB phosphate transporter ATP-binding protein; Pr 98.24
cd03272243 ABC_SMC3_euk Eukaryotic SMC3 proteins; SMC protein 98.24
PRK15079331 oligopeptide ABC transporter ATP-binding protein O 98.24
PRK09452 375 potA putrescine/spermidine ABC transporter ATPase 98.24
COG4987573 CydC ABC-type transport system involved in cytochr 98.24
PRK13651305 cobalt transporter ATP-binding subunit; Provisiona 98.24
PRK09984262 phosphonate/organophosphate ester transporter subu 98.24
TIGR01288303 nodI ATP-binding ABC transporter family nodulation 98.24
PRK11231255 fecE iron-dicitrate transporter ATP-binding subuni 98.24
KOG0971 1243 consensus Microtubule-associated protein dynactin 98.24
PRK11153 343 metN DL-methionine transporter ATP-binding subunit 98.24
PRK10247225 putative ABC transporter ATP-binding protein YbbL; 98.24
TIGR03771223 anch_rpt_ABC anchored repeat-type ABC transporter, 98.24
TIGR02314 343 ABC_MetN D-methionine ABC transporter, ATP-binding 98.23
TIGR03411242 urea_trans_UrtD urea ABC transporter, ATP-binding 98.23
PRK14240250 phosphate transporter ATP-binding protein; Provisi 98.23
cd03233202 ABC_PDR_domain1 The pleiotropic drug resistance (P 98.23
PRK14239252 phosphate transporter ATP-binding protein; Provisi 98.23
PRK14241258 phosphate transporter ATP-binding protein; Provisi 98.23
PRK09493240 glnQ glutamine ABC transporter ATP-binding protein 98.23
PRK14259269 phosphate ABC transporter ATP-binding protein; Pro 98.23
PRK13638271 cbiO cobalt transporter ATP-binding subunit; Provi 98.23
KOG0976 1265 consensus Rho/Rac1-interacting serine/threonine ki 98.23
KOG0977546 consensus Nuclear envelope protein lamin, intermed 98.23
PRK11300255 livG leucine/isoleucine/valine transporter ATP-bin 98.23
cd03279213 ABC_sbcCD SbcCD and other Mre11/Rad50 (MR) complex 98.23
COG1131293 CcmA ABC-type multidrug transport system, ATPase c 98.23
PRK14235267 phosphate transporter ATP-binding protein; Provisi 98.22
PRK14243264 phosphate transporter ATP-binding protein; Provisi 98.22
COG4175 386 ProV ABC-type proline/glycine betaine transport sy 98.22
PRK11000 369 maltose/maltodextrin transporter ATP-binding prote 98.22
PRK13547272 hmuV hemin importer ATP-binding subunit; Provision 98.22
PRK14255252 phosphate ABC transporter ATP-binding protein; Pro 98.22
PRK14244251 phosphate ABC transporter ATP-binding protein; Pro 98.21
PRK13649280 cbiO cobalt transporter ATP-binding subunit; Provi 98.21
PRK15056272 manganese/iron transporter ATP-binding protein; Pr 98.21
PRK14265274 phosphate ABC transporter ATP-binding protein; Pro 98.21
COG4988559 CydD ABC-type transport system involved in cytochr 98.21
PRK14238271 phosphate transporter ATP-binding protein; Provisi 98.21
PRK10419268 nikE nickel transporter ATP-binding protein NikE; 98.21
PRK14267253 phosphate ABC transporter ATP-binding protein; Pro 98.21
PRK09473330 oppD oligopeptide transporter ATP-binding componen 98.21
cd03246173 ABCC_Protease_Secretion This family represents the 98.21
cd03252237 ABCC_Hemolysin The ABC-transporter hemolysin B is 98.2
TIGR02142 354 modC_ABC molybdenum ABC transporter, ATP-binding p 98.2
cd03232192 ABC_PDR_domain2 The pleiotropic drug resistance-li 98.2
cd03254229 ABCC_Glucan_exporter_like Glucan exporter ATP-bind 98.2
COG4559259 ABC-type hemin transport system, ATPase component 98.2
PRK14251251 phosphate ABC transporter ATP-binding protein; Pro 98.2
cd03249238 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) 98.2
PRK14248268 phosphate ABC transporter ATP-binding protein; Pro 98.19
PRK14271276 phosphate ABC transporter ATP-binding protein; Pro 98.19
PRK11124242 artP arginine transporter ATP-binding subunit; Pro 98.19
cd03228171 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein 98.19
PRK14256252 phosphate ABC transporter ATP-binding protein; Pro 98.19
PRK13409590 putative ATPase RIL; Provisional 98.19
PRK11144 352 modC molybdate transporter ATP-binding protein; Pr 98.19
cd03238176 ABC_UvrA The excision repair protein UvrA; Nucleot 98.19
TIGR02769265 nickel_nikE nickel import ATP-binding protein NikE 98.19
COG4694 758 Uncharacterized protein conserved in bacteria [Fun 98.19
PRK13545 549 tagH teichoic acids export protein ATP-binding sub 98.19
PRK15093330 antimicrobial peptide ABC transporter ATP-binding 98.19
PRK13648269 cbiO cobalt transporter ATP-binding subunit; Provi 98.18
PRK14261253 phosphate ABC transporter ATP-binding protein; Pro 98.18
PRK13546264 teichoic acids export protein ATP-binding subunit; 98.18
PRK14275286 phosphate ABC transporter ATP-binding protein; Pro 98.18
PRK11432 351 fbpC ferric transporter ATP-binding subunit; Provi 98.18
PRK10851 353 sulfate/thiosulfate transporter subunit; Provision 98.18
cd03213194 ABCG_EPDR ABCG transporters are involved in eye pi 98.18
TIGR01978243 sufC FeS assembly ATPase SufC. SufC is part of the 98.18
cd03234226 ABCG_White The White subfamily represents ABC tran 98.18
PRK13647274 cbiO cobalt transporter ATP-binding subunit; Provi 98.18
cd03251234 ABCC_MsbA MsbA is an essential ABC transporter, cl 98.18
cd03248226 ABCC_TAP TAP, the Transporter Associated with Anti 98.18
TIGR03265 353 PhnT2 putative 2-aminoethylphosphonate ABC transpo 98.18
PRK14253249 phosphate ABC transporter ATP-binding protein; Pro 98.18
PRK13650279 cbiO cobalt transporter ATP-binding subunit; Provi 98.18
TIGR03258 362 PhnT 2-aminoethylphosphonate ABC transport system, 98.18
PRK13641287 cbiO cobalt transporter ATP-binding subunit; Provi 98.17
cd03217200 ABC_FeS_Assembly ABC-type transport system involve 98.17
PRK13536340 nodulation factor exporter subunit NodI; Provision 98.17
PRK14272252 phosphate ABC transporter ATP-binding protein; Pro 98.17
PRK03695248 vitamin B12-transporter ATPase; Provisional 98.17
PRK14263261 phosphate ABC transporter ATP-binding protein; Pro 98.17
PRK13636283 cbiO cobalt transporter ATP-binding subunit; Provi 98.17
TIGR03608206 L_ocin_972_ABC putative bacteriocin export ABC tra 98.17
COG1119257 ModF ABC-type molybdenum transport system, ATPase 98.17
TIGR03873256 F420-0_ABC_ATP proposed F420-0 ABC transporter, AT 98.17
PRK13633280 cobalt transporter ATP-binding subunit; Provisiona 98.16
PRK13652277 cbiO cobalt transporter ATP-binding subunit; Provi 98.16
COG1340294 Uncharacterized archaeal coiled-coil protein [Func 98.16
PRK14266250 phosphate ABC transporter ATP-binding protein; Pro 98.16
PRK14237267 phosphate transporter ATP-binding protein; Provisi 98.16
PRK10895241 lipopolysaccharide ABC transporter ATP-binding pro 98.16
TIGR03415 382 ABC_choXWV_ATP choline ABC transporter, ATP-bindin 98.15
PRK14254285 phosphate ABC transporter ATP-binding protein; Pro 98.15
PRK13632271 cbiO cobalt transporter ATP-binding subunit; Provi 98.15
PRK13639275 cbiO cobalt transporter ATP-binding subunit; Provi 98.15
cd03300232 ABC_PotA_N PotA is an ABC-type transporter and the 98.15
cd03270226 ABC_UvrA_I The excision repair protein UvrA domain 98.15
PRK14236272 phosphate transporter ATP-binding protein; Provisi 98.14
PRK14249251 phosphate ABC transporter ATP-binding protein; Pro 98.14
PRK15134 529 microcin C ABC transporter ATP-binding protein Yej 98.14
COG4619223 ABC-type uncharacterized transport system, ATPase 98.14
COG1123 539 ATPase components of various ABC-type transport sy 98.14
PRK13537306 nodulation ABC transporter NodI; Provisional 98.14
cd03369207 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-ty 98.14
PRK14260259 phosphate ABC transporter ATP-binding protein; Pro 98.14
TIGR02324224 CP_lyasePhnL phosphonate C-P lyase system protein 98.14
COG1127263 Ttg2A ABC-type transport system involved in resist 98.13
cd03247178 ABCC_cytochrome_bd The CYD subfamily implicated in 98.13
cd03244221 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C. 98.13
PRK11607 377 potG putrescine transporter ATP-binding subunit; P 98.12
PRK10938 490 putative molybdenum transport ATP-binding protein 98.12
PRK13541195 cytochrome c biogenesis protein CcmA; Provisional 98.12
PRK13640282 cbiO cobalt transporter ATP-binding subunit; Provi 98.12
COG1123539 ATPase components of various ABC-type transport sy 98.12
TIGR02633500 xylG D-xylose ABC transporter, ATP-binding protein 98.11
PRK11637428 AmiB activator; Provisional 98.11
PRK15134529 microcin C ABC transporter ATP-binding protein Yej 98.11
PRK10938490 putative molybdenum transport ATP-binding protein 98.11
TIGR03269 520 met_CoM_red_A2 methyl coenzyme M reductase system, 98.11
TIGR00611365 recf recF protein. All proteins in this family for 98.11
cd03223166 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cass 98.1
PRK15439510 autoinducer 2 ABC transporter ATP-binding protein 98.1
TIGR00968237 3a0106s01 sulfate ABC transporter, ATP-binding pro 98.1
PRK14252265 phosphate ABC transporter ATP-binding protein; Pro 98.1
PRK09700510 D-allose transporter ATP-binding protein; Provisio 98.09
PRK10762501 D-ribose transporter ATP binding protein; Provisio 98.09
cd03271261 ABC_UvrA_II The excision repair protein UvrA domai 98.09
cd03299235 ABC_ModC_like Archeal protein closely related to M 98.09
PRK13642277 cbiO cobalt transporter ATP-binding subunit; Provi 98.09
PF05557722 MAD: Mitotic checkpoint protein; InterPro: IPR0086 98.09
cd03221144 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is 98.08
PRK09580248 sufC cysteine desulfurase ATPase component; Review 98.08
cd03253236 ABCC_ATM1_transporter ATM1 is an ABC transporter t 98.08
PF05701522 WEMBL: Weak chloroplast movement under blue light; 98.08
PRK11637428 AmiB activator; Provisional 98.08
COG2884223 FtsE Predicted ATPase involved in cell division [C 98.08
PRK13549506 xylose transporter ATP-binding subunit; Provisiona 98.08
COG2274709 SunT ABC-type bacteriocin/lantibiotic exporters, c 98.07
COG4604252 CeuD ABC-type enterochelin transport system, ATPas 98.07
PRK14264305 phosphate ABC transporter ATP-binding protein; Pro 98.07
COG4938374 Uncharacterized conserved protein [Function unknow 98.07
PRK10261623 glutathione transporter ATP-binding protein; Provi 98.07
PRK11288501 araG L-arabinose transporter ATP-binding protein; 98.07
PF00038312 Filament: Intermediate filament protein; InterPro: 98.07
KOG10291118 consensus Endocytic adaptor protein intersectin [S 98.07
TIGR03522301 GldA_ABC_ATP gliding motility-associated ABC trans 98.06
PRK15177213 Vi polysaccharide export ATP-binding protein VexC; 98.06
TIGR03269520 met_CoM_red_A2 methyl coenzyme M reductase system, 98.06
PRK13644274 cbiO cobalt transporter ATP-binding subunit; Provi 98.06
PRK13635279 cbiO cobalt transporter ATP-binding subunit; Provi 98.06
COG3842 352 PotA ABC-type spermidine/putrescine transport syst 98.06
COG1118 345 CysA ABC-type sulfate/molybdate transport systems, 98.05
PRK00064361 recF recombination protein F; Reviewed 98.05
TIGR02982220 heterocyst_DevA ABC exporter ATP-binding subunit, 98.05
PRK10982491 galactose/methyl galaxtoside transporter ATP-bindi 98.04
PRK14257329 phosphate ABC transporter ATP-binding protein; Pro 98.04
CHL00131252 ycf16 sulfate ABC transporter protein; Validated 98.04
PRK10982 491 galactose/methyl galaxtoside transporter ATP-bindi 98.03
cd03236255 ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 o 98.02
COG4559259 ABC-type hemin transport system, ATPase component 98.02
PRK09536 402 btuD corrinoid ABC transporter ATPase; Reviewed 98.02
PF09726697 Macoilin: Transmembrane protein; InterPro: IPR0191 98.01
COG1120258 FepC ABC-type cobalamin/Fe3+-siderophores transpor 98.01
PRK14246257 phosphate ABC transporter ATP-binding protein; Pro 98.01
COG4608268 AppF ABC-type oligopeptide transport system, ATPas 98.0
COG5293591 Predicted ATPase [General function prediction only 98.0
PRK11288 501 araG L-arabinose transporter ATP-binding protein; 98.0
cd03250204 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C. 97.99
cd03290218 ABCC_SUR1_N The SUR domain 1. The sulfonylurea rec 97.99
TIGR02633 500 xylG D-xylose ABC transporter, ATP-binding protein 97.98
PRK13549 506 xylose transporter ATP-binding subunit; Provisiona 97.98
PRK15439 510 autoinducer 2 ABC transporter ATP-binding protein 97.98
PRK10261 623 glutathione transporter ATP-binding protein; Provi 97.98
KOG0977546 consensus Nuclear envelope protein lamin, intermed 97.95
PRK13409 590 putative ATPase RIL; Provisional 97.95
PRK09700 510 D-allose transporter ATP-binding protein; Provisio 97.94
PF09726697 Macoilin: Transmembrane protein; InterPro: IPR0191 97.93
PRK10762 501 D-ribose transporter ATP binding protein; Provisio 97.93
COG1117253 PstB ABC-type phosphate transport system, ATPase c 97.93
TIGR02203571 MsbA_lipidA lipid A export permease/ATP-binding pr 97.92
PRK11174588 cysteine/glutathione ABC transporter membrane/ATP- 97.92
cd03288257 ABCC_SUR2 The SUR domain 2. The sulfonylurea recep 97.92
COG4172 534 ABC-type uncharacterized transport system, duplica 97.9
cd03289275 ABCC_CFTR2 The CFTR subfamily domain 2. The cystic 97.89
cd03291282 ABCC_CFTR1 The CFTR subfamily domain 1. The cystic 97.89
TIGR03719552 ABC_ABC_ChvD ATP-binding cassette protein, ChvD fa 97.88
TIGR01192585 chvA glucan exporter ATP-binding protein. This mod 97.87
KOG1003205 consensus Actin filament-coating protein tropomyos 97.87
PRK10789569 putative multidrug transporter membrane\ATP-bindin 97.86
COG4372499 Uncharacterized protein conserved in bacteria with 97.86
KOG10291118 consensus Endocytic adaptor protein intersectin [S 97.85
PRK13657588 cyclic beta-1,2-glucan ABC transporter; Provisiona 97.85
COG3839 338 MalK ABC-type sugar transport systems, ATPase comp 97.84
COG1121254 ZnuC ABC-type Mn/Zn transport systems, ATPase comp 97.84
PRK11176582 lipid transporter ATP-binding/permease protein; Pr 97.83
PRK10636 638 putative ABC transporter ATP-binding protein; Prov 97.83
PF09730717 BicD: Microtubule-associated protein Bicaudal-D; I 97.83
TIGR01194555 cyc_pep_trnsptr cyclic peptide transporter. This m 97.83
COG1579239 Zn-ribbon protein, possibly nucleic acid-binding [ 97.83
COG4598256 HisP ABC-type histidine transport system, ATPase c 97.82
PRK14265274 phosphate ABC transporter ATP-binding protein; Pro 97.82
PRK10790592 putative multidrug transporter membrane\ATP-bindin 97.81
PLN03211 659 ABC transporter G-25; Provisional 97.81
PRK11160574 cysteine/glutathione ABC transporter membrane/ATP- 97.81
COG4618580 ArpD ABC-type protease/lipase transport system, AT 97.81
COG4604252 CeuD ABC-type enterochelin transport system, ATPas 97.79
PRK11819556 putative ABC transporter ATP-binding protein; Revi 97.79
COG1135 339 AbcC ABC-type metal ion transport system, ATPase c 97.79
cd03242270 ABC_RecF RecF is a recombinational DNA repair ATPa 97.78
PRK15064530 ABC transporter ATP-binding protein; Provisional 97.78
TIGR03375694 type_I_sec_LssB type I secretion system ATPase, Ls 97.78
PRK14242253 phosphate transporter ATP-binding protein; Provisi 97.78
COG4133209 CcmA ABC-type transport system involved in cytochr 97.78
COG0411250 LivG ABC-type branched-chain amino acid transport 97.78
PRK04778569 septation ring formation regulator EzrA; Provision 97.77
PF05701522 WEMBL: Weak chloroplast movement under blue light; 97.76
COG0396251 sufC Cysteine desulfurase activator ATPase [Posttr 97.76
COG4172534 ABC-type uncharacterized transport system, duplica 97.76
PRK15064 530 ABC transporter ATP-binding protein; Provisional 97.76
PRK10522547 multidrug transporter membrane component/ATP-bindi 97.76
TIGR00630 924 uvra excinuclease ABC, A subunit. This family is b 97.76
TIGR01846694 type_I_sec_HlyB type I secretion system ABC transp 97.75
TIGR02868529 CydC thiol reductant ABC exporter, CydC subunit. T 97.75
PRK14268258 phosphate ABC transporter ATP-binding protein; Pro 97.75
cd03215182 ABC_Carb_Monos_II This family represents domain II 97.75
TIGR01842544 type_I_sec_PrtD type I secretion system ABC transp 97.75
TIGR02204576 MsbA_rel ABC transporter, permease/ATP-binding pro 97.74
PRK10584228 putative ABC transporter ATP-binding protein YbbA; 97.73
cd03238176 ABC_UvrA The excision repair protein UvrA; Nucleot 97.73
COG4372499 Uncharacterized protein conserved in bacteria with 97.72
PF06470120 SMC_hinge: SMC proteins Flexible Hinge Domain; Int 97.72
cd03221144 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is 97.72
COG1132567 MdlB ABC-type multidrug transport system, ATPase a 97.71
TIGR03719 552 ABC_ABC_ChvD ATP-binding cassette protein, ChvD fa 97.7
COG1126240 GlnQ ABC-type polar amino acid transport system, A 97.69
cd03296239 ABC_CysA_sulfate_importer Part of the ABC transpor 97.69
KOG0057591 consensus Mitochondrial Fe/S cluster exporter, ABC 97.69
PRK13538204 cytochrome c biogenesis protein CcmA; Provisional 97.69
PRK13539207 cytochrome c biogenesis protein CcmA; Provisional 97.68
PRK11819 556 putative ABC transporter ATP-binding protein; Revi 97.68
PRK11147 635 ABC transporter ATPase component; Reviewed 97.68
COG4778235 PhnL ABC-type phosphonate transport system, ATPase 97.68
COG1137243 YhbG ABC-type (unclassified) transport system, ATP 97.67
PRK13540200 cytochrome c biogenesis protein CcmA; Provisional 97.65
PRK11248255 tauB taurine transporter ATP-binding subunit; Prov 97.64
COG4133209 CcmA ABC-type transport system involved in cytochr 97.64
PRK14261253 phosphate ABC transporter ATP-binding protein; Pro 97.64
PF00038312 Filament: Intermediate filament protein; InterPro: 97.64
TIGR02315243 ABC_phnC phosphonate ABC transporter, ATP-binding 97.64
PLN03073718 ABC transporter F family; Provisional 97.64
cd00267157 ABC_ATPase ABC (ATP-binding cassette) transporter 97.63
PRK14079349 recF recombination protein F; Provisional 97.63
PRK14245250 phosphate ABC transporter ATP-binding protein; Pro 97.62
TIGR02673214 FtsE cell division ATP-binding protein FtsE. This 97.62
PF12718143 Tropomyosin_1: Tropomyosin like; InterPro: IPR0005 97.62
COG0396251 sufC Cysteine desulfurase activator ATPase [Posttr 97.62
cd03264211 ABC_drug_resistance_like ABC-type multidrug transp 97.61
PRK14237267 phosphate transporter ATP-binding protein; Provisi 97.61
cd03265220 ABC_DrrA DrrA is the ATP-binding protein component 97.61
PRK14247250 phosphate ABC transporter ATP-binding protein; Pro 97.61
cd03248226 ABCC_TAP TAP, the Transporter Associated with Anti 97.61
PRK11147 635 ABC transporter ATPase component; Reviewed 97.6
PF00005137 ABC_tran: ABC transporter This structure is on hol 97.6
PRK11247257 ssuB aliphatic sulfonates transport ATP-binding su 97.6
KOG0058716 consensus Peptide exporter, ABC superfamily [Intra 97.6
PRK14262250 phosphate ABC transporter ATP-binding protein; Pro 97.6
cd03262213 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP- 97.59
PRK10744260 pstB phosphate transporter ATP-binding protein; Pr 97.59
TIGR01257 2272 rim_protein retinal-specific rim ABC transporter. 97.59
TIGR00960216 3a0501s02 Type II (General) Secretory Pathway (IIS 97.58
TIGR03864236 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, 97.58
PRK09544251 znuC high-affinity zinc transporter ATPase; Review 97.58
PRK13638271 cbiO cobalt transporter ATP-binding subunit; Provi 97.58
PRK14238271 phosphate transporter ATP-binding protein; Provisi 97.56
KOG0976 1265 consensus Rho/Rac1-interacting serine/threonine ki 97.56
PRK11629233 lolD lipoprotein transporter ATP-binding subunit; 97.56
PRK14243264 phosphate transporter ATP-binding protein; Provisi 97.56
TIGR03797686 NHPM_micro_ABC2 NHPM bacteriocin system ABC transp 97.56
PRK00349943 uvrA excinuclease ABC subunit A; Reviewed 97.56
PRK14273254 phosphate ABC transporter ATP-binding protein; Pro 97.56
cd03269210 ABC_putative_ATPase This subfamily is involved in 97.55
PRK14275286 phosphate ABC transporter ATP-binding protein; Pro 97.55
>KOG0250 consensus DNA repair protein RAD18 (SMC family protein) [Replication, recombination and repair] Back     alignment and domain information 
Probab=100.00  E-value=2.7e-102  Score=839.28  Aligned_cols=1035  Identities=37%  Similarity=0.602  Sum_probs=871.7

Q ss_pred             CCCCCCCCCeeEEEEEEEecccccCceeeeCCCeEEEEcCCCCcHHHHHHHHHHHhcCCccCCCCccchhhhhhcCCcee
Q 001536           11 GYGPQRSGAGTITRVRLENFMCHSSLQIELGEWVNFITGQNGSGKSAILTALCIAFGCRAKGTQRAATLKDFIKTGCSYA   90 (1058)
Q Consensus        11 ~~~~~~~~~m~i~~l~l~nf~~~~~~~i~f~~~~~~I~G~NgsGKStil~ai~~~lg~~~~~~~r~~~~~~~i~~~~~~~   90 (1058)
                      ++..+....|+|.+|+|.|||||.+..|+|+|.+|+|+|+||||||.||.||+.|||++++.+.||+++++||+.|+++|
T Consensus        31 ~~~~~~~~sG~I~sI~L~NFMCHsnL~IeFg~~vNfI~G~NGSGKSAIltAl~lglG~rAs~tnRgsslK~lIK~G~~~A  110 (1074)
T KOG0250|consen   31 DFTLQRAESGKIESIHLTNFMCHSNLLIEFGPRVNFIVGNNGSGKSAILTALTLGLGGRASATNRGSSLKDLIKDGCSSA  110 (1074)
T ss_pred             chhhhhhhcceEEEEEEeeecccccceeccCCCceEeecCCCCcHHHHHHHHHHhhccccccccchhhHHHHHhCCCcce
Confidence            44445566699999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             EEEEEEEeCCCCccCcccCCCeEEEEEEEecCcceEEEE-cCCCceecccHHHHHHHHHhcCCcccCCeeeechhhhhHh
Q 001536           91 MVEVELKNRGEDAFKPEIFGDSIIIERRITESTSTTVLK-DHQGKRVASRKQELLELIDHFNIDVENPCVIMSQDKSREF  169 (1058)
Q Consensus        91 ~v~~~~~~~~~~~~~~~~~~~~~~i~R~~~~~~~~~~~~-~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~q~~~~~~  169 (1058)
                      .|.|+++|.|.++|.|++||+.|+|.|+|...+++|++. +.+|++|+.+..++..++..|||++.||++|++|+.++.|
T Consensus       111 ~IsItL~N~G~~Afk~eiyG~~IiIER~I~~~~S~~~~~~~~~grvVStKk~dl~~vv~~f~I~veNP~~~lsQD~aR~F  190 (1074)
T KOG0250|consen  111 KISITLSNSGLDAFKPEIYGNSIIIERTIRRSSSTYYLLRSANGRVVSTKKEDLDTVVDHFNIQVENPMFVLSQDAARSF  190 (1074)
T ss_pred             EEEEEEecCCcccCChhhcCCeeEEEEeeccccchHHHHhhccCccccccHHHHHHHHHHhCcCCCCcchhhcHHHHHHH
Confidence            999999999999999999999999999999655555555 7899999999999999999999999999999999999999


Q ss_pred             hhcCCchhHHHHHHhhhhHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhhhHHHHHHHHHHHHhhHhHHHHHHHHHHHHHH
Q 001536          170 LHSGNDKDKFKFFFKATLLQQVNDLLQSIYNHLNKGDALVLELEATIKPTEKELSELQRKIRNMEHVEEITQDLQRLKKK  249 (1058)
Q Consensus       170 l~~~~~~~~~~~~~~~~~l~~~~~~l~~~~~~l~~~~~~l~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~  249 (1058)
                      |....+.++|++|+.++.++.+...+..+.+.+....+.+......+..+++++...+..+..++....+...+..+...
T Consensus       191 L~~~~p~dkYklfmkaT~L~qi~~~~~~~~~~~~~~~~~i~~~~e~i~~l~k~i~e~~e~~~~~~~~e~~~~~l~~Lk~k  270 (1074)
T KOG0250|consen  191 LANSNPKDKYKLFMKATQLEQITESYSEIMESLDHAKELIDLKEEEIKNLKKKIKEEEEKLDNLEQLEDLKENLEQLKAK  270 (1074)
T ss_pred             HhcCChHHHHHHHHHHhHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HhhHHHHHHHHHHHHHHHHHHHHHhhhHHHHHhHHHHHHHHHHHHHHHHHHHHHHHHHHHhhHHHHHHHHHHHHHHHHHH
Q 001536          250 LAWSWVYDVDRQLKEQTLKIEKLKDRIPRCQAKIDSRHSILESLRDCFMKKKAEIAVMVEKTSEVRRRKDELQQSISLAT  329 (1058)
Q Consensus       250 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~  329 (1058)
                      +.|..+.....++......+...+.....+++.++.....+..+...+.+.+.++..+.........++..+.+.+..+.
T Consensus       271 ~~W~~V~~~~~ql~~~~~~i~~~qek~~~l~~ki~~~~~k~~~~r~k~teiea~i~~~~~e~~~~d~Ei~~~r~~~~~~~  350 (1074)
T KOG0250|consen  271 MAWAWVNEVERQLNNQEEEIKKKQEKVDTLQEKIEEKQGKIEEARQKLTEIEAKIGELKDEVDAQDEEIEEARKDLDDLR  350 (1074)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhhhHHHHHHHHHHHhhhhhhHHHHHHHHHHHHHH
Confidence            99999999999999999999999999999999998888888888888888888888888888888888888888888888


Q ss_pred             HHHHHHHHHHHHhHHHHHHHHHHHHHHHHHHHHHHHHHHHhhHHHHHHHHHHHHHHHHHHHHHHHHHHHhHHhHHHHHHH
Q 001536          330 KEKLELEGELVRNTSYMQKMVNRVKGLEQQVHDIQEQHVRNTQAEESEIEAKLKELQCEIDAANITLSRMKEEDSALSEK  409 (1058)
Q Consensus       330 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~l~~~  409 (1058)
                      .+..+++..+....+.+..++..+..+++.+..+..........++.+.+..+..|..+++.++..+..+..+.+.+...
T Consensus       351 re~~~~~~~~~~~~n~i~~~k~~~d~l~k~I~~~~~~~~~~~~~~~~e~e~k~~~L~~evek~e~~~~~L~~e~~~~~~~  430 (1074)
T KOG0250|consen  351 REVNDLKEEIREIENSIRKLKKEVDRLEKQIADLEKQTNNELGSELEERENKLEQLKKEVEKLEEQINSLREELNEVKEK  430 (1074)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhhhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            88888888888888888888888888888888887776666677778888889999999999999889999999999888


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhcCCcccccCcccHHHHHHHHHhhccCCCCCCcccccccEEecCCC
Q 001536          410 LSKEKNEIRRISDEIEDYDKKCREIRSEIRELQQHQTNKVTAFGGDRVISLLRAIERHHHKFKSPPIGPIGSHVTLVNGD  489 (1058)
Q Consensus       410 ~~~~~~~~~~l~~~~~~~~~~~~~l~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~  489 (1058)
                      ....+.+...+...+..++..++.....+..+.....+.+..|+ +.+..++..|......|..+|.||++.++.+.+ +
T Consensus       431 ~~~~~ee~~~i~~~i~~l~k~i~~~~~~l~~lk~~k~dkvs~FG-~~m~~lL~~I~r~~~~f~~~P~GPlG~~Vtl~~-~  508 (1074)
T KOG0250|consen  431 AKEEEEEKEHIEGEILQLRKKIENISEELKDLKKTKTDKVSAFG-PNMPQLLRAIERRKRRFQTPPKGPLGKYVTLKE-P  508 (1074)
T ss_pred             HHHhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhcccchhhhcc-hhhHHHHHHHHHHHhcCCCCCCCCccceeEecC-c
Confidence            88888889899999999999999999999999999889999999 999999999999888888899999999999999 9


Q ss_pred             ChHHHHHHHHhccccceeecchhhHHHHHHHHHHhcCCC--ccEEEEecCCCCCCCCCCCCCCCCCCchhhccccCcHHH
Q 001536          490 TWAPAVEQAIGRLLNAFIVTDHKDALLLRGCAREANYNH--LQIIIYDFSRPRLSLPHHMLPHTKHPTTLSVLQSDNPTV  567 (1058)
Q Consensus       490 ~~~~~~~~~l~~~~~~~v~~~~~~~~~~~~~l~~~~~~~--~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~l~~~~~~~  567 (1058)
                      +|..+++.++|+.+.+|+|.+..++..+..+++...++.  .++++..+  ++..++.+..+...++.+++.|..++|.+
T Consensus       509 KWa~aIE~~L~n~lnaFiv~sh~D~~~Lr~i~~~~~~~~~~ptIvvs~~--~~~~y~~~~~p~~~~pTil~~le~ddp~V  586 (1074)
T KOG0250|consen  509 KWALAIERCLGNLLNAFIVTSHKDARILRAIMRRLKIPGNRPTIVVSSF--TPFDYSVGRNPGYEFPTILDALEFDDPEV  586 (1074)
T ss_pred             HHHHHHHHHHHHhhhhheeCCHhhHHHHHHHHHHcCCCCCCCcEEEecC--CccccccccCCCCCCCceeeeeecCChHH
Confidence            999999999999999999999999999999999888875  44444443  55555666666666899999999999999


Q ss_pred             HHHhhccCCccEEEEecChHHHHHHh-hhcCCCCcceEEccCCCeeeecCCc---cccccccccccCccccCCHHHHHHH
Q 001536          568 INVLVDMGSAERQVLVRDYDVGKAVA-FEQRISNLKEVYTLDGHKMFSRGSV---QTILPLNRRLRTGRLCGSYDEKIKD  643 (1058)
Q Consensus       568 ~~~l~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~g~~~~~~~~~---~~~~~~~~~~~~~~~~~~l~~~i~~  643 (1058)
                      .++|++...+...+++++-..+..+. ....+.++..+++++|...+.+|..   .++.+.... ++..........+..
T Consensus       587 ~N~LID~s~iE~~lLiEdk~Ea~~~m~s~~~p~n~~~aytldg~~~~~~g~~~~~ySt~~~~~r-~~~~~~~s~d~~ie~  665 (1074)
T KOG0250|consen  587 LNVLIDKSGIEQVLLIEDKKEAREFMQSDKPPANVTKAYTLDGRQIFAGGPNYRVYSTRGTRAR-RPGVDEFSFDDEIED  665 (1074)
T ss_pred             HHHhhhhccceeEEEecchHHHHHHHhcCCCCccceeeeccCccccccCCCCcceeccCCCCCC-CccccchhHhHHHHH
Confidence            99999999999999999955555444 4444667889999999877666552   111111111 233445567888999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhhhcCCCCCCCchhHHHHHH
Q 001536          644 LERAALHVQEEAQQCRKRKRDSEERLQDLQQHQQNVKRRCFSAERNRMSKELAFQDVKNSFAADAGPPSASAVDEISQEI  723 (1058)
Q Consensus       644 l~~~l~~~~~~~~~l~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~l~~~~~~~~~~~~~~~~~~l~~~~  723 (1058)
                      ++.++..++.++..+......++..+..++..+..+...+...+..+.....++.++++..+.  .......++++..++
T Consensus       666 le~e~~~l~~~~~~l~~~~~~~e~~l~e~~~~~~~l~~~~~q~~~~~~~~~~em~el~n~~e~--~~~~~~~~~~l~~ei  743 (1074)
T KOG0250|consen  666 LEREASRLQKEILELENQRREAEKNLEELEKKLRELSEHIEQIKRRIRKKRAEMTELKNTAEE--KQVDISKLEDLAREI  743 (1074)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhhhh--hhcchhhhHHHHHHH
Confidence            999999999988888888888888888888888888888888888888888888888873111  001235567777777


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhHHHHHHHHHHHHHHh
Q 001536          724 SNIQEEIQEKEIILEKLQFSMNEAEAKVEDLKLSFQSLCESAKEEVDTFEAAEKELMEIEKNLQTSESEKAHYEDVMRTR  803 (1058)
Q Consensus       724 ~~l~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  803 (1058)
                      .....++......+..++..+..+......+..........+......+..+..++......+.........++..+ ..
T Consensus       744 ~~~~~eIe~~~~~~e~l~~e~e~~~~e~~e~~~~~~~~~~~l~~e~~~l~~l~~el~~r~dk~~s~e~~~~HyE~~~-K~  822 (1074)
T KOG0250|consen  744 KKKEKEIEEKEAPLEKLKEELEHIELEAQELEEYYAAGREKLQGEISKLDALKEELKLREDKLRSAEDEKRHYEDKL-KS  822 (1074)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhHHHHHHHHHHHHHhhhhhhhhhHHHHH-HH
Confidence            77788888888888888888888888888888888877777777777777777777766666666666666666555 33


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHhhCCchh--hhhcCCCCCCCHHHHHHHHHHHHHHHHHHhhhcCCCHHHHHHHH
Q 001536          804 VVGAIKEAESQYRELELLRQDSCRKASVICPESE--IEALGGWDGSTPEQLSAQVNRLNQRLKHESHQYSESIEDLRMLY  881 (1058)
Q Consensus       804 ~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~--~~~~~~~~~~~~~~l~~~l~~l~~~~~~~~~~~~~~~~~~~~~~  881 (1058)
                      .-..+...+..+..+...+.+....+...|+...  +..+    .....++...+.++...++..... ....+++-..+
T Consensus       823 ~l~~l~~~E~~~~~~e~~~~e~~~ka~~~cp~~~~ei~~~----~~~~~eik~ei~rlk~~i~~~ee~-~~~~~e~~~~~  897 (1074)
T KOG0250|consen  823 RLEELKQKEVEKVNLEEPRAEEDQKARTECPEEGIEIEAL----GKTVAEIKREIKRLKRQIQMCEES-LGELEELHRGL  897 (1074)
T ss_pred             hhHHHHHHHHHHHhhhcchhhhCchhhhhCccccchhhcc----cchHHHHHHHHHHHHHHHHHHHHh-cchHHHHHHHH
Confidence            4455666666776666666666666666776652  2222    235677888888888877765443 33333333333


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhccCceeeEeeccccceeEEEEecCC
Q 001536          882 EEKEHKILRKQQTYQAFREKVRACREALDSRWGKFQRNATLLKRQLTWQFNGHLGKKGISGKININYEEKTLSIEVKMPQ  961 (1058)
Q Consensus       882 ~~~~~~~~~l~~~~~~l~~~i~~l~~~~~~~~~~~~~~~~~~~~~~~~~f~~~~~~~~~~g~~~~~~~~~~l~i~v~~~~  961 (1058)
                      -.....+.....-...+.+.+..+...+..+|..|......+.-.....|..++...|+.|.+.+++.+..+++.|..|.
T Consensus       898 ~~~~~~~~k~~~~k~~~~e~L~~l~~~l~~R~~~~qk~r~~~~~~~~~~F~~~l~~R~~sg~l~~~~e~ktl~i~v~~~~  977 (1074)
T KOG0250|consen  898 HEARKELKKEDELKVTLDELLKALGEALESREQKYQKFRKLLTRRATEEFDALLGKRGFSGKLEFDHEEKTLSISVKLPT  977 (1074)
T ss_pred             HHHhhhhhhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhccccCcceeecccccccchhhccCC
Confidence            33333333333333336888888889999999999999999999999999999999999999999999999999995554


Q ss_pred             CCCCCcccCCccCCCCchhHHHHHHHHHhhhhcCCCeeeechhhhccChhhHHHHHHHHHHHHhcCCcEEEEEccCCCCC
Q 001536          962 DASSSNVRDTRGLSGGERSFSTLCFALALHEMTEAPFRAMDEFDVFMDAISRKISLDTLVDFALAQGSQWIFITPHDVGL 1041 (1058)
Q Consensus       962 ~~~~~~~~~~~~lSgGE~~~~~la~~~al~~~~~~p~~v~DE~~~~lD~~~~~~~~~~l~~~~~~~~~Q~i~iT~~~~~~ 1041 (1058)
                      ....+.+.++..|||||||++++||+||||.++.|||++|||+||+||.+||..++++|++++...++|||||||+++.+
T Consensus       978 ~~~~~~v~d~~gLSGGERSFsTv~lllsLW~~me~Pfr~LDEFDVFMD~vNRKi~~dlLv~~a~~~~~Q~IfiTPqdi~~ 1057 (1074)
T KOG0250|consen  978 SGNEKAVRDTRGLSGGERSFSTVCLLLSLWEVMECPFRALDEFDVFMDMVNRKISMDLLVDFAKKKGRQFIFITPQDISK 1057 (1074)
T ss_pred             CCcccccccccccCcccchHHHHHHHHHHhHhhcCchhhhhHHHHHHHHHHHHHHHHHHHHHHHhhcceEEEEccccHhh
Confidence            44446688999999999999999999999999999999999999999999999999999999987779999999999999


Q ss_pred             CCCCCCeeEEecCCCCC
Q 001536         1042 VKQGERIKKQQMAAPRP 1058 (1058)
Q Consensus      1042 ~~~~~~~~v~~~~~~~~ 1058 (1058)
                      +..+++|+|++|++|+.
T Consensus      1058 l~~~~~i~v~rm~~pe~ 1074 (1074)
T KOG0250|consen 1058 LNSDDGIVVFRMSDPER 1074 (1074)
T ss_pred             hccccceEEeeccCCCC
Confidence            99999999999999985

>COG1196 Smc Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>KOG0979 consensus Structural maintenance of chromosome protein SMC5/Spr18, SMC superfamily [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] Back     alignment and domain information
>KOG0996 consensus Structural maintenance of chromosome protein 4 (chromosome condensation complex Condensin, subunit C) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0933 consensus Structural maintenance of chromosome protein 2 (chromosome condensation complex Condensin, subunit E) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0964 consensus Structural maintenance of chromosome protein 3 (sister chromatid cohesion complex Cohesin, subunit SMC3) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0018 consensus Structural maintenance of chromosome protein 1 (sister chromatid cohesion complex Cohesin, subunit SMC1) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>TIGR02169 SMC_prok_A chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>TIGR02168 SMC_prok_B chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>PRK02224 chromosome segregation protein; Provisional Back     alignment and domain information
>PRK03918 chromosome segregation protein; Provisional Back     alignment and domain information
>PRK01156 chromosome segregation protein; Provisional Back     alignment and domain information
>COG0419 SbcC ATPase involved in DNA repair [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK10246 exonuclease subunit SbcC; Provisional Back     alignment and domain information
>TIGR00606 rad50 rad50 Back     alignment and domain information
>PRK04863 mukB cell division protein MukB; Provisional Back     alignment and domain information
>TIGR00618 sbcc exonuclease SbcC Back     alignment and domain information
>COG4717 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13514 AAA_27: AAA domain Back     alignment and domain information
>TIGR02680 conserved hypothetical protein TIGR02680 Back     alignment and domain information
>COG4913 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG0962 consensus DNA repair protein RAD50, ABC-type ATPase/SMC superfamily [Replication, recombination and repair] Back     alignment and domain information
>TIGR03185 DNA_S_dndD DNA sulfur modification protein DndD Back     alignment and domain information
>PRK10869 recombination and repair protein; Provisional Back     alignment and domain information
>COG0497 RecN ATPase involved in DNA repair [DNA replication, recombination, and repair] Back     alignment and domain information
>PHA02562 46 endonuclease subunit; Provisional Back     alignment and domain information
>PF02463 SMC_N: RecF/RecN/SMC N terminal domain; InterPro: IPR003395 This domain is found at the N terminus of structural maintenance of chromosomes (SMC) proteins, which function together with other proteins in a range of chromosomal transactions, including chromosome condensation, sister-chromatid cohesion, recombination, DNA repair and epigenetic silencing of gene expression [] Back     alignment and domain information
>PF12128 DUF3584: Protein of unknown function (DUF3584); InterPro: IPR021979 This family consist of uncharacterised bacterial proteins Back     alignment and domain information
>TIGR00634 recN DNA repair protein RecN Back     alignment and domain information
>COG3096 MukB Uncharacterized protein involved in chromosome partitioning [Cell division and chromosome partitioning] Back     alignment and domain information
>COG1196 Smc Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>KOG0250 consensus DNA repair protein RAD18 (SMC family protein) [Replication, recombination and repair] Back     alignment and domain information
>KOG0996 consensus Structural maintenance of chromosome protein 4 (chromosome condensation complex Condensin, subunit C) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>TIGR02169 SMC_prok_A chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>KOG0933 consensus Structural maintenance of chromosome protein 2 (chromosome condensation complex Condensin, subunit E) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>TIGR02168 SMC_prok_B chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>cd03273 ABC_SMC2_euk Eukaryotic SMC2 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains Back     alignment and domain information
>TIGR00634 recN DNA repair protein RecN Back     alignment and domain information
>cd03275 ABC_SMC1_euk Eukaryotic SMC1 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains Back     alignment and domain information
>PRK02224 chromosome segregation protein; Provisional Back     alignment and domain information
>PRK14079 recF recombination protein F; Provisional Back     alignment and domain information
>PHA02562 46 endonuclease subunit; Provisional Back     alignment and domain information
>PRK00064 recF recombination protein F; Reviewed Back     alignment and domain information
>cd03242 ABC_RecF RecF is a recombinational DNA repair ATPase that maintains replication in the presence of DNA damage Back     alignment and domain information
>cd03241 ABC_RecN RecN ATPase involved in DNA repair; ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds including sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>PF13555 AAA_29: P-loop containing region of AAA domain Back     alignment and domain information
>cd03277 ABC_SMC5_euk Eukaryotic SMC5 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains Back     alignment and domain information
>KOG0964 consensus Structural maintenance of chromosome protein 3 (sister chromatid cohesion complex Cohesin, subunit SMC3) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0161 consensus Myosin class II heavy chain [Cytoskeleton] Back     alignment and domain information
>KOG0018 consensus Structural maintenance of chromosome protein 1 (sister chromatid cohesion complex Cohesin, subunit SMC1) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0161 consensus Myosin class II heavy chain [Cytoskeleton] Back     alignment and domain information
>cd03272 ABC_SMC3_euk Eukaryotic SMC3 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains Back     alignment and domain information
>cd03239 ABC_SMC_head The structural maintenance of chromosomes (SMC) proteins are essential for successful chromosome transmission during replication and segregation of the genome in all organisms Back     alignment and domain information
>TIGR00611 recf recF protein Back     alignment and domain information
>COG1195 RecF Recombinational DNA repair ATPase (RecF pathway) [DNA replication, recombination, and repair] Back     alignment and domain information
>cd03276 ABC_SMC6_euk Eukaryotic SMC6 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains Back     alignment and domain information
>KOG0979 consensus Structural maintenance of chromosome protein SMC5/Spr18, SMC superfamily [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] Back     alignment and domain information
>PF13476 AAA_23: AAA domain; PDB: 3AV0_B 3AUY_B 3AUX_A 2O5V_A 3QG5_B 3QF7_A 3THO_A Back     alignment and domain information
>cd03279 ABC_sbcCD SbcCD and other Mre11/Rad50 (MR) complexes are implicated in the metabolism of DNA ends Back     alignment and domain information
>PRK03918 chromosome segregation protein; Provisional Back     alignment and domain information
>cd03240 ABC_Rad50 The catalytic domains of Rad50 are similar to the ATP-binding cassette of ABC transporters, but are not associated with membrane-spanning domains Back     alignment and domain information
>cd03278 ABC_SMC_barmotin Barmotin is a tight junction-associated protein expressed in rat epithelial cells which is thought to have an important regulatory role in tight junction barrier function Back     alignment and domain information
>cd03274 ABC_SMC4_euk Eukaryotic SMC4 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains Back     alignment and domain information
>PRK04863 mukB cell division protein MukB; Provisional Back     alignment and domain information
>PF12128 DUF3584: Protein of unknown function (DUF3584); InterPro: IPR021979 This family consist of uncharacterised bacterial proteins Back     alignment and domain information
>TIGR00606 rad50 rad50 Back     alignment and domain information
>PF11398 DUF2813: Protein of unknown function (DUF2813); InterPro: IPR022602 This entry contains YbjD from Escherichia coli (strain K12), which is a conserved protein with a nucleotide triphosphate binding domain Back     alignment and domain information
>PF13166 AAA_13: AAA domain Back     alignment and domain information
>cd03276 ABC_SMC6_euk Eukaryotic SMC6 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains Back     alignment and domain information
>KOG4674 consensus Uncharacterized conserved coiled-coil protein [Function unknown] Back     alignment and domain information
>COG3950 Predicted ATP-binding protein involved in virulence [General function prediction only] Back     alignment and domain information
>PRK01156 chromosome segregation protein; Provisional Back     alignment and domain information
>COG5293 Predicted ATPase [General function prediction only] Back     alignment and domain information
>cd03277 ABC_SMC5_euk Eukaryotic SMC5 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains Back     alignment and domain information
>PF00261 Tropomyosin: Tropomyosin; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells Back     alignment and domain information
>PF10174 Cast: RIM-binding protein of the cytomatrix active zone; InterPro: IPR019323 This entry represents a family of proteins that form part of the CAZ (cytomatrix at the active zone) complex which is involved in determining the site of synaptic vesicle fusion [] Back     alignment and domain information
>PF01576 Myosin_tail_1: Myosin tail; InterPro: IPR002928 Muscle contraction is caused by sliding between the thick and thin filaments of the myofibril Back     alignment and domain information
>cd03227 ABC_Class2 ABC-type Class 2 contains systems involved in cellular processes other than transport Back     alignment and domain information
>cd03278 ABC_SMC_barmotin Barmotin is a tight junction-associated protein expressed in rat epithelial cells which is thought to have an important regulatory role in tight junction barrier function Back     alignment and domain information
>PF00261 Tropomyosin: Tropomyosin; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells Back     alignment and domain information
>cd03239 ABC_SMC_head The structural maintenance of chromosomes (SMC) proteins are essential for successful chromosome transmission during replication and segregation of the genome in all organisms Back     alignment and domain information
>COG3840 ThiQ ABC-type thiamine transport system, ATPase component [Coenzyme metabolism] Back     alignment and domain information
>PF04310 MukB: MukB N-terminal; InterPro: IPR007406 This is the N-terminal region of MukB Back     alignment and domain information
>PF13166 AAA_13: AAA domain Back     alignment and domain information
>cd03240 ABC_Rad50 The catalytic domains of Rad50 are similar to the ATP-binding cassette of ABC transporters, but are not associated with membrane-spanning domains Back     alignment and domain information
>COG1122 CbiO ABC-type cobalt transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG1136 SalX ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>PRK04778 septation ring formation regulator EzrA; Provisional Back     alignment and domain information
>PF01576 Myosin_tail_1: Myosin tail; InterPro: IPR002928 Muscle contraction is caused by sliding between the thick and thin filaments of the myofibril Back     alignment and domain information
>cd03275 ABC_SMC1_euk Eukaryotic SMC1 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains Back     alignment and domain information
>COG1121 ZnuC ABC-type Mn/Zn transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG3593 Predicted ATP-dependent endonuclease of the OLD family [DNA replication, recombination, and repair] Back     alignment and domain information
>PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT) Back     alignment and domain information
>COG4637 Predicted ATPase [General function prediction only] Back     alignment and domain information
>COG1106 Predicted ATPases [General function prediction only] Back     alignment and domain information
>PF13558 SbcCD_C: Putative exonuclease SbcCD, C subunit; PDB: 3QG5_B 3QF7_A 3THO_A 3EUK_H 3EUJ_A 3AV0_B 3AUY_B 3AUX_A Back     alignment and domain information
>cd03274 ABC_SMC4_euk Eukaryotic SMC4 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains Back     alignment and domain information
>cd03273 ABC_SMC2_euk Eukaryotic SMC2 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains Back     alignment and domain information
>KOG0994 consensus Extracellular matrix glycoprotein Laminin subunit beta [Extracellular structures] Back     alignment and domain information
>PF13175 AAA_15: AAA ATPase domain Back     alignment and domain information
>cd03259 ABC_Carb_Solutes_like ABC Carbohydrate and Solute Transporters-like subgroup Back     alignment and domain information
>COG3910 Predicted ATPase [General function prediction only] Back     alignment and domain information
>COG1120 FepC ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>KOG0994 consensus Extracellular matrix glycoprotein Laminin subunit beta [Extracellular structures] Back     alignment and domain information
>cd03293 ABC_NrtD_SsuB_transporters NrtD and SsuB are the ATP-binding subunits of the bacterial ABC-type nitrate and sulfonate transport systems, respectively Back     alignment and domain information
>COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>cd03235 ABC_Metallic_Cations ABC component of the metal-type transporters Back     alignment and domain information
>TIGR01184 ntrCD nitrate transport ATP-binding subunits C and D Back     alignment and domain information
>cd03225 ABC_cobalt_CbiO_domain1 Domain I of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota Back     alignment and domain information
>cd00267 ABC_ATPase ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>COG1116 TauB ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd03256 ABC_PhnC_transporter ABC-type phosphate/phosphonate transport system Back     alignment and domain information
>cd03237 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 of RNase L inhibitor Back     alignment and domain information
>PRK11247 ssuB aliphatic sulfonates transport ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR00960 3a0501s02 Type II (General) Secretory Pathway (IISP) Family protein Back     alignment and domain information
>TIGR01277 thiQ thiamine ABC transporter, ATP-binding protein Back     alignment and domain information
>cd03214 ABC_Iron-Siderophores_B12_Hemin ABC transporters, involved in the uptake of siderophores, heme, and vitamin B12, are widely conserved in bacteria and archaea Back     alignment and domain information
>COG1124 DppF ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>cd03255 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of liporoteins from the cytoplasmic membrane (LolCDE) Back     alignment and domain information
>cd03261 ABC_Org_Solvent_Resistant ABC (ATP-binding cassette) transport system involved in resistant to organic solvents; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>PRK11248 tauB taurine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR01166 cbiO cobalt transport protein ATP-binding subunit Back     alignment and domain information
>cd03265 ABC_DrrA DrrA is the ATP-binding protein component of a bacterial exporter complex that confers resistance to the antibiotics daunorubicin and doxorubicin Back     alignment and domain information
>cd03298 ABC_ThiQ_thiamine_transporter ABC-type thiamine tranport system; part of the binding-protein-dependent transport system tbpA-thiPQ for thiamine and TPP Back     alignment and domain information
>cd03296 ABC_CysA_sulfate_importer Part of the ABC transporter complex cysAWTP involved in sulfate import Back     alignment and domain information
>TIGR02211 LolD_lipo_ex lipoprotein releasing system, ATP-binding protein Back     alignment and domain information
>cd03226 ABC_cobalt_CbiO_domain2 Domain II of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota Back     alignment and domain information
>TIGR02673 FtsE cell division ATP-binding protein FtsE Back     alignment and domain information
>cd03230 ABC_DR_subfamily_A This family of ATP-binding proteins belongs to a multisubunit transporter involved in drug resistance (BcrA and DrrA), nodulation, lipid transport, and lantibiotic immunity Back     alignment and domain information
>cd03220 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transporter subfamily is involved in extracellular polysaccharide export Back     alignment and domain information
>PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT) Back     alignment and domain information
>COG1125 OpuBA ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>cd03227 ABC_Class2 ABC-type Class 2 contains systems involved in cellular processes other than transport Back     alignment and domain information
>cd03297 ABC_ModC_molybdenum_transporter ModC is an ABC-type transporter and the ATPase component of a molybdate transport system that also includes the periplasmic binding protein ModA and the membrane protein ModB Back     alignment and domain information
>PRK13538 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>PRK11629 lolD lipoprotein transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03268 ABC_BcrA_bacitracin_resist The BcrA subfamily represents ABC transporters involved in peptide antibiotic resistance Back     alignment and domain information
>cd03231 ABC_CcmA_heme_exporter CcmA, the ATP-binding component of the bacterial CcmAB transporter Back     alignment and domain information
>cd03257 ABC_NikE_OppD_transporters The ABC transporter subfamily specific for the transport of dipeptides, oligopeptides (OppD), and nickel (NikDE) Back     alignment and domain information
>TIGR02315 ABC_phnC phosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>cd03260 ABC_PstB_phosphate_transporter Phosphate uptake is of fundamental importance in the cell physiology of bacteria because phosphate is required as a nutrient Back     alignment and domain information
>cd03229 ABC_Class3 This class is comprised of all BPD (Binding Protein Dependent) systems that are largely represented in archaea and eubacteria and are primarily involved in scavenging solutes from the environment Back     alignment and domain information
>TIGR02680 conserved hypothetical protein TIGR02680 Back     alignment and domain information
>TIGR03864 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system Back     alignment and domain information
>cd03269 ABC_putative_ATPase This subfamily is involved in drug resistance, nodulation, lipid transport, and bacteriocin and lantibiotic immunity Back     alignment and domain information
>cd03301 ABC_MalK_N The N-terminal ATPase domain of the maltose transporter, MalK Back     alignment and domain information
>TIGR02770 nickel_nikD nickel import ATP-binding protein NikD Back     alignment and domain information
>PRK14245 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03218 ABC_YhbG The ABC transporters belonging to the YhbG family are similar to members of the Mj1267_LivG family, which is involved in the transport of branched-chain amino acids Back     alignment and domain information
>COG4181 Predicted ABC-type transport system involved in lysophospholipase L1 biosynthesis, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>cd03262 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP-binding components of the bacterial periplasmic histidine and glutamine permeases, repectively Back     alignment and domain information
>cd03258 ABC_MetN_methionine_transporter MetN (also known as YusC) is an ABC-type transporter encoded by metN of the metNPQ operon in Bacillus subtilis that is involved in methionine transport Back     alignment and domain information
>cd03219 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC transporter subfamily is involved in the transport of the hydrophobic amino acids leucine, isoleucine and valine Back     alignment and domain information
>cd03263 ABC_subfamily_A The ABCA subfamily mediates the transport of a variety of lipid compounds Back     alignment and domain information
>PRK11831 putative ABC transporter ATP-binding protein YrbF; Provisional Back     alignment and domain information
>cd03264 ABC_drug_resistance_like ABC-type multidrug transport system, ATPase component Back     alignment and domain information
>PRK10584 putative ABC transporter ATP-binding protein YbbA; Provisional Back     alignment and domain information
>PRK10771 thiQ thiamine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03266 ABC_NatA_sodium_exporter NatA is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled proton or K+ uptake Back     alignment and domain information
>PRK13637 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14250 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03294 ABC_Pro_Gly_Bertaine This family comprises the glycine betaine/L-proline ATP binding subunit in bacteria and its equivalents in archaea Back     alignment and domain information
>cd03267 ABC_NatA_like Similar in sequence to NatA, this is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled to proton or K+ uptake Back     alignment and domain information
>COG0444 DppD ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK15112 antimicrobial peptide ABC system ATP-binding protein SapF; Provisional Back     alignment and domain information
>PRK10575 iron-hydroxamate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR01188 drrA daunorubicin resistance ABC transporter ATP-binding subunit Back     alignment and domain information
>cd03241 ABC_RecN RecN ATPase involved in DNA repair; ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds including sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>PRK14258 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03216 ABC_Carb_Monos_I This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information
>COG4525 TauB ABC-type taurine transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK13645 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14247 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10619 histidine/lysine/arginine/ornithine transporter subunit; Provisional Back     alignment and domain information
>PRK14268 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR00972 3a0107s01c2 phosphate ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK11614 livF leucine/isoleucine/valine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR01186 proV glycine betaine/L-proline transport ATP binding subunit Back     alignment and domain information
>PRK11022 dppD dipeptide transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR01187 potA spermidine/putrescine ABC transporter ATP-binding subunit Back     alignment and domain information
>PRK13643 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03295 ABC_OpuCA_Osmoprotection OpuCA is a the ATP binding component of a bacterial solute transporter that serves a protective role to cells growing in a hyperosmolar environment Back     alignment and domain information
>cd03245 ABCC_bacteriocin_exporters ABC-type bacteriocin exporters Back     alignment and domain information
>cd03292 ABC_FtsE_transporter FtsE is a hydrophilic nucleotide-binding protein that binds FtsX to form a heterodimeric ATP-binding cassette (ABC)-type transporter that associates with the bacterial inner membrane Back     alignment and domain information
>PRK10253 iron-enterobactin transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14242 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03215 ABC_Carb_Monos_II This family represents domain II of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information
>PRK13540 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>TIGR01189 ccmA heme ABC exporter, ATP-binding protein CcmA Back     alignment and domain information
>PRK14269 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13646 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK10070 glycine betaine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03224 ABC_TM1139_LivF_branched LivF (TM1139) is part of the LIV-I bacterial ABC-type two-component transport system that imports neutral, branched-chain amino acids Back     alignment and domain information
>TIGR02323 CP_lyasePhnK phosphonate C-P lyase system protein PhnK Back     alignment and domain information
>TIGR03410 urea_trans_UrtE urea ABC transporter, ATP-binding protein UrtE Back     alignment and domain information
>PRK13634 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11264 putative amino-acid ABC transporter ATP-binding protein YecC; Provisional Back     alignment and domain information
>PRK13543 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>PRK14273 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14262 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG4674 Uncharacterized ABC-type transport system, ATPase component [General function prediction only] Back     alignment and domain information
>PRK11308 dppF dipeptide transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK10418 nikD nickel transporter ATP-binding protein NikD; Provisional Back     alignment and domain information
>cd03222 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor (RLI) is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids Back     alignment and domain information
>PRK13631 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK09544 znuC high-affinity zinc transporter ATPase; Reviewed Back     alignment and domain information
>PRK13548 hmuV hemin importer ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR03740 galliderm_ABC gallidermin-class lantibiotic protection ABC transporter, ATP-binding subunit Back     alignment and domain information
>PRK13539 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>PRK11701 phnK phosphonate C-P lyase system protein PhnK; Provisional Back     alignment and domain information
>PRK11650 ugpC glycerol-3-phosphate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK10908 cell division protein FtsE; Provisional Back     alignment and domain information
>TIGR03005 ectoine_ehuA ectoine/hydroxyectoine ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK14274 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14270 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10744 pstB phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03272 ABC_SMC3_euk Eukaryotic SMC3 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains Back     alignment and domain information
>PRK15079 oligopeptide ABC transporter ATP-binding protein OppF; Provisional Back     alignment and domain information
>PRK09452 potA putrescine/spermidine ABC transporter ATPase protein; Reviewed Back     alignment and domain information
>COG4987 CydC ABC-type transport system involved in cytochrome bd biosynthesis, fused ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK13651 cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK09984 phosphonate/organophosphate ester transporter subunit; Provisional Back     alignment and domain information
>TIGR01288 nodI ATP-binding ABC transporter family nodulation protein NodI Back     alignment and domain information
>PRK11231 fecE iron-dicitrate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>KOG0971 consensus Microtubule-associated protein dynactin DCTN1/Glued [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton] Back     alignment and domain information
>PRK11153 metN DL-methionine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK10247 putative ABC transporter ATP-binding protein YbbL; Provisional Back     alignment and domain information
>TIGR03771 anch_rpt_ABC anchored repeat-type ABC transporter, ATP-binding subunit Back     alignment and domain information
>TIGR02314 ABC_MetN D-methionine ABC transporter, ATP-binding protein Back     alignment and domain information
>TIGR03411 urea_trans_UrtD urea ABC transporter, ATP-binding protein UrtD Back     alignment and domain information
>PRK14240 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03233 ABC_PDR_domain1 The pleiotropic drug resistance (PDR) family of ATP-binding cassette (ABC) transporters Back     alignment and domain information
>PRK14239 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14241 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK09493 glnQ glutamine ABC transporter ATP-binding protein; Reviewed Back     alignment and domain information
>PRK14259 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13638 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>KOG0976 consensus Rho/Rac1-interacting serine/threonine kinase Citron [Signal transduction mechanisms] Back     alignment and domain information
>KOG0977 consensus Nuclear envelope protein lamin, intermediate filament superfamily [Cell cycle control, cell division, chromosome partitioning; Nuclear structure] Back     alignment and domain information
>PRK11300 livG leucine/isoleucine/valine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03279 ABC_sbcCD SbcCD and other Mre11/Rad50 (MR) complexes are implicated in the metabolism of DNA ends Back     alignment and domain information
>COG1131 CcmA ABC-type multidrug transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>PRK14235 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14243 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG4175 ProV ABC-type proline/glycine betaine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>PRK11000 maltose/maltodextrin transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13547 hmuV hemin importer ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14255 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14244 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13649 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK15056 manganese/iron transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14265 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG4988 CydD ABC-type transport system involved in cytochrome bd biosynthesis, ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14238 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10419 nikE nickel transporter ATP-binding protein NikE; Provisional Back     alignment and domain information
>PRK14267 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK09473 oppD oligopeptide transporter ATP-binding component; Provisional Back     alignment and domain information
>cd03246 ABCC_Protease_Secretion This family represents the ABC component of the protease secretion system PrtD, a 60-kDa integral membrane protein sharing 37% identity with HlyB, the ABC component of the alpha-hemolysin secretion pathway, in the C-terminal domain Back     alignment and domain information
>cd03252 ABCC_Hemolysin The ABC-transporter hemolysin B is a central component of the secretion machinery that translocates the toxin, hemolysin A, in a Sec-independent fashion across both membranes of E Back     alignment and domain information
>TIGR02142 modC_ABC molybdenum ABC transporter, ATP-binding protein Back     alignment and domain information
>cd03232 ABC_PDR_domain2 The pleiotropic drug resistance-like (PDR) family of ATP-binding cassette (ABC) transporters Back     alignment and domain information
>cd03254 ABCC_Glucan_exporter_like Glucan exporter ATP-binding protein Back     alignment and domain information
>COG4559 ABC-type hemin transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK14251 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03249 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) is a mitochondrial ATP-binding cassette protein involved in iron homeostasis and one of four ABC transporters expressed in the mitochondrial inner membrane, the other three being MDL1(ABC7), MDL2, and ATM1 Back     alignment and domain information
>PRK14248 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14271 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11124 artP arginine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03228 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-like transporters are involved in drug, peptide, and lipid export Back     alignment and domain information
>PRK14256 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13409 putative ATPase RIL; Provisional Back     alignment and domain information
>PRK11144 modC molybdate transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03238 ABC_UvrA The excision repair protein UvrA; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion Back     alignment and domain information
>TIGR02769 nickel_nikE nickel import ATP-binding protein NikE Back     alignment and domain information
>COG4694 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PRK13545 tagH teichoic acids export protein ATP-binding subunit; Provisional Back     alignment and domain information
>PRK15093 antimicrobial peptide ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13648 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14261 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13546 teichoic acids export protein ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14275 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11432 fbpC ferric transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK10851 sulfate/thiosulfate transporter subunit; Provisional Back     alignment and domain information
>cd03213 ABCG_EPDR ABCG transporters are involved in eye pigment (EP) precursor transport, regulation of lipid-trafficking mechanisms, and pleiotropic drug resistance (DR) Back     alignment and domain information
>TIGR01978 sufC FeS assembly ATPase SufC Back     alignment and domain information
>cd03234 ABCG_White The White subfamily represents ABC transporters homologous to the Drosophila white gene, which acts as a dimeric importer for eye pigment precursors Back     alignment and domain information
>PRK13647 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03251 ABCC_MsbA MsbA is an essential ABC transporter, closely related to eukaryotic MDR proteins Back     alignment and domain information
>cd03248 ABCC_TAP TAP, the Transporter Associated with Antigen Processing; TAP is essential for peptide delivery from the cytosol into the lumen of the endoplasmic reticulum (ER), where these peptides are loaded on major histocompatibility complex (MHC) I molecules Back     alignment and domain information
>TIGR03265 PhnT2 putative 2-aminoethylphosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK14253 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13650 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR03258 PhnT 2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT Back     alignment and domain information
>PRK13641 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03217 ABC_FeS_Assembly ABC-type transport system involved in Fe-S cluster assembly, ATPase component Back     alignment and domain information
>PRK13536 nodulation factor exporter subunit NodI; Provisional Back     alignment and domain information
>PRK14272 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK03695 vitamin B12-transporter ATPase; Provisional Back     alignment and domain information
>PRK14263 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13636 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR03608 L_ocin_972_ABC putative bacteriocin export ABC transporter, lactococcin 972 group Back     alignment and domain information
>COG1119 ModF ABC-type molybdenum transport system, ATPase component/photorepair protein PhrA [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR03873 F420-0_ABC_ATP proposed F420-0 ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK13633 cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13652 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG1340 Uncharacterized archaeal coiled-coil protein [Function unknown] Back     alignment and domain information
>PRK14266 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14237 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10895 lipopolysaccharide ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR03415 ABC_choXWV_ATP choline ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK14254 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13632 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13639 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03300 ABC_PotA_N PotA is an ABC-type transporter and the ATPase component of the spermidine/putrescine-preferential uptake system consisting of PotA, -B, -C, and -D Back     alignment and domain information
>cd03270 ABC_UvrA_I The excision repair protein UvrA domain I; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion Back     alignment and domain information
>PRK14236 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14249 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK15134 microcin C ABC transporter ATP-binding protein YejF; Provisional Back     alignment and domain information
>COG4619 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>COG1123 ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] Back     alignment and domain information
>PRK13537 nodulation ABC transporter NodI; Provisional Back     alignment and domain information
>cd03369 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-type transporter 1) Back     alignment and domain information
>PRK14260 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR02324 CP_lyasePhnL phosphonate C-P lyase system protein PhnL Back     alignment and domain information
>COG1127 Ttg2A ABC-type transport system involved in resistance to organic solvents, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>cd03247 ABCC_cytochrome_bd The CYD subfamily implicated in cytochrome bd biogenesis Back     alignment and domain information
>cd03244 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C Back     alignment and domain information
>PRK11607 potG putrescine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK10938 putative molybdenum transport ATP-binding protein ModF; Provisional Back     alignment and domain information
>PRK13541 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>PRK13640 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG1123 ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] Back     alignment and domain information
>TIGR02633 xylG D-xylose ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK11637 AmiB activator; Provisional Back     alignment and domain information
>PRK15134 microcin C ABC transporter ATP-binding protein YejF; Provisional Back     alignment and domain information
>PRK10938 putative molybdenum transport ATP-binding protein ModF; Provisional Back     alignment and domain information
>TIGR03269 met_CoM_red_A2 methyl coenzyme M reductase system, component A2 Back     alignment and domain information
>TIGR00611 recf recF protein Back     alignment and domain information
>cd03223 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette transporter (Pat) is involved in the import of very long-chain fatty acids (VLCFA) into the peroxisome Back     alignment and domain information
>PRK15439 autoinducer 2 ABC transporter ATP-binding protein LsrA; Provisional Back     alignment and domain information
>TIGR00968 3a0106s01 sulfate ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK14252 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK09700 D-allose transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10762 D-ribose transporter ATP binding protein; Provisional Back     alignment and domain information
>cd03271 ABC_UvrA_II The excision repair protein UvrA domain II; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion Back     alignment and domain information
>cd03299 ABC_ModC_like Archeal protein closely related to ModC Back     alignment and domain information
>PRK13642 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PF05557 MAD: Mitotic checkpoint protein; InterPro: IPR008672 This family consists of several eukaryotic mitotic checkpoint (Mitotic arrest deficient or MAD) proteins Back     alignment and domain information
>cd03221 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth Back     alignment and domain information
>PRK09580 sufC cysteine desulfurase ATPase component; Reviewed Back     alignment and domain information
>cd03253 ABCC_ATM1_transporter ATM1 is an ABC transporter that is expressed in the mitochondria Back     alignment and domain information
>PF05701 WEMBL: Weak chloroplast movement under blue light; InterPro: IPR008545 This family consists of several plant proteins of unknown function Back     alignment and domain information
>PRK11637 AmiB activator; Provisional Back     alignment and domain information
>COG2884 FtsE Predicted ATPase involved in cell division [Cell division and chromosome partitioning] Back     alignment and domain information
>PRK13549 xylose transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG2274 SunT ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain [Defense mechanisms] Back     alignment and domain information
>COG4604 CeuD ABC-type enterochelin transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK14264 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG4938 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK10261 glutathione transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11288 araG L-arabinose transporter ATP-binding protein; Provisional Back     alignment and domain information
>PF00038 Filament: Intermediate filament protein; InterPro: IPR016044 Intermediate filaments (IF) [, , ] are proteins which are primordial components of the cytoskeleton and the nuclear envelope Back     alignment and domain information
>KOG1029 consensus Endocytic adaptor protein intersectin [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>TIGR03522 GldA_ABC_ATP gliding motility-associated ABC transporter ATP-binding subunit GldA Back     alignment and domain information
>PRK15177 Vi polysaccharide export ATP-binding protein VexC; Provisional Back     alignment and domain information
>TIGR03269 met_CoM_red_A2 methyl coenzyme M reductase system, component A2 Back     alignment and domain information
>PRK13644 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13635 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG3842 PotA ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>COG1118 CysA ABC-type sulfate/molybdate transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK00064 recF recombination protein F; Reviewed Back     alignment and domain information
>TIGR02982 heterocyst_DevA ABC exporter ATP-binding subunit, DevA family Back     alignment and domain information
>PRK10982 galactose/methyl galaxtoside transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14257 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>CHL00131 ycf16 sulfate ABC transporter protein; Validated Back     alignment and domain information
>PRK10982 galactose/methyl galaxtoside transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03236 ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 of RNase L inhibitor Back     alignment and domain information
>COG4559 ABC-type hemin transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK09536 btuD corrinoid ABC transporter ATPase; Reviewed Back     alignment and domain information
>PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes Back     alignment and domain information
>COG1120 FepC ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>PRK14246 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG4608 AppF ABC-type oligopeptide transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>COG5293 Predicted ATPase [General function prediction only] Back     alignment and domain information
>PRK11288 araG L-arabinose transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03250 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C Back     alignment and domain information
>cd03290 ABCC_SUR1_N The SUR domain 1 Back     alignment and domain information
>TIGR02633 xylG D-xylose ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK13549 xylose transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK15439 autoinducer 2 ABC transporter ATP-binding protein LsrA; Provisional Back     alignment and domain information
>PRK10261 glutathione transporter ATP-binding protein; Provisional Back     alignment and domain information
>KOG0977 consensus Nuclear envelope protein lamin, intermediate filament superfamily [Cell cycle control, cell division, chromosome partitioning; Nuclear structure] Back     alignment and domain information
>PRK13409 putative ATPase RIL; Provisional Back     alignment and domain information
>PRK09700 D-allose transporter ATP-binding protein; Provisional Back     alignment and domain information
>PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes Back     alignment and domain information
>PRK10762 D-ribose transporter ATP binding protein; Provisional Back     alignment and domain information
>COG1117 PstB ABC-type phosphate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR02203 MsbA_lipidA lipid A export permease/ATP-binding protein MsbA Back     alignment and domain information
>PRK11174 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed Back     alignment and domain information
>cd03288 ABCC_SUR2 The SUR domain 2 Back     alignment and domain information
>COG4172 ABC-type uncharacterized transport system, duplicated ATPase component [General function prediction only] Back     alignment and domain information
>cd03289 ABCC_CFTR2 The CFTR subfamily domain 2 Back     alignment and domain information
>cd03291 ABCC_CFTR1 The CFTR subfamily domain 1 Back     alignment and domain information
>TIGR03719 ABC_ABC_ChvD ATP-binding cassette protein, ChvD family Back     alignment and domain information
>TIGR01192 chvA glucan exporter ATP-binding protein Back     alignment and domain information
>KOG1003 consensus Actin filament-coating protein tropomyosin [Cytoskeleton] Back     alignment and domain information
>PRK10789 putative multidrug transporter membrane\ATP-binding components; Provisional Back     alignment and domain information
>COG4372 Uncharacterized protein conserved in bacteria with the myosin-like domain [Function unknown] Back     alignment and domain information
>KOG1029 consensus Endocytic adaptor protein intersectin [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK13657 cyclic beta-1,2-glucan ABC transporter; Provisional Back     alignment and domain information
>COG3839 MalK ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG1121 ZnuC ABC-type Mn/Zn transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK11176 lipid transporter ATP-binding/permease protein; Provisional Back     alignment and domain information
>PRK10636 putative ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PF09730 BicD: Microtubule-associated protein Bicaudal-D; InterPro: IPR018477 BicD proteins consist of three coiled-coiled domains and are involved in dynein-mediated minus end-directed transport from the Golgi apparatus to the endoplasmic reticulum (ER) [] Back     alignment and domain information
>TIGR01194 cyc_pep_trnsptr cyclic peptide transporter Back     alignment and domain information
>COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] Back     alignment and domain information
>COG4598 HisP ABC-type histidine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>PRK14265 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10790 putative multidrug transporter membrane\ATP-binding components; Provisional Back     alignment and domain information
>PLN03211 ABC transporter G-25; Provisional Back     alignment and domain information
>PRK11160 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed Back     alignment and domain information
>COG4618 ArpD ABC-type protease/lipase transport system, ATPase and permease components [General function prediction only] Back     alignment and domain information
>COG4604 CeuD ABC-type enterochelin transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK11819 putative ABC transporter ATP-binding protein; Reviewed Back     alignment and domain information
>COG1135 AbcC ABC-type metal ion transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd03242 ABC_RecF RecF is a recombinational DNA repair ATPase that maintains replication in the presence of DNA damage Back     alignment and domain information
>PRK15064 ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR03375 type_I_sec_LssB type I secretion system ATPase, LssB family Back     alignment and domain information
>PRK14242 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG4133 CcmA ABC-type transport system involved in cytochrome c biogenesis, ATPase component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG0411 LivG ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>PRK04778 septation ring formation regulator EzrA; Provisional Back     alignment and domain information
>PF05701 WEMBL: Weak chloroplast movement under blue light; InterPro: IPR008545 This family consists of several plant proteins of unknown function Back     alignment and domain information
>COG0396 sufC Cysteine desulfurase activator ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG4172 ABC-type uncharacterized transport system, duplicated ATPase component [General function prediction only] Back     alignment and domain information
>PRK15064 ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10522 multidrug transporter membrane component/ATP-binding component; Provisional Back     alignment and domain information
>TIGR00630 uvra excinuclease ABC, A subunit Back     alignment and domain information
>TIGR01846 type_I_sec_HlyB type I secretion system ABC transporter, HlyB family Back     alignment and domain information
>TIGR02868 CydC thiol reductant ABC exporter, CydC subunit Back     alignment and domain information
>PRK14268 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03215 ABC_Carb_Monos_II This family represents domain II of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information
>TIGR01842 type_I_sec_PrtD type I secretion system ABC transporter, PrtD family Back     alignment and domain information
>TIGR02204 MsbA_rel ABC transporter, permease/ATP-binding protein Back     alignment and domain information
>PRK10584 putative ABC transporter ATP-binding protein YbbA; Provisional Back     alignment and domain information
>cd03238 ABC_UvrA The excision repair protein UvrA; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion Back     alignment and domain information
>COG4372 Uncharacterized protein conserved in bacteria with the myosin-like domain [Function unknown] Back     alignment and domain information
>PF06470 SMC_hinge: SMC proteins Flexible Hinge Domain; InterPro: IPR010935 This entry represents the hinge region of the SMC (Structural Maintenance of Chromosomes) family of proteins Back     alignment and domain information
>cd03221 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth Back     alignment and domain information
>COG1132 MdlB ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms] Back     alignment and domain information
>TIGR03719 ABC_ABC_ChvD ATP-binding cassette protein, ChvD family Back     alignment and domain information
>COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>cd03296 ABC_CysA_sulfate_importer Part of the ABC transporter complex cysAWTP involved in sulfate import Back     alignment and domain information
>KOG0057 consensus Mitochondrial Fe/S cluster exporter, ABC superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK13538 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>PRK13539 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>PRK11819 putative ABC transporter ATP-binding protein; Reviewed Back     alignment and domain information
>PRK11147 ABC transporter ATPase component; Reviewed Back     alignment and domain information
>COG4778 PhnL ABC-type phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG1137 YhbG ABC-type (unclassified) transport system, ATPase component [General function prediction only] Back     alignment and domain information
>PRK13540 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>PRK11248 tauB taurine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG4133 CcmA ABC-type transport system involved in cytochrome c biogenesis, ATPase component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14261 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PF00038 Filament: Intermediate filament protein; InterPro: IPR016044 Intermediate filaments (IF) [, , ] are proteins which are primordial components of the cytoskeleton and the nuclear envelope Back     alignment and domain information
>TIGR02315 ABC_phnC phosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>PLN03073 ABC transporter F family; Provisional Back     alignment and domain information
>cd00267 ABC_ATPase ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>PRK14079 recF recombination protein F; Provisional Back     alignment and domain information
>PRK14245 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR02673 FtsE cell division ATP-binding protein FtsE Back     alignment and domain information
>PF12718 Tropomyosin_1: Tropomyosin like; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells Back     alignment and domain information
>COG0396 sufC Cysteine desulfurase activator ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd03264 ABC_drug_resistance_like ABC-type multidrug transport system, ATPase component Back     alignment and domain information
>PRK14237 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03265 ABC_DrrA DrrA is the ATP-binding protein component of a bacterial exporter complex that confers resistance to the antibiotics daunorubicin and doxorubicin Back     alignment and domain information
>PRK14247 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03248 ABCC_TAP TAP, the Transporter Associated with Antigen Processing; TAP is essential for peptide delivery from the cytosol into the lumen of the endoplasmic reticulum (ER), where these peptides are loaded on major histocompatibility complex (MHC) I molecules Back     alignment and domain information
>PRK11147 ABC transporter ATPase component; Reviewed Back     alignment and domain information
>PF00005 ABC_tran: ABC transporter This structure is on hold until Dec 1999; InterPro: IPR003439 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energise diverse biological systems Back     alignment and domain information
>PRK11247 ssuB aliphatic sulfonates transport ATP-binding subunit; Provisional Back     alignment and domain information
>KOG0058 consensus Peptide exporter, ABC superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK14262 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03262 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP-binding components of the bacterial periplasmic histidine and glutamine permeases, repectively Back     alignment and domain information
>PRK10744 pstB phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR01257 rim_protein retinal-specific rim ABC transporter Back     alignment and domain information
>TIGR00960 3a0501s02 Type II (General) Secretory Pathway (IISP) Family protein Back     alignment and domain information
>TIGR03864 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system Back     alignment and domain information
>PRK09544 znuC high-affinity zinc transporter ATPase; Reviewed Back     alignment and domain information
>PRK13638 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14238 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>KOG0976 consensus Rho/Rac1-interacting serine/threonine kinase Citron [Signal transduction mechanisms] Back     alignment and domain information
>PRK11629 lolD lipoprotein transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14243 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR03797 NHPM_micro_ABC2 NHPM bacteriocin system ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK00349 uvrA excinuclease ABC subunit A; Reviewed Back     alignment and domain information
>PRK14273 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03269 ABC_putative_ATPase This subfamily is involved in drug resistance, nodulation, lipid transport, and bacteriocin and lantibiotic immunity Back     alignment and domain information
>PRK14275 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1058
3qku_A359 Mre11 Rad50 Binding Domain In Complex With Rad50 An 2e-05
1ii8_A195 Crystal Structure Of The P. Furiosus Rad50 Atpase D 2e-05
3qkt_A339 Rad50 Abc-Atpase With Adjacent Coiled-Coil Region I 2e-05
3qkr_A203 Mre11 Rad50 Binding Domain Bound To Rad50 Length = 2e-05
1us8_A147 The Rad50 Signature Motif: Essential To Atp Binding 1e-04
1xew_Y172 Structural Biochemistry Of Atp-Driven Dimerization 1e-04
1f2t_A149 Crystal Structure Of Atp-free Rad50 Abc-atpase Leng 1e-04
3kta_B173 Structural Basis For Adenylate Kinase Activity In A 2e-04
1xex_B172 Structural Biochemistry Of Atp-Driven Dimerization 3e-04
4i99_A354 Crystal Structure Of The Smchead Bound To The C-win 8e-04
>pdb|3QKU|A Chain A, Mre11 Rad50 Binding Domain In Complex With Rad50 And Amp-Pnp Length = 359 Back     alignment and structure 
Iteration: 1

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 20/43 (46%), Positives = 28/43 (65%)
Query: 24 RVRLENFMCHSSLQIELGEWVNFITGQNGSGKSAILTALCIAF 66
          RV ++NF  HS   +E  E +N I GQNGSGKS++L A+ +  
Sbjct: 5  RVTVKNFRSHSDTVVEFKEGINLIIGQNGSGKSSLLDAILVGL 47
>pdb|1II8|A Chain A, Crystal Structure Of The P. Furiosus Rad50 Atpase Domain Length = 195 Back     alignment and structure
>pdb|3QKT|A Chain A, Rad50 Abc-Atpase With Adjacent Coiled-Coil Region In Complex With Amp- Pnp Length = 339 Back     alignment and structure
>pdb|3QKR|A Chain A, Mre11 Rad50 Binding Domain Bound To Rad50 Length = 203 Back     alignment and structure
>pdb|1US8|A Chain A, The Rad50 Signature Motif: Essential To Atp Binding And Biological Function Length = 147 Back     alignment and structure
>pdb|1XEW|Y Chain Y, Structural Biochemistry Of Atp-Driven Dimerization And Dna Stimulated Activation Of Smc Atpases Length = 172 Back     alignment and structure
>pdb|1F2T|A Chain A, Crystal Structure Of Atp-free Rad50 Abc-atpase Length = 149 Back     alignment and structure
>pdb|3KTA|B Chain B, Structural Basis For Adenylate Kinase Activity In Abc Atpases Length = 173 Back     alignment and structure
>pdb|1XEX|B Chain B, Structural Biochemistry Of Atp-Driven Dimerization And Dna Stimulated Activation Of Smc Atpases Length = 172 Back     alignment and structure
>pdb|4I99|A Chain A, Crystal Structure Of The Smchead Bound To The C-winged Helix Domain Of Scpa Length = 354 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1058
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-20
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-17
1vt4_I1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-15
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 8e-15
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-11
3auy_A371 DNA double-strand break repair RAD50 ATPase; DNA r 1e-19
3auy_A371 DNA double-strand break repair RAD50 ATPase; DNA r 2e-06
1f2t_A149 RAD50 ABC-ATPase; DNA double-strand break repair, 1e-18
3qks_A203 DNA double-strand break repair RAD50 ATPase; RECA- 3e-18
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 2e-15
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 2e-14
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 7e-13
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 2e-12
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 2e-12
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 6e-10
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 9e-09
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 3e-06
3qkt_A339 DNA double-strand break repair RAD50 ATPase; RECA- 5e-13
3qf7_A365 RAD50; ABC-ATPase, ATPase, hydrolase; HET: ANP; 1. 5e-10
3qf7_A365 RAD50; ABC-ATPase, ATPase, hydrolase; HET: ANP; 1. 4e-04
1w1w_A430 Structural maintenance of chromosome 1; cohesin, c 1e-09
1w1w_A430 Structural maintenance of chromosome 1; cohesin, c 5e-05
2o5v_A359 DNA replication and repair protein RECF; ABC ATPas 3e-09
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 2e-07
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 4e-07
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 9e-06
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 4e-05
1c1g_A284 Tropomyosin; contractIle protein; 7.00A {Sus scrof 6e-06
1c1g_A284 Tropomyosin; contractIle protein; 7.00A {Sus scrof 7e-06
1c1g_A284 Tropomyosin; contractIle protein; 7.00A {Sus scrof 5e-05
1c1g_A284 Tropomyosin; contractIle protein; 7.00A {Sus scrof 4e-04
1qhl_A227 Protein (cell division protein MUKB); SMC, chromos 8e-06
3euj_A483 Chromosome partition protein MUKB, linker; MUKB, M 3e-05
3lvg_D190 LCB, clathrin light chain B; SELF assembly, coated 7e-05
2wd5_A233 Structural maintenance of chromosomes protein 1A; 9e-05
1cii_A602 Colicin IA; bacteriocin, ION channel formation, tr 2e-04
3qa8_A676 MGC80376 protein; kinase ubiquitin-like domain, ph 4e-04
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
 Score = 96.8 bits (240), Expect = 2e-20
 Identities = 99/737 (13%), Positives = 218/737 (29%), Gaps = 208/737 (28%)

Query: 362  DIQEQHVRNTQAEESEIEAKLKELQCE--IDAANITLSRMKEEDSALSEKLSKEKNEIRR 419
            +  E   +         +A +    C+   D     LS+ +E D  +  K     +   R
Sbjct: 10   ETGEHQYQYKDILSVFEDAFVDNFDCKDVQDMPKSILSK-EEIDHIIMSK--DAVSGTLR 66

Query: 420  ISDEIEDYDKKCREIRSEIRELQQHQTNKVTAFGGDRVISLLRAIERHHHKFKSPPIGPI 479
            +   +                    Q   V  F  +        + R ++KF        
Sbjct: 67   LFWTLLSK-----------------QEEMVQKFVEE--------VLRINYKF-------- 93

Query: 480  GSHVTLVNGDTWAPAVEQAIGRLLNAFIVTDHKDALLLRGCAREANYNHLQIII-YDFSR 538
                        +P   +     +   +  + +D L          YN  Q+   Y+ SR
Sbjct: 94   ----------LMSPIKTEQRQPSMMTRMYIEQRDRL----------YNDNQVFAKYNVSR 133

Query: 539  PRLSLPHHMLPHTKHPTTLSVLQSDNPTVINVLVD-MGSAERQVLV----RDYDVGKAVA 593
             +        P+ K    L  L+       NVL+D +  + +  +       Y V   + 
Sbjct: 134  LQ--------PYLKLRQALLELRPAK----NVLIDGVLGSGKTWVALDVCLSYKVQCKMD 181

Query: 594  FEQRISNLKEVYTLDGHKMFSRGSVQTIL-PLNRRLRTGRLCGSYDEKIKDLERAALHVQ 652
            F+        ++ L    + +  S +T+L  L +      L    D              
Sbjct: 182  FK--------IFWL---NLKNCNSPETVLEMLQK------LLYQIDPNWTSRS------- 217

Query: 653  EEAQQCRKRKRDSEERLQDLQQHQQNVKRRCFSAERNRMSKELAFQDVKNSFAADAGPPS 712
            + +   + R    +  L+ L + +      C           L   +V+N+ A +A    
Sbjct: 218  DHSSNIKLRIHSIQAELRRLLKSKPY--ENCL----------LVLLNVQNAKAWNA---- 261

Query: 713  ASAVD---EI-----SQEISNIQEEIQEKEIILEKLQFSMNEAE-----AKVEDLKLSFQ 759
                +   +I      +++++         I L+    ++   E      K   L    Q
Sbjct: 262  ---FNLSCKILLTTRFKQVTDFLSAATTTHISLDHHSMTLTPDEVKSLLLKY--LDCRPQ 316

Query: 760  SLCESAKE----EVDTFEAAEKELMEIEKNLQTSESEKAHYEDVMRTRVVGAIKEAESQ- 814
             L           +     + ++ +    N +    +K     ++ +  +  ++ AE + 
Sbjct: 317  DLPREVLTTNPRRLSIIAESIRDGLATWDNWKHVNCDK--LTTIIES-SLNVLEPAEYRK 373

Query: 815  -YRELELLRQDSCRKASVICPESEIEALGGWDGSTPEQLSAQVNRLNQR--LKHESHQYS 871
             +  L +             P   +  +  W       +   VN+L++   ++ +  + +
Sbjct: 374  MFDRLSVFPPS------AHIPTILLSLI--WFDVIKSDVMVVVNKLHKYSLVEKQPKEST 425

Query: 872  ESIEDLRMLYEEKE------HKILRKQQTYQAFREKVRACREALDSRWGKFQRNATLLKR 925
             SI  + +  + K       H+ +     Y   +                F  +  +   
Sbjct: 426  ISIPSIYLELKVKLENEYALHRSIVDH--YNIPK---------------TFDSDDLIPPY 468

Query: 926  QLTWQFN--G-HLGKKGISGKININYEEKTLS---IEVKMPQDASSSNVRDTRGLSGGER 979
               + ++  G HL       ++ + +    L    +E K+  D+++ N            
Sbjct: 469  LDQYFYSHIGHHLKNIEHPERMTL-FRMVFLDFRFLEQKIRHDSTAWNASG--------- 518

Query: 980  SFSTLCFALALHE--MTE---APFRAMDEFDVFMDAISRKI----SLDTLVDFALAQGSQ 1030
            S       L  ++  + +      R ++    F+  I   +      D L+  AL    +
Sbjct: 519  SILNTLQQLKFYKPYICDNDPKYERLVNAILDFLPKIEENLICSKYTD-LLRIALMAEDE 577

Query: 1031 WIFITPHDVGLVKQGER 1047
             IF   H     KQ +R
Sbjct: 578  AIFEEAH-----KQVQR 589
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3auy_A DNA double-strand break repair RAD50 ATPase; DNA repair, ABC transporter ATPase domain-like; HET: DNA ADP; 2.70A {Methanocaldococcus jannaschii} PDB: 3aux_A* 3av0_B* Length = 371 Back     alignment and structure
>3auy_A DNA double-strand break repair RAD50 ATPase; DNA repair, ABC transporter ATPase domain-like; HET: DNA ADP; 2.70A {Methanocaldococcus jannaschii} PDB: 3aux_A* 3av0_B* Length = 371 Back     alignment and structure
>1f2t_A RAD50 ABC-ATPase; DNA double-strand break repair, replication; 1.60A {Pyrococcus furiosus} SCOP: c.37.1.12 PDB: 1f2u_A* 1us8_A* Length = 149 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>3qkt_A DNA double-strand break repair RAD50 ATPase; RECA-like fold, coiled-coils, ATP binding, DNA bindi MRE11, replication; HET: DNA ANP; 1.90A {Pyrococcus furiosus} PDB: 3qku_A* 1ii8_A 3qks_B* 3qkr_B* 1ii8_B Length = 339 Back     alignment and structure
>3qf7_A RAD50; ABC-ATPase, ATPase, hydrolase; HET: ANP; 1.90A {Thermotoga maritima} PDB: 3qg5_A 3tho_A* Length = 365 Back     alignment and structure
>3qf7_A RAD50; ABC-ATPase, ATPase, hydrolase; HET: ANP; 1.90A {Thermotoga maritima} PDB: 3qg5_A 3tho_A* Length = 365 Back     alignment and structure
>1w1w_A Structural maintenance of chromosome 1; cohesin, chromosome segregation, cell adhesion, kleisin, MIT cell cycle; HET: ATG; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.12 Length = 430 Back     alignment and structure
>1w1w_A Structural maintenance of chromosome 1; cohesin, chromosome segregation, cell adhesion, kleisin, MIT cell cycle; HET: ATG; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.12 Length = 430 Back     alignment and structure
>2o5v_A DNA replication and repair protein RECF; ABC ATPase, walker A motif, P-loop, signature motif, replication/recombination complex; HET: DNA; 1.61A {Deinococcus radiodurans} Length = 359 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 Back     alignment and structure
>1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Length = 284 Back     alignment and structure
>1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Length = 284 Back     alignment and structure
>1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Length = 284 Back     alignment and structure
>1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Length = 284 Back     alignment and structure
>1qhl_A Protein (cell division protein MUKB); SMC, chromosome partitioning; 2.20A {Escherichia coli} SCOP: c.37.1.12 Length = 227 Back     alignment and structure
>3euj_A Chromosome partition protein MUKB, linker; MUKB, MUKE, chromosome condensation, condensin, SMC, N subunit, ABC-type ATPase, WHD, ATP-binding; HET: AGS; 3.10A {Haemophilus ducreyi} PDB: 3euk_A* Length = 483 Back     alignment and structure
>3lvg_D LCB, clathrin light chain B; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} Length = 190 Back     alignment and structure
>2wd5_A Structural maintenance of chromosomes protein 1A; DNA damage, cell cycle, cell division; 2.70A {Mus musculus} Length = 233 Back     alignment and structure
>1cii_A Colicin IA; bacteriocin, ION channel formation, transmembrane protein; 3.00A {Escherichia coli} SCOP: f.1.1.1 h.4.3.1 Length = 602 Back     alignment and structure
>3qa8_A MGC80376 protein; kinase ubiquitin-like domain, phosphorylation, kinase domain ubiquitin-like domain, kinase, substrate binding; 3.60A {Xenopus laevis} PDB: 3qad_A* 3rzf_A* Length = 676 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

No hit with probability above 80.00

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 1058
d1w1wa_427 c.37.1.12 (A:) Smc head domain {Baker's yeast (Sac 7e-19
d1w1wa_427 c.37.1.12 (A:) Smc head domain {Baker's yeast (Sac 3e-10
g1xew.1329 c.37.1.12 (X:,Y:) Smc head domain {Pyrococcus furi 2e-15
g1ii8.1369 c.37.1.12 (A:,B:) Rad50 {Archaeon Pyrococcus furio 5e-14
d1qhla_222 c.37.1.12 (A:) Cell division protein MukB {Escheri 1e-13
d1e69a_308 c.37.1.12 (A:) Smc head domain {Thermotoga maritim 1e-12
g1f2t.1292 c.37.1.12 (A:,B:) Rad50 {Archaeon Pyrococcus furio 1e-08
d1gxja_161 d.215.1.1 (A:) Smc hinge domain {Thermotoga mariti 9e-06
>d1w1wa_ c.37.1.12 (A:) Smc head domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 427 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: ABC transporter ATPase domain-like
domain: Smc head domain
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

 Score = 88.2 bits (217), Expect = 7e-19
 Identities = 34/175 (19%), Positives = 64/175 (36%), Gaps = 16/175 (9%)

Query: 20  GTITRVRLENFMCHSSLQ-IELGEW-VNFITGQNGSGKSAILTALCIAFGCRAKGTQRAA 77
           G +  + L NF  +  +  +  GE     I G NGSGKS ++ A+    G R+    R+ 
Sbjct: 1   GRLVGLELSNFKSYRGVTKVGFGESNFTSIIGPNGSGKSNMMDAISFVLGVRSNHL-RSN 59

Query: 78  TLKDFIKTGCSYAMVEVELKNRGEDAFKP---------EIFGDSIIIERRITESTSTTVL 128
            LKD I  G        +  N G  +  P         +     + + R I+ +  T+  
Sbjct: 60  ILKDLIYRGVLNDENSDDYDNEGAASSNPQSAYVKAFYQKGNKLVELMRIISRNGDTSYK 119

Query: 129 KDHQGKRVASRKQELLELIDHFNIDVENPCVIMSQDKSREFLHSGNDKDKFKFFF 183
            D +        ++    +++ NI ++    ++ Q    +       +    F  
Sbjct: 120 IDGK----TVSYKDYSIFLENENILIKAKNFLVFQGDVEQIAAQSPVELSRMFEE 170
>d1w1wa_ c.37.1.12 (A:) Smc head domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 427 Back     information, alignment and structure
>d1qhla_ c.37.1.12 (A:) Cell division protein MukB {Escherichia coli [TaxId: 562]} Length = 222 Back     information, alignment and structure
>d1e69a_ c.37.1.12 (A:) Smc head domain {Thermotoga maritima [TaxId: 2336]} Length = 308 Back     information, alignment and structure
>d1gxja_ d.215.1.1 (A:) Smc hinge domain {Thermotoga maritima [TaxId: 2336]} Length = 161 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query1058
d1w1wa_427 Smc head domain {Baker's yeast (Saccharomyces cere 99.82
g1xew.1329 Smc head domain {Pyrococcus furiosus [TaxId: 2261] 99.7
d1e69a_308 Smc head domain {Thermotoga maritima [TaxId: 2336] 99.65
g1ii8.1369 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 99.64
d1w1wa_427 Smc head domain {Baker's yeast (Saccharomyces cere 99.6
g1f2t.1292 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 99.5
d1qhla_222 Cell division protein MukB {Escherichia coli [TaxI 99.26
g1ii8.1369 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 98.98
d1e69a_308 Smc head domain {Thermotoga maritima [TaxId: 2336] 98.61
g1f2t.1292 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 98.53
g1xew.1329 Smc head domain {Pyrococcus furiosus [TaxId: 2261] 98.27
d1l2ta_230 MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 98.09
d3b60a1253 Multidrug resistance ABC transporter MsbA, C-termi 98.07
d2pmka1241 Haemolysin B ATP-binding protein {Escherichia coli 97.97
d1v43a3239 Hypothetical protein PH0022, N-terminal domain {Py 97.95
d2hyda1255 Putative multidrug export ATP-binding/permease pro 97.91
d1g6ha_254 MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 97.84
d3dhwc1240 Methionine import ATP-binding protein MetN {Escher 97.82
d2awna2232 Maltose transport protein MalK, N-terminal domain 97.8
d1g2912240 Maltose transport protein MalK, N-terminal domain 97.76
d2onka1240 Molybdate/tungstate import ATP-binding protein Wtp 97.72
d1jj7a_251 Peptide transporter Tap1, C-terminal ABC domain {H 97.7
d1oxxk2242 Glucose transport protein GlcV, N-terminal domain 97.69
d1vpla_238 Putative ABC transporter TM0544 {Thermotoga mariti 97.67
d3d31a2229 Sulfate/molybdate ABC transporter, ATP-binding pro 97.66
d1gxja_161 Smc hinge domain {Thermotoga maritima [TaxId: 2336 97.65
d1ji0a_240 Branched chain aminoacid ABC transporter {Thermoto 97.64
d1mv5a_242 Multidrug resistance ABC transporter LmrA, C-termi 97.62
d1b0ua_258 ATP-binding subunit of the histidine permease {Sal 97.62
d1sgwa_200 Putative ABC transporter PF0895 {Pyrococcus furios 97.57
d1l7vc_231 ABC transporter involved in vitamin B12 uptake, Bt 97.45
d1r0wa_281 Cystic fibrosis transmembrane conductance regulato 97.18
d2onka1240 Molybdate/tungstate import ATP-binding protein Wtp 96.65
d1v43a3239 Hypothetical protein PH0022, N-terminal domain {Py 96.61
d3d31a2229 Sulfate/molybdate ABC transporter, ATP-binding pro 96.48
d1g6ha_254 MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 96.44
d2awna2232 Maltose transport protein MalK, N-terminal domain 96.4
d1l7vc_231 ABC transporter involved in vitamin B12 uptake, Bt 96.39
d1ji0a_240 Branched chain aminoacid ABC transporter {Thermoto 96.36
d1vpla_238 Putative ABC transporter TM0544 {Thermotoga mariti 96.3
d1sgwa_200 Putative ABC transporter PF0895 {Pyrococcus furios 96.17
d1g2912240 Maltose transport protein MalK, N-terminal domain 96.15
d1b0ua_258 ATP-binding subunit of the histidine permease {Sal 96.04
d1l2ta_230 MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 96.02
d1r0wa_281 Cystic fibrosis transmembrane conductance regulato 95.9
d1jj7a_251 Peptide transporter Tap1, C-terminal ABC domain {H 95.84
d1mv5a_242 Multidrug resistance ABC transporter LmrA, C-termi 95.84
d2pmka1241 Haemolysin B ATP-binding protein {Escherichia coli 95.38
d3dhwc1240 Methionine import ATP-binding protein MetN {Escher 95.35
d3b60a1253 Multidrug resistance ABC transporter MsbA, C-termi 95.29
d1oxxk2242 Glucose transport protein GlcV, N-terminal domain 95.15
d2hyda1255 Putative multidrug export ATP-binding/permease pro 94.51
d1ewqa2224 DNA repair protein MutS, the C-terminal domain {Th 94.5
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 94.21
d1wb9a2234 DNA repair protein MutS, the C-terminal domain {Es 93.26
d1p9ra_401 Extracellular secretion NTPase EpsE {Vibrio choler 91.07
d1np6a_170 Molybdopterin-guanine dinucleotide biosynthesis pr 91.02
d2i3ba1189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 90.83
d1znwa1182 Guanylate kinase {Mycobacterium tuberculosis [TaxI 89.93
d1yrba1244 ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss 89.35
d1zp6a1176 Hypothetical protein Atu3015 {Agrobacterium tumefa 88.81
d1qhxa_178 Chloramphenicol phosphotransferase {Streptomyces v 88.65
d1knqa_171 Gluconate kinase {Escherichia coli [TaxId: 562]} 87.94
d2bdta1176 Hypothetical protein BH3686 {Bacillus halodurans [ 87.68
d1u0la2225 Probable GTPase EngC (YjeQ), C-terminal domain {Th 87.51
d1s96a_205 Guanylate kinase {Escherichia coli [TaxId: 562]} 87.02
d1sxja2253 Replication factor C1 {Baker's yeast (Saccharomyce 86.86
d1khta_190 Adenylate kinase {Archaeon Methanococcus voltae [T 86.72
d1lw7a2192 Transcriptional regulator NadR, ribosylnicotinamid 86.32
d1xjca_165 Molybdopterin-guanine dinucleotide biosynthesis pr 86.09
d1kgda_178 Guanylate kinase-like domain of Cask {Human (Homo 85.95
d1gvnb_273 Plasmid maintenance system epsilon/zeta, toxin zet 85.95
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 85.41
d1m8pa3183 ATP sulfurylase C-terminal domain {Fungus (Penicil 85.06
d1y63a_174 Probable kinase LmjF30.1890 {Leishmania major [Tax 84.95
d1nksa_194 Adenylate kinase {Archaeon Sulfolobus acidocaldari 84.88
d1lvga_190 Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 84.77
d1gkya_186 Guanylate kinase {Baker's yeast (Saccharomyces cer 84.69
d1uj2a_213 Uridine-cytidine kinase 2 {Human (Homo sapiens) [T 84.67
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 84.65
d1fnna2276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 84.44
d1ls1a2207 GTPase domain of the signal sequence recognition p 84.12
d1yj5a2172 5' polynucleotide kinase-3' phosphatase, C-termina 84.0
d1cr2a_277 Gene 4 protein (g4p, DNA primase), helicase domain 83.94
d1kaga_169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 83.84
d1t9ha2231 Probable GTPase EngC (YjeQ), C-terminal domain {Ba 83.42
d2qy9a2211 GTPase domain of the signal recognition particle r 83.38
d1rz3a_198 Hypothetical protein rbstp0775 {Bacillus stearothe 83.22
d1okkd2207 GTPase domain of the signal recognition particle r 83.12
d1vmaa2213 GTPase domain of the signal recognition particle r 82.79
d2p67a1327 LAO/AO transport system kinase ArgK {Escherichia c 82.42
d1g6oa_323 Hexameric traffic ATPase, HP0525 {Helicobacter pyl 82.37
d1rkba_173 Adenylate kinase {Human (Homo sapiens), isoenzyme 82.27
d1svia_195 Probable GTPase EngB {Bacillus subtilis [TaxId: 14 81.7
d1r7ra3265 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 81.4
d1sxje2252 Replication factor C5 {Baker's yeast (Saccharomyce 81.04
d1qf9a_194 UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 80.97
d1sxjb2224 Replication factor C4 {Baker's yeast (Saccharomyce 80.06
>d1w1wa_ c.37.1.12 (A:) Smc head domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: ABC transporter ATPase domain-like
domain: Smc head domain
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

Probab=99.82  E-value=1.2e-19  Score=176.48  Aligned_cols=148  Identities=22%  Similarity=0.320  Sum_probs=116.2

Q ss_pred             EEEEEEEEEECCCCCC-CEEEEC-CCEEEEECCCCCCHHHHHHHHHHHHCCCCCCCCCCCCHHHHHHCCCCEEEEEEEEE
Q ss_conf             0587999981233357-335617-97489985999967899999998705875677776541243213982369999998
Q 001536           20 GTITRVRLENFMCHSS-LQIELG-EWVNFITGQNGSGKSAILTALCIAFGCRAKGTQRAATLKDFIKTGCSYAMVEVELK   97 (1058)
Q Consensus        20 m~i~~l~l~nf~~~~~-~~i~f~-~~~~~I~G~NgsGKStil~ai~~~lg~~~~~~~r~~~~~~~i~~~~~~~~v~~~~~   97 (1058)
                      |+|++|.|.||++|.+ ++|+|. +|+|+|+||||||||||++||+||||+.+.. .|+.++.++|+.|...+.+...|.
T Consensus         1 ~ki~~l~l~NFks~~~~~~i~f~~~~l~~i~G~NGsGKS~ileAi~~~lg~~~~~-~R~~~~~dli~~g~~~~~~~~~~~   79 (427)
T d1w1wa_           1 GRLVGLELSNFKSYRGVTKVGFGESNFTSIIGPNGSGKSNMMDAISFVLGVRSNH-LRSNILKDLIYRGVLNDENSDDYD   79 (427)
T ss_dssp             CCEEEEEEESCSSCCSEEEEECTTCSEEEEECSTTSSHHHHHHHHHHHTTC----------CGGGSCCC-----------
T ss_pred             CEEEEEEEECEEEECCCEEEECCCCCEEEEECCCCCCHHHHHHHHHHHHCCCCCC-CCCCCCHHHEECCCCCCCCEEEEE
T ss_conf             9288999949441079879758999989999999998899999999985778510-023340665246876775128987


Q ss_pred             ECCCCCC---------CCCCCCCEEEEEEEEE-CCCCEEEEECCCCCEECCCHHHHHHHHHHCCCCCCCCEEEECHHHHH
Q ss_conf             1798766---------7556799189999873-68663899758995101438899999875487666883563202366
Q 001536           98 NRGEDAF---------KPEIFGDSIIIERRIT-ESTSTTVLKDHQGKRVASRKQELLELIDHFNIDVENPCVIMSQDKSR  167 (1058)
Q Consensus        98 ~~~~~~~---------~~~~~~~~~~i~R~~~-~~~~~~~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~q~~~~  167 (1058)
                      +.+....         .....+..+.+.|.+. ++.+.|++   ||+.++  ..++..++..+++...++++++.|+++.
T Consensus        80 ~~~~~~~~~~~~~~~~~~~~~~~~i~i~r~i~~~~~~~~~i---n~~~~~--~~~i~~~~~~~~~~~~~~~~~i~q~~~~  154 (427)
T d1w1wa_          80 NEGAASSNPQSAYVKAFYQKGNKLVELMRIISRNGDTSYKI---DGKTVS--YKDYSIFLENENILIKAKNFLVFQGDVE  154 (427)
T ss_dssp             --------CCEEEEEEEEEETTEEEEEEEEEETTSCEEEEE---TTEEEC--HHHHHHHHHHTTCCTTTCTTEECTTCTT
T ss_pred             EECCCCCCCCCCCEEEEECCCCCEEEEEEEECCCCCEEEEC---CCCCCC--HHHHHHHHHHCCCCCCCCCCEECHHHHH
T ss_conf             41233444200011245305892799999972589636702---764442--9999999987087878865242204566


Q ss_pred             HHHHCC
Q ss_conf             720049
Q 001536          168 EFLHSG  173 (1058)
Q Consensus       168 ~~l~~~  173 (1058)
                      .++...
T Consensus       155 ~~~~~~  160 (427)
T d1w1wa_         155 QIAAQS  160 (427)
T ss_dssp             HHHHSC
T ss_pred             HHHHCC
T ss_conf             666406
>d1e69a_ c.37.1.12 (A:) Smc head domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1w1wa_ c.37.1.12 (A:) Smc head domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qhla_ c.37.1.12 (A:) Cell division protein MukB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e69a_ c.37.1.12 (A:) Smc head domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Back     information, alignment and structure
>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Back     information, alignment and structure
>d1gxja_ d.215.1.1 (A:) Smc hinge domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Back     information, alignment and structure
>d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Back     information, alignment and structure
>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Back     information, alignment and structure
>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1ewqa2 c.37.1.12 (A:542-765) DNA repair protein MutS, the C-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1wb9a2 c.37.1.12 (A:567-800) DNA repair protein MutS, the C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure